2P0FA

Arhgap9 ph domain in complex with ins(1,3,5)p3
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
b'SHEVEKSGLLNMTKIAQGGRKLRKNWGPSWVVLTGNSLVFYREPPPTAPSSGWGPAGSRPESSVDLRGAALAHGRHLSSRRNVLHIRTIPGHEFLLQSDHETELRAWHRALRTVIERLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rho GTPase-activating protein 9
publication title Non-canonical Interaction of Phosphoinositides with Pleckstrin Homology Domains of Tiam1 and ArhGAP9.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligand binding protein
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2p0fA00
3HW2B 2VRWB 2D2QA 5HE1A 3ZVRA 3RCPA 1MIZB 5KQ4A 3D8EA 1J19A 3P6AA 2YVCA 5D3YA 2LKOA 2NMBA 1FAOA 2IYBA 3VIAA 2YS1A 2ELBA 2I5FA 1V5PA 4K81A 2GJYA 1RRPB 2D4QA 4KHAA 5DIFB 4DBBA 2ZPYA 1FB8A 1B55A 2LG1A 2DLWA 3VOQA 3KY9A 1UNPA 2ROVA 4GPTB 5GOWB 5JHHA 3BINA 3X23A 2X18A 1U2BA 1OY2A 2CY5A 1UPRA 2P0DA 1NU2A 4TKNA 4Z2MB 4NSWA 4A6FA 1NTVA 3G9WA 2UVMA 3U8ZA 2CODA 2D9YA 3F5RA 2MFQA 4KHBB 2DHIA 4GMXB 1GC6A 3D8FA 4EMOA 4DXAB 3ULCA 2Z0OA 4A6KA 2I1JA 1ZC3B 4HB3B 1P3RA 1TJ6A 3O96A 3D8DA 3AU4A 2D9VA 2P0HA 4EJNA 2I5CA 1UEFA 2UZSA 1V89A 4GZUA 3DXDA 5J3TA 1IRSA 1GG3A 1WGQA 2P8VA 2LULA 2YT1A 2K2UA 2PZ1A 1X1GA 2Q13A 2J59M 1X86A 1ZSQA 4HAYB 4GN1A 5DI9B 1WVHA 2I1KA 3TO1A 4ZRJA 1BAKA 1GC7A 2QKMA 2XQNM 1U27A 4HDOA 1WG7A 1ZVRA 2EC1A 2DYNA 2RVBB 3ZDTA 5HE0A 3KRXA 2BCJA 1N3HA 2V76A 4HAXB 1BWNA 2D9ZA 3ODOA 2EJ8A 1Q67A 2DA0A 1DDWA 3PVWA 1W1GA 2RUKB 2JP2A 5LONB 1XKEA 3QWMA 2Y7BA 2DN6A 4HDQA 1BTNA 4F7HA 5L81A 5FI1A 2L2IA 2AEHA 2K00A 1V88A 2VSZA 2W2XD 2COFA 1KZGA 2M38A 5D3XA 1V5UA 5DHFB 3N7CA 5HE2A 3A8PA 2K2JA 1MK7B 1MAIA 2Y8FA 1PMSA 1X05A 2RNRB 4HAWB 4YL8A 1XX0A 2DFKA 2OQBA 4DX90 1EVHA 2LYDA 4H8SA 1ZM0A 2KUPA 5JHGA 3KZ1A 