2P0FA

Arhgap9 ph domain in complex with ins(1,3,5)p3
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
SHEVEKSGLLNMTKIAQGGRKLRKNWGPSWVVLTGNSLVFYREPPPTAPSSGWGPAGSRPESSVDLRGAALAHGRHLSSRRNVLHIRTIPGHEFLLQSDHETELRAWHRALRTVIERLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Non-canonical Interaction of Phosphoinositides with Pleckstrin Homology Domains of Tiam1 and ArhGAP9.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligand binding protein
molecule keywords Rho GTPase-activating protein 9
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2p0fA00
3SV1A 1SHCA 4BBKA 1GG3A 1V61A 4IFSA 1PFJA 1V89A 2Y7BA 3MDBC 2D4QA 5J3TA 1BTNA 4MT7A 1LW3A 2K2UA 1FAOA 2VSZA 1UNPA 2L1CA 2GJYA 1U29A 2H7DA 4DXAB 4B6HA 1SGHA 3ML4A 3QIJA 1UNQA 2G35A 2Y8GA 3CXBB 5LONB 1NI2A 1M7RA 2GCJA 4P7IA 2D10A 2YT1A 4GPTB 5DH9B 2KGXB 3ULCA 1X1GA 3TVVA 2GS0A 5JHGA 1I2HA 3PVLA 1FGZA 2P8VA 3SNHA 1ZC3B 4K81A 2RSGA 5CLLB 5J3YA 2EC1A 1WJ1A 3KRWA 3DXDA 3LJUX 2EJ8A 4EJNA 3D8EA 3TO1A 3VIAA 4HDQA 1Z87A 2LOZA 1WG7A 2DA0A 5LOPB 1OQNA 3OANA 4HB0B 2RGNB 2DYQA 1W1HA 4CHMA 1IRSA 5DHAB 4L6EA 5CLQB 5JHHA 4YL8A 1KI1B 3A98B 4GMVA 2X18A 4IAPA 2ELBA 1MAIA 2K00A 2NMBA 1MK9B 2RUKB 2MDXA 3ODOA 4KVGB 3PEGA 4HAVB 3PP2A 2L2IA 3AJ4A 1P3RA 2COFA 4F7HA 4DX8A 4TYZA 1WVHA 2D9XA 2QKMA 4KHAA 1XKEA 3M1IB 1H4RA 4H8SA 1FOEA 2ELAA 4Z2NA 1GC7A 4NSWA 1U27A 5KQ1A 3ODWA 1UPRA 4D0NB 1AQCA 1J0WA 5JLJB 1J19A 2LULA 3BINA 2DYNA 1U5GA 2RLOA 2I5CA 2NZ8B 2XQNM 3DXCA 3U8ZA 2FJLA 2Z0QA 2Y8FA 3NSUA 2D9ZA 3A8PA 1BAKA 4KHOA 2DX5A 3AU5A 1UNRA 4CYEA 2IYBA 4CHJA 1FB8A 1X86A 3ODXA 2PZ1A 3X23A 2UVMA 4TKNA 2KCJA 1GC6A 2UZRA 2P0FA 2W2XD 4K17A 1ZVRA 1BWNA 1EF1A 4Z2MB 3PVUA 4ZRJA 1TJ6A 2RNRB 5DHFB 3GYOA 1U5FA 4K2PA 1RRPB 2MWNB 1V88A 1QQGA 2DX1A 1XX0A 1UEFA 5D3VA 1ZSQA 1Q67A 3SYXA 1WJMA 4GZUA 2J59M 2R09A 3UZTA 3O96A 4DX90 3QWMA 1U2BA 2W2WA 5D27A 1V5UA 2J0KA 2DHKA 3TW1A 1E5WA 2OQBA 4IOYX 2K2JA 2D9YA 3KY9A 2YF0A 3TFMA 2ADZA 2YVCA 2JP2A 4MK0A 3PZDA 2MKRA 2CY4A 1X05A 1AWEA 1DDMA 3KSYA 2Q13A 4HAZB 4KAXB 1P5TA 5KCVA 4C0AA 2GCLA 2MFQA 5KQ4A 1UPQA 3ZVRA 2AL6A 4Y94A 5D3YA 2Z0OA 2QKLA 3BJIA 1MIXA 1XODA 5C5BB 3WYFB 3GYPA 2CY5A 4HAWB 4HB3B 5C79A 1ZC4B 2J0JA 3HW2B 5D3WA 2D9VA 1B55A 1TXDA 1FHOA 1V5MA 1DDWA 2HTHB 2P0HA 3DXEA 3F0WA 4A6HA 4F7GA 1I7AA 2COAA 5HE3A 1NTVA 3PVWA 2D2QA 1RJ2A 5HE0A 1MIZB 1W1GA 1ZM0A 1U5EA 3FM8C 4WVFB 3PG7A 2RVBB 1N3HA 2I1KA 1XCGA 4A5KA 3D8FA 4A6FA 1EVHA 2UZSA 2D11A 1Y19B 2YRYA 5HE2A 1WGQA 1KZ7A 2M14A 1Y5OA 5L81A 2N0YA 2DHJA 3D8DA 1H10A 2COCA 4KHBB 4HB2B 4WJ7A 2LYDA 2W2XC 3SUZA 1TQZA 2V76A 2VKIA 3VOQA 2LOXA 2YS3A 4MY6A 3ULBA 3U7DA 5C16A 2YSZA 1NU2A 5DI9B 3RCPA 2H7EA 1KZGA 1OY2A 1WGUA 1EAZA 3KZ1A 4HATB 1XD4A 2LG1A 2CAYA 4ZRIA 3WA0A 2R0DA 4GMXB 2KUPA 4ZRKA 2DFKA 3MPXA 1MK7B 2YS5A 1NTYA 4EMOA 3KRXA 2P0DA 1XR0B 2ZPYA 2HE7A 4HAXB 1BTKA 1MPHA 2ROZB 3A8QA 3TCAA 1DYNA 3SO6A 4F7UP 5FI0A 2CRFA 3IVFA 4WSFA 5HE1A 1QC6A 2EMSA 1EGXA 