2P0FA

Arhgap9 ph domain in complex with ins(1,3,5)p3
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
SHEVEKSGLLNMTKIAQGGRKLRKNWGPSWVVLTGNSLVFYREPPPTAPSSGWGPAGSRPESSVDLRGAALAHGRHLSSRRNVLHIRTIPGHEFLLQSDHETELRAWHRALRTVIERLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rho GTPase-activating protein 9
publication title Non-canonical Interaction of Phosphoinositides with Pleckstrin Homology Domains of Tiam1 and ArhGAP9.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligand binding protein
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2p0fA00
2CRFA 3CIKA 4PNKA 4K81A 2GS0A 1BAKA 1WVHA 1ZC4B 4PQ0A 2HTHB 2QKLA 2Z0OA 1DROA 3SUZA 2D9WA 3GYOA 4TKNA 5FI0A 3TW1A 2CAYA 3M1IB 4WVFB 3G9WA 2IYBA 4HAZB 2D9YA 1MKEA 3A8PA 1DBHA 2EJ8A 2YS3A 5JP4A 1MPHA 1U2BA 3PSCA 1K5DB 2VRWB 5DIFB 3KZ1A 1DDMA 1WJMA 2DFKA 2D9VA 1XKEA 3MDBC 4H8SA 5DHAB 2EC1A 1FB8A 2DX5A 4WJ7A 2D9XA 2COAA 3SO6A 5L81A 1FHOA 3D8FA 3A98B 1P3RA 2W2XD 2J0MA 2ADZA 3VOQA 3ML4A 4MT7A 3TVVA 2D4QA 2LYDA 3F0WA 1BWNA 1K5GB 3DXCA 2N0YA 3X23A 2DKPA 4XWXA 2RGNB 1TQZA 1X11A 4Z2MB 2KCJA 5DI9B 2CY5A 2UZSA 4HB4B 4TYZA 4HDOA 3BJIA 4GPTB 1U5FA 3PP2A 2H7EA 3PEGA 4HAUB 5D3VA 3SYXA 4KVGB 5JLJB 2K00A 2MKRA 4K2OA 3RCPA 4EMOA 1Z87A 5C5BA 2COFA 4GN1A 5HE0A 1FGZA 2OQBA 5C5BB 2DLWA 4DX8A 1X1FA 3A8QA 5D3XA 1EGXA 1TJ6A 2IFSA 2ELBA 1PMSA 4HDQA 2JP2A 3FM8C 3DXDA 2L1CA 4KHOA 5LOPB 1FGYA 4EKUA 5FI1A 3ULCA 2H7DA 2LULA 5KCVA 1E5WA 1Q67A 3HW2B 1OY2A 3AU5A 2DX1A 2R0DA 2QKMA 2DHKA 1EVHA 1P5TA 1W1HA 3NSUA 4Y94A 1X86A 5HE2A 2RSGA 4HAYB 1UNPA 4HHVA 3OANA 2LOXA 2YRYA 2K2JA 1MIXA 3N7CA 1FHWA 2MWNB 4CHJA 1OMWA 2I5FA 2J59M 2YF0A 1MIZB 2OTXA 5KQ1A 4K2PA 4BBKA 2K2UA 4DX90 1UNQA 1KZGA 2CY4A 1QC6A 4ZRKA 2VKIA 4DBBA 1GC7A 1MK9B 5J3TA 2Y8GA 2BCJA 4GMVA 3ZVRA 2Z0PA 3ODXA 2YS5A 2UVMA 1V5UA 2MFQA 1FHXA 2VSZA 3SV1A 4IOYX 2GJYA 1UPRA 1BTKA 2D9ZA 2ROVA 2Y8FA 2NMBA 1M7EA 3ZDTA 5DH9B 1B55A 5GOWB 5CLQB 4B6HA 5C79A 5HE3A 3UZTA 2DHJA 2Y7BA 3VIAA 2YVCA 2EMTA 1UNRA 1ZM0A 1XR0B 4ZRJA 1LB1A 4C0AA 3LJUX 3FSSA 1TXDA 2RNRB 2N23A 2MDXA 3KRWA 3PVUA 2COCA 1X1GA 3AJ4A 4NY0A 4D0NB 2W2WA 2GCJA 4CHMA 2GCLA 1FOEA 4A6HA 1WG7A 4DXAB 1OQNA 2DN6A 1N3HA 2M38A 1V61A 2HE7A 1DYNA 1ZSQA 1V5PA 2J0KA 3U8ZA 4KHBB 2R09A 4A5KA 2DKQA 1AQCA 2P8VA 2FJLA 1LW3A 1M7RA 3WA0A 4MY6A 2W2XC 1WI1A 4K17A 2AL6A 1ZC3B 3FEHA 3D8EA 2RLOA 1GG3A 1XCGA 1Y19B 3V5WA 1U27A 2P0FA 5DHFB 2I1JA 3PVLA 4F7GA 2ROZB 3QIJA 2DTCA 5EFXA 5D3WA 1X05A 1EAZA 1SGHA 1IRSA 5J3YA 3HQCA 5KQ4A 5J3QA 5HE1A 2P0HA 1KI1B 2PZ1A 2D11A 2V76A 4HAXB 1GC6A 2L2IA 2ZPYA 4HB0B 2UZRA 1NU2A 1I7AA 1PFJA 1U5DA 4WSFA 5CLLB 1W1DA 1BTNA 2DA0A 2LOZA 4F7UP 1U5EA 3KY9A 4HATB 4NSWA 2Z0QA 2DYQA 3GYPA 1KZ7A 2M14A 4HAVB 1NI2A 2CODA 3QBVB 4YONA 1DDVA 3HK0A 1WJ1A 2KGXB 2KUPA 4HAWB 2DYNA 2YT0A 1I2HA 4MK0A 1NTYA 4IFSA 3AU4A 1UEFA 1AWEA 2J0JA 3TCAA 2RUKB 1RRPB 3P6AA 1EF1A 4GZUA 2LKOA 1RJ2A 4HB3B 2D10A 3O96A 3WYFB 1WGQA 3PG7A 2AEHA 2P0DA 