2P0FA

Arhgap9 ph domain in complex with ins(1,3,5)p3
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
SHEVEKSGLLNMTKIAQGGRKLRKNWGPSWVVLTGNSLVFYREPPPTAPSSGWGPAGSRPESSVDLRGAALAHGRHLSSRRNVLHIRTIPGHEFLLQSDHETELRAWHRALRTVIERLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rho GTPase-activating protein 9
publication title Non-canonical Interaction of Phosphoinositides with Pleckstrin Homology Domains of Tiam1 and ArhGAP9.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligand binding protein
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2p0fA00
3M1IB 3WYFB 4K2PA 2DYQA 4CHJA 3OANA 3ODOA 1BAKA 2QKMA 1PLSA 3PZDA 2YT1A 5FI1A 5D3XA 2YS1A 1XODA 2P0HA 4HDOA 3MPXA 1TJ6A 2DLWA 1M7RA 4HAXB 3NSUA 1X11A 2COFA 2FJLA 3D8EA 3RCPA 3N7CA 1FGYA 4GXBA 4HB4B 1Y5OA 1U29A 3F5RA 1WI1A 4HB0B 1KZ7A 3WA0A 3PVLA 3TW1A 5D3YA 4HAWB 3P6AA 4DBBA 1KI1B 1RJ2A 1UPRA 2UVMA 1Q67A 1MIZB 2DHJA 4HAUB 4F7GA 1W1DA 2Q13A 4WSFA 5HE0A 1J19A 1ZC3B 2DHKA 5EFXA 2ZPYA 4IFSA 1X1GA 1EF1A 1UEFA 2ADZA 2CAYA 2DA0A 4HAYB 4KHAA 2CY4A 3DXDA 4KHOA 1BTNA 3DXCA 1ISNA 1NTVA 4KVGB 4MY6A 1MPHA 2R09A 1ZM0A 2CRFA 5C79A 1WJMA 3CXBB 3ULBA 5JHHA 5D3WA 3VIAA 1MIXA 1NU2A 2CY5A 1FHOA 2LOZA 1FGZA 2OQBA 1MAIA 1SHCA 2HTHB 3FM8C 4PNKA 2V76A 2KGXB 5C6RA 4Y94A 2P0DA 2EMSA 1NI2A 2Y8FA 2AEHA 4C0AA 4MK0A 1N3HA 2RSGA 4HHVA 2GCJA 2BCJA 1UPQA 3KRWA 4XWXA 1U2BA 3HW2B 5GOWB 1XR0B 2J0KA 2JP2A 4IAPA 2YRYA 1H4RA 3FSSA 3SO6A 4A5KA 2Z0QA 1QQGA 2RLOA 3KY9A 2J0JA 2EMTA 3AU5A 3BINA 2LOXA 2P0FA 2MFQA 2DX5A 2X18A 3LJUX 1U27A 3T06A 1GC7A 5HE1A 1ZSQA 2I5FA 1UNRA 1U5DA 5DH9B 3PG7A 1W1GA 2DYNA 2Z0PA 1MK9B 3F0WA 2D2QA 3A8PA 5DI9B 5D3VA 1GC6A 2I5CA 1SGHA 2L1CA 2LYDA 3D8FA 4P7IA 4PQ0A 3PSCA 2D11A 3V5WA 2D9ZA 1TQZA 5LONB 3ODWA 2RVBB 1DBHA 1ZC4B 3TCAA 5KQ4A 1E5WA 2W2XD 1DDWA 2D9WA 2MKRA 1DDVA 1RRPB 3AU4A 4H8SA 4A6KA 4GMVA 1K5DB 5J3TA 2HE7A 1KZGA 5L81A 4B6HA 2CODA 1FHXA 5DHFB 2LKOA 3A98B 2K00A 3IVFA 2Z0OA 1P6SA 4DX8A 4K81A 2EC1A 2Y7BA 2DHIA 2Y8GA 5LOPB 1OMWA 2H7DA 2COAA 2IFSA 2YSZA 1X86A 2I1JA 2OTXA 2ELAA 2H7EA 3SUZA 4Z2MB 2UZRA 2M14A 1EGXA 4DX90 1P5TA 3SV1A 4YONA 2ROVA 3G9WA 1J0WA 4EJNA 4KAXB 3KRXA 4HDQA 3ZDTA 2DFKA 4NSWA 1WGUA 2YS5A 2W2WA 4TYZA 1XD4A 2I1KA 4ZRJA 1BTKA 5DHAB 2LULA 2KCJA 3TFMA 5CLQB 1BWNA 1LB1A 3PVWA 2L2IA 2QKLA 4GMXB 2DN6A 1V61A 2NZ8B 2YVCA 2K2UA 2MDXA 5J3QA 4EMOA 1WG7A 4GN1A 5HE2A 3SNHA 3GYOA 2J0MA 1X1FA 4K17A 3U7DA 4HB3B 4KHBB 4K2OA 5FI0A 3HK0A 2YS3A 1UNQA 4HAZB 3TO1A 3TVVA 1OY2A 2NMBA 5J3YA 1WJ1A 2E2XA 3CIKA 1FOEA 4WJ7A 2D9VA 1FAOA 2DKQA 2PZ1A 3O96A 5CLLB 5KQ1A 3DXEA 5HE3A 2AL6A 1V88A 2D4QA 1K5GB 2GCLA 3ZVRA 1PFJA 2RGNB 1P3RA 1OQNA 4MT7A 4HAVB 1WVHA 5DIFB 1V5UA 1FHWA 1WGQA 2DTCA 5C5BB 2M38A 1QC6A 1DYNA 1XKEA 3P7ZA 2P8VA 5KCVA 5C16A 3PP2A 4A6FB 1V89A 2LG1A 3BJIA 3AJ4A 4HB2B 1M7EA 4Z2NA 2J59M 1PMSA 1Z87A 1LW3A 4CHMA 4D0NB 4F7UP 1DROA 2ELBA 1GG3A 4BBKA 1MKEA 2COCA 3KZ1A 1AQCA 1V5PA 1XX0A 2D9XA 2D10A 1IRSA 