1LB1A 4GXBA 5FI1A 2DKQA 5C5BA 4HDOA 3F5RA 1PMSA 1WI1A 4HB4B 1V5PA 1ISNA 2EMTA 1K5GB 3P6AA 3G9WA 2I5FA 1K5DB 2J0MA 4PQ0A 5DIFB 3T06A 4DBBA 4A6KA 2DKPA 5D3XA 3V5WA 4PNKA 3PSCA 2E2XA 4K2OA 2VRWB 1U5DA 2CODA 2BCJA 2DLWA 2N23A 4HHVA 1X1FA 1PLSA 4EKUA 2Z0PA 1DBHA 5EFXA 4YONA 1FHXA 2YS1A 2AEHA 1FGYA 2M38A 5JP4A 2DTCA 3FEHA 5GOWB 2DN6A 2DHIA 3ZDTA 1P6SA 3P7ZA 1OMWA 1DDVA 2YT0A 3FSSA 4XWXA 2D9WA 1W1DA 3QBVB 2ROVA 1FHWA 2OTXA 4HAUB 2LKOA 1X11A 2IFSA 4HAYB 4A6FB 1MKEA 3AU4A 3N7CA 4NY0A 3CIKA 5J3QA 1DROA 2I1JA 5C6RA 3HQCA 1M7EA 4GN1A 3HK0A
chains in the Genus database with same CATH superfamily
3SV1A 1SHCA 4BBKA 1GG3A 1V61A 4IFSA 1PFJA 1V89A 2Y7BA 3MDBC 2D4QA 2FJUB 5J3TA 1BTNA 4MT7A 1LW3A 2K2UA 1FAOA 2VSZA 1UNPA 2Z14A 2L1CA 2GJYA 1U29A 2H7DA 4DXAB 4B6HA 1SGHA 3ML4A 3QIJA 1UNQA 2G35A 2Y8GA 3CXBB 5LONB 1NI2A 2Z4DA 1M7RA 2GCJA 4P7IA 2D10A 2YT1A 4GPTB 5DH9B 2KGXB 5M4YB 3ULCA 1X1GA 3TVVA 2GS0A 5JHGA 3B77A 1I2HA 3PVLA 1FGZA 2P8VA 2Z13A 3SNHA 1ZC3B 4K81A 2RSGA 5CLLB 5J3YA 2EC1A 2YT2A 1WJ1A 3KRWA 3DXDA 3LJUX 2EJ8A 4EJNA 3D8EA 3TO1A 3VIAA 4HDQA 1Z87A 2LOZA 1WG7A 2DA0A 5LOPB 1OQNA 3OANA 4HB0B 2RGNB 2DYQA 1W1HA 4CHMA 1IRSA 5DHAB 4L6EA 5CLQB 5JHHA 4YL8A 1KI1B 3A98B 4GMVA 4QXAB 2X18A 4IAPA 2ELBA 4OT1A 1MAIA 2K00A 2NMBA 1MK9B 2RUKB 2MDXA 4QJ4B 3ODOA 4KVGB 3PEGA 4HAVB 3PP2A 2L2IA 3AJ4A 1P3RA 2COFA 4F7HA 4DX8A 3HSAA 4TYZA 4OSNA 1WVHA 2D9XA 2QKMA 2KUQA 4KHAA 1XKEA 3M1IB 1H4RA 4H8SA 1FOEA 2ELAA 4Z2NA 1GC7A 2KIEA 4NSWA 1U27A 5KQ1A 3ODWA 1UPRA 4D0NB 5LG4B 1AQCA 1J0WA 5JLJB 2R2YA 1J19A 2LULA 3BINA 2GUMA 2DYNA 1U5GA 4QJ5B 2RLOA 2I5CA 2NZ8B 2XQNM 3DXCA 3U8ZA 2FJLA 2Z0QA 2Y8FA 3NSUA 2D9ZA 3A8PA 1BAKA 4KHOA 2DX5A 3NWAA 3AU5A 1UNRA 4CYEA 2IYBA 4CHJA 1FB8A 1X86A 3ODXA 2PZ1A 3X23A 2UVMA 4TKNA 2KCJA 1GC6A 2UZRA 2P0FA 2W2XD 4K17A 1T77A 1ZVRA 1BWNA 1EF1A 4Z2MB 3PVUA 2NBVA 4ZRJA 1TJ6A 2RNRB 4KHBA 5DHFB 3GYOA 1U5FA 4K2PA 1RRPB 2MWNB 1V88A 1QQGA 2DX1A 1XX0A 1UEFA 5D3VA 1ZSQA 1Q67A 3SYXA 2Z59A 3NWFA 1WJMA 4GZUA 2J59M 2R09A 3UZTA 3O96A 4DX90 3QWMA 5I2MA 1U2BA 2W2WA 5D27A 1V5UA 2J0KA 2DHKA 3TW1A 1E5WA 2OQBA 4IOYX 2K2JA 2D9YA 3KY9A 3FVCA 2YF0A 3TFMA 2ADZA 2YVCA 2JP2A 4MK0A 3PZDA 3DCXA 2MKRA 2CY4A 1X05A 1AWEA 1DDMA 3KSYA 4GOUA 2Q13A 2RRFA 4HAZB 4KAXB 1P5TA 2K8EA 5KCVA 4C0AA 5I2SA 2GCLA 2MFQA 5KQ4A 1UPQA 3ZVRA 2AL6A 4Y94A 5D3YA 2Z0OA 2QKLA 3BJIA 1MIXA 1XODA 5C5BB 3WYFB 3GYPA 2CY5A 4HAWB 4HB3B 5C79A 1ZC4B 2J0JA 3HW2B 5D3WA 2D9VA 1B55A 1TXDA 1FHOA 1V5MA 1DDWA 2HTHB 2P0HA 3DXEA 3F0WA 5IRSA 4A6HA 4F7GA 1I7AA 2COAA 5HE3A 1NTVA 3PVWA 2D2QA 1RJ2A 5HE0A 1MIZB 1W1GA 1ZM0A 1U5EA 3FM8C 4WVFB 3PG7A 2RVBB 1N3HA 2I1KA 1XCGA 4A5KA 3D8FA 4A6FA 1EVHA 2UZSA 2D11A 1Y19B 2YRYA 5HE2A 1WGQA 1KZ7A 2M14A 1Y5OA 5L81A 2N0YA 2DHJA 3D8DA 1H10A 2COCA 4KHBB 4HB2B 4WJ7A 2LYDA 2W2XC 3SUZA 1TQZA 2V76A 2VKIA 3VOQA 2LOXA 2YS3A 4MY6A 3ULBA 1ZYIA 3U7DA 5C16A 2YSZA 1NU2A 5DI9B 3RCPA 2H7EA 1KZGA 1OY2A 1WGUA 1EAZA 3KZ1A 4HATB 1XD4A 