5DHAB 4A6HA 3A98B 1WJMA 1Y19B 5HE3A 2DTCA 5D27A 1XR0B 1EF1A 4HB0B 1SGHA 3SYXA 2DKQA 3WA0A 2YT0A 5C79A 3TVVA 4B6HA 2YF0A 3PSCA 2ELAA 5D3WA 1XD4A 4WVFB 3ODWA 4BBKA 1ISNA 2DHJA 1J0WA 1WI1A 2YRYA 2E2XA 2YS5A 4NY0A 1K5GB 5JP4A 4PQ0A 5LOPB 3A8QA 2J0JA 1DYNA 2CAYA 1H10A 3FEHA 3U7DA 5KQ1A 4HAVB 1RJ2A 1X1FA 5C5BA 3CXBB 1H4RA 3M1IB 2G35A 5C6RA 1QQGA 1AQCA 1EAZA 1NTYA 4P7IA 1WGUA 1FGYA 3PP2A 3QIJA 1E5WA 5KCVA 3CIKA 3NSUA 2COAA 4Y94A 2H7EA 3MDBC 1M7RA 4CHJA 1MKEA 2J0MA 1OMWA 1XCGA 2W2WA 3PVLA 3V5WA 2GS0A 1P6SA 2N0YA 3PVUA 1UPQA 3OANA 1DBHA 2LOZA 3PZDA 1FOEA 3KSYA 1TQZA 4HHVA 1QC6A 2RSGA 2HE7A 4F7UP 4MY6A 3HQCA 2IFSA 1AWEA 1DROA 4ZRKA 1OQNA 2R09A 4MT7A 1LB1A 2FJLA 1UNRA 4TYZA 3SV1A 2D11A 5FI0A 4CHMA 1FHXA 3SUZA 1BTKA 2KCJA 5C16A 5CLLB 3GYPA 2DX1A 4C0AA 2GCLA 2OTXA 2L1CA 1X11A 1DDMA 5D3VA 2YSZA 1Y5OA 3PG7A 3UZTA 1W1HA 4PNKA 3ODXA 2P0FA 4EKUA 3IVFA 4XWXA 5EFXA 4HB2B 2D9XA 1FHWA 1MPHA 1I2HA 3BJIA 2YS3A 1U5GA 2RGNB 3TFMA 2GCJA 2RLOA 1KI1B 4K2OA 5DH9B 3SNHA 2NZ8B 3FM8C 4WSFA 1MK9B 5JLJB 2Z0PA 1K5DB 3T06A 2COCA 4ZRIA 2QKLA 1DDVA 1PFJA 3AJ4A 3P7ZA 2H7DA 4MK0A 4CYEA 1EGXA 3MPXA 3ULBA 1FGZA 4L6EA 2MDXA 3F0WA 4YONA 1LW3A 3FSSA 3SO6A 4K2PA 4DX8A 2M14A 3QBVB 4IOYX 1KZ7A 3WYFB 5CLQB 4KHOA 2DYQA 1XODA 2EMSA 1SHCA 4HAZB 3KRWA 4HAUB 4A6FB 4GMVA 2DKPA 3ML4A 2Y8GA 4HB4B 4D0NB 1I7AA 2UZRA 3DXEA 1V61A 2VKIA 3AU5A 2MKRA 2DHKA 1U5FA 1UNQA 2ROZB 5J3QA 1U29A 1WJ1A 1V5MA 1NI2A 4IFSA 2AL6A 3HK0A 2D10A 4WJ7A 3TW1A 3PEGA 1Z87A 2KGXB 2MWNB 3GYOA 1MIXA 4K17A 4KAXB 4KVGB 3LJUX 1FHOA 1M7EA 5C5BB 2LOXA 2EMTA 4GXBA 1U5DA 4Z2NA 2Z0QA 2CY4A 1P5TA 4F7GA 2ADZA 2CRFA 1W1DA 2D9WA 4A5KA 1ZC4B 2N23A 1TXDA 5J3YA 3TCAA 3DXCA 2R0DA 1PLSA 4IAPA 1U5EA 2J0KA 2DX5A 2W2XC 4HATB 2HTHB