3ULBA 5JHHA 3TFMA 2X18A 4F7HA 3PZDA 2LG1A 4P7IA 1SHCA 1MAIA 1U29A 3TO1A 1P6SA 1ISNA 5C6RA 3F5RA 2YSZA 4HB2B 4YL8A 4KHAA 3SNHA 3KSYA 3CXBB 2YS1A 1QQGA 1V5MA 3ODWA 1UPQA 2EMSA 3IVFA 5D27A 5JHGA 5LONB 2DHIA 3BINA 2I5CA 1MK7B 1ZVRA 4EJNA 3QWMA 1PLSA 1NTVA 1J0WA 1XODA 1XX0A 1H10A 3U7DA 2I1KA 3P7ZA 3ODOA 2ELAA 3DXEA 2Q13A 4A6FA 5C16A 1U5GA 1Y5OA 1FAOA 2D2QA 4CYEA 1WGUA 4A6KA 1H4RA 1XD4A 4A6FB 4GMXB 4Z2NA 4L6EA 1DDWA 5D3YA 1J19A 2XQNM 3KRXA 2E2XA 1V88A 4GXBA 1W1GA 2NZ8B 4IAPA 3D8DA 4KAXB 3T06A 2YT1A 2RVBB 1V89A 3MPXA 2G35A 4ZRIA 3PVWA
chains in the Genus database with same CATH superfamily
2CRFA 3DCXA 3CIKA 4PNKA 4K81A 2GS0A 4OSNA 1BAKA 1WVHA 1ZC4B 4PQ0A 3U12A 2HTHB 2QKLA 2Z0OA 1DROA 3SUZA 2D9WA 3GYOA 4TKNA 4D6WA 5FI0A 2Z14A 2CAYA 3TW1A 3M1IB 4WVFB 3G9WA 2IYBA 4HAZB 2D9YA 4QXAB 1MKEA 3A8PA 1DBHA 2EJ8A 1T77A 2YS3A 5JP4A 1MPHA 1U2BA 3PSCA 1K5DB 2VRWB 5DIFB 3KZ1A 1DDMA 1WJMA 2DFKA 2D9VA 1XKEA 3MDBC 4H8SA 5DHAB 5LG4B 2EC1A 1FB8A 2DX5A 4WJ7A 4HSIA 2D9XA 4OT1A 2COAA 3SO6A 5L81A 1FHOA 3D8FA 3A98B 1P3RA 2W2XD 2J0MA 2ADZA 3VOQA 3ML4A 4MT7A 3TVVA 2D4QA 2LYDA 3F0WA 1BWNA 1K5GB 3DXCA 2N0YA 3X23A 2DKPA 4XWXA 2RGNB 1TQZA 1X11A 4Z2MB 2KCJA 5DI9B 2CY5A 2UZSA 4HB4B 4TYZA 4HDOA 3BJIA 4GPTB 1U5FA 3PP2A 2H7EA 3PEGA 4HAUB 4GNKB 5D3VA 3SYXA 4KVGB 5JLJB 2K00A 2MKRA 4K2OA 3RCPA 1MI1A 1Z87A 4EMOA 5C5BA 2COFA 4GN1A 5HE0A 1FGZA 2RRFA 2OQBA 5C5BB 5I2SA 4L1RA 2DLWA 4DX8A 1X1FA 3A8QA 5D3XA 1EGXA 4CSQA 1TJ6A 2IFSA 2ELBA 2ZKMX 1PMSA 4HDQA 2JP2A 5M4YB 3FM8C 3DXDA 2L1CA 2R2YA 4KHOA 5LOPB 1FGYA 4EKUA 5FI1A 3ULCA 2H7DA 2LULA 5KCVA 1E5WA 1Q67A 3HW2B 1OY2A 3AU5A 2DX1A 2R0DA 2QKMA 2DHKA 1EVHA 1P5TA 1W1HA 2NBVA 3NSUA 4Y94A 1X86A 5HE2A 3NWAA 2RSGA 4HAYB 1UNPA 4HHVA 3OANA 2LOXA 2YRYA 2K2JA 1MIXA 3N7CA 1FHWA 2MWNB 4CHJA 1OMWA 2I5FA 2J59M 2YF0A 1MIZB 2OTXA 5KQ1A 4K2PA 4BBKA 2K2UA 4DX90 1UNQA 1KZGA 2CY4A 1QC6A 4ZRKA 2VKIA 4DBBA 1GC7A 1MK9B 5J3TA 3NW8A 2Y8GA 2BCJA 1ZYIA 3NWDA 4GMVA 3ZVRA 2Z0PA 3ODXA 2YS5A 3FVCA 2Z13A 2UVMA 1V5UA 2MFQA 1FHXA 2VSZA 3SV1A 4IOYX 2GJYA 1UPRA 1BTKA 2D9ZA 2ROVA 2KIGA 2Y8FA 2NMBA 1M7EA 5I2MA 3ZDTA 5DH9B 1B55A 5GOWB 5CLQB 4B6HA 5C79A 4GOUA 5HE3A 2GUMA 3UZTA 2DHJA 2Y7BA 4DIXA 3VIAA 2YVCA 2EMTA 1UNRA 1ZM0A 1XR0B 4ZRJA 1LB1A 4C0AA 3LJUX 3FSSA 1TXDA 2RNRB 2N23A 2Z4DA 2MDXA 3KRWA 3PVUA 2COCA 1X1GA 3AJ4A 4NY0A 4D0NB 2W2WA 2GCJA 4CHMA 3HIEA 2Z59A 2GCLA 1FOEA 4A6HA 1WG7A 4DXAB 1OQNA 2DN6A 1N3HA 2M38A 1V61A 2HE7A 4KHBA 1DYNA 2K8EA 1ZSQA 1V5PA 2J0KA 3U8ZA 4KHBB 2R09A 4A5KA 2DKQA 1AQCA 2P8VA 2FJLA 1LW3A 1M7RA 3WA0A 4MY6A 2W2XC 1WI1A 4K17A 4QJ4B 2AL6A 1ZC3B 3FEHA 3D8EA 2RLOA 1GG3A 1XCGA 1Y19B 3V5WA 1U27A 2P0FA 2YT2A 5DHFB 2I1JA 2K49A 3PVLA 4F7GA 2ROZB 3QIJA 2DTCA 5EFXA 5IRSA 5D3WA 1X05A 1EAZA 1SGHA 1IRSA 5J3YA 4QJ3B 3HQCA 5KQ4A 5J3QA 5HE1A 2P0HA 1KI1B 2PZ1A 2D11A 2V76A 4HAXB 1GC6A 2L2IA 2ZPYA 4HB0B 2UZRA 1NU2A 1I7AA 1PFJA 1U5DA 4WSFA 5CLLB 1W1DA 1BTNA 2DA0A 2LOZA 4F7UP 1U5EA 3KY9A 