2LG1A 2CAYA 4ZRIA 3WA0A 2R0DA 3NW8A 4GMXB 2KUPA 4HSIA 4ZRKA 2DFKA 4QJ3B 3MPXA 1MK7B 2YS5A 1NTYA 4EMOA 2K49A 3KRXA 1MI1A 2ZKMX 2P0DA 1XR0B 2ZPYA 2HE7A 4HAXB 1BTKA 1MPHA 2ROZB 3A8QA 3TCAA 1DYNA 3SO6A 4F7UP 5FI0A 2CRFA 3IVFA 4WSFA 5HE1A 1QC6A 2EMSA 1EGXA 1LB1A 4GXBA 5FI1A 2DKQA 5C5BA 4HDOA 3F5RA 1PMSA 1WI1A 2KIGA 4HB4B 1V5PA 1ISNA 2EMTA 2KR0A 1K5GB 3P6AA 3G9WA 2I5FA 1K5DB 2J0MA 4PQ0A 5DIFB 3T06A 4DBBA 4A6KA 2DKPA 5D3XA 3V5WA 4PNKA 3PSCA 2E2XA 4K2OA 2VRWB 1U5DA 2CODA 4DIXA 2BCJA 2DLWA 2N23A 4HHVA 1X1FA 3A58A 1PLSA 4EKUA 2Z0PA 1DBHA 5EFXA 3HIEA 4CSQA 4YONA 1FHXA 2YS1A 2AEHA 1FGYA 2M38A 5JP4A 2DTCA 3FEHA 4GNKB 2DN6A 5GOWB 2DHIA 3ZDTA 3U12A 1P6SA 3P7ZA 1OMWA 1DDVA 2YT0A 3FSSA 4XWXA 2D9WA 1W1DA 3NWDA 3QBVB 2ROVA 1FHWA 2OTXA 4HAUB 2LKOA 1X11A 2IFSA 4HAYB 4A6FB 1MKEA 3AU4A 4L1RA 3N7CA 4NY0A 3CIKA 5J3QA 1DROA 2I1JA 3OHMB 5C6RA 3HQCA 1M7EA 4GN1A 3HK0A 4D6WA
chains in the Genus database with same CATH topology
3SV1A 1SHCA 4BBKA 1GG3A 1V61A 4IFSA 1PFJA 1V89A 2Y7BA 3MDBC 2D4QA 5J3TA 1BTNA 4MT7A 1LW3A 2K2UA 1FAOA 2VSZA 1UNPA 2L1CA 2GJYA 1U29A 2H7DA 4DXAB 4B6HA 1SGHA 3ML4A 3QIJA 1UNQA 2G35A 2Y8GA 3CXBB 5LONB 1NI2A 1M7RA 2GCJA 4P7IA 2D10A 2YT1A 4GPTB 5DH9B 2KGXB 3ULCA 1X1GA 3TVVA 2GS0A 5JHGA 1I2HA 3PVLA 1FGZA 2P8VA 3SNHA 1ZC3B 4K81A 2RSGA 5CLLB 5J3YA 2EC1A 1WJ1A 3KRWA 3DXDA 3LJUX 2EJ8A 4EJNA 3D8EA 3TO1A 3VIAA 4HDQA 1Z87A 2LOZA 1WG7A 2DA0A 5LOPB 1OQNA 3OANA 4HB0B 2RGNB 2DYQA 1W1HA 4CHMA 1IRSA 5DHAB 4L6EA 5CLQB 5JHHA 4YL8A 1KI1B 3A98B 4GMVA 2X18A 4IAPA 2ELBA 1MAIA 2K00A 2NMBA 1MK9B 2RUKB 2MDXA 3ODOA 4KVGB 3PEGA 4HAVB 3PP2A 2L2IA 3AJ4A 1P3RA 2COFA 4F7HA 4DX8A 4TYZA 1WVHA 2D9XA 2QKMA 4KHAA 1XKEA 3M1IB 1H4RA 4H8SA 1FOEA 2ELAA 4Z2NA 1GC7A 4NSWA 1U27A 5KQ1A 3ODWA 1UPRA 4D0NB 1AQCA 1J0WA 5JLJB 1J19A 2LULA 3BINA 2DYNA 1U5GA 2RLOA 2I5CA 2NZ8B 2XQNM 3DXCA 3U8ZA 2FJLA 2Z0QA 2Y8FA 3NSUA 2D9ZA 3A8PA 1BAKA 4KHOA 2DX5A 3AU5A 1UNRA 4CYEA 2IYBA 4CHJA 1FB8A 1X86A 3ODXA 2PZ1A 3X23A 2UVMA 4TKNA 2KCJA 1GC6A 2UZRA 2P0FA 2W2XD 4K17A 1ZVRA 1BWNA 1EF1A 4Z2MB 3PVUA 4ZRJA 1TJ6A 2RNRB 5DHFB 3GYOA 1U5FA 4K2PA 1RRPB 2MWNB 1V88A 1QQGA 2DX1A 1XX0A 1UEFA 5D3VA 1ZSQA 1Q67A 3SYXA 1WJMA 4GZUA 2J59M 2R09A 3UZTA 3O96A 4DX90 3QWMA 1U2BA 2W2WA 5D27A 1V5UA 2J0KA 2DHKA 3TW1A 1E5WA 2OQBA 4IOYX 2K2JA 2D9YA 3KY9A 2YF0A 3TFMA 2ADZA 2YVCA 2JP2A 4MK0A 3PZDA 2MKRA 2CY4A 1X05A 1AWEA 1DDMA 3KSYA 2Q13A 4HAZB 4KAXB 1P5TA 5KCVA 4C0AA 2GCLA 2MFQA 5KQ4A 1UPQA 3ZVRA 2AL6A 4Y94A 5D3YA 2Z0OA 2QKLA 3BJIA 1MIXA 1XODA 5C5BB 3WYFB 3GYPA 2CY5A 4HAWB 4HB3B 5C79A 1ZC4B 2J0JA 3HW2B 5D3WA 2D9VA 1B55A 1TXDA 1FHOA 1V5MA 1DDWA 2HTHB 2P0HA 3DXEA 3F0WA 4A6HA 4F7GA 1I7AA 2COAA 5HE3A 1NTVA 3PVWA 2D2QA 1RJ2A 5HE0A 1MIZB 1W1GA 1ZM0A 1U5EA 3FM8C 4WVFB 3PG7A 2RVBB 1N3HA 2I1KA 1XCGA 4A5KA 3D8FA 4A6FA 1EVHA 2UZSA 2D11A 1Y19B 2YRYA 5HE2A 1WGQA 1KZ7A 2M14A 1Y5OA 5L81A 2N0YA 2DHJA 3D8DA 1H10A 2COCA 4KHBB 4HB2B 4WJ7A 2LYDA 2W2XC 3SUZA 