chains in the Genus database with same CATH superfamily
3HW2B 4L1RA 2VRWB 2D2QA 5HE1A 3ZVRA 3RCPA 1MIZB 5KQ4A 3D8EA 1J19A 3NW8A 3P6AA 2YVCA 5D3YA 2LKOA 2NMBA 1FAOA 2IYBA 5I2SA 3VIAA 2YS1A 2ELBA 2I5FA 1V5PA 4K81A 2GJYA 1RRPB 2D4QA 4KHAA 5DIFB 4DBBA 2ZPYA 1FB8A 1B55A 2LG1A 2DLWA 3VOQA 3KY9A 1UNPA 2ROVA 4GPTB 5GOWB 5JHHA 3BINA 3X23A 2X18A 1U2BA 1OY2A 2CY5A 1UPRA 2P0DA 1NU2A 4TKNA 4Z2MB 4NSWA 4A6FA 1NTVA 3G9WA 2UVMA 3NWAA 3U8ZA 2CODA 2D9YA 2KIEA 3F5RA 2MFQA 4KHBB 2DHIA 4GMXB 1GC6A 3D8FA 4EMOA 4DXAB 3ULCA 2Z0OA 4A6KA 2I1JA 1ZC3B 4HB3B 1P3RA 1TJ6A 3O96A 3D8DA 3AU4A 2D9VA 2P0HA 4EJNA 2I5CA 1UEFA 2UZSA 1V89A 4GZUA 3DXDA 5J3TA 1IRSA 3B77A 3A58A 1GG3A 1WGQA 2P8VA 2LULA 2YT1A 2K2UA 2PZ1A 1X1GA 2Q13A 2J59M 1X86A 1ZSQA 4HAYB 4GN1A 4QJ5B 5DI9B 1WVHA 2I1KA 3TO1A 4ZRJA 1BAKA 1GC7A 2QKMA 4GNKB 2XQNM 1U27A 4HDOA 1WG7A 1ZVRA 2EC1A 2DYNA 2RVBB 3ZDTA 5HE0A 3KRXA 2BCJA 1N3HA 2V76A 1T77A 4HAXB 1BWNA 2D9ZA 3ODOA 2EJ8A 1Q67A 2DA0A 1DDWA 3PVWA 1W1GA 2KUQA 2RUKB 2JP2A 5LONB 1XKEA 3QWMA 2Y7BA 3HSAA 2DN6A 4HDQA 1BTNA 4F7HA 5L81A 5FI1A 2L2IA 2AEHA 5LG4B 2K00A 1V88A 2VSZA 2W2XD 2COFA 5M4YB 1KZGA 2M38A 5D3XA 1V5UA 2NBVA 5DHFB 2GUMA 3FVCA 3N7CA 5HE2A 3A8PA 2K2JA 3OHMB 1MK7B 1MAIA 2Y8FA 1PMSA 1X05A 2RNRB 4HAWB 4YL8A 1XX0A 2DFKA 2OQBA 4DX90 1EVHA 2LYDA 4H8SA 1ZM0A 2KUPA 5JHGA 3KZ1A 5DHAB 4A6HA 3A98B 1WJMA 1Y19B 5HE3A 2DTCA 2Z59A 5D27A 1XR0B 1EF1A 4HB0B 1SGHA 3SYXA 2DKQA 3WA0A 2YT0A 5C79A 3TVVA 4B6HA 2YF0A 3PSCA 2ELAA 5D3WA 1XD4A 4WVFB 3ODWA 4BBKA 2KIGA 1ISNA 2DHJA 4QJ3B 1J0WA 1WI1A 2YRYA 2E2XA 2YS5A 4NY0A 1K5GB 5JP4A 4PQ0A 3DCXA 5LOPB 3A8QA 4CSQA 2J0JA 1DYNA 2CAYA 1H10A 3FEHA 3U7DA 5KQ1A 4HAVB 1RJ2A 1X1FA 5C5BA 2Z4DA 3CXBB 1H4RA 3M1IB 2G35A 5C6RA 1QQGA 4GOUA 1AQCA 1EAZA 1NTYA 4QXAB 4P7IA 1WGUA 1FGYA 