4HATB 4NSWA 2Z0QA 2DYQA 3GYPA 1KZ7A 2M14A 4HAVB 1NI2A 2CODA 3QBVB 4YONA 1DDVA 3HK0A 1WJ1A 2KGXB 2KUPA 4HAWB 2DYNA 2YT0A 1I2HA 3B77A 4MK0A 1NTYA 4IFSA 3AU4A 1UEFA 1AWEA 2J0JA 3TCAA 2RUKB 1RRPB 3P6AA 1EF1A 4GZUA 2LKOA 1RJ2A 2KR0A 4HB3B 2D10A 3O96A 3WYFB 1WGQA 3PG7A 2AEHA 2P0DA 3ULBA 5JHHA 3TFMA 2X18A 4F7HA 3PZDA 2LG1A 4P7IA 1SHCA 3HSAA 1MAIA 1U29A 3TO1A 1P6SA 1ISNA 5C6RA 2KUQA 2FJUB 3F5RA 2YSZA 4HB2B 4YL8A 3A58A 4KHAA 3SNHA 3KSYA 3CXBB 2YS1A 1QQGA 1V5MA 3ODWA 1UPQA 2EMSA 3IVFA 5D27A 5JHGA 5LONB 2DHIA 2KIEA 3BINA 2I5CA 1MK7B 1ZVRA 4EJNA 3QWMA 1PLSA 1NTVA 1J0WA 1XODA 1XX0A 1H10A 3OHMB 2I1KA 3P7ZA 3ODOA 3U7DA 2ELAA 4QJ5B 3DXEA 2Q13A 4A6FA 5C16A 3NWFA 1U5GA 1Y5OA 1FAOA 2D2QA 4CYEA 1WGUA 4A6KA 1H4RA 1XD4A 4A6FB 4GMXB 4Z2NA 4L6EA 1DDWA 5D3YA 1J19A 2XQNM 3KRXA 2E2XA 1V88A 4GXBA 1W1GA 2NZ8B 4IAPA 3D8DA 4KAXB 3T06A 2YT1A 2RVBB 1V89A 3MPXA 2G35A 4ZRIA 3PVWA
chains in the Genus database with same CATH topology
2CRFA 3CIKA 4PNKA 4K81A 2GS0A 1BAKA 1WVHA 1ZC4B 4PQ0A 2HTHB 2QKLA 2Z0OA 1DROA 3SUZA 2D9WA 3GYOA 4TKNA 5FI0A 3TW1A 2CAYA 3M1IB 4WVFB 3G9WA 2IYBA 4HAZB 2D9YA 1MKEA 3A8PA 1DBHA 2EJ8A 2YS3A 5JP4A 1MPHA 1U2BA 3PSCA 1K5DB 2VRWB 5DIFB 3KZ1A 1DDMA 1WJMA 2DFKA 2D9VA 1XKEA 3MDBC 4H8SA 5DHAB 2EC1A 1FB8A 2DX5A 4WJ7A 2D9XA 2COAA 3SO6A 5L81A 1FHOA 3D8FA 3A98B 1P3RA 2W2XD 2J0MA 2ADZA 3VOQA 3ML4A 4MT7A 3TVVA 2D4QA 2LYDA 3F0WA 1BWNA 1K5GB 3DXCA 2N0YA 3X23A 2DKPA 4XWXA 2RGNB 1TQZA 1X11A 4Z2MB 2KCJA 5DI9B 2CY5A 2UZSA 4HB4B 4TYZA 4HDOA 3BJIA 4GPTB 1U5FA 3PP2A 2H7EA 3PEGA 4HAUB 5D3VA 3SYXA 4KVGB 5JLJB 2K00A 2MKRA 4K2OA 3RCPA 4EMOA 1Z87A 5C5BA 2COFA 4GN1A 5HE0A 1FGZA 2OQBA 5C5BB 2DLWA 4DX8A 1X1FA 3A8QA 5D3XA 1EGXA 1TJ6A 2IFSA 2ELBA 1PMSA 4HDQA 2JP2A 3FM8C 3DXDA 2L1CA 4KHOA 5LOPB 1FGYA 4EKUA 5FI1A 3ULCA 2H7DA 2LULA 5KCVA 1E5WA 1Q67A 3HW2B 1OY2A 3AU5A 2DX1A 2R0DA 2QKMA 2DHKA 1EVHA 1P5TA 1W1HA 3NSUA 4Y94A 1X86A 5HE2A 2RSGA 4HAYB 1UNPA 4HHVA 3OANA 2LOXA 2YRYA 2K2JA 1MIXA 3N7CA 1FHWA 2MWNB 4CHJA 1OMWA 2I5FA 2J59M 2YF0A 1MIZB 2OTXA 5KQ1A 4K2PA 4BBKA 2K2UA 4DX90 1UNQA 1KZGA 2CY4A 1QC6A 4ZRKA 2VKIA 4DBBA 1GC7A 1MK9B 5J3TA 2Y8GA 2BCJA 4GMVA 3ZVRA 2Z0PA 3ODXA 2YS5A 2UVMA 1V5UA 2MFQA 1FHXA 2VSZA 3SV1A 4IOYX 2GJYA 1UPRA 1BTKA 2D9ZA 2ROVA 2Y8FA 2NMBA 1M7EA 3ZDTA 5DH9B 1B55A 5GOWB 5CLQB 4B6HA 5C79A 5HE3A 3UZTA 2DHJA 2Y7BA 3VIAA 2YVCA 2EMTA 1UNRA 1ZM0A 1XR0B 4ZRJA 1LB1A 4C0AA 3LJUX 3FSSA 1TXDA 2RNRB 2N23A 2MDXA 3KRWA 3PVUA 2COCA 1X1GA 3AJ4A 4NY0A 4D0NB 2W2WA 2GCJA 4CHMA 2GCLA 1FOEA 4A6HA 1WG7A 4DXAB 1OQNA 2DN6A 1N3HA 2M38A 1V61A 2HE7A 1DYNA 1ZSQA 1V5PA 2J0KA 3U8ZA 4KHBB 2R09A 4A5KA 2DKQA 1AQCA 2P8VA 2FJLA 1LW3A 1M7RA 3WA0A 4MY6A 2W2XC 1WI1A 4K17A 2AL6A 1ZC3B 3FEHA 3D8EA 2RLOA 1GG3A 1XCGA 1Y19B 3V5WA 1U27A 2P0FA 5DHFB 2I1JA 3PVLA 4F7GA 2ROZB 3QIJA 2DTCA 5EFXA 5D3WA 1X05A 1EAZA 1SGHA 1IRSA 5J3YA 3HQCA 5KQ4A 5J3QA 5HE1A 2P0HA 1KI1B 2PZ1A 2D11A 2V76A 4HAXB 1GC6A 2L2IA 2ZPYA 4HB0B 