1TQZA 2V76A 2VKIA 3VOQA 2LOXA 2YS3A 4MY6A 3ULBA 3U7DA 5C16A 2YSZA 1NU2A 5DI9B 3RCPA 2H7EA 1KZGA 1OY2A 1WGUA 1EAZA 3KZ1A 4HATB 1XD4A 2LG1A 2CAYA 4ZRIA 3WA0A 2R0DA 4GMXB 2KUPA 4ZRKA 2DFKA 3MPXA 1MK7B 2YS5A 1NTYA 4EMOA 3KRXA 2P0DA 1XR0B 2ZPYA 2HE7A 4HAXB 1BTKA 1MPHA 2ROZB 3A8QA 3TCAA 1DYNA 3SO6A 4F7UP 5FI0A 2CRFA 3IVFA 4WSFA 5HE1A 1QC6A 2EMSA 1EGXA 1LB1A 4GXBA 5FI1A 2DKQA 5C5BA 4HDOA 3F5RA 1PMSA 1WI1A 4HB4B 1V5PA 1ISNA 2EMTA 1K5GB 3P6AA 3G9WA 2I5FA 1K5DB 2J0MA 4PQ0A 5DIFB 3T06A 4DBBA 4A6KA 2DKPA 5D3XA 3V5WA 4PNKA 3PSCA 2E2XA 4K2OA 2VRWB 1U5DA 2CODA 2BCJA 2DLWA 2N23A 4HHVA 1X1FA 1PLSA 4EKUA 2Z0PA 1DBHA 5EFXA 4YONA 1FHXA 2YS1A 2AEHA 1FGYA 2M38A 5JP4A 2DTCA 3FEHA 5GOWB 2DN6A 2DHIA 3ZDTA 1P6SA 3P7ZA 1OMWA 1DDVA 2YT0A 3FSSA 4XWXA 2D9WA 1W1DA 3QBVB 2ROVA 1FHWA 2OTXA 4HAUB 2LKOA 1X11A 2IFSA 4HAYB 4A6FB 1MKEA 3AU4A 3N7CA 4NY0A 3CIKA 5J3QA 1DROA 2I1JA 5C6RA 3HQCA 1M7EA 4GN1A 3HK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SV1 A;  1SHC A;  4BBK A;  1GG3 A;  1V61 A;  4IFS A;  1PFJ A;  1V89 A;  2Y7B A;  3MDB C;  2D4Q A;  5J3T A;  1BTN A;  4MT7 A;  1LW3 A;  2K2U A;  1FAO A;  2VSZ A;  1UNP A;  2L1C A;  2GJY A;  1U29 A;  2H7D A;  4DXA B;  4B6H A;  1SGH A;  3ML4 A;  3QIJ A;  1UNQ A;  2G35 A;  2Y8G A;  3CXB B;  5LON B;  1NI2 A;  1M7R A;  2GCJ A;  4P7I A;  2D10 A;  2YT1 A;  4GPT B;  5DH9 B;  2KGX B;  3ULC A;  1X1G A;  3TVV A;  2GS0 A;  5JHG A;  1I2H A;  3PVL A;  1FGZ A;  2P8V A;  3SNH A;  1ZC3 B;  4K81 A;  2RSG A;  5CLL B;  5J3Y A;  2EC1 A;  1WJ1 A;  3KRW A;  3DXD A;  3LJU X;  2EJ8 A;  4EJN A;  3D8E A;  3TO1 A;  3VIA A;  4HDQ A;  1Z87 A;  2LOZ A;  1WG7 A;  2DA0 A;  5LOP B;  1OQN A;  3OAN A;  4HB0 B;  2RGN B;  2DYQ A;  1W1H A;  4CHM A;  1IRS A;  5DHA B;  4L6E A;  5CLQ B;  5JHH A;  4YL8 A;  1KI1 B;  3A98 B;  4GMV A;  2X18 A;  4IAP A;  2ELB A;  1MAI A;  2K00 A;  2NMB A;  1MK9 B;  2RUK B;  2MDX A;  3ODO A;  4KVG B;  3PEG A;  4HAV B;  3PP2 A;  2L2I A;  3AJ4 A;  1P3R A;  2COF A;  4F7H A;  4DX8 A;  4TYZ A;  1WVH A;  2D9X A;  2QKM A;  4KHA A;  1XKE A;  3M1I B;  1H4R A;  4H8S A;  1FOE A;  2ELA A;  4Z2N A;  1GC7 A;  4NSW A;  1U27 A;  5KQ1 A;  3ODW A;  1UPR A;  4D0N B;  1AQC A;  1J0W A;  5JLJ B;  1J19 A;  2LUL A;  3BIN A;  2DYN A;  1U5G A;  2RLO A;  2I5C A;  2NZ8 B;  2XQN M;  3DXC A;  3U8Z A;  2FJL A;  2Z0Q A;  2Y8F A;  3NSU A;  2D9Z A;  3A8P A;  1BAK A;  4KHO A;  2DX5 A;  3AU5 A;  1UNR A;  4CYE A;  2IYB A;  4CHJ A;  1FB8 A;  1X86 A;  3ODX A;  2PZ1 A;  3X23 A;  2UVM A;  4TKN A;  2KCJ A;  1GC6 A;  2UZR A;  2P0F A;  2W2X D;  4K17 A;  1ZVR A;  1BWN A;  1EF1 A;  4Z2M B;  3PVU A;  4ZRJ A;  1TJ6 A;  2RNR B;  5DHF B;  3GYO A;  1U5F A;  4K2P A;  1RRP B;  2MWN B;  1V88 A;  1QQG A;  2DX1 A;  1XX0 A;  1UEF A;  5D3V A;  1ZSQ A;  1Q67 A;  3SYX A;  1WJM A;  4GZU A;  2J59 M;  2R09 A;  3UZT A;  3O96 A;  4DX9 0;  3QWM A;  1U2B A;  2W2W A;  5D27 A;  1V5U A;  2J0K A;  2DHK A;  3TW1 