3PP2A 3QIJA 1E5WA 5KCVA 3CIKA 3NSUA 2COAA 4Y94A 2H7EA 3MDBC 1M7RA 4CHJA 2R2YA 1MKEA 2J0MA 1OMWA 1XCGA 2W2WA 3PVLA 3V5WA 2GS0A 1P6SA 2FJUB 2N0YA 3PVUA 1UPQA 3OANA 1DBHA 2LOZA 3PZDA 1FOEA 3KSYA 1TQZA 4HHVA 1QC6A 2RSGA 2HE7A 4F7UP 4MY6A 3HQCA 3NWDA 2IFSA 1AWEA 1DROA 4OT1A 4ZRKA 1OQNA 2R09A 1ZYIA 4MT7A 4D6WA 1LB1A 2FJLA 1UNRA 4TYZA 3SV1A 2D11A 5FI0A 4CHMA 1FHXA 3SUZA 1BTKA 2KCJA 5C16A 5CLLB 3GYPA 2DX1A 4DIXA 4C0AA 5IRSA 2GCLA 2OTXA 2L1CA 1X11A 1DDMA 5D3VA 2Z14A 2YSZA 1Y5OA 3PG7A 3UZTA 1W1HA 4OSNA 4PNKA 3ODXA 2P0FA 4EKUA 3IVFA 4XWXA 5EFXA 4HB2B 2D9XA 3HIEA 1FHWA 1MPHA 4KHBA 1I2HA 2K8EA 3BJIA 2YS3A 1U5GA 2RGNB 3TFMA 2GCJA 2RLOA 1KI1B 4K2OA 5DH9B 2KR0A 3SNHA 2NZ8B 3FM8C 4WSFA 1MK9B 5JLJB 2Z0PA 1K5DB 3T06A 2COCA 4ZRIA 2QKLA 1DDVA 1PFJA 3AJ4A 3P7ZA 5I2MA 2H7DA 4MK0A 4CYEA 1EGXA 3MPXA 3ULBA 1FGZA 4L6EA 2MDXA 3F0WA 4YONA 1LW3A 3FSSA 3SO6A 4K2PA 2K49A 4DX8A 2M14A 3NWFA 3QBVB 4IOYX 1KZ7A 3WYFB 5CLQB 4KHOA 2DYQA 1XODA 2EMSA 1SHCA 4HAZB 3KRWA 4HAUB 2RRFA 4A6FB 4GMVA 2DKPA 3ML4A 4QJ4B 2Y8GA 4HB4B 4D0NB 1I7AA 2UZRA 3DXEA 1V61A 2VKIA 3AU5A 2MKRA 2DHKA 1U5FA 1UNQA 2ROZB 5J3QA 1U29A 4HSIA 1WJ1A 1V5MA 1NI2A 2ZKMX 4IFSA 2AL6A 3HK0A 2D10A 4WJ7A 3TW1A 3PEGA 1Z87A 2KGXB 2MWNB 3GYOA 1MIXA 4K17A 3U12A 4KAXB 4KVGB 3LJUX 1FHOA 1M7EA 5C5BB 2LOXA 2EMTA 4GXBA 1U5DA 4Z2NA 2Z0QA 2CY4A 1P5TA 4F7GA 2ADZA 2CRFA 1W1DA 1MI1A 2D9WA 4A5KA 1ZC4B 2N23A 2YT2A 1TXDA 5J3YA 3TCAA 3DXCA 2R0DA 2Z13A 1PLSA 4IAPA 1U5EA 2J0KA 2DX5A 2W2XC 4HATB 2HTHB
chains in the Genus database with same CATH topology