4L6EA 2YF0A 4DXAB 4A6HA 1DDMA 2DKPA 1TXDA 4ZRIA 3SYXA 1W1HA 4F7HA 3PEGA 5C5BA 2KUPA 3QIJA 2N23A 1U5EA 3HQCA 2VRWB 1UNPA 3VOQA 4EKUA 3U8ZA 4NY0A 4A6FA 3X23A 4GZUA 3QBVB 3A8QA 4ZRKA 3PVUA 3D8DA 5JP4A 1U5GA 3ODXA 4IOYX 2GJYA 3ULCA 5JLJB 1B55A 2YT0A 3KSYA 5D27A 1I2HA 2GS0A 1NTYA 3GYPA 1U5FA 1ZVRA 2VKIA 2MWNB 1MK7B 2XQNM 2ROZB 3MDBC 2UZSA 4GPTB 2EJ8A 3UZTA 1Y19B 2RNRB 2R0DA 3FEHA 4WVFB 2K2JA 1EAZA 2DX1A 2VSZA 1V5MA 1AWEA 2G35A 2IYBA 2RUKB 2D9YA 4YL8A 2N0YA 1FB8A 4TKNA 1H10A 4CYEA 1EVHA 3ML4A 1XCGA 1I7AA 1X05A 4HATB 5JHGA 2W2XC 3QWMA
chains in the Genus database with same CATH superfamily
3M1IB 3WYFB 4K2PA 2DYQA 2RRFA 4CHJA 4QJ3B 3OANA 3ODOA 1BAKA 2QKMA 1PLSA 3PZDA 2YT1A 5FI1A 5D3XA 2YS1A 1XODA 2P0HA 4HDOA 3MPXA 1TJ6A 2DLWA 1M7RA 3NW8A 4HAXB 3NSUA 5IRSA 1X11A 2COFA 2FJLA 3D8EA 3RCPA 3N7CA 1FGYA 4GXBA 4HB4B 2Z14A 1Y5OA 4QXAB 1U29A 3F5RA 1WI1A 4HB0B 1KZ7A 3WA0A 3PVLA 3TW1A 5D3YA 4HAWB 3P6AA 4DBBA 1KI1B 1RJ2A 1UPRA 2UVMA 1Q67A 4CSQA 1MIZB 2DHJA 4HAUB 4F7GA 1W1DA 2KIGA 2Q13A 4WSFA 5HE0A 1J19A 1ZC3B 2DHKA 5EFXA 2ZPYA 4IFSA 1X1GA 1EF1A 1UEFA 2ADZA 2CAYA 2DA0A 4HAYB 4KHAA 5LG4B 3FVCA 2CY4A 3DXDA 2ZKMX 4GOUA 4KHOA 1BTNA 3DXCA 1ISNA 1NTVA 4KVGB 4MY6A 1MPHA 2R09A 1ZM0A 2CRFA 5C79A 1WJMA 3CXBB 3ULBA 5JHHA 5M4YB 5D3WA 3VIAA 1MIXA 1NU2A 4L1RA 4OT1A 2CY5A 1FHOA 2LOZA 1FGZA 2K49A 2OQBA 1MAIA 1SHCA 4DIXA 2HTHB 3FM8C 2YT2A 4PNKA 2V76A 1MI1A 4QJ4B 2KGXB 5C6RA 4Y94A 2P0DA 2EMSA 1NI2A 2Y8FA 2GUMA 2AEHA 2Z4DA 4C0AA 4MK0A 1N3HA 2RSGA 4HHVA 2GCJA 3OHMB 2BCJA 1UPQA 3KRWA 4XWXA 1U2BA 3HW2B 5GOWB 1XR0B 2J0KA 2JP2A 4IAPA 2YRYA 1H4RA 3FSSA 3B77A 3SO6A 4A5KA 3NWFA 2Z0QA 1QQGA 2RLOA 3KY9A 2J0JA 2EMTA 3AU5A 3BINA 2LOXA 2P0FA 2MFQA 2DX5A 2X18A 3LJUX 1U27A 3T06A 1GC7A 5HE1A 1ZSQA 2I5FA 1UNRA 1T77A 1U5DA 5DH9B 3PG7A 1W1GA 2DYNA 2Z0PA 1MK9B 3F0WA 2D2QA 3A8PA 5DI9B 5D3VA 1GC6A 2I5CA 1SGHA 2L1CA 2LYDA 3D8FA 2Z59A 4P7IA 4PQ0A 3PSCA 2D11A 3V5WA 2D9ZA 1TQZA 5LONB 3ODWA 2RVBB 1DBHA 1ZC4B 3TCAA 5KQ4A 1E5WA 2W2XD 1DDWA 2D9WA 2MKRA 1DDVA 1RRPB 3AU4A 4H8SA 4A6KA 4GMVA 1K5DB 5J3TA 2HE7A 1KZGA 5L81A 4B6HA 2KR0A 2CODA 1FHXA 5DHFB 2LKOA 3A98B 2K00A 3IVFA 2Z0OA 1P6SA 4DX8A 4K81A 2EC1A 2Y7BA 3A58A 2DHIA 2Y8GA 2KIEA 5LOPB 3NWAA 1OMWA 2H7DA 2COAA 2IFSA 2YSZA 1X86A 2I1JA 2OTXA 2ELAA 2FJUB 2H7EA 3SUZA 4Z2MB 2UZRA 2M14A 1EGXA 4DX90 1P5TA 3SV1A 2Z13A 4YONA 2ROVA 3G9WA 1J0WA 4EJNA 4KAXB 3U12A 3KRXA 4HDQA 3ZDTA 2DFKA 4NSWA 1WGUA 2YS5A 2W2WA 4TYZA 1XD4A 2I1KA 4ZRJA 1BTKA 5DHAB 2LULA 2KCJA 3TFMA 5CLQB 5I2SA 1BWNA 1LB1A 3PVWA 2L2IA 2QKLA 4GMXB 2DN6A 1V61A 2NZ8B 2YVCA 2K2UA 2MDXA 5J3QA 4EMOA 1WG7A 4GN1A 5HE2A 3SNHA 3GYOA 2J0MA 1X1FA 4K17A 4D6WA 3U7DA 2NBVA 4HB3B 4KHBB 4K2OA 5FI0A 3HK0A 2YS3A 1UNQA 4HAZB 3TO1A 3TVVA 1OY2A 2NMBA 5J3YA 1WJ1A 2E2XA 3CIKA 1FOEA 4WJ7A 2D9VA 1FAOA 2K8EA 2DKQA 2PZ1A 4QJ5B 3O96A 5CLLB 5KQ1A 3DXEA 5HE3A 2AL6A 1V88A 2D4QA 1K5GB 2GCLA 3ZVRA 3HIEA 1PFJA 2RGNB 1ZYIA 1P3RA 1OQNA 2R2YA 4MT7A 