2P0FA

Arhgap9 ph domain in complex with ins(1,3,5)p3
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
SHEVEKSGLLNMTKIAQGGRKLRKNWGPSWVVLTGNSLVFYREPPPTAPSSGWGPAGSRPESSVDLRGAALAHGRHLSSRRNVLHIRTIPGHEFLLQSDHETELRAWHRALRTVIERLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligand binding protein
molecule keywords Rho GTPase-activating protein 9
publication title Non-canonical Interaction of Phosphoinositides with Pleckstrin Homology Domains of Tiam1 and ArhGAP9.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2p0fA00
1FOEA 4GPTB 3ODWA 2DFKA 1FB8A 3LJUX 2LOXA 3X23A 3IVFA 2VKIA 5C16A 1UNQA 1LB1A 4K81A 3HQCA 1X11A 2RLOA 1DROA 1XR0B 4MK0A 2X18A 4F7HA 2M14A 1BTNA 1XODA 3NSUA 3U8ZA 3O96A 5HE2A 2LOZA 3F0WA 1ZVRA 2DX5A 2CY5A 2DTCA 2ZPYA 2GCLA 1E5WA 1MK9B 3V5WA 2QKLA 3TFMA 4EJNA 2N0YA 4HDOA 2YRYA 2W2XC 4DX90 3BINA 1DYNA 1XX0A 4EKUA 2DHJA 5JHGA 2V76A 3KZ1A 3G9WA 5C5BA 5D3XA 3N7CA 2I1KA 1X86A 2EMTA 1MPHA 2K00A 2D9ZA 2LKOA 2DN6A 4IFSA 5D3VA 3DXCA 3M1IB 4WSFA 2MKRA 2CY4A 1AWEA 2EJ8A 1XD4A 1N3HA 2MWNB 2G35A 1EAZA 4Y94A 5C5BB 4NSWA 3PVLA 3KRWA 2R09A 4HATB 4ZRIA 3TCAA 2NZ8B 4IAPA 4GN1A 4EMOA 4HDQA 1OY2A 3D8EA 2COAA 1UPQA 5JP4A 5JLJB 2AL6A 2ELBA 3PG7A 2D10A 1MIZB 1I2HA 4HAZB 1QQGA 1TQZA 3SO6A 1W1HA 3P7ZA 1PMSA 2Q13A 2K2UA 3TVVA 2M38A 2CRFA 3ODOA 3SNHA 3ULBA 2D11A 3T06A 1I7AA 1V89A 3SYXA 2LULA 5LOPB 1IRSA 4A6KA 1M7RA 4YONA 4A5KA 2PZ1A 1V5PA 2P8VA 2DKPA 1WVHA 1MKEA 5C79A 4HHVA 4CYEA 1TXDA 3PVUA 1FHOA 4HB3B 1SGHA 4TYZA 3A98B 5KQ1A 5J3QA 2AEHA 2Z0QA 1QC6A 2Z0OA 1M7EA 2CODA 3TW1A 4NY0A 5D3YA 4HAVB 5C6RA 3OANA 2RSGA 2K2JA 3QBVB 3P6AA 2VSZA 2RUKB 2HE7A 5DH9B 3ODXA 1J0WA 1WI1A 1EGXA 2H7EA 1FGZA 3AU4A 1ISNA 1DBHA 3UZTA 2W2WA 2YT1A 4CHJA 3ML4A 3PZDA 1H4RA 4DBBA 1U5GA 2EC1A 2YVCA 2DYNA 1Q67A 1NU2A 1V61A 1U2BA 3PEGA 3SUZA 2IFSA 4A6FA 4DXAB 2LG1A 1V5MA 1FAOA 1P6SA 4K2PA 4Z2NA 5KQ4A 1FHXA 2KCJA 3BJIA 5CLLB 1U27A 1ZM0A 1GC7A 1KZ7A 1V88A 1UPRA 4A6FB 5DHFB 2P0HA 2J0MA 2Y7BA 4HAXB 3F5RA 3A8PA 2UZSA 4KHBB 2COCA 2XQNM 3MPXA 1WG7A 1MAIA 5DI9B 1PFJA 3PSCA 3CIKA 3RCPA 1DDVA 1EF1A 3DXDA 3KRXA 2Z0PA 4KAXB 2P0FA 2D9VA 2CAYA 2YT0A 2J59M 1AQCA 5LONB 4HAWB 2MDXA 4GZUA 4WVFB 2OQBA 2RGNB 4ZRJA 2P0DA 1EVHA 2I5CA 1ZC3B 1TJ6A 2DLWA 4ZRKA 2FJLA 4TKNA 5DHAB 1NTVA 1Z87A 2I1JA 1K5GB 1OQNA 2YSZA 1RJ2A 2E2XA 1U5DA 3U7DA 2D9YA 1Y19B 2DKQA 2J0KA 3WA0A 1Y5OA 3HK0A 5CLQB 5EFXA 2H7DA 3KY9A 3PP2A 4GMVA 3D8FA 2EMSA 4HB0B 5D3WA 1WGQA 2COFA 4YL8A 3QWMA 1FGYA 5HE3A 1BAKA 4HB4B 4C0AA 4MT7A 1ZSQA 5GOWB 2IYBA 5J3YA 2R0DA 2ADZA 1GC6A 3VIAA 2DX1A 2I5FA 3PVWA 4CHMA 5HE0A 1J19A 5KCVA 1V5UA 3GYPA 2YS3A 2GJYA 4KVGB 2GCJA 2NMBA 1XCGA 2DYQA 3FSSA 1OMWA 2Y8GA 3QIJA 4KHOA 1PLSA 3DXEA 4P7IA 2DHKA 4B6HA 1X1GA 2QKMA 5HE1A 1U29A 2ROZB 3VOQA 2KGXB 1WGUA 1UEFA 3D8DA 2OTXA 3AU5A 2HTHB 1K5DB 3CXBB 2RVBB 1W1DA 3KSYA 2JP2A 2D9XA 1UNPA 1ZC4B 3FM8C 2YF0A 2ELAA 1BTKA 4DX8A 3A8QA 1NI2A 1KI1B 2N23A 4XWXA 1BWNA 1SHCA 