A;  1E5W A;  2OQB A;  4IOY X;  2K2J A;  2D9Y A;  3KY9 A;  2YF0 A;  3TFM A;  2ADZ A;  2YVC A;  2JP2 A;  4MK0 A;  3PZD A;  2MKR A;  2CY4 A;  1X05 A;  1AWE A;  1DDM A;  3KSY A;  2Q13 A;  4HAZ B;  4KAX B;  1P5T A;  5KCV A;  4C0A A;  2GCL A;  2MFQ A;  5KQ4 A;  1UPQ A;  3ZVR A;  2AL6 A;  4Y94 A;  5D3Y A;  2Z0O A;  2QKL A;  3BJI A;  1MIX A;  1XOD A;  5C5B B;  3WYF B;  3GYP A;  2CY5 A;  4HAW B;  4HB3 B;  5C79 A;  1ZC4 B;  2J0J A;  3HW2 B;  5D3W A;  2D9V A;  1B55 A;  1TXD A;  1FHO A;  1V5M A;  1DDW A;  2HTH B;  2P0H A;  3DXE A;  3F0W A;  4A6H A;  4F7G A;  1I7A A;  2COA A;  5HE3 A;  1NTV A;  3PVW A;  2D2Q A;  1RJ2 A;  5HE0 A;  1MIZ B;  1W1G A;  1ZM0 A;  1U5E A;  3FM8 C;  4WVF B;  3PG7 A;  2RVB B;  1N3H A;  2I1K A;  1XCG A;  4A5K A;  3D8F A;  4A6F A;  1EVH A;  2UZS A;  2D11 A;  1Y19 B;  2YRY A;  5HE2 A;  1WGQ A;  1KZ7 A;  2M14 A;  1Y5O A;  5L81 A;  2N0Y A;  2DHJ A;  3D8D A;  1H10 A;  2COC A;  4KHB B;  4HB2 B;  4WJ7 A;  2LYD A;  2W2X C;  3SUZ A;  1TQZ A;  2V76 A;  2VKI A;  3VOQ A;  2LOX A;  2YS3 A;  4MY6 A;  3ULB A;  3U7D A;  5C16 A;  2YSZ A;  1NU2 A;  5DI9 B;  3RCP A;  2H7E A;  1KZG A;  1OY2 A;  1WGU A;  1EAZ A;  3KZ1 A;  4HAT B;  1XD4 A;  2LG1 A;  2CAY A;  4ZRI A;  3WA0 A;  2R0D A;  4GMX B;  2KUP A;  4ZRK A;  2DFK A;  3MPX A;  1MK7 B;  2YS5 A;  1NTY A;  4EMO A;  3KRX A;  2P0D A;  1XR0 B;  2ZPY A;  2HE7 A;  4HAX B;  1BTK A;  1MPH A;  2ROZ B;  3A8Q A;  3TCA A;  1DYN A;  3SO6 A;  4F7U P;  5FI0 A;  2CRF A;  3IVF A;  4WSF A;  5HE1 A;  1QC6 A;  2EMS A;  1EGX A;  1LB1 A;  4GXB A;  5FI1 A;  2DKQ A;  5C5B A;  4HDO A;  3F5R A;  1PMS A;  1WI1 A;  4HB4 B;  1V5P A;  1ISN A;  2EMT A;  1K5G B;  3P6A A;  3G9W A;  2I5F A;  1K5D B;  2J0M A;  4PQ0 A;  5DIF B;  3T06 A;  4DBB A;  4A6K A;  2DKP A;  5D3X A;  3V5W A;  4PNK A;  3PSC A;  2E2X A;  4K2O A;  2VRW B;  1U5D A;  2COD A;  2BCJ A;  2DLW A;  2N23 A;  4HHV A;  1X1F A;  1PLS A;  4EKU A;  2Z0P A;  1DBH A;  5EFX A;  4YON A;  1FHX A;  2YS1 A;  2AEH A;  1FGY A;  2M38 A;  5JP4 A;  2DTC A;  3FEH A;  5GOW B;  2DN6 A;  2DHI A;  3ZDT A;  1P6S A;  3P7Z A;  1OMW A;  1DDV A;  2YT0 A;  3FSS A;  4XWX A;  2D9W A;  1W1D A;  3QBV B;  2ROV A;  1FHW A;  2OTX A;  4HAU B;  2LKO A;  1X11 A;  2IFS A;  4HAY B;  4A6F B;  1MKE A;  3AU4 A;  3N7C A;  4NY0 A;  3CIK A;  5J3Q A;  1DRO A;  2I1J A;  5C6R A;  3HQC A;  1M7E A;  4GN1 A;  3HK0 A; 
#chains in the Genus database with same CATH topology
 3SV1 A;  1SHC A;  4BBK A;  1GG3 A;  1V61 A;  4IFS A;  1PFJ A;  1V89 A;  2Y7B A;  3MDB C;  2D4Q A;  2FJU B;  5J3T A;  1BTN A;  4MT7 A;  1LW3 A;  2K2U A;  1FAO A;  2VSZ A;  1UNP A;  2Z14 A;  2L1C A;  2GJY A;  1U29 A;  2H7D A;  4DXA B;  4B6H A;  1SGH A;  3ML4 A;  3QIJ A;  1UNQ A;  2G35 A;  2Y8G A;  3CXB B;  5LON B;  1NI2 A;  2Z4D A;  1M7R A;  2GCJ A;  4P7I A;  2D10 A;  2YT1 A;  4GPT B;  5DH9 B;  2KGX B;  5M4Y B;  3ULC A;  1X1G A;  3TVV A;  2GS0 A;  5JHG A;  3B77 