4HAVB 5I2MA 1WVHA 5DIFB 1V5UA 1FHWA 1WGQA 2DTCA 4KHBA 5C5BB 2M38A 1QC6A 1DYNA 1XKEA 3P7ZA 2P8VA 5KCVA 5C16A 3PP2A 4A6FB 1V89A 2LG1A 3BJIA 3AJ4A 4HB2B 1M7EA 4Z2NA 2J59M 1PMSA 1Z87A 1LW3A 4CHMA 4D0NB 4F7UP 1DROA 2ELBA 1GG3A 4BBKA 1MKEA 2COCA 3KZ1A 1AQCA 1V5PA 1XX0A 3HSAA 2D9XA 3DCXA 2D10A 4GNKB 1IRSA 4L6EA 2YF0A 4DXAB 4A6HA 1DDMA 2DKPA 1TXDA 4ZRIA 3SYXA 1W1HA 4F7HA 3PEGA 5C5BA 2KUPA 3QIJA 2N23A 1U5EA 3HQCA 2VRWB 1UNPA 3VOQA 4EKUA 4OSNA 3U8ZA 4NY0A 4A6FA 3X23A 4GZUA 3QBVB 3A8QA 4ZRKA 3PVUA 3D8DA 5JP4A 1U5GA 3ODXA 4IOYX 2GJYA 3ULCA 5JLJB 1B55A 2YT0A 3KSYA 5D27A 1I2HA 2GS0A 3NWDA 1NTYA 4HSIA 3GYPA 1U5FA 1ZVRA 2KUQA 2VKIA 2MWNB 1MK7B 2XQNM 2ROZB 3MDBC 2UZSA 4GPTB 2EJ8A 3UZTA 1Y19B 2RNRB 2R0DA 3FEHA 4WVFB 2K2JA 1EAZA 2DX1A 2VSZA 1V5MA 1AWEA 2G35A 2IYBA 2RUKB 2D9YA 4YL8A 2N0YA 1FB8A 4TKNA 1H10A 4CYEA 1EVHA 3ML4A 1XCGA 1I7AA 1X05A 4HATB 5JHGA 2W2XC 3QWMA
chains in the Genus database with same CATH topology
3M1IB 3WYFB 4K2PA 2DYQA 4CHJA 3OANA 3ODOA 1BAKA 2QKMA 1PLSA 3PZDA 2YT1A 5FI1A 5D3XA 2YS1A 1XODA 2P0HA 4HDOA 3MPXA 1TJ6A 2DLWA 1M7RA 4HAXB 3NSUA 1X11A 2COFA 2FJLA 3D8EA 3RCPA 3N7CA 1FGYA 4GXBA 4HB4B 1Y5OA 1U29A 3F5RA 1WI1A 4HB0B 1KZ7A 3WA0A 3PVLA 3TW1A 5D3YA 4HAWB 3P6AA 4DBBA 1KI1B 1RJ2A 1UPRA 2UVMA 1Q67A 1MIZB 2DHJA 4HAUB 4F7GA 1W1DA 2Q13A 4WSFA 5HE0A 1J19A 1ZC3B 2DHKA 5EFXA 2ZPYA 4IFSA 1X1GA 1EF1A 1UEFA 2ADZA 2CAYA 2DA0A 4HAYB 4KHAA 2CY4A 3DXDA 4KHOA 1BTNA 3DXCA 1ISNA 1NTVA 4KVGB 4MY6A 1MPHA 2R09A 1ZM0A 2CRFA 5C79A 1WJMA 3CXBB 3ULBA 5JHHA 5D3WA 3VIAA 1MIXA 1NU2A 2CY5A 1FHOA 2LOZA 1FGZA 2OQBA 1MAIA 1SHCA 2HTHB 3FM8C 4PNKA 2V76A 2KGXB 5C6RA 4Y94A 2P0DA 2EMSA 1NI2A 2Y8FA 2AEHA 4C0AA 4MK0A 1N3HA 2RSGA 4HHVA 2GCJA 2BCJA 1UPQA 3KRWA 4XWXA 1U2BA 3HW2B 5GOWB 1XR0B 2J0KA 2JP2A 4IAPA 2YRYA 1H4RA 3FSSA 3SO6A 4A5KA 2Z0QA 1QQGA 2RLOA 3KY9A 2J0JA 2EMTA 3AU5A 3BINA 2LOXA 2P0FA 2MFQA 2DX5A 2X18A 3LJUX 1U27A 3T06A 1GC7A 5HE1A 1ZSQA 2I5FA 1UNRA 1U5DA 5DH9B 3PG7A 1W1GA 2DYNA 2Z0PA 1MK9B 3F0WA 2D2QA 3A8PA 5DI9B 5D3VA 1GC6A 2I5CA 1SGHA 2L1CA 2LYDA 3D8FA 4P7IA 4PQ0A 3PSCA 2D11A 3V5WA 2D9ZA 1TQZA 5LONB 3ODWA 2RVBB 1DBHA 1ZC4B 3TCAA 5KQ4A 1E5WA 2W2XD 1DDWA 2D9WA 2MKRA 1DDVA 1RRPB 3AU4A 4H8SA 4A6KA 4GMVA 1K5DB 5J3TA 2HE7A 1KZGA 5L81A 4B6HA 2CODA 1FHXA 5DHFB 2LKOA 3A98B 2K00A 3IVFA 2Z0OA 1P6SA 4DX8A 4K81A 2EC1A 2Y7BA 2DHIA 2Y8GA 5LOPB 1OMWA 2H7DA 2COAA 2IFSA 2YSZA 1X86A 2I1JA 2OTXA 2ELAA 2H7EA 3SUZA 4Z2MB 2UZRA 2M14A 1EGXA 4DX90 1P5TA 3SV1A 4YONA 2ROVA 3G9WA 1J0WA 4EJNA 4KAXB 3KRXA 4HDQA 3ZDTA 2DFKA 4NSWA 1WGUA 2YS5A 2W2WA 4TYZA 1XD4A 2I1KA 4ZRJA 1BTKA 5DHAB 2LULA 2KCJA 3TFMA 5CLQB 1BWNA 1LB1A 3PVWA 2L2IA 2QKLA 4GMXB 2DN6A 1V61A 2NZ8B 2YVCA 2K2UA 2MDXA 5J3QA 4EMOA 1WG7A 4GN1A 5HE2A 3SNHA 3GYOA 2J0MA 1X1FA 4K17A 3U7DA 4HB3B 4KHBB 4K2OA 5FI0A 3HK0A 2YS3A 1UNQA 4HAZB 3TO1A 3TVVA 1OY2A 2NMBA 5J3YA 1WJ1A 2E2XA 3CIKA 1FOEA 4WJ7A 2D9VA 1FAOA 2DKQA 2PZ1A 3O96A 5CLLB 5KQ1A 