2UVMA 1WJMA 3TO1A 2RNRB 1MIXA 4BBKA 1LW3A 3AJ4A 4GMXB 1P3RA 1WJ1A 1FHWA 5FI0A 1GG3A 1MK7B 1KZGA 4KHAA 2W2XD 5J3TA 4A6HA 2D2QA 2Y8FA 3GYOA 3HW2B 1W1GA 1H10A 4K17A 4GXBA 4HB2B 1DDMA 3MDBC 2DA0A 3WYFB 2ROVA 4F7UP 3ULCA 4HAYB 1DDWA 4K2OA 1XKEA 4PQ0A 5JHHA 4H8SA 2KUPA 2J0JA 3ZVRA 4MY6A 1X05A 2D9WA 2MFQA 4PNKA 2BCJA 2DHIA 4IOYX 1P5TA 5D27A 4D0NB 5DIFB 1X1FA 3SV1A 4L6EA 5FI1A 5L81A 4HAUB 4F7GA 1RRPB 4WJ7A 2GS0A 2L2IA 1NTYA 3FEHA 1UNRA 1U5FA 2VRWB 2UZRA 2LYDA 2L1CA 4Z2MB 1U5EA 2D4QA 1B55A 3ZDTA 2YS1A 2YS5A
chains in the Genus database with same CATH superfamily
1FOEA 3DCXA 4QJ4B 4GPTB 3ODWA 2DFKA 1FB8A 3LJUX 2LOXA 3X23A 3IVFA 2VKIA 5C16A 1UNQA 1LB1A 4K81A 3HQCA 1X11A 2RLOA 1DROA 1XR0B 4MK0A 2X18A 4F7HA 4L1RA 2M14A 1BTNA 1XODA 3NSUA 3U8ZA 3O96A 5HE2A 2LOZA 3F0WA 1ZVRA 2DX5A 2CY5A 2DTCA 2ZPYA 2GCLA 4OSNA 1E5WA 1MK9B 3V5WA 2QKLA 3TFMA 4EJNA 2N0YA 4HDOA 2YRYA 2W2XC 4DX90 3BINA 1DYNA 1XX0A 4EKUA 2DHJA 3FVCA 5JHGA 2V76A 3KZ1A 3G9WA 5C5BA 5D3XA 3N7CA 2I1KA 1X86A 2EMTA 1MPHA 2K00A 2D9ZA 2LKOA 2DN6A 4IFSA 5D3VA 3DXCA 3M1IB 4WSFA 2MKRA 2CY4A 1AWEA 2KUQA 2EJ8A 1XD4A 1N3HA 2MWNB 4QJ3B 2G35A 1EAZA 4Y94A 5C5BB 4NSWA 2RRFA 3PVLA 3KRWA 2R09A 4HATB 4ZRIA 3TCAA 2NZ8B 4IAPA 4GN1A 4EMOA 4HDQA 1OY2A 2K8EA 3D8EA 2COAA 1UPQA 2Z13A 5JP4A 5JLJB 2AL6A 2ELBA 3PG7A 2D10A 1MIZB 1I2HA 4HAZB 1QQGA 1TQZA 3SO6A 1W1HA 3P7ZA 1PMSA 2Q13A 2K2UA 3TVVA 2M38A 4D6WA 2CRFA 3ODOA 3SNHA 3ULBA 2D11A 3T06A 2Z14A 1I7AA 1V89A 3SYXA 2LULA 5LOPB 1IRSA 4A6KA 1M7RA 4YONA 4A5KA 2PZ1A 1V5PA 2P8VA 2DKPA 1WVHA 1MKEA 5C79A 4HHVA 4CYEA 1TXDA 3PVUA 1FHOA 4HB3B 1SGHA 4TYZA 3A98B 5KQ1A 5J3QA 2AEHA 2Z0QA 1QC6A 2Z0OA 1M7EA 2CODA 3HIEA 3TW1A 4NY0A 5D3YA 4HAVB 3B77A 5C6RA 3OANA 2RSGA 2K2JA 3QBVB 3P6AA 2VSZA 2RUKB 2HE7A 5DH9B 3ODXA 1J0WA 1WI1A 1EGXA 2H7EA 1FGZA 3AU4A 1ISNA 1DBHA 3UZTA 2NBVA 2W2WA 2YT1A 3OHMB 4CHJA 3ML4A 3PZDA 1H4RA 4DBBA 1U5GA 2EC1A 2YVCA 2DYNA 2GUMA 1Q67A 1NU2A 1V61A 1U2BA 3PEGA 3SUZA 2IFSA 4A6FA 4DXAB 2LG1A 1V5MA 1FAOA 1P6SA 4K2PA 4KHBA 4Z2NA 5KQ4A 1FHXA 2KCJA 3BJIA 5CLLB 1U27A 3HSAA 1ZM0A 1GC7A 1KZ7A 1V88A 1UPRA 4A6FB 4OT1A 5DHFB 2P0HA 2J0MA 2Y7BA 4HAXB 3F5RA 3A8PA 1ZYIA 2KIEA 2UZSA 4QJ5B 4KHBB 2COCA 2XQNM 3MPXA 1WG7A 1MAIA 5DI9B 1PFJA 3PSCA 3CIKA 5I2MA 3RCPA 1DDVA 2KIGA 1EF1A 3DXDA 3KRXA 2Z0PA 4KAXB 2P0FA 2YT2A 2D9VA 2CAYA 2YT0A 2J59M 1AQCA 5LONB 4HAWB 2MDXA 4GZUA 4WVFB 4HSIA 2OQBA 2RGNB 4ZRJA 3A58A 2P0DA 1EVHA 2I5CA 1ZC3B 1TJ6A 2DLWA 4ZRKA 2FJLA 4TKNA 5DHAB 1NTVA 1Z87A 2I1JA 1K5GB 1OQNA 2YSZA 1RJ2A 2E2XA 1U5DA 3U7DA 2D9YA 1Y19B 2DKQA 2J0KA 3WA0A 1Y5OA 3HK0A 5CLQB 5EFXA 2H7DA 3KY9A 5M4YB 3PP2A 4GMVA 3D8FA 4GOUA 2EMSA 4HB0B 5D3WA 1WGQA 2COFA 4YL8A 3QWMA 1FGYA 5HE3A 1BAKA 4HB4B 4C0AA 4MT7A 1ZSQA 5GOWB 2IYBA 5J3YA 2R2YA 2R0DA 2ADZA 1GC6A 3VIAA 2DX1A 2I5FA 3PVWA 4CHMA 5HE0A 1J19A 2FJUB 5KCVA 1V5UA 3GYPA 2YS3A 5IRSA 2GJYA 4KVGB 2GCJA 2NMBA 3NWFA 1XCGA 2DYQA 3FSSA 1OMWA 2Y8GA 2Z4DA 3QIJA 4KHOA 