2UZRA 1NU2A 1I7AA 1PFJA 1U5DA 4WSFA 5CLLB 1W1DA 1BTNA 2DA0A 2LOZA 4F7UP 1U5EA 3KY9A 4HATB 4NSWA 2Z0QA 2DYQA 3GYPA 1KZ7A 2M14A 4HAVB 1NI2A 2CODA 3QBVB 4YONA 1DDVA 3HK0A 1WJ1A 2KGXB 2KUPA 4HAWB 2DYNA 2YT0A 1I2HA 4MK0A 1NTYA 4IFSA 3AU4A 1UEFA 1AWEA 2J0JA 3TCAA 2RUKB 1RRPB 3P6AA 1EF1A 4GZUA 2LKOA 1RJ2A 4HB3B 2D10A 3O96A 3WYFB 1WGQA 3PG7A 2AEHA 2P0DA 3ULBA 5JHHA 3TFMA 2X18A 4F7HA 3PZDA 2LG1A 4P7IA 1SHCA 1MAIA 1U29A 3TO1A 1P6SA 1ISNA 5C6RA 3F5RA 2YSZA 4HB2B 4YL8A 4KHAA 3SNHA 3KSYA 3CXBB 2YS1A 1QQGA 1V5MA 3ODWA 1UPQA 2EMSA 3IVFA 5D27A 5JHGA 5LONB 2DHIA 3BINA 2I5CA 1MK7B 1ZVRA 4EJNA 3QWMA 1PLSA 1NTVA 1J0WA 1XODA 1XX0A 1H10A 3U7DA 2I1KA 3P7ZA 3ODOA 2ELAA 3DXEA 2Q13A 4A6FA 5C16A 1U5GA 1Y5OA 1FAOA 2D2QA 4CYEA 1WGUA 4A6KA 1H4RA 1XD4A 4A6FB 4GMXB 4Z2NA 4L6EA 1DDWA 5D3YA 1J19A 2XQNM 3KRXA 2E2XA 1V88A 4GXBA 1W1GA 2NZ8B 4IAPA 3D8DA 4KAXB 3T06A 2YT1A 2RVBB 1V89A 3MPXA 2G35A 4ZRIA 3PVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CRF A;  3CIK A;  4PNK A;  4K81 A;  2GS0 A;  1BAK A;  1WVH A;  1ZC4 B;  4PQ0 A;  2HTH B;  2QKL A;  2Z0O A;  1DRO A;  3SUZ A;  2D9W A;  3GYO A;  4TKN A;  5FI0 A;  3TW1 A;  2CAY A;  3M1I B;  4WVF B;  3G9W A;  2IYB A;  4HAZ B;  2D9Y A;  1MKE A;  3A8P A;  1DBH A;  2EJ8 A;  2YS3 A;  5JP4 A;  1MPH A;  1U2B A;  3PSC A;  1K5D B;  2VRW B;  5DIF B;  3KZ1 A;  1DDM A;  1WJM A;  2DFK A;  2D9V A;  1XKE A;  3MDB C;  4H8S A;  5DHA B;  2EC1 A;  1FB8 A;  2DX5 A;  4WJ7 A;  2D9X A;  2COA A;  3SO6 A;  5L81 A;  1FHO A;  3D8F A;  3A98 B;  1P3R A;  2W2X D;  2J0M A;  2ADZ A;  3VOQ A;  3ML4 A;  4MT7 A;  3TVV A;  2D4Q A;  2LYD A;  3F0W A;  1BWN A;  1K5G B;  3DXC A;  2N0Y A;  3X23 A;  2DKP A;  4XWX A;  2RGN B;  1TQZ A;  1X11 A;  4Z2M B;  2KCJ A;  5DI9 B;  2CY5 A;  2UZS A;  4HB4 B;  4TYZ A;  4HDO A;  3BJI A;  4GPT B;  1U5F A;  3PP2 A;  2H7E A;  3PEG A;  4HAU B;  5D3V A;  3SYX A;  4KVG B;  5JLJ B;  2K00 A;  2MKR A;  4K2O A;  3RCP A;  4EMO A;  1Z87 A;  5C5B A;  2COF A;  4GN1 A;  5HE0 A;  1FGZ A;  2OQB A;  5C5B B;  2DLW A;  4DX8 A;  1X1F A;  3A8Q A;  5D3X A;  1EGX A;  1TJ6 A;  2IFS A;  2ELB A;  1PMS A;  4HDQ A;  2JP2 A;  3FM8 C;  3DXD A;  2L1C A;  4KHO A;  5LOP B;  1FGY A;  4EKU A;  5FI1 A;  3ULC A;  2H7D A;  2LUL A;  5KCV A;  1E5W A;  1Q67 A;  3HW2 B;  1OY2 A;  3AU5 A;  2DX1 A;  2R0D A;  2QKM A;  2DHK A;  1EVH A;  1P5T A;  1W1H A;  3NSU A;  4Y94 A;  1X86 A;  5HE2 A;  2RSG A;  4HAY B;  1UNP A;  4HHV A;  3OAN A;  2LOX A;  2YRY A;  2K2J A;  1MIX A;  3N7C A;  1FHW A;  2MWN B;  4CHJ A;  1OMW A;  2I5F A;  2J59 M;  2YF0 A;  1MIZ B;  2OTX A;  5KQ1 A;  4K2P A;  4BBK A;  2K2U A;  4DX9 0;  1UNQ A;  1KZG A;  2CY4 A;  1QC6 A;  4ZRK A;  2VKI A;  4DBB A;  1GC7 A;  1MK9 B;  5J3T A;  2Y8G A;  2BCJ A;  4GMV A;  3ZVR A;  2Z0P A;  3ODX A;  2YS5 A;  2UVM A;  1V5U A;  2MFQ A;  1FHX A;  2VSZ A;  3SV1 A;  4IOY X;  2GJY A;  1UPR A;  1BTK A;  2D9Z A;  2ROV A;  2Y8F A;  2NMB A;  1M7E