3DXEA 5HE3A 2AL6A 1V88A 2D4QA 1K5GB 2GCLA 3ZVRA 1PFJA 2RGNB 1P3RA 1OQNA 4MT7A 4HAVB 1WVHA 5DIFB 1V5UA 1FHWA 1WGQA 2DTCA 5C5BB 2M38A 1QC6A 1DYNA 1XKEA 3P7ZA 2P8VA 5KCVA 5C16A 3PP2A 4A6FB 1V89A 2LG1A 3BJIA 3AJ4A 4HB2B 1M7EA 4Z2NA 2J59M 1PMSA 1Z87A 1LW3A 4CHMA 4D0NB 4F7UP 1DROA 2ELBA 1GG3A 4BBKA 1MKEA 2COCA 3KZ1A 1AQCA 1V5PA 1XX0A 2D9XA 2D10A 1IRSA 4L6EA 2YF0A 4DXAB 4A6HA 1DDMA 2DKPA 1TXDA 4ZRIA 3SYXA 1W1HA 4F7HA 3PEGA 5C5BA 2KUPA 3QIJA 2N23A 1U5EA 3HQCA 2VRWB 1UNPA 3VOQA 4EKUA 3U8ZA 4NY0A 4A6FA 3X23A 4GZUA 3QBVB 3A8QA 4ZRKA 3PVUA 3D8DA 5JP4A 1U5GA 3ODXA 4IOYX 2GJYA 3ULCA 5JLJB 1B55A 2YT0A 3KSYA 5D27A 1I2HA 2GS0A 1NTYA 3GYPA 1U5FA 1ZVRA 2VKIA 2MWNB 1MK7B 2XQNM 2ROZB 3MDBC 2UZSA 4GPTB 2EJ8A 3UZTA 1Y19B 2RNRB 2R0DA 3FEHA 4WVFB 2K2JA 1EAZA 2DX1A 2VSZA 1V5MA 1AWEA 2G35A 2IYBA 2RUKB 2D9YA 4YL8A 2N0YA 1FB8A 4TKNA 1H10A 4CYEA 1EVHA 3ML4A 1XCGA 1I7AA 1X05A 4HATB 5JHGA 2W2XC 3QWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M1I B;  3WYF B;  4K2P A;  2DYQ A;  4CHJ A;  3OAN A;  3ODO A;  1BAK A;  2QKM A;  1PLS A;  3PZD A;  2YT1 A;  5FI1 A;  5D3X A;  2YS1 A;  1XOD A;  2P0H A;  4HDO A;  3MPX A;  1TJ6 A;  2DLW A;  1M7R A;  4HAX B;  3NSU A;  1X11 A;  2COF A;  2FJL A;  3D8E A;  3RCP A;  3N7C A;  1FGY A;  4GXB A;  4HB4 B;  1Y5O A;  1U29 A;  3F5R A;  1WI1 A;  4HB0 B;  1KZ7 A;  3WA0 A;  3PVL A;  3TW1 A;  5D3Y A;  4HAW B;  3P6A A;  4DBB A;  1KI1 B;  1RJ2 A;  1UPR A;  2UVM A;  1Q67 A;  1MIZ B;  2DHJ A;  4HAU B;  4F7G A;  1W1D A;  2Q13 A;  4WSF A;  5HE0 A;  1J19 A;  1ZC3 B;  2DHK A;  5EFX A;  2ZPY A;  4IFS A;  1X1G A;  1EF1 A;  1UEF A;  2ADZ A;  2CAY A;  2DA0 A;  4HAY B;  4KHA A;  2CY4 A;  3DXD A;  4KHO A;  1BTN A;  3DXC A;  1ISN A;  1NTV A;  4KVG B;  4MY6 A;  1MPH A;  2R09 A;  1ZM0 A;  2CRF A;  5C79 A;  1WJM A;  3CXB B;  3ULB A;  5JHH A;  5D3W A;  3VIA A;  1MIX A;  1NU2 A;  2CY5 A;  1FHO A;  2LOZ A;  1FGZ A;  2OQB A;  1MAI A;  1SHC A;  2HTH B;  3FM8 C;  4PNK A;  2V76 A;  2KGX B;  5C6R A;  4Y94 A;  2P0D A;  2EMS A;  1NI2 A;  2Y8F A;  2AEH A;  4C0A A;  4MK0 A;  1N3H A;  2RSG A;  4HHV A;  2GCJ A;  2BCJ A;  1UPQ A;  3KRW A;  4XWX A;  1U2B A;  3HW2 B;  5GOW B;  1XR0 B;  2J0K A;  2JP2 A;  4IAP A;  2YRY A;  1H4R A;  3FSS A;  3SO6 A;  4A5K A;  2Z0Q A;  1QQG A;  2RLO A;  3KY9 A;  2J0J A;  2EMT A;  3AU5 A;  3BIN A;  2LOX A;  2P0F A;  2MFQ A;  2DX5 A;  2X18 A;  3LJU X;  1U27 A;  3T06 A;  1GC7 A;  5HE1 A;  1ZSQ A;  2I5F A;  1UNR A;  1U5D A;  5DH9 B;  3PG7 A;  1W1G A;  2DYN A;  2Z0P A;  1MK9 B;  3F0W A;  2D2Q A;  3A8P A;  5DI9 B;  5D3V A;  1GC6 A;  2I5C A;  1SGH A;  2L1C A;  2LYD A;  3D8F A;  4P7I A;  4PQ0 A;  3PSC A;  2D11 A;  3V5W A;  2D9Z A;  1TQZ A;  5LON B;  3ODW A;  2RVB B;  1DBH A;  1ZC4 B;  3TCA A;  5KQ4 A;  1E5W A;  2W2X D;  1DDW A;  2D9W A;  2MKR A;  1DDV A;  1RRP B;  3AU4 A;  4H8S A;  4A6K A;  4GMV A;  1K5D B;  5J3T A;  2HE7 A;  1KZG A;  5L81 A;  4B6H A;  2COD