2ZKMX 1PLSA 3DXEA 4P7IA 2DHKA 4B6HA 1X1GA 2QKMA 5HE1A 1U29A 2ROZB 3VOQA 2KGXB 1WGUA 1UEFA 3D8DA 2OTXA 3AU5A 2HTHB 1K5DB 5LG4B 3CXBB 2RVBB 1W1DA 3KSYA 2JP2A 2D9XA 1UNPA 1ZC4B 3FM8C 2YF0A 3NWAA 2ELAA 1BTKA 4DX8A 3A8QA 4QXAB 1MI1A 1NI2A 1KI1B 2N23A 4XWXA 1BWNA 1SHCA 2UVMA 1WJMA 4GNKB 3TO1A 2RNRB 1MIXA 4BBKA 1LW3A 3AJ4A 4GMXB 1P3RA 1WJ1A 1FHWA 5FI0A 1GG3A 1MK7B 1KZGA 4KHAA 2W2XD 5J3TA 4A6HA 2D2QA 3NW8A 2Y8FA 3GYOA 3HW2B 1W1GA 3NWDA 1H10A 4K17A 4GXBA 4HB2B 1DDMA 3MDBC 1T77A 2DA0A 3WYFB 2ROVA 4F7UP 3ULCA 4HAYB 1DDWA 4K2OA 1XKEA 4PQ0A 5JHHA 4H8SA 2KUPA 2J0JA 3ZVRA 4MY6A 1X05A 4DIXA 2D9WA 2MFQA 4PNKA 2BCJA 2DHIA 4IOYX 1P5TA 5D27A 4D0NB 5DIFB 1X1FA 3SV1A 4L6EA 5FI1A 4CSQA 4HAUB 5L81A 4F7GA 1RRPB 4WJ7A 2GS0A 2L2IA 1NTYA 3FEHA 1UNRA 1U5FA 2VRWB 2UZRA 2K49A 2LYDA 5I2SA 3U12A 2Z59A 2L1CA 2KR0A 4Z2MB 1U5EA 2D4QA 1B55A 3ZDTA 2YS1A 2YS5A
chains in the Genus database with same CATH topology
1FOEA 4GPTB 3ODWA 2DFKA 1FB8A 3LJUX 2LOXA 3X23A 3IVFA 2VKIA 5C16A 1UNQA 1LB1A 4K81A 3HQCA 1X11A 2RLOA 1DROA 1XR0B 4MK0A 2X18A 4F7HA 2M14A 1BTNA 1XODA 3NSUA 3U8ZA 3O96A 5HE2A 2LOZA 3F0WA 1ZVRA 2DX5A 2CY5A 2DTCA 2ZPYA 2GCLA 1E5WA 1MK9B 3V5WA 2QKLA 3TFMA 4EJNA 2N0YA 4HDOA 2YRYA 2W2XC 4DX90 3BINA 1DYNA 1XX0A 4EKUA 2DHJA 5JHGA 2V76A 3KZ1A 3G9WA 5C5BA 5D3XA 3N7CA 2I1KA 1X86A 2EMTA 1MPHA 2K00A 2D9ZA 2LKOA 2DN6A 4IFSA 5D3VA 3DXCA 3M1IB 4WSFA 2MKRA 2CY4A 1AWEA 2EJ8A 1XD4A 1N3HA 2MWNB 2G35A 1EAZA 4Y94A 5C5BB 4NSWA 3PVLA 3KRWA 2R09A 4HATB 4ZRIA 3TCAA 2NZ8B 4IAPA 4GN1A 4EMOA 4HDQA 1OY2A 3D8EA 2COAA 1UPQA 5JP4A 5JLJB 2AL6A 2ELBA 3PG7A 2D10A 1MIZB 1I2HA 4HAZB 1QQGA 1TQZA 3SO6A 1W1HA 3P7ZA 1PMSA 2Q13A 2K2UA 3TVVA 2M38A 2CRFA 3ODOA 3SNHA 3ULBA 2D11A 3T06A 1I7AA 1V89A 3SYXA 2LULA 5LOPB 1IRSA 4A6KA 1M7RA 4YONA 4A5KA 2PZ1A 1V5PA 2P8VA 2DKPA 1WVHA 1MKEA 5C79A 4HHVA 4CYEA 1TXDA 3PVUA 1FHOA 4HB3B 1SGHA 4TYZA 3A98B 5KQ1A 5J3QA 2AEHA 2Z0QA 1QC6A 2Z0OA 1M7EA 2CODA 3TW1A 4NY0A 5D3YA 4HAVB 5C6RA 3OANA 2RSGA 2K2JA 3QBVB 3P6AA 2VSZA 2RUKB 2HE7A 5DH9B 3ODXA 1J0WA 1WI1A 1EGXA 2H7EA 1FGZA 3AU4A 1ISNA 1DBHA 3UZTA 2W2WA 2YT1A 4CHJA 3ML4A 3PZDA 1H4RA 4DBBA 1U5GA 2EC1A 2YVCA 2DYNA 1Q67A 1NU2A 1V61A 1U2BA 3PEGA 3SUZA 2IFSA 4A6FA 4DXAB 2LG1A 1V5MA 1FAOA 1P6SA 4K2PA 4Z2NA 5KQ4A 1FHXA 2KCJA 3BJIA 5CLLB 1U27A 1ZM0A 1GC7A 1KZ7A 1V88A 1UPRA 4A6FB 5DHFB 2P0HA 2J0MA 2Y7BA 4HAXB 3F5RA 3A8PA 2UZSA 4KHBB 2COCA 2XQNM 3MPXA 1WG7A 1MAIA 5DI9B 1PFJA 3PSCA 3CIKA 3RCPA 1DDVA 1EF1A 3DXDA 3KRXA 2Z0PA 4KAXB 2P0FA 2D9VA 2CAYA 2YT0A 2J59M 1AQCA 5LONB 4HAWB 2MDXA 4GZUA 4WVFB 2OQBA 2RGNB 4ZRJA 2P0DA 1EVHA 2I5CA 1ZC3B 1TJ6A 2DLWA 4ZRKA 2FJLA 4TKNA 5DHAB 1NTVA 1Z87A 2I1JA 1K5GB 1OQNA 2YSZA 1RJ2A 2E2XA 1U5DA 3U7DA 2D9YA 1Y19B 2DKQA 2J0KA 3WA0A 1Y5OA 3HK0A 5CLQB 5EFXA 2H7DA 3KY9A 3PP2A 4GMVA 3D8FA 2EMSA 4HB0B 5D3WA 1WGQA 2COFA 4YL8A 3QWMA 1FGYA 5HE3A 1BAKA 4HB4B 4C0AA 4MT7A 1ZSQA 5GOWB 2IYBA 5J3YA 2R0DA 2ADZA 1GC6A 3VIAA 2DX1A 