A;  3ZDT A;  5DH9 B;  1B55 A;  5GOW B;  5CLQ B;  4B6H A;  5C79 A;  5HE3 A;  3UZT A;  2DHJ A;  2Y7B A;  3VIA A;  2YVC A;  2EMT A;  1UNR A;  1ZM0 A;  1XR0 B;  4ZRJ A;  1LB1 A;  4C0A A;  3LJU X;  3FSS A;  1TXD A;  2RNR B;  2N23 A;  2MDX A;  3KRW A;  3PVU A;  2COC A;  1X1G A;  3AJ4 A;  4NY0 A;  4D0N B;  2W2W A;  2GCJ A;  4CHM A;  2GCL A;  1FOE A;  4A6H A;  1WG7 A;  4DXA B;  1OQN A;  2DN6 A;  1N3H A;  2M38 A;  1V61 A;  2HE7 A;  1DYN A;  1ZSQ A;  1V5P A;  2J0K A;  3U8Z A;  4KHB B;  2R09 A;  4A5K A;  2DKQ A;  1AQC A;  2P8V A;  2FJL A;  1LW3 A;  1M7R A;  3WA0 A;  4MY6 A;  2W2X C;  1WI1 A;  4K17 A;  2AL6 A;  1ZC3 B;  3FEH A;  3D8E A;  2RLO A;  1GG3 A;  1XCG A;  1Y19 B;  3V5W A;  1U27 A;  2P0F A;  5DHF B;  2I1J A;  3PVL A;  4F7G A;  2ROZ B;  3QIJ A;  2DTC A;  5EFX A;  5D3W A;  1X05 A;  1EAZ A;  1SGH A;  1IRS A;  5J3Y A;  3HQC A;  5KQ4 A;  5J3Q A;  5HE1 A;  2P0H A;  1KI1 B;  2PZ1 A;  2D11 A;  2V76 A;  4HAX B;  1GC6 A;  2L2I A;  2ZPY A;  4HB0 B;  2UZR A;  1NU2 A;  1I7A A;  1PFJ A;  1U5D A;  4WSF A;  5CLL B;  1W1D A;  1BTN A;  2DA0 A;  2LOZ A;  4F7U P;  1U5E A;  3KY9 A;  4HAT B;  4NSW A;  2Z0Q A;  2DYQ A;  3GYP A;  1KZ7 A;  2M14 A;  4HAV B;  1NI2 A;  2COD A;  3QBV B;  4YON A;  1DDV A;  3HK0 A;  1WJ1 A;  2KGX B;  2KUP A;  4HAW B;  2DYN A;  2YT0 A;  1I2H A;  4MK0 A;  1NTY A;  4IFS A;  3AU4 A;  1UEF A;  1AWE A;  2J0J A;  3TCA A;  2RUK B;  1RRP B;  3P6A A;  1EF1 A;  4GZU A;  2LKO A;  1RJ2 A;  4HB3 B;  2D10 A;  3O96 A;  3WYF B;  1WGQ A;  3PG7 A;  2AEH A;  2P0D A;  3ULB A;  5JHH A;  3TFM A;  2X18 A;  4F7H A;  3PZD A;  2LG1 A;  4P7I A;  1SHC A;  1MAI A;  1U29 A;  3TO1 A;  1P6S A;  1ISN A;  5C6R A;  3F5R A;  2YSZ A;  4HB2 B;  4YL8 A;  4KHA A;  3SNH A;  3KSY A;  3CXB B;  2YS1 A;  1QQG A;  1V5M A;  3ODW A;  1UPQ A;  2EMS A;  3IVF A;  5D27 A;  5JHG A;  5LON B;  2DHI A;  3BIN A;  2I5C A;  1MK7 B;  1ZVR A;  4EJN A;  3QWM A;  1PLS A;  1NTV A;  1J0W A;  1XOD A;  1XX0 A;  1H10 A;  3U7D A;  2I1K A;  3P7Z A;  3ODO A;  2ELA A;  3DXE A;  2Q13 A;  4A6F A;  5C16 A;  1U5G A;  1Y5O A;  1FAO A;  2D2Q A;  4CYE A;  1WGU A;  4A6K A;  1H4R A;  1XD4 A;  4A6F B;  4GMX B;  4Z2N A;  4L6E A;  1DDW A;  5D3Y A;  1J19 A;  2XQN M;  3KRX A;  2E2X A;  1V88 A;  4GXB A;  1W1G A;  2NZ8 B;  4IAP A;  3D8D A;  4KAX B;  3T06 A;  2YT1 A;  2RVB B;  1V89 A;  3MPX A;  2G35 A;  4ZRI A;  3PVW A; 
#chains in the Genus database with same CATH topology
 2CRF A;  3DCX A;  3CIK A;  4PNK A;  4K81 A;  2GS0 A;  4OSN A;  1BAK A;  1WVH A;  1ZC4 B;  4PQ0 A;  3U12 A;  2HTH B;  2QKL A;  2Z0O A;  1DRO A;  3SUZ A;  2D9W A;  3GYO A;  4TKN A;  4D6W A;  5FI0 A;  2Z14 A;  2CAY A;  3TW1 A;  3M1I B;  4WVF B;  3G9W A;  2IYB A;  4HAZ B;  2D9Y A;  4QXA B;  1MKE A;  3A8P A;  1DBH A;  2EJ8 A;  1T77 A;  2YS3 A;  5JP4 A;  1MPH A;  1U2B A;  3PSC A;  1K5D B;  2VRW B;  5DIF B;  3KZ1 A;  1DDM A;  1WJM A;  2DFK A;  2D9V A;  1XKE A;  3MDB