A;  1FHX A;  5DHF B;  2LKO A;  3A98 B;  2K00 A;  3IVF A;  2Z0O A;  1P6S A;  4DX8 A;  4K81 A;  2EC1 A;  2Y7B A;  2DHI A;  2Y8G A;  5LOP B;  1OMW A;  2H7D A;  2COA A;  2IFS A;  2YSZ A;  1X86 A;  2I1J A;  2OTX A;  2ELA A;  2H7E A;  3SUZ A;  4Z2M B;  2UZR A;  2M14 A;  1EGX A;  4DX9 0;  1P5T A;  3SV1 A;  4YON A;  2ROV A;  3G9W A;  1J0W A;  4EJN A;  4KAX B;  3KRX A;  4HDQ A;  3ZDT A;  2DFK A;  4NSW A;  1WGU A;  2YS5 A;  2W2W A;  4TYZ A;  1XD4 A;  2I1K A;  4ZRJ A;  1BTK A;  5DHA B;  2LUL A;  2KCJ A;  3TFM A;  5CLQ B;  1BWN A;  1LB1 A;  3PVW A;  2L2I A;  2QKL A;  4GMX B;  2DN6 A;  1V61 A;  2NZ8 B;  2YVC A;  2K2U A;  2MDX A;  5J3Q A;  4EMO A;  1WG7 A;  4GN1 A;  5HE2 A;  3SNH A;  3GYO A;  2J0M A;  1X1F A;  4K17 A;  3U7D A;  4HB3 B;  4KHB B;  4K2O A;  5FI0 A;  3HK0 A;  2YS3 A;  1UNQ A;  4HAZ B;  3TO1 A;  3TVV A;  1OY2 A;  2NMB A;  5J3Y A;  1WJ1 A;  2E2X A;  3CIK A;  1FOE A;  4WJ7 A;  2D9V A;  1FAO A;  2DKQ A;  2PZ1 A;  3O96 A;  5CLL B;  5KQ1 A;  3DXE A;  5HE3 A;  2AL6 A;  1V88 A;  2D4Q A;  1K5G B;  2GCL A;  3ZVR A;  1PFJ A;  2RGN B;  1P3R A;  1OQN A;  4MT7 A;  4HAV B;  1WVH A;  5DIF B;  1V5U A;  1FHW A;  1WGQ A;  2DTC A;  5C5B B;  2M38 A;  1QC6 A;  1DYN A;  1XKE A;  3P7Z A;  2P8V A;  5KCV A;  5C16 A;  3PP2 A;  4A6F B;  1V89 A;  2LG1 A;  3BJI A;  3AJ4 A;  4HB2 B;  1M7E A;  4Z2N A;  2J59 M;  1PMS A;  1Z87 A;  1LW3 A;  4CHM A;  4D0N B;  4F7U P;  1DRO A;  2ELB A;  1GG3 A;  4BBK A;  1MKE A;  2COC A;  3KZ1 A;  1AQC A;  1V5P A;  1XX0 A;  2D9X A;  2D10 A;  1IRS A;  4L6E A;  2YF0 A;  4DXA B;  4A6H A;  1DDM A;  2DKP A;  1TXD A;  4ZRI A;  3SYX A;  1W1H A;  4F7H A;  3PEG A;  5C5B A;  2KUP A;  3QIJ A;  2N23 A;  1U5E A;  3HQC A;  2VRW B;  1UNP A;  3VOQ A;  4EKU A;  3U8Z A;  4NY0 A;  4A6F A;  3X23 A;  4GZU A;  3QBV B;  3A8Q A;  4ZRK A;  3PVU A;  3D8D A;  5JP4 A;  1U5G A;  3ODX A;  4IOY X;  2GJY A;  3ULC A;  5JLJ B;  1B55 A;  2YT0 A;  3KSY A;  5D27 A;  1I2H A;  2GS0 A;  1NTY A;  3GYP A;  1U5F A;  1ZVR A;  2VKI A;  2MWN B;  1MK7 B;  2XQN M;  2ROZ B;  3MDB C;  2UZS A;  4GPT B;  2EJ8 A;  3UZT A;  1Y19 B;  2RNR B;  2R0D A;  3FEH A;  4WVF B;  2K2J A;  1EAZ A;  2DX1 A;  2VSZ A;  1V5M A;  1AWE A;  2G35 A;  2IYB A;  2RUK B;  2D9Y A;  4YL8 A;  2N0Y A;  1FB8 A;  4TKN A;  1H10 A;  4CYE A;  1EVH A;  3ML4 A;  1XCG A;  1I7A A;  1X05 A;  4HAT B;  5JHG A;  2W2X C;  3QWM A; 
#chains in the Genus database with same CATH topology
 3M1I B;  3WYF B;  4K2P A;  2DYQ A;  2RRF A;  4CHJ A;  4QJ3 B;  3OAN A;  3ODO A;  1BAK A;  2QKM A;  1PLS A;  3PZD A;  2YT1 A;  5FI1 A;  5D3X A;  2YS1 A;  1XOD A;  2P0H A;  4HDO A;  3MPX A;  1TJ6 A;  2DLW A;  1M7R A;  3NW8 A;  4HAX B;  3NSU A;  5IRS A;  1X11 A;  2COF A;  2FJL A;  3D8E A;  3RCP A;  3N7C A;  1FGY A;  4GXB A;  4HB4 B;  2Z14 A;  1Y5O A;  4QXA B;  1U29 A;  3F5R A;  1WI1 A;  4HB0 B;  1KZ7 A;  3WA0 A;  3PVL A;  3TW1 A;  5D3Y A;  4HAW B;  3P6A A;  4DBB