2I5FA 3PVWA 4CHMA 5HE0A 1J19A 5KCVA 1V5UA 3GYPA 2YS3A 2GJYA 4KVGB 2GCJA 2NMBA 1XCGA 2DYQA 3FSSA 1OMWA 2Y8GA 3QIJA 4KHOA 1PLSA 3DXEA 4P7IA 2DHKA 4B6HA 1X1GA 2QKMA 5HE1A 1U29A 2ROZB 3VOQA 2KGXB 1WGUA 1UEFA 3D8DA 2OTXA 3AU5A 2HTHB 1K5DB 3CXBB 2RVBB 1W1DA 3KSYA 2JP2A 2D9XA 1UNPA 1ZC4B 3FM8C 2YF0A 2ELAA 1BTKA 4DX8A 3A8QA 1NI2A 1KI1B 2N23A 4XWXA 1BWNA 1SHCA 2UVMA 1WJMA 3TO1A 2RNRB 1MIXA 4BBKA 1LW3A 3AJ4A 4GMXB 1P3RA 1WJ1A 1FHWA 5FI0A 1GG3A 1MK7B 1KZGA 4KHAA 2W2XD 5J3TA 4A6HA 2D2QA 2Y8FA 3GYOA 3HW2B 1W1GA 1H10A 4K17A 4GXBA 4HB2B 1DDMA 3MDBC 2DA0A 3WYFB 2ROVA 4F7UP 3ULCA 4HAYB 1DDWA 4K2OA 1XKEA 4PQ0A 5JHHA 4H8SA 2KUPA 2J0JA 3ZVRA 4MY6A 1X05A 2D9WA 2MFQA 4PNKA 2BCJA 2DHIA 4IOYX 1P5TA 5D27A 4D0NB 5DIFB 1X1FA 3SV1A 4L6EA 5FI1A 5L81A 4HAUB 4F7GA 1RRPB 4WJ7A 2GS0A 2L2IA 1NTYA 3FEHA 1UNRA 1U5FA 2VRWB 2UZRA 2LYDA 2L1CA 4Z2MB 1U5EA 2D4QA 1B55A 3ZDTA 2YS1A 2YS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FOE A;  4GPT B;  3ODW A;  2DFK A;  1FB8 A;  3LJU X;  2LOX A;  3X23 A;  3IVF A;  2VKI A;  5C16 A;  1UNQ A;  1LB1 A;  4K81 A;  3HQC A;  1X11 A;  2RLO A;  1DRO A;  1XR0 B;  4MK0 A;  2X18 A;  4F7H A;  2M14 A;  1BTN A;  1XOD A;  3NSU A;  3U8Z A;  3O96 A;  5HE2 A;  2LOZ A;  3F0W A;  1ZVR A;  2DX5 A;  2CY5 A;  2DTC A;  2ZPY A;  2GCL A;  1E5W A;  1MK9 B;  3V5W A;  2QKL A;  3TFM A;  4EJN A;  2N0Y A;  4HDO A;  2YRY A;  2W2X C;  4DX9 0;  3BIN A;  1DYN A;  1XX0 A;  4EKU A;  2DHJ A;  5JHG A;  2V76 A;  3KZ1 A;  3G9W A;  5C5B A;  5D3X A;  3N7C A;  2I1K A;  1X86 A;  2EMT A;  1MPH A;  2K00 A;  2D9Z A;  2LKO A;  2DN6 A;  4IFS A;  5D3V A;  3DXC A;  3M1I B;  4WSF A;  2MKR A;  2CY4 A;  1AWE A;  2EJ8 A;  1XD4 A;  1N3H A;  2MWN B;  2G35 A;  1EAZ A;  4Y94 A;  5C5B B;  4NSW A;  3PVL A;  3KRW A;  2R09 A;  4HAT B;  4ZRI A;  3TCA A;  2NZ8 B;  4IAP A;  4GN1 A;  4EMO A;  4HDQ A;  1OY2 A;  3D8E A;  2COA A;  1UPQ A;  5JP4 A;  5JLJ B;  2AL6 A;  2ELB A;  3PG7 A;  2D10 A;  1MIZ B;  1I2H A;  4HAZ B;  1QQG A;  1TQZ A;  3SO6 A;  1W1H A;  3P7Z A;  1PMS A;  2Q13 A;  2K2U A;  3TVV A;  2M38 A;  2CRF A;  3ODO A;  3SNH A;  3ULB A;  2D11 A;  3T06 A;  1I7A A;  1V89 A;  3SYX A;  2LUL A;  5LOP B;  1IRS A;  4A6K A;  1M7R A;  4YON A;  4A5K A;  2PZ1 A;  1V5P A;  2P8V A;  2DKP A;  1WVH A;  1MKE A;  5C79 A;  4HHV A;  4CYE A;  1TXD A;  3PVU A;  1FHO A;  4HB3 B;  1SGH A;  4TYZ A;  3A98 B;  5KQ1 A;  5J3Q A;  2AEH A;  2Z0Q A;  1QC6 A;  2Z0O A;  1M7E A;  2COD A;  3TW1 A;  4NY0 A;  5D3Y A;  4HAV B;  5C6R A;  3OAN A;  2RSG A;  2K2J A;  3QBV B;  3P6A A;  2VSZ A;  2RUK B;  2HE7 A;  5DH9 B;  3ODX A;  1J0W A;  1WI1 A;  1EGX A;  2H7E A;  1FGZ A;  3AU4 A;  1ISN A;  1DBH A;  3UZT A;  2W2W A;  2YT1 A;  4CHJ A;  3ML4 A;  3PZD A;  1H4R A;  4DBB A;  1U5G A;  2EC1 A;  2YVC A;  2DYN A;  1Q67 A;  1NU2 A;  1V61 A;  1U2B A;  3PEG A;  3SUZ A;  2IFS A;  4A6F A;  4DXA B;  2LG1 A;  1V5M A;  1FAO A;  1P6S A;  4K2P A;  4Z2N