C;  4H8S A;  5DHA B;  5LG4 B;  2EC1 A;  1FB8 A;  2DX5 A;  4WJ7 A;  4HSI A;  2D9X A;  4OT1 A;  2COA A;  3SO6 A;  5L81 A;  1FHO A;  3D8F A;  3A98 B;  1P3R A;  2W2X D;  2J0M A;  2ADZ A;  3VOQ A;  3ML4 A;  4MT7 A;  3TVV A;  2D4Q A;  2LYD A;  3F0W A;  1BWN A;  1K5G B;  3DXC A;  2N0Y A;  3X23 A;  2DKP A;  4XWX A;  2RGN B;  1TQZ A;  1X11 A;  4Z2M B;  2KCJ A;  5DI9 B;  2CY5 A;  2UZS A;  4HB4 B;  4TYZ A;  4HDO A;  3BJI A;  4GPT B;  1U5F A;  3PP2 A;  2H7E A;  3PEG A;  4HAU B;  4GNK B;  5D3V A;  3SYX A;  4KVG B;  5JLJ B;  2K00 A;  2MKR A;  4K2O A;  3RCP A;  1MI1 A;  1Z87 A;  4EMO A;  5C5B A;  2COF A;  4GN1 A;  5HE0 A;  1FGZ A;  2RRF A;  2OQB A;  5C5B B;  5I2S A;  4L1R A;  2DLW A;  4DX8 A;  1X1F A;  3A8Q A;  5D3X A;  1EGX A;  4CSQ A;  1TJ6 A;  2IFS A;  2ELB A;  2ZKM X;  1PMS A;  4HDQ A;  2JP2 A;  5M4Y B;  3FM8 C;  3DXD A;  2L1C A;  2R2Y A;  4KHO A;  5LOP B;  1FGY A;  4EKU A;  5FI1 A;  3ULC A;  2H7D A;  2LUL A;  5KCV A;  1E5W A;  1Q67 A;  3HW2 B;  1OY2 A;  3AU5 A;  2DX1 A;  2R0D A;  2QKM A;  2DHK A;  1EVH A;  1P5T A;  1W1H A;  2NBV A;  3NSU A;  4Y94 A;  1X86 A;  5HE2 A;  3NWA A;  2RSG A;  4HAY B;  1UNP A;  4HHV A;  3OAN A;  2LOX A;  2YRY A;  2K2J A;  1MIX A;  3N7C A;  1FHW A;  2MWN B;  4CHJ A;  1OMW A;  2I5F A;  2J59 M;  2YF0 A;  1MIZ B;  2OTX A;  5KQ1 A;  4K2P A;  4BBK A;  2K2U A;  4DX9 0;  1UNQ A;  1KZG A;  2CY4 A;  1QC6 A;  4ZRK A;  2VKI A;  4DBB A;  1GC7 A;  1MK9 B;  5J3T A;  3NW8 A;  2Y8G A;  2BCJ A;  1ZYI A;  3NWD A;  4GMV A;  3ZVR A;  2Z0P A;  3ODX A;  2YS5 A;  3FVC A;  2Z13 A;  2UVM A;  1V5U A;  2MFQ A;  1FHX A;  2VSZ A;  3SV1 A;  4IOY X;  2GJY A;  1UPR A;  1BTK A;  2D9Z A;  2ROV A;  2KIG A;  2Y8F A;  2NMB A;  1M7E A;  5I2M A;  3ZDT A;  5DH9 B;  1B55 A;  5GOW B;  5CLQ B;  4B6H A;  5C79 A;  4GOU A;  5HE3 A;  2GUM A;  3UZT A;  2DHJ A;  2Y7B A;  4DIX A;  3VIA A;  2YVC A;  2EMT A;  1UNR A;  1ZM0 A;  1XR0 B;  4ZRJ A;  1LB1 A;  4C0A A;  3LJU X;  3FSS A;  1TXD A;  2RNR B;  2N23 A;  2Z4D A;  2MDX A;  3KRW A;  3PVU A;  2COC A;  1X1G A;  3AJ4 A;  4NY0 A;  4D0N B;  2W2W A;  2GCJ A;  4CHM A;  3HIE A;  2Z59 A;  2GCL A;  1FOE A;  4A6H A;  1WG7 A;  4DXA B;  1OQN A;  2DN6 A;  1N3H A;  2M38 A;  1V61 A;  2HE7 A;  4KHB A;  1DYN A;  2K8E A;  1ZSQ A;  1V5P A;  2J0K A;  3U8Z A;  4KHB B;  2R09 A;  4A5K A;  2DKQ A;  1AQC A;  2P8V A;  2FJL A;  1LW3 A;  1M7R A;  3WA0 A;  4MY6 A;  2W2X C;  1WI1 A;  4K17 A;  4QJ4 B;  2AL6 A;  1ZC3 B;  3FEH A;  3D8E A;  2RLO A;  1GG3 A;  1XCG A;  1Y19 B;  3V5W A;  1U27 A;  2P0F A;  2YT2 A;  5DHF B;  2I1J A;  2K49 A;  3PVL A;  4F7G A;  2ROZ B;  3QIJ A;  2DTC A;  5EFX A;  5IRS A;  5D3W A;  1X05 A;  1EAZ A;  1SGH A;  1IRS A;  5J3Y A;  4QJ3 B;  3HQC A;  5KQ4 A;  5J3Q A;  5HE1 A;  2P0H A;  1KI1 B;  2PZ1 A;  2D11 A;  2V76 A;  4HAX B;  1GC6 A;  2L2I A;  2ZPY A;  4HB0 B;  2UZR A;  1NU2 A;  1I7A A;  1PFJ A;  1U5D A;  4WSF A;  5CLL B;  1W1D A;  