A;  1I2H A;  3PVL A;  1FGZ A;  2P8V A;  2Z13 A;  3SNH A;  1ZC3 B;  4K81 A;  2RSG A;  5CLL B;  5J3Y A;  2EC1 A;  2YT2 A;  1WJ1 A;  3KRW A;  3DXD A;  3LJU X;  2EJ8 A;  4EJN A;  3D8E A;  3TO1 A;  3VIA A;  4HDQ A;  1Z87 A;  2LOZ A;  1WG7 A;  2DA0 A;  5LOP B;  1OQN A;  3OAN A;  4HB0 B;  2RGN B;  2DYQ A;  1W1H A;  4CHM A;  1IRS A;  5DHA B;  4L6E A;  5CLQ B;  5JHH A;  4YL8 A;  1KI1 B;  3A98 B;  4GMV A;  4QXA B;  2X18 A;  4IAP A;  2ELB A;  4OT1 A;  1MAI A;  2K00 A;  2NMB A;  1MK9 B;  2RUK B;  2MDX A;  4QJ4 B;  3ODO A;  4KVG B;  3PEG A;  4HAV B;  3PP2 A;  2L2I A;  3AJ4 A;  1P3R A;  2COF A;  4F7H A;  4DX8 A;  3HSA A;  4TYZ A;  4OSN A;  1WVH A;  2D9X A;  2QKM A;  2KUQ A;  4KHA A;  1XKE A;  3M1I B;  1H4R A;  4H8S A;  1FOE A;  2ELA A;  4Z2N A;  1GC7 A;  2KIE A;  4NSW A;  1U27 A;  5KQ1 A;  3ODW A;  1UPR A;  4D0N B;  5LG4 B;  1AQC A;  1J0W A;  5JLJ B;  2R2Y A;  1J19 A;  2LUL A;  3BIN A;  2GUM A;  2DYN A;  1U5G A;  4QJ5 B;  2RLO A;  2I5C A;  2NZ8 B;  2XQN M;  3DXC A;  3U8Z A;  2FJL A;  2Z0Q A;  2Y8F A;  3NSU A;  2D9Z A;  3A8P A;  1BAK A;  4KHO A;  2DX5 A;  3NWA A;  3AU5 A;  1UNR A;  4CYE A;  2IYB A;  4CHJ A;  1FB8 A;  1X86 A;  3ODX A;  2PZ1 A;  3X23 A;  2UVM A;  4TKN A;  2KCJ A;  1GC6 A;  2UZR A;  2P0F A;  2W2X D;  4K17 A;  1T77 A;  1ZVR A;  1BWN A;  1EF1 A;  4Z2M B;  3PVU A;  2NBV A;  4ZRJ A;  1TJ6 A;  2RNR B;  4KHB A;  5DHF B;  3GYO A;  1U5F A;  4K2P A;  1RRP B;  2MWN B;  1V88 A;  1QQG A;  2DX1 A;  1XX0 A;  1UEF A;  5D3V A;  1ZSQ A;  1Q67 A;  3SYX A;  2Z59 A;  3NWF A;  1WJM A;  4GZU A;  2J59 M;  2R09 A;  3UZT A;  3O96 A;  4DX9 0;  3QWM A;  5I2M A;  1U2B A;  2W2W A;  5D27 A;  1V5U A;  2J0K A;  2DHK A;  3TW1 A;  1E5W A;  2OQB A;  4IOY X;  2K2J A;  2D9Y A;  3KY9 A;  3FVC A;  2YF0 A;  3TFM A;  2ADZ A;  2YVC A;  2JP2 A;  4MK0 A;  3PZD A;  3DCX A;  2MKR A;  2CY4 A;  1X05 A;  1AWE A;  1DDM A;  3KSY A;  4GOU A;  2Q13 A;  2RRF A;  4HAZ B;  4KAX B;  1P5T A;  2K8E A;  5KCV A;  4C0A A;  5I2S A;  2GCL A;  2MFQ A;  5KQ4 A;  1UPQ A;  3ZVR A;  2AL6 A;  4Y94 A;  5D3Y A;  2Z0O A;  2QKL A;  3BJI A;  1MIX A;  1XOD A;  5C5B B;  3WYF B;  3GYP A;  2CY5 A;  4HAW B;  4HB3 B;  5C79 A;  1ZC4 B;  2J0J A;  3HW2 B;  5D3W A;  2D9V A;  1B55 A;  1TXD A;  1FHO A;  1V5M A;  1DDW A;  2HTH B;  2P0H A;  3DXE A;  3F0W A;  5IRS A;  4A6H A;  4F7G A;  1I7A A;  2COA A;  5HE3 A;  1NTV A;  3PVW A;  2D2Q A;  1RJ2 A;  5HE0 A;  1MIZ B;  1W1G A;  1ZM0 A;  1U5E A;  3FM8 C;  4WVF B;  3PG7 A;  2RVB B;  1N3H A;  2I1K A;  1XCG A;  4A5K A;  3D8F A;  4A6F A;  1EVH A;  2UZS A;  2D11 A;  1Y19 B;  2YRY A;  5HE2 A;  1WGQ A;  1KZ7 A;  2M14 A;  1Y5O A;  5L81 A;  2N0Y A;  2DHJ A;  3D8D A;  1H10 A;  2COC A;  4KHB B;  4HB2 B;  4WJ7 A;  2LYD A;  2W2X C;  3SUZ A;  1TQZ A;  2V76 A;  2VKI A;  3VOQ A;  2LOX A;  2YS3 A;  4MY6 A;  3ULB A;  1ZYI A;  3U7D A;  5C16 A;  2YSZ A;  1NU2 A;  5DI9 B;  3RCP A;  2H7E A;  1KZG A;  