A;  1KI1 B;  1RJ2 A;  1UPR A;  2UVM A;  1Q67 A;  4CSQ A;  1MIZ B;  2DHJ A;  4HAU B;  4F7G A;  1W1D A;  2KIG A;  2Q13 A;  4WSF A;  5HE0 A;  1J19 A;  1ZC3 B;  2DHK A;  5EFX A;  2ZPY A;  4IFS A;  1X1G A;  1EF1 A;  1UEF A;  2ADZ A;  2CAY A;  2DA0 A;  4HAY B;  4KHA A;  5LG4 B;  3FVC A;  2CY4 A;  3DXD A;  2ZKM X;  4GOU A;  4KHO A;  1BTN A;  3DXC A;  1ISN A;  1NTV A;  4KVG B;  4MY6 A;  1MPH A;  2R09 A;  1ZM0 A;  2CRF A;  5C79 A;  1WJM A;  3CXB B;  3ULB A;  5JHH A;  5M4Y B;  5D3W A;  3VIA A;  1MIX A;  1NU2 A;  4L1R A;  4OT1 A;  2CY5 A;  1FHO A;  2LOZ A;  1FGZ A;  2K49 A;  2OQB A;  1MAI A;  1SHC A;  4DIX A;  2HTH B;  3FM8 C;  2YT2 A;  4PNK A;  2V76 A;  1MI1 A;  4QJ4 B;  2KGX B;  5C6R A;  4Y94 A;  2P0D A;  2EMS A;  1NI2 A;  2Y8F A;  2GUM A;  2AEH A;  2Z4D A;  4C0A A;  4MK0 A;  1N3H A;  2RSG A;  4HHV A;  2GCJ A;  3OHM B;  2BCJ A;  1UPQ A;  3KRW A;  4XWX A;  1U2B A;  3HW2 B;  5GOW B;  1XR0 B;  2J0K A;  2JP2 A;  4IAP A;  2YRY A;  1H4R A;  3FSS A;  3B77 A;  3SO6 A;  4A5K A;  3NWF A;  2Z0Q A;  1QQG A;  2RLO A;  3KY9 A;  2J0J A;  2EMT A;  3AU5 A;  3BIN A;  2LOX A;  2P0F A;  2MFQ A;  2DX5 A;  2X18 A;  3LJU X;  1U27 A;  3T06 A;  1GC7 A;  5HE1 A;  1ZSQ A;  2I5F A;  1UNR A;  1T77 A;  1U5D A;  5DH9 B;  3PG7 A;  1W1G A;  2DYN A;  2Z0P A;  1MK9 B;  3F0W A;  2D2Q A;  3A8P A;  5DI9 B;  5D3V A;  1GC6 A;  2I5C A;  1SGH A;  2L1C A;  2LYD A;  3D8F A;  2Z59 A;  4P7I A;  4PQ0 A;  3PSC A;  2D11 A;  3V5W A;  2D9Z A;  1TQZ A;  5LON B;  3ODW A;  2RVB B;  1DBH A;  1ZC4 B;  3TCA A;  5KQ4 A;  1E5W A;  2W2X D;  1DDW A;  2D9W A;  2MKR A;  1DDV A;  1RRP B;  3AU4 A;  4H8S A;  4A6K A;  4GMV A;  1K5D B;  5J3T A;  2HE7 A;  1KZG A;  5L81 A;  4B6H A;  2KR0 A;  2COD A;  1FHX A;  5DHF B;  2LKO A;  3A98 B;  2K00 A;  3IVF A;  2Z0O A;  1P6S A;  4DX8 A;  4K81 A;  2EC1 A;  2Y7B A;  3A58 A;  2DHI A;  2Y8G A;  2KIE A;  5LOP B;  3NWA A;  1OMW A;  2H7D A;  2COA A;  2IFS A;  2YSZ A;  1X86 A;  2I1J A;  2OTX A;  2ELA A;  2FJU B;  2H7E A;  3SUZ A;  4Z2M B;  2UZR A;  2M14 A;  1EGX A;  4DX9 0;  1P5T A;  3SV1 A;  2Z13 A;  4YON A;  2ROV A;  3G9W A;  1J0W A;  4EJN A;  4KAX B;  3U12 A;  3KRX A;  4HDQ A;  3ZDT A;  2DFK A;  4NSW A;  1WGU A;  2YS5 A;  2W2W A;  4TYZ A;  1XD4 A;  2I1K A;  4ZRJ A;  1BTK A;  5DHA B;  2LUL A;  2KCJ A;  3TFM A;  5CLQ B;  5I2S A;  1BWN A;  1LB1 A;  3PVW A;  2L2I A;  2QKL A;  4GMX B;  2DN6 A;  1V61 A;  2NZ8 B;  2YVC A;  2K2U A;  2MDX A;  5J3Q A;  4EMO A;  1WG7 A;  4GN1 A;  5HE2 A;  3SNH A;  3GYO A;  2J0M A;  1X1F A;  4K17 A;  4D6W A;  3U7D A;  2NBV A;  4HB3 B;  4KHB B;  4K2O A;  5FI0 A;  3HK0 A;  2YS3 A;  1UNQ A;  4HAZ B;  3TO1 A;  3TVV A;  1OY2 A;  2NMB A;  5J3Y A;  1WJ1 A;  2E2X A;  3CIK A;  1FOE A;  4WJ7 A;  2D9V A;  1FAO A;  2K8E A;  2DKQ A;  2PZ1 A;  4QJ5 B;  3O96 A;  5CLL B;  5KQ1 A;  3DXE A;  5HE3 A;  2AL6 A;  1V88 A;  2D4Q A;  1K5G B;  2GCL A;  3ZVR A;  3HIE A;  1PFJ A;  