A;  5KQ4 A;  1FHX A;  2KCJ A;  3BJI A;  5CLL B;  1U27 A;  1ZM0 A;  1GC7 A;  1KZ7 A;  1V88 A;  1UPR A;  4A6F B;  5DHF B;  2P0H A;  2J0M A;  2Y7B A;  4HAX B;  3F5R A;  3A8P A;  2UZS A;  4KHB B;  2COC A;  2XQN M;  3MPX A;  1WG7 A;  1MAI A;  5DI9 B;  1PFJ A;  3PSC A;  3CIK A;  3RCP A;  1DDV A;  1EF1 A;  3DXD A;  3KRX A;  2Z0P A;  4KAX B;  2P0F A;  2D9V A;  2CAY A;  2YT0 A;  2J59 M;  1AQC A;  5LON B;  4HAW B;  2MDX A;  4GZU A;  4WVF B;  2OQB A;  2RGN B;  4ZRJ A;  2P0D A;  1EVH A;  2I5C A;  1ZC3 B;  1TJ6 A;  2DLW A;  4ZRK A;  2FJL A;  4TKN A;  5DHA B;  1NTV A;  1Z87 A;  2I1J A;  1K5G B;  1OQN A;  2YSZ A;  1RJ2 A;  2E2X A;  1U5D A;  3U7D A;  2D9Y A;  1Y19 B;  2DKQ A;  2J0K A;  3WA0 A;  1Y5O A;  3HK0 A;  5CLQ B;  5EFX A;  2H7D A;  3KY9 A;  3PP2 A;  4GMV A;  3D8F A;  2EMS A;  4HB0 B;  5D3W A;  1WGQ A;  2COF A;  4YL8 A;  3QWM A;  1FGY A;  5HE3 A;  1BAK A;  4HB4 B;  4C0A A;  4MT7 A;  1ZSQ A;  5GOW B;  2IYB A;  5J3Y A;  2R0D A;  2ADZ A;  1GC6 A;  3VIA A;  2DX1 A;  2I5F A;  3PVW A;  4CHM A;  5HE0 A;  1J19 A;  5KCV A;  1V5U A;  3GYP A;  2YS3 A;  2GJY A;  4KVG B;  2GCJ A;  2NMB A;  1XCG A;  2DYQ A;  3FSS A;  1OMW A;  2Y8G A;  3QIJ A;  4KHO A;  1PLS A;  3DXE A;  4P7I A;  2DHK A;  4B6H A;  1X1G A;  2QKM A;  5HE1 A;  1U29 A;  2ROZ B;  3VOQ A;  2KGX B;  1WGU A;  1UEF A;  3D8D A;  2OTX A;  3AU5 A;  2HTH B;  1K5D B;  3CXB B;  2RVB B;  1W1D A;  3KSY A;  2JP2 A;  2D9X A;  1UNP A;  1ZC4 B;  3FM8 C;  2YF0 A;  2ELA A;  1BTK A;  4DX8 A;  3A8Q A;  1NI2 A;  1KI1 B;  2N23 A;  4XWX A;  1BWN A;  1SHC A;  2UVM A;  1WJM A;  3TO1 A;  2RNR B;  1MIX A;  4BBK A;  1LW3 A;  3AJ4 A;  4GMX B;  1P3R A;  1WJ1 A;  1FHW A;  5FI0 A;  1GG3 A;  1MK7 B;  1KZG A;  4KHA A;  2W2X D;  5J3T A;  4A6H A;  2D2Q A;  2Y8F A;  3GYO A;  3HW2 B;  1W1G A;  1H10 A;  4K17 A;  4GXB A;  4HB2 B;  1DDM A;  3MDB C;  2DA0 A;  3WYF B;  2ROV A;  4F7U P;  3ULC A;  4HAY B;  1DDW A;  4K2O A;  1XKE A;  4PQ0 A;  5JHH A;  4H8S A;  2KUP A;  2J0J A;  3ZVR A;  4MY6 A;  1X05 A;  2D9W A;  2MFQ A;  4PNK A;  2BCJ A;  2DHI A;  4IOY X;  1P5T A;  5D27 A;  4D0N B;  5DIF B;  1X1F A;  3SV1 A;  4L6E A;  5FI1 A;  5L81 A;  4HAU B;  4F7G A;  1RRP B;  4WJ7 A;  2GS0 A;  2L2I A;  1NTY A;  3FEH A;  1UNR A;  1U5F A;  2VRW B;  2UZR A;  2LYD A;  2L1C A;  4Z2M B;  1U5E A;  2D4Q A;  1B55 A;  3ZDT A;  2YS1 A;  2YS5 A; 
#chains in the Genus database with same CATH topology
 1FOE A;  3DCX A;  4QJ4 B;  4GPT B;  3ODW A;  2DFK A;  1FB8 A;  3LJU X;  2LOX A;  3X23 A;  3IVF A;  2VKI A;  5C16 A;  1UNQ A;  1LB1 A;  4K81 A;  3HQC A;  1X11 A;  2RLO A;  1DRO A;  1XR0 B;  4MK0 A;  2X18 A;  4F7H A;  4L1R A;  2M14 A;  1BTN A;  1XOD A;  3NSU A;  3U8Z A;  3O96 A;  5HE2 A;  2LOZ A;  3F0W A;  1ZVR A;  2DX5 A;  2CY5 A;  2DTC A;  2ZPY A;  2GCL A;  4OSN A;  1E5W A;  1MK9 B;  3V5W A;  2QKL A;  3TFM A;  4EJN A;  2N0Y A;  4HDO A;  2YRY A;  2W2X C;  4DX9 0;  3BIN A;  1DYN A;  1XX0 A;  4EKU A;  2DHJ A;  3FVC A;  5JHG A;  2V76 A;  3KZ1 A;  3G9W A;  5C5B A;  5D3X A;  3N7C A;  2I1K A;  1X86 A;  2EMT A;  1MPH A;  2K00 A;  2D9Z A;  2LKO A;  2DN6 A;  4IFS A;  5D3V A;  3DXC A;  3M1I B;  4WSF A;  2MKR A;  2CY4 A;  1AWE A;  2KUQ A;  2EJ8 A;  1XD4 A;  1N3H A;  2MWN B;  4QJ3 B;  2G35 A;  1EAZ A;  4Y94 A;  5C5B B;  4NSW A;  2RRF A;  3PVL A;  3KRW A;  2R09 A;  4HAT B;  4ZRI A;  3TCA A;  2NZ8 B;  4IAP A;  4GN1 A;  4EMO A;  4HDQ A;  1OY2 A;  2K8E A;  3D8E A;  2COA A;  1UPQ A;  2Z13 A;  5JP4 A;  5JLJ B;  2AL6 A;  2ELB A;  3PG7 A;  2D10 A;  1MIZ B;  1I2H A;  4HAZ B;  1QQG A;  1TQZ A;  3SO6 A;  1W1H A;  3P7Z A;  1PMS A;  2Q13 A;  2K2U A;  3TVV A;  2M38 A;  4D6W A;  2CRF A;  3ODO A;  3SNH A;  3ULB A;  2D11 A;  3T06 A;  2Z14 A;  1I7A A;  1V89 A;  3SYX A;  2LUL A;  5LOP B;  1IRS A;  4A6K A;  1M7R A;  4YON A;  4A5K A;  2PZ1 A;  1V5P A;  2P8V A;  2DKP A;  1WVH A;  1MKE A;  5C79 A;  4HHV A;  4CYE A;  1TXD A;  3PVU A;  1FHO A;  4HB3 B;  1SGH A;  4TYZ A;  3A98 B;  5KQ1 A;  5J3Q A;  2AEH A;  2Z0Q A;  1QC6 A;  2Z0O A;  1M7E A;  2COD A;  3HIE A;  3TW1 A;  4NY0 A;  5D3Y A;  4HAV B;  3B77 A;  5C6R A;  3OAN A;  2RSG A;  2K2J A;  3QBV B;  3P6A A;  2VSZ A;  2RUK B;  2HE7 A;  5DH9 B;  3ODX A;  1J0W A;  1WI1 A;  1EGX A;  2H7E A;  1FGZ A;  3AU4 A;  1ISN A;  1DBH A;  3UZT A;  2NBV A;  2W2W A;  2YT1 A;  3OHM B;  4CHJ A;  3ML4 A;  3PZD A;  1H4R A;  4DBB A;  1U5G A;  2EC1 A;  2YVC A;  2DYN A;  2GUM A;  1Q67 A;  1NU2 A;  1V61 A;  1U2B A;  3PEG A;  3SUZ A;  2IFS A;  4A6F A;  4DXA B;  2LG1 A;  1V5M A;  1FAO A;  1P6S A;  4K2P A;  4KHB A;  4Z2N A;  5KQ4 A;  1FHX A;  2KCJ A;  3BJI A;  5CLL B;  1U27 A;  3HSA A;  1ZM0 A;  1GC7 A;  1KZ7 A;  1V88 A;  1UPR A;  4A6F B;  4OT1 A;  5DHF B;  2P0H A;  2J0M A;  2Y7B A;  4HAX B;  3F5R A;  3A8P A;  1ZYI A;  2KIE A;  2UZS A;  4QJ5 B;  4KHB B;  2COC A;  2XQN M;  3MPX A;  1WG7 A;  1MAI A;  5DI9 B;  1PFJ A;  3PSC A;  3CIK A;  5I2M A;  3RCP A;  1DDV A;  2KIG A;  1EF1 A;  3DXD A;  3KRX A;  2Z0P A;  4KAX B;  2P0F A;  2YT2 A;  2D9V A;  2CAY A;  2YT0 A;  2J59 M;  1AQC A;  5LON B;  4HAW B;  2MDX A;  4GZU A;  4WVF B;  4HSI A;  2OQB A;  2RGN B;  4ZRJ A;  3A58 A;  2P0D A;  1EVH A;  2I5C A;  1ZC3 B;  1TJ6 A;  2DLW A;  4ZRK A;  2FJL A;  4TKN A;  5DHA B;  1NTV A;  1Z87 A;  2I1J A;  1K5G B;  1OQN A;  2YSZ A;  1RJ2 A;  2E2X A;  1U5D A;  3U7D A;  2D9Y A;  1Y19 B;  2DKQ A;  2J0K A;  3WA0 A;  1Y5O A;  3HK0 A;  5CLQ B;  5EFX A;  2H7D A;  3KY9 A;  5M4Y B;  3PP2 A;  4GMV A;  3D8F A;  4GOU A;  2EMS A;  4HB0 B;  5D3W A;  1WGQ A;  2COF A;  4YL8 A;  3QWM A;  1FGY A;  5HE3 A;  1BAK A;  4HB4 B;  4C0A A;  4MT7 A;  1ZSQ A;  5GOW B;  2IYB A;  5J3Y A;  2R2Y A;  2R0D A;  2ADZ A;  1GC6 A;  3VIA A;  2DX1 A;  2I5F A;  3PVW A;  4CHM A;  5HE0 A;  1J19 A;  2FJU B;  5KCV A;  1V5U A;  3GYP A;  2YS3 A;  5IRS A;  2GJY A;  4KVG B;  2GCJ A;  2NMB A;  