3HW2B 2VRWB 2D2QA 5HE1A 3ZVRA 3RCPA 1MIZB 5KQ4A 3D8EA 1J19A 3P6AA 2YVCA 5D3YA 2LKOA 2NMBA 1FAOA 2IYBA 3VIAA 2YS1A 2ELBA 2I5FA 1V5PA 4K81A 2GJYA 1RRPB 2D4QA 4KHAA 5DIFB 4DBBA 2ZPYA 1FB8A 1B55A 2LG1A 2DLWA 3VOQA 3KY9A 1UNPA 2ROVA 4GPTB 5GOWB 5JHHA 3BINA 3X23A 2X18A 1U2BA 1OY2A 2CY5A 1UPRA 2P0DA 1NU2A 4TKNA 4Z2MB 4NSWA 4A6FA 1NTVA 3G9WA 2UVMA 3U8ZA 2CODA 2D9YA 3F5RA 2MFQA 4KHBB 2DHIA 4GMXB 1GC6A 3D8FA 4EMOA 4DXAB 3ULCA 2Z0OA 4A6KA 2I1JA 1ZC3B 4HB3B 1P3RA 1TJ6A 3O96A 3D8DA 3AU4A 2D9VA 2P0HA 4EJNA 2I5CA 1UEFA 2UZSA 1V89A 4GZUA 3DXDA 5J3TA 1IRSA 1GG3A 1WGQA 2P8VA 2LULA 2YT1A 2K2UA 2PZ1A 1X1GA 2Q13A 2J59M 1X86A 1ZSQA 4HAYB 4GN1A 5DI9B 1WVHA 2I1KA 3TO1A 4ZRJA 1BAKA 1GC7A 2QKMA 2XQNM 1U27A 4HDOA 1WG7A 1ZVRA 2EC1A 2DYNA 2RVBB 3ZDTA 5HE0A 3KRXA 2BCJA 1N3HA 2V76A 4HAXB 1BWNA 2D9ZA 3ODOA 2EJ8A 1Q67A 2DA0A 1DDWA 3PVWA 1W1GA 2RUKB 2JP2A 5LONB 1XKEA 3QWMA 2Y7BA 2DN6A 4HDQA 1BTNA 4F7HA 5L81A 5FI1A 2L2IA 2AEHA 2K00A 1V88A 2VSZA 2W2XD 2COFA 1KZGA 2M38A 5D3XA 1V5UA 5DHFB 3N7CA 5HE2A 3A8PA 2K2JA 1MK7B 1MAIA 2Y8FA 1PMSA 1X05A 2RNRB 4HAWB 4YL8A 1XX0A 2DFKA 2OQBA 4DX90 1EVHA 2LYDA 4H8SA 1ZM0A 2KUPA 5JHGA 3KZ1A 5DHAB 4A6HA 3A98B 1WJMA 1Y19B 5HE3A 2DTCA 5D27A 1XR0B 1EF1A 4HB0B 1SGHA 3SYXA 2DKQA 3WA0A 2YT0A 5C79A 3TVVA 4B6HA 2YF0A 3PSCA 2ELAA 5D3WA 1XD4A 4WVFB 3ODWA 4BBKA 1ISNA 2DHJA 1J0WA 1WI1A 2YRYA 2E2XA 2YS5A 4NY0A 1K5GB 5JP4A 4PQ0A 5LOPB 3A8QA 2J0JA 1DYNA 2CAYA 1H10A 3FEHA 3U7DA 5KQ1A 4HAVB 1RJ2A 1X1FA 5C5BA 3CXBB 1H4RA 3M1IB 2G35A 5C6RA 1QQGA 1AQCA 1EAZA 1NTYA 4P7IA 1WGUA 1FGYA 3PP2A 3QIJA 1E5WA 5KCVA 3CIKA 3NSUA 2COAA 4Y94A 2H7EA 3MDBC 1M7RA 4CHJA 1MKEA 2J0MA 1OMWA 1XCGA 2W2WA 3PVLA 3V5WA 2GS0A 1P6SA 2N0YA 3PVUA 1UPQA 3OANA 1DBHA 2LOZA 3PZDA 1FOEA 3KSYA 1TQZA 4HHVA 1QC6A 2RSGA 2HE7A 4F7UP 4MY6A 3HQCA 2IFSA 1AWEA 1DROA 4ZRKA 1OQNA 2R09A 4MT7A 1LB1A 2FJLA 1UNRA 4TYZA 3SV1A 2D11A 5FI0A 4CHMA 1FHXA 3SUZA 1BTKA 2KCJA 5C16A 5CLLB 3GYPA 2DX1A 4C0AA 2GCLA 2OTXA 2L1CA 