1OY2 A;  1WGU A;  1EAZ A;  3KZ1 A;  4HAT B;  1XD4 A;  2LG1 A;  2CAY A;  4ZRI A;  3WA0 A;  2R0D A;  3NW8 A;  4GMX B;  2KUP A;  4HSI A;  4ZRK A;  2DFK A;  4QJ3 B;  3MPX A;  1MK7 B;  2YS5 A;  1NTY A;  4EMO A;  2K49 A;  3KRX A;  1MI1 A;  2ZKM X;  2P0D A;  1XR0 B;  2ZPY A;  2HE7 A;  4HAX B;  1BTK A;  1MPH A;  2ROZ B;  3A8Q A;  3TCA A;  1DYN A;  3SO6 A;  4F7U P;  5FI0 A;  2CRF A;  3IVF A;  4WSF A;  5HE1 A;  1QC6 A;  2EMS A;  1EGX A;  1LB1 A;  4GXB A;  5FI1 A;  2DKQ A;  5C5B A;  4HDO A;  3F5R A;  1PMS A;  1WI1 A;  2KIG A;  4HB4 B;  1V5P A;  1ISN A;  2EMT A;  2KR0 A;  1K5G B;  3P6A A;  3G9W A;  2I5F A;  1K5D B;  2J0M A;  4PQ0 A;  5DIF B;  3T06 A;  4DBB A;  4A6K A;  2DKP A;  5D3X A;  3V5W A;  4PNK A;  3PSC A;  2E2X A;  4K2O A;  2VRW B;  1U5D A;  2COD A;  4DIX A;  2BCJ A;  2DLW A;  2N23 A;  4HHV A;  1X1F A;  3A58 A;  1PLS A;  4EKU A;  2Z0P A;  1DBH A;  5EFX A;  3HIE A;  4CSQ A;  4YON A;  1FHX A;  2YS1 A;  2AEH A;  1FGY A;  2M38 A;  5JP4 A;  2DTC A;  3FEH A;  4GNK B;  2DN6 A;  5GOW B;  2DHI A;  3ZDT A;  3U12 A;  1P6S A;  3P7Z A;  1OMW A;  1DDV A;  2YT0 A;  3FSS A;  4XWX A;  2D9W A;  1W1D A;  3NWD A;  3QBV B;  2ROV A;  1FHW A;  2OTX A;  4HAU B;  2LKO A;  1X11 A;  2IFS A;  4HAY B;  4A6F B;  1MKE A;  3AU4 A;  4L1R A;  3N7C A;  4NY0 A;  3CIK A;  5J3Q A;  1DRO A;  2I1J A;  3OHM B;  5C6R A;  3HQC A;  1M7E A;  4GN1 A;  3HK0 A;  4D6W A; 
#chains in the Genus database with same CATH homology
 3SV1 A;  1SHC A;  4BBK A;  1GG3 A;  1V61 A;  4IFS A;  1PFJ A;  1V89 A;  2Y7B A;  3MDB C;  2D4Q A;  5J3T A;  1BTN A;  4MT7 A;  1LW3 A;  2K2U A;  1FAO A;  2VSZ A;  1UNP A;  2L1C A;  2GJY A;  1U29 A;  2H7D A;  4DXA B;  4B6H A;  1SGH A;  3ML4 A;  3QIJ A;  1UNQ A;  2G35 A;  2Y8G A;  3CXB B;  5LON B;  1NI2 A;  1M7R A;  2GCJ A;  4P7I A;  2D10 A;  2YT1 A;  4GPT B;  5DH9 B;  2KGX B;  3ULC A;  1X1G A;  3TVV A;  2GS0 A;  5JHG A;  1I2H A;  3PVL A;  1FGZ A;  2P8V A;  3SNH A;  1ZC3 B;  4K81 A;  2RSG A;  5CLL B;  5J3Y A;  2EC1 A;  1WJ1 A;  3KRW A;  3DXD A;  3LJU X;  2EJ8 A;  4EJN A;  3D8E A;  3TO1 A;  3VIA A;  4HDQ A;  1Z87 A;  2LOZ A;  1WG7 A;  2DA0 A;  5LOP B;  1OQN A;  3OAN A;  4HB0 B;  2RGN B;  2DYQ A;  1W1H A;  4CHM A;  1IRS A;  5DHA B;  4L6E A;  5CLQ B;  5JHH A;  4YL8 A;  1KI1 B;  3A98 B;  4GMV A;  2X18 A;  4IAP A;  2ELB A;  1MAI A;  2K00 A;  2NMB A;  1MK9 B;  2RUK B;  2MDX A;  3ODO A;  4KVG B;  3PEG A;  4HAV B;  3PP2 A;  2L2I A;  3AJ4 A;  1P3R A;  2COF A;  4F7H A;  4DX8 A;  4TYZ A;  1WVH A;  2D9X A;  2QKM A;  4KHA A;  1XKE A;  3M1I B;  1H4R A;  4H8S A;  1FOE A;  2ELA A;  4Z2N A;  1GC7 A;  4NSW A;  1U27 A;  5KQ1 A;  3ODW A;  1UPR A;  4D0N B;  1AQC A;  1J0W A;  5JLJ B;  1J19 A;  2LUL A;  3BIN A;  2DYN A;  1U5G A;  2RLO A;  2I5C A;  2NZ8 B;  2XQN M;  3DXC A;  3U8Z A;  2FJL A;  2Z0Q A;  2Y8F A;  3NSU A;  2D9Z A;  3A8P A;  1BAK A;  4KHO A;  2DX5 A;  3AU5 A;  1UNR A;  4CYE A;  2IYB