3NWF A;  1XCG A;  2DYQ A;  3FSS A;  1OMW A;  2Y8G A;  2Z4D A;  3QIJ A;  4KHO A;  2ZKM X;  1PLS A;  3DXE A;  4P7I A;  2DHK A;  4B6H A;  1X1G A;  2QKM A;  5HE1 A;  1U29 A;  2ROZ B;  3VOQ A;  2KGX B;  1WGU A;  1UEF A;  3D8D A;  2OTX A;  3AU5 A;  2HTH B;  1K5D B;  5LG4 B;  3CXB B;  2RVB B;  1W1D A;  3KSY A;  2JP2 A;  2D9X A;  1UNP A;  1ZC4 B;  3FM8 C;  2YF0 A;  3NWA A;  2ELA A;  1BTK A;  4DX8 A;  3A8Q A;  4QXA B;  1MI1 A;  1NI2 A;  1KI1 B;  2N23 A;  4XWX A;  1BWN A;  1SHC A;  2UVM A;  1WJM A;  4GNK B;  3TO1 A;  2RNR B;  1MIX A;  4BBK A;  1LW3 A;  3AJ4 A;  4GMX B;  1P3R A;  1WJ1 A;  1FHW A;  5FI0 A;  1GG3 A;  1MK7 B;  1KZG A;  4KHA A;  2W2X D;  5J3T A;  4A6H A;  2D2Q A;  3NW8 A;  2Y8F A;  3GYO A;  3HW2 B;  1W1G A;  3NWD A;  1H10 A;  4K17 A;  4GXB A;  4HB2 B;  1DDM A;  3MDB C;  1T77 A;  2DA0 A;  3WYF B;  2ROV A;  4F7U P;  3ULC A;  4HAY B;  1DDW A;  4K2O A;  1XKE A;  4PQ0 A;  5JHH A;  4H8S A;  2KUP A;  2J0J A;  3ZVR A;  4MY6 A;  1X05 A;  4DIX A;  2D9W A;  2MFQ A;  4PNK A;  2BCJ A;  2DHI A;  4IOY X;  1P5T A;  5D27 A;  4D0N B;  5DIF B;  1X1F A;  3SV1 A;  4L6E A;  5FI1 A;  4CSQ A;  4HAU B;  5L81 A;  4F7G A;  1RRP B;  4WJ7 A;  2GS0 A;  2L2I A;  1NTY A;  3FEH A;  1UNR A;  1U5F A;  2VRW B;  2UZR A;  2K49 A;  2LYD A;  5I2S A;  3U12 A;  2Z59 A;  2L1C A;  2KR0 A;  4Z2M B;  1U5E A;  2D4Q A;  1B55 A;  3ZDT A;  2YS1 A;  2YS5 A; 
#chains in the Genus database with same CATH homology
 1FOE A;  4GPT B;  3ODW A;  2DFK A;  1FB8 A;  3LJU X;  2LOX A;  3X23 A;  3IVF A;  2VKI A;  5C16 A;  1UNQ A;  1LB1 A;  4K81 A;  3HQC A;  1X11 A;  2RLO A;  1DRO A;  1XR0 B;  4MK0 A;  2X18 A;  4F7H A;  2M14 A;  1BTN A;  1XOD A;  3NSU A;  3U8Z A;  3O96 A;  5HE2 A;  2LOZ A;  3F0W A;  1ZVR A;  2DX5 A;  2CY5 A;  2DTC A;  2ZPY A;  2GCL A;  1E5W A;  1MK9 B;  3V5W A;  2QKL A;  3TFM A;  4EJN A;  2N0Y A;  4HDO A;  2YRY A;  2W2X C;  4DX9 0;  3BIN A;  1DYN A;  1XX0 A;  4EKU A;  2DHJ A;  5JHG A;  2V76 A;  3KZ1 A;  3G9W A;  5C5B A;  5D3X A;  3N7C A;  2I1K A;  1X86 A;  2EMT A;  1MPH A;  2K00 A;  2D9Z A;  2LKO A;  2DN6 A;  4IFS A;  5D3V A;  3DXC A;  3M1I B;  4WSF A;  2MKR A;  2CY4 A;  1AWE A;  2EJ8 A;  1XD4 A;  1N3H A;  2MWN B;  2G35 A;  1EAZ A;  4Y94 A;  5C5B B;  4NSW A;  3PVL A;  3KRW A;  2R09 A;  4HAT B;  4ZRI A;  3TCA A;  2NZ8 B;  4IAP A;  4GN1 A;  4EMO A;  4HDQ A;  1OY2 A;  3D8E A;  2COA A;  1UPQ A;  5JP4 A;  5JLJ B;  2AL6 A;  2ELB A;  3PG7 A;  2D10 A;  1MIZ B;  1I2H A;  4HAZ B;  1QQG A;  1TQZ A;  3SO6 A;  1W1H A;  3P7Z A;  1PMS A;  2Q13 A;  2K2U A;  3TVV A;  2M38 A;  2CRF A;  3ODO A;  3SNH A;  3ULB A;  2D11 A;  3T06 A;  1I7A A;  1V89 A;  3SYX A;  2LUL A;  5LOP B;  1IRS A;  4A6K A;  1M7R A;  4YON A;  4A5K A;  2PZ1 A;  1V5P A;  2P8V A;  2DKP A;  1WVH A;  1MKE A;  5C79 A;  4HHV A;  4CYE A;  1TXD A;  3PVU A;  1FHO A;  4HB3 B;  1SGH A;  4TYZ A;  3A98 B;  5KQ1 A;  5J3Q A;  2AEH A;  2Z0Q A;  