1BTN A;  2DA0 A;  2LOZ A;  4F7U P;  1U5E A;  3KY9 A;  4HAT B;  4NSW A;  2Z0Q A;  2DYQ A;  3GYP A;  1KZ7 A;  2M14 A;  4HAV B;  1NI2 A;  2COD A;  3QBV B;  4YON A;  1DDV A;  3HK0 A;  1WJ1 A;  2KGX B;  2KUP A;  4HAW B;  2DYN A;  2YT0 A;  1I2H A;  3B77 A;  4MK0 A;  1NTY A;  4IFS A;  3AU4 A;  1UEF A;  1AWE A;  2J0J A;  3TCA A;  2RUK B;  1RRP B;  3P6A A;  1EF1 A;  4GZU A;  2LKO A;  1RJ2 A;  2KR0 A;  4HB3 B;  2D10 A;  3O96 A;  3WYF B;  1WGQ A;  3PG7 A;  2AEH A;  2P0D A;  3ULB A;  5JHH A;  3TFM A;  2X18 A;  4F7H A;  3PZD A;  2LG1 A;  4P7I A;  1SHC A;  3HSA A;  1MAI A;  1U29 A;  3TO1 A;  1P6S A;  1ISN A;  5C6R A;  2KUQ A;  2FJU B;  3F5R A;  2YSZ A;  4HB2 B;  4YL8 A;  3A58 A;  4KHA A;  3SNH A;  3KSY A;  3CXB B;  2YS1 A;  1QQG A;  1V5M A;  3ODW A;  1UPQ A;  2EMS A;  3IVF A;  5D27 A;  5JHG A;  5LON B;  2DHI A;  2KIE A;  3BIN A;  2I5C A;  1MK7 B;  1ZVR A;  4EJN A;  3QWM A;  1PLS A;  1NTV A;  1J0W A;  1XOD A;  1XX0 A;  1H10 A;  3OHM B;  2I1K A;  3P7Z A;  3ODO A;  3U7D A;  2ELA A;  4QJ5 B;  3DXE A;  2Q13 A;  4A6F A;  5C16 A;  3NWF A;  1U5G A;  1Y5O A;  1FAO A;  2D2Q A;  4CYE A;  1WGU A;  4A6K A;  1H4R A;  1XD4 A;  4A6F B;  4GMX B;  4Z2N A;  4L6E A;  1DDW A;  5D3Y A;  1J19 A;  2XQN M;  3KRX A;  2E2X A;  1V88 A;  4GXB A;  1W1G A;  2NZ8 B;  4IAP A;  3D8D A;  4KAX B;  3T06 A;  2YT1 A;  2RVB B;  1V89 A;  3MPX A;  2G35 A;  4ZRI A;  3PVW A; 
#chains in the Genus database with same CATH homology
 2CRF A;  3CIK A;  4PNK A;  4K81 A;  2GS0 A;  1BAK A;  1WVH A;  1ZC4 B;  4PQ0 A;  2HTH B;  2QKL A;  2Z0O A;  1DRO A;  3SUZ A;  2D9W A;  3GYO A;  4TKN A;  5FI0 A;  3TW1 A;  2CAY A;  3M1I B;  4WVF B;  3G9W A;  2IYB A;  4HAZ B;  2D9Y A;  1MKE A;  3A8P A;  1DBH A;  2EJ8 A;  2YS3 A;  5JP4 A;  1MPH A;  1U2B A;  3PSC A;  1K5D B;  2VRW B;  5DIF B;  3KZ1 A;  1DDM A;  1WJM A;  2DFK A;  2D9V A;  1XKE A;  3MDB C;  4H8S A;  5DHA B;  2EC1 A;  1FB8 A;  2DX5 A;  4WJ7 A;  2D9X A;  2COA A;  3SO6 A;  5L81 A;  1FHO A;  3D8F A;  3A98 B;  1P3R A;  2W2X D;  2J0M A;  2ADZ A;  3VOQ A;  3ML4 A;  4MT7 A;  3TVV A;  2D4Q A;  2LYD A;  3F0W A;  1BWN A;  1K5G B;  3DXC A;  2N0Y A;  3X23 A;  2DKP A;  4XWX A;  2RGN B;  1TQZ A;  1X11 A;  4Z2M B;  2KCJ A;  5DI9 B;  2CY5 A;  2UZS A;  4HB4 B;  4TYZ A;  4HDO A;  3BJI A;  4GPT B;  1U5F A;  3PP2 A;  2H7E A;  3PEG A;  4HAU B;  5D3V A;  3SYX A;  4KVG B;  5JLJ B;  2K00 A;  2MKR A;  4K2O A;  3RCP A;  4EMO A;  1Z87 A;  5C5B A;  2COF A;  4GN1 A;  5HE0 A;  1FGZ A;  2OQB A;  5C5B B;  2DLW A;  4DX8 A;  1X1F A;  3A8Q A;  5D3X A;  1EGX A;  1TJ6 A;  2IFS A;  2ELB A;  1PMS A;  4HDQ A;  2JP2 A;  3FM8 C;  3DXD A;  2L1C A;  4KHO A;  5LOP B;  1FGY A;  4EKU A;  5FI1 A;  3ULC A;  2H7D A;  2LUL A;  5KCV A;  1E5W A;  1Q67 A;  3HW2 B;  1OY2 A;  3AU5 A;  2DX1 A;  2R0D A;  2QKM A;  2DHK A;  1EVH A;  1P5T A;  1W1H A;  3NSU A;  4Y94 A;  1X86 A;  5HE2 A;  2RSG A;  4HAY B;  1UNP A;  4HHV