A;  4CHJ A;  1FB8 A;  1X86 A;  3ODX A;  2PZ1 A;  3X23 A;  2UVM A;  4TKN A;  2KCJ A;  1GC6 A;  2UZR A;  2P0F A;  2W2X D;  4K17 A;  1ZVR A;  1BWN A;  1EF1 A;  4Z2M B;  3PVU A;  4ZRJ A;  1TJ6 A;  2RNR B;  5DHF B;  3GYO A;  1U5F A;  4K2P A;  1RRP B;  2MWN B;  1V88 A;  1QQG A;  2DX1 A;  1XX0 A;  1UEF A;  5D3V A;  1ZSQ A;  1Q67 A;  3SYX A;  1WJM A;  4GZU A;  2J59 M;  2R09 A;  3UZT A;  3O96 A;  4DX9 0;  3QWM A;  1U2B A;  2W2W A;  5D27 A;  1V5U A;  2J0K A;  2DHK A;  3TW1 A;  1E5W A;  2OQB A;  4IOY X;  2K2J A;  2D9Y A;  3KY9 A;  2YF0 A;  3TFM A;  2ADZ A;  2YVC A;  2JP2 A;  4MK0 A;  3PZD A;  2MKR A;  2CY4 A;  1X05 A;  1AWE A;  1DDM A;  3KSY A;  2Q13 A;  4HAZ B;  4KAX B;  1P5T A;  5KCV A;  4C0A A;  2GCL A;  2MFQ A;  5KQ4 A;  1UPQ A;  3ZVR A;  2AL6 A;  4Y94 A;  5D3Y A;  2Z0O A;  2QKL A;  3BJI A;  1MIX A;  1XOD A;  5C5B B;  3WYF B;  3GYP A;  2CY5 A;  4HAW B;  4HB3 B;  5C79 A;  1ZC4 B;  2J0J A;  3HW2 B;  5D3W A;  2D9V A;  1B55 A;  1TXD A;  1FHO A;  1V5M A;  1DDW A;  2HTH B;  2P0H A;  3DXE A;  3F0W A;  4A6H A;  4F7G A;  1I7A A;  2COA A;  5HE3 A;  1NTV A;  3PVW A;  2D2Q A;  1RJ2 A;  5HE0 A;  1MIZ B;  1W1G A;  1ZM0 A;  1U5E A;  3FM8 C;  4WVF B;  3PG7 A;  2RVB B;  1N3H A;  2I1K A;  1XCG A;  4A5K A;  3D8F A;  4A6F A;  1EVH A;  2UZS A;  2D11 A;  1Y19 B;  2YRY A;  5HE2 A;  1WGQ A;  1KZ7 A;  2M14 A;  1Y5O A;  5L81 A;  2N0Y A;  2DHJ A;  3D8D A;  1H10 A;  2COC A;  4KHB B;  4HB2 B;  4WJ7 A;  2LYD A;  2W2X C;  3SUZ A;  1TQZ A;  2V76 A;  2VKI A;  3VOQ A;  2LOX A;  2YS3 A;  4MY6 A;  3ULB A;  3U7D A;  5C16 A;  2YSZ A;  1NU2 A;  5DI9 B;  3RCP A;  2H7E A;  1KZG A;  1OY2 A;  1WGU A;  1EAZ A;  3KZ1 A;  4HAT B;  1XD4 A;  2LG1 A;  2CAY A;  4ZRI A;  3WA0 A;  2R0D A;  4GMX B;  2KUP A;  4ZRK A;  2DFK A;  3MPX A;  1MK7 B;  2YS5 A;  1NTY A;  4EMO A;  3KRX A;  2P0D A;  1XR0 B;  2ZPY A;  2HE7 A;  4HAX B;  1BTK A;  1MPH A;  2ROZ B;  3A8Q A;  3TCA A;  1DYN A;  3SO6 A;  4F7U P;  5FI0 A;  2CRF A;  3IVF A;  4WSF A;  5HE1 A;  1QC6 A;  2EMS A;  1EGX A;  1LB1 A;  4GXB A;  5FI1 A;  2DKQ A;  5C5B A;  4HDO A;  3F5R A;  1PMS A;  1WI1 A;  4HB4 B;  1V5P A;  1ISN A;  2EMT A;  1K5G B;  3P6A A;  3G9W A;  2I5F A;  1K5D B;  2J0M A;  4PQ0 A;  5DIF B;  3T06 A;  4DBB A;  4A6K A;  2DKP A;  5D3X A;  3V5W A;  4PNK A;  3PSC A;  2E2X A;  4K2O A;  2VRW B;  1U5D A;  2COD A;  2BCJ A;  2DLW A;  2N23 A;  4HHV A;  1X1F A;  1PLS A;  4EKU A;  2Z0P A;  1DBH A;  5EFX A;  4YON A;  1FHX A;  2YS1 A;  2AEH A;  1FGY A;  2M38 A;  5JP4 A;  2DTC A;  3FEH A;  5GOW B;  2DN6 A;  2DHI A;  3ZDT A;  1P6S A;  3P7Z A;  1OMW A;  1DDV A;  2YT0 A;  3FSS A;  4XWX A;  2D9W A;  1W1D A;  3QBV B;  2ROV A;  1FHW A;  2OTX A;  4HAU B;  2LKO A;  1X11 A;  2IFS A;  4HAY B;  4A6F B;  1MKE A;  3AU4 A;  3N7C A;  4NY0 A;  3CIK A;  5J3Q A;  1DRO A;  2I1J A;  5C6R A;  3HQC A;  1M7E A;  4GN1 A;  3HK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...