2RGN B;  1ZYI A;  1P3R A;  1OQN A;  2R2Y A;  4MT7 A;  4HAV B;  5I2M A;  1WVH A;  5DIF B;  1V5U A;  1FHW A;  1WGQ A;  2DTC A;  4KHB A;  5C5B B;  2M38 A;  1QC6 A;  1DYN A;  1XKE A;  3P7Z A;  2P8V A;  5KCV A;  5C16 A;  3PP2 A;  4A6F B;  1V89 A;  2LG1 A;  3BJI A;  3AJ4 A;  4HB2 B;  1M7E A;  4Z2N A;  2J59 M;  1PMS A;  1Z87 A;  1LW3 A;  4CHM A;  4D0N B;  4F7U P;  1DRO A;  2ELB A;  1GG3 A;  4BBK A;  1MKE A;  2COC A;  3KZ1 A;  1AQC A;  1V5P A;  1XX0 A;  3HSA A;  2D9X A;  3DCX A;  2D10 A;  4GNK B;  1IRS A;  4L6E A;  2YF0 A;  4DXA B;  4A6H A;  1DDM A;  2DKP A;  1TXD A;  4ZRI A;  3SYX A;  1W1H A;  4F7H A;  3PEG A;  5C5B A;  2KUP A;  3QIJ A;  2N23 A;  1U5E A;  3HQC A;  2VRW B;  1UNP A;  3VOQ A;  4EKU A;  4OSN A;  3U8Z A;  4NY0 A;  4A6F A;  3X23 A;  4GZU A;  3QBV B;  3A8Q A;  4ZRK A;  3PVU A;  3D8D A;  5JP4 A;  1U5G A;  3ODX A;  4IOY X;  2GJY A;  3ULC A;  5JLJ B;  1B55 A;  2YT0 A;  3KSY A;  5D27 A;  1I2H A;  2GS0 A;  3NWD A;  1NTY A;  4HSI A;  3GYP A;  1U5F A;  1ZVR A;  2KUQ A;  2VKI A;  2MWN B;  1MK7 B;  2XQN M;  2ROZ B;  3MDB C;  2UZS A;  4GPT B;  2EJ8 A;  3UZT A;  1Y19 B;  2RNR B;  2R0D A;  3FEH A;  4WVF B;  2K2J A;  1EAZ A;  2DX1 A;  2VSZ A;  1V5M A;  1AWE A;  2G35 A;  2IYB A;  2RUK B;  2D9Y A;  4YL8 A;  2N0Y A;  1FB8 A;  4TKN A;  1H10 A;  4CYE A;  1EVH A;  3ML4 A;  1XCG A;  1I7A A;  1X05 A;  4HAT B;  5JHG A;  2W2X C;  3QWM A; 
#chains in the Genus database with same CATH homology
 3M1I B;  3WYF B;  4K2P A;  2DYQ A;  4CHJ A;  3OAN A;  3ODO A;  1BAK A;  2QKM A;  1PLS A;  3PZD A;  2YT1 A;  5FI1 A;  5D3X A;  2YS1 A;  1XOD A;  2P0H A;  4HDO A;  3MPX A;  1TJ6 A;  2DLW A;  1M7R A;  4HAX B;  3NSU A;  1X11 A;  2COF A;  2FJL A;  3D8E A;  3RCP A;  3N7C A;  1FGY A;  4GXB A;  4HB4 B;  1Y5O A;  1U29 A;  3F5R A;  1WI1 A;  4HB0 B;  1KZ7 A;  3WA0 A;  3PVL A;  3TW1 A;  5D3Y A;  4HAW B;  3P6A A;  4DBB A;  1KI1 B;  1RJ2 A;  1UPR A;  2UVM A;  1Q67 A;  1MIZ B;  2DHJ A;  4HAU B;  4F7G A;  1W1D A;  2Q13 A;  4WSF A;  5HE0 A;  1J19 A;  1ZC3 B;  2DHK A;  5EFX A;  2ZPY A;  4IFS A;  1X1G A;  1EF1 A;  1UEF A;  2ADZ A;  2CAY A;  2DA0 A;  4HAY B;  4KHA A;  2CY4 A;  3DXD A;  4KHO A;  1BTN A;  3DXC A;  1ISN A;  1NTV A;  4KVG B;  4MY6 A;  1MPH A;  2R09 A;  1ZM0 A;  2CRF A;  5C79 A;  1WJM A;  3CXB B;  3ULB A;  5JHH A;  5D3W A;  3VIA A;  1MIX A;  1NU2 A;  2CY5 A;  1FHO A;  2LOZ A;  1FGZ A;  2OQB A;  1MAI A;  1SHC A;  2HTH B;  3FM8 C;  4PNK A;  2V76 A;  2KGX B;  5C6R A;  4Y94 A;  2P0D A;  2EMS A;  1NI2 A;  2Y8F A;  2AEH A;  4C0A A;  4MK0 A;  1N3H A;  2RSG A;  4HHV A;  2GCJ A;  2BCJ A;  1UPQ A;  3KRW A;  4XWX A;  1U2B A;  3HW2 B;  5GOW B;  1XR0 B;  2J0K A;  2JP2 A;  4IAP A;  2YRY A;  1H4R A;  3FSS A;  3SO6 A;  4A5K A;  2Z0Q A;  1QQG A;  2RLO A;  3KY9 A;  2J0J A;  2EMT A;  3AU5 A;  3BIN A;  2LOX A;  2P0F A;  2MFQ A;  2DX5 A;  2X18 A;  3LJU X;  1U27 A;  3T06 A;  1GC7 A;  5HE1 A;  1ZSQ A;  2I5F A;  1UNR A;  1U5D A;  5DH9 B;  3PG7 A;  1W1G A;  2DYN A;  2Z0P A;  1MK9 B;  3F0W A;  2D2Q A;  3A8P A;  5DI9 B;  5D3V A;  1GC6 A;  2I5C A;  1SGH A;  2L1C A;  2LYD A;  3D8F A;  4P7I A;  4PQ0 A;  3PSC A;  2D11 A;  3V5W A;  2D9Z A;  1TQZ A;  5LON B;  3ODW A;  2RVB B;  1DBH A;  1ZC4 B;  3TCA A;  5KQ4 A;  1E5W A;  2W2X D;  1DDW A;  2D9W A;  2MKR A;  1DDV A;  1RRP B;  3AU4 A;  4H8S A;  4A6K A;  4GMV A;  1K5D B;  5J3T A;  2HE7 A;  1KZG A;  5L81 A;  4B6H A;  2COD A;  1FHX A;  5DHF B;  2LKO A;  3A98 B;  2K00 A;  3IVF A;  2Z0O A;  1P6S A;  4DX8 A;  4K81 A;  2EC1 A;  2Y7B A;  2DHI A;  2Y8G A;  5LOP B;  1OMW A;  2H7D A;  2COA A;  2IFS A;  2YSZ A;  1X86 A;  2I1J A;  2OTX A;  2ELA A;  2H7E A;  3SUZ A;  4Z2M B;  2UZR A;  2M14 A;  1EGX A;  4DX9 0;  1P5T A;  3SV1 A;  4YON A;  2ROV A;  3G9W A;  1J0W A;  4EJN A;  4KAX B;  3KRX A;  4HDQ A;  3ZDT A;  2DFK A;  4NSW A;  1WGU A;  2YS5 A;  2W2W A;  4TYZ A;  1XD4 A;  2I1K A;  4ZRJ A;  1BTK A;  5DHA B;  2LUL A;  2KCJ A;  3TFM A;  5CLQ B;  1BWN A;  1LB1 A;  3PVW A;  2L2I A;  2QKL A;  4GMX B;  2DN6 A;  1V61 A;  2NZ8 B;  2YVC A;  2K2U A;  2MDX A;  5J3Q A;  4EMO A;  1WG7 A;  4GN1 A;  5HE2 A;  3SNH A;  3GYO A;  2J0M A;  1X1F A;  4K17 A;  3U7D A;  4HB3 B;  4KHB B;  4K2O A;  5FI0 A;  3HK0 A;  2YS3 A;  1UNQ A;  4HAZ B;  3TO1 A;  3TVV A;  1OY2 A;  2NMB A;  5J3Y A;  1WJ1 A;  2E2X A;  3CIK A;  1FOE A;  4WJ7 A;  2D9V A;  1FAO A;  2DKQ A;  2PZ1 A;  3O96 A;  5CLL B;  5KQ1 A;  3DXE A;  5HE3 A;  2AL6 A;  1V88 A;  2D4Q A;  1K5G B;  2GCL A;  3ZVR A;  1PFJ A;  2RGN B;  1P3R A;  1OQN A;  4MT7 A;  4HAV B;  1WVH A;  5DIF B;  1V5U A;  1FHW A;  1WGQ A;  2DTC A;  5C5B B;  2M38 A;  1QC6 A;  1DYN A;  1XKE A;  3P7Z A;  2P8V A;  5KCV A;  5C16 A;  3PP2 A;  4A6F B;  1V89 A;  2LG1 A;  3BJI A;  3AJ4 A;  4HB2 B;  1M7E A;  4Z2N A;  2J59 M;  1PMS A;  1Z87 A;  1LW3 A;  4CHM A;  4D0N B;  4F7U P;  1DRO A;  2ELB A;  1GG3 A;  4BBK A;  1MKE A;  2COC A;  3KZ1 A;  1AQC A;  1V5P A;  1XX0 A;  2D9X A;  2D10 A;  1IRS A;  4L6E A;  2YF0 A;  4DXA B;  4A6H A;  1DDM A;  2DKP A;  1TXD A;  4ZRI A;  3SYX A;  1W1H A;  4F7H A;  3PEG A;  5C5B A;  2KUP A;  3QIJ A;  2N23 A;  1U5E A;  3HQC A;  2VRW B;  1UNP A;  3VOQ A;  4EKU A;  3U8Z A;  4NY0 A;  4A6F A;  3X23 A;  4GZU A;  3QBV B;  3A8Q A;  4ZRK A;  3PVU A;  3D8D A;  5JP4 A;  1U5G A;  3ODX A;  4IOY X;  2GJY A;  3ULC A;  5JLJ B;  1B55 A;  2YT0 A;  3KSY A;  5D27 A;  1I2H A;  2GS0 A;  1NTY A;  3GYP A;  1U5F A;  1ZVR A;  2VKI A;  2MWN B;  1MK7 B;  2XQN M;  2ROZ B;  3MDB C;  2UZS A;  4GPT B;  2EJ8 A;  3UZT A;  1Y19 B;  2RNR B;  2R0D A;  3FEH A;  4WVF B;  2K2J A;  1EAZ A;  2DX1 A;  2VSZ A;  1V5M A;  1AWE A;  2G35 A;  2IYB A;  2RUK B;  2D9Y A;  4YL8 A;  2N0Y A;  1FB8 A;  4TKN A;  1H10 A;  4CYE A;  1EVH A;  3ML4 A;  1XCG A;  1I7A A;  1X05 A;  4HAT B;  5JHG A;  2W2X C;  3QWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...