1QC6 A;  2Z0O A;  1M7E A;  2COD A;  3TW1 A;  4NY0 A;  5D3Y A;  4HAV B;  5C6R A;  3OAN A;  2RSG A;  2K2J A;  3QBV B;  3P6A A;  2VSZ A;  2RUK B;  2HE7 A;  5DH9 B;  3ODX A;  1J0W A;  1WI1 A;  1EGX A;  2H7E A;  1FGZ A;  3AU4 A;  1ISN A;  1DBH A;  3UZT A;  2W2W A;  2YT1 A;  4CHJ A;  3ML4 A;  3PZD A;  1H4R A;  4DBB A;  1U5G A;  2EC1 A;  2YVC A;  2DYN A;  1Q67 A;  1NU2 A;  1V61 A;  1U2B A;  3PEG A;  3SUZ A;  2IFS A;  4A6F A;  4DXA B;  2LG1 A;  1V5M A;  1FAO A;  1P6S A;  4K2P A;  4Z2N A;  5KQ4 A;  1FHX A;  2KCJ A;  3BJI A;  5CLL B;  1U27 A;  1ZM0 A;  1GC7 A;  1KZ7 A;  1V88 A;  1UPR A;  4A6F B;  5DHF B;  2P0H A;  2J0M A;  2Y7B A;  4HAX B;  3F5R A;  3A8P A;  2UZS A;  4KHB B;  2COC A;  2XQN M;  3MPX A;  1WG7 A;  1MAI A;  5DI9 B;  1PFJ A;  3PSC A;  3CIK A;  3RCP A;  1DDV A;  1EF1 A;  3DXD A;  3KRX A;  2Z0P A;  4KAX B;  2P0F A;  2D9V A;  2CAY A;  2YT0 A;  2J59 M;  1AQC A;  5LON B;  4HAW B;  2MDX A;  4GZU A;  4WVF B;  2OQB A;  2RGN B;  4ZRJ A;  2P0D A;  1EVH A;  2I5C A;  1ZC3 B;  1TJ6 A;  2DLW A;  4ZRK A;  2FJL A;  4TKN A;  5DHA B;  1NTV A;  1Z87 A;  2I1J A;  1K5G B;  1OQN A;  2YSZ A;  1RJ2 A;  2E2X A;  1U5D A;  3U7D A;  2D9Y A;  1Y19 B;  2DKQ A;  2J0K A;  3WA0 A;  1Y5O A;  3HK0 A;  5CLQ B;  5EFX A;  2H7D A;  3KY9 A;  3PP2 A;  4GMV A;  3D8F A;  2EMS A;  4HB0 B;  5D3W A;  1WGQ A;  2COF A;  4YL8 A;  3QWM A;  1FGY A;  5HE3 A;  1BAK A;  4HB4 B;  4C0A A;  4MT7 A;  1ZSQ A;  5GOW B;  2IYB A;  5J3Y A;  2R0D A;  2ADZ A;  1GC6 A;  3VIA A;  2DX1 A;  2I5F A;  3PVW A;  4CHM A;  5HE0 A;  1J19 A;  5KCV A;  1V5U A;  3GYP A;  2YS3 A;  2GJY A;  4KVG B;  2GCJ A;  2NMB A;  1XCG A;  2DYQ A;  3FSS A;  1OMW A;  2Y8G A;  3QIJ A;  4KHO A;  1PLS A;  3DXE A;  4P7I A;  2DHK A;  4B6H A;  1X1G A;  2QKM A;  5HE1 A;  1U29 A;  2ROZ B;  3VOQ A;  2KGX B;  1WGU A;  1UEF A;  3D8D A;  2OTX A;  3AU5 A;  2HTH B;  1K5D B;  3CXB B;  2RVB B;  1W1D A;  3KSY A;  2JP2 A;  2D9X A;  1UNP A;  1ZC4 B;  3FM8 C;  2YF0 A;  2ELA A;  1BTK A;  4DX8 A;  3A8Q A;  1NI2 A;  1KI1 B;  2N23 A;  4XWX A;  1BWN A;  1SHC A;  2UVM A;  1WJM A;  3TO1 A;  2RNR B;  1MIX A;  4BBK A;  1LW3 A;  3AJ4 A;  4GMX B;  1P3R A;  1WJ1 A;  1FHW A;  5FI0 A;  1GG3 A;  1MK7 B;  1KZG A;  4KHA A;  2W2X D;  5J3T A;  4A6H A;  2D2Q A;  2Y8F A;  3GYO A;  3HW2 B;  1W1G A;  1H10 A;  4K17 A;  4GXB A;  4HB2 B;  1DDM A;  3MDB C;  2DA0 A;  3WYF B;  2ROV A;  4F7U P;  3ULC A;  4HAY B;  1DDW A;  4K2O A;  1XKE A;  4PQ0 A;  5JHH A;  4H8S A;  2KUP A;  2J0J A;  3ZVR A;  4MY6 A;  1X05 A;  2D9W A;  2MFQ A;  4PNK A;  2BCJ A;  2DHI A;  4IOY X;  1P5T A;  5D27 A;  4D0N B;  5DIF B;  1X1F A;  3SV1 A;  4L6E A;  5FI1 A;  5L81 A;  4HAU B;  4F7G A;  1RRP B;  4WJ7 A;  2GS0 A;  2L2I A;  1NTY A;  3FEH A;  1UNR A;  1U5F A;  2VRW B;  2UZR A;  2LYD A;  2L1C A;  4Z2M B;  1U5E A;  2D4Q A;  1B55 A;  3ZDT A;  2YS1 A;  2YS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...