A;  3OAN A;  2LOX A;  2YRY A;  2K2J A;  1MIX A;  3N7C A;  1FHW A;  2MWN B;  4CHJ A;  1OMW A;  2I5F A;  2J59 M;  2YF0 A;  1MIZ B;  2OTX A;  5KQ1 A;  4K2P A;  4BBK A;  2K2U A;  4DX9 0;  1UNQ A;  1KZG A;  2CY4 A;  1QC6 A;  4ZRK A;  2VKI A;  4DBB A;  1GC7 A;  1MK9 B;  5J3T A;  2Y8G A;  2BCJ A;  4GMV A;  3ZVR A;  2Z0P A;  3ODX A;  2YS5 A;  2UVM A;  1V5U A;  2MFQ A;  1FHX A;  2VSZ A;  3SV1 A;  4IOY X;  2GJY A;  1UPR A;  1BTK A;  2D9Z A;  2ROV A;  2Y8F A;  2NMB A;  1M7E A;  3ZDT A;  5DH9 B;  1B55 A;  5GOW B;  5CLQ B;  4B6H A;  5C79 A;  5HE3 A;  3UZT A;  2DHJ A;  2Y7B A;  3VIA A;  2YVC A;  2EMT A;  1UNR A;  1ZM0 A;  1XR0 B;  4ZRJ A;  1LB1 A;  4C0A A;  3LJU X;  3FSS A;  1TXD A;  2RNR B;  2N23 A;  2MDX A;  3KRW A;  3PVU A;  2COC A;  1X1G A;  3AJ4 A;  4NY0 A;  4D0N B;  2W2W A;  2GCJ A;  4CHM A;  2GCL A;  1FOE A;  4A6H A;  1WG7 A;  4DXA B;  1OQN A;  2DN6 A;  1N3H A;  2M38 A;  1V61 A;  2HE7 A;  1DYN A;  1ZSQ A;  1V5P A;  2J0K A;  3U8Z A;  4KHB B;  2R09 A;  4A5K A;  2DKQ A;  1AQC A;  2P8V A;  2FJL A;  1LW3 A;  1M7R A;  3WA0 A;  4MY6 A;  2W2X C;  1WI1 A;  4K17 A;  2AL6 A;  1ZC3 B;  3FEH A;  3D8E A;  2RLO A;  1GG3 A;  1XCG A;  1Y19 B;  3V5W A;  1U27 A;  2P0F A;  5DHF B;  2I1J A;  3PVL A;  4F7G A;  2ROZ B;  3QIJ A;  2DTC A;  5EFX A;  5D3W A;  1X05 A;  1EAZ A;  1SGH A;  1IRS A;  5J3Y A;  3HQC A;  5KQ4 A;  5J3Q A;  5HE1 A;  2P0H A;  1KI1 B;  2PZ1 A;  2D11 A;  2V76 A;  4HAX B;  1GC6 A;  2L2I A;  2ZPY A;  4HB0 B;  2UZR A;  1NU2 A;  1I7A A;  1PFJ A;  1U5D A;  4WSF A;  5CLL B;  1W1D A;  1BTN A;  2DA0 A;  2LOZ A;  4F7U P;  1U5E A;  3KY9 A;  4HAT B;  4NSW A;  2Z0Q A;  2DYQ A;  3GYP A;  1KZ7 A;  2M14 A;  4HAV B;  1NI2 A;  2COD A;  3QBV B;  4YON A;  1DDV A;  3HK0 A;  1WJ1 A;  2KGX B;  2KUP A;  4HAW B;  2DYN A;  2YT0 A;  1I2H A;  4MK0 A;  1NTY A;  4IFS A;  3AU4 A;  1UEF A;  1AWE A;  2J0J A;  3TCA A;  2RUK B;  1RRP B;  3P6A A;  1EF1 A;  4GZU A;  2LKO A;  1RJ2 A;  4HB3 B;  2D10 A;  3O96 A;  3WYF B;  1WGQ A;  3PG7 A;  2AEH A;  2P0D A;  3ULB A;  5JHH A;  3TFM A;  2X18 A;  4F7H A;  3PZD A;  2LG1 A;  4P7I A;  1SHC A;  1MAI A;  1U29 A;  3TO1 A;  1P6S A;  1ISN A;  5C6R A;  3F5R A;  2YSZ A;  4HB2 B;  4YL8 A;  4KHA A;  3SNH A;  3KSY A;  3CXB B;  2YS1 A;  1QQG A;  1V5M A;  3ODW A;  1UPQ A;  2EMS A;  3IVF A;  5D27 A;  5JHG A;  5LON B;  2DHI A;  3BIN A;  2I5C A;  1MK7 B;  1ZVR A;  4EJN A;  3QWM A;  1PLS A;  1NTV A;  1J0W A;  1XOD A;  1XX0 A;  1H10 A;  3U7D A;  2I1K A;  3P7Z A;  3ODO A;  2ELA A;  3DXE A;  2Q13 A;  4A6F A;  5C16 A;  1U5G A;  1Y5O A;  1FAO A;  2D2Q A;  4CYE A;  1WGU A;  4A6K A;  1H4R A;  1XD4 A;  4A6F B;  4GMX B;  4Z2N A;  4L6E A;  1DDW A;  5D3Y A;  1J19 A;  2XQN M;  3KRX A;  2E2X A;  1V88 A;  4GXB A;  1W1G A;  2NZ8 B;  4IAP A;  3D8D A;  4KAX B;  3T06 A;  2YT1 A;  2RVB B;  1V89 A;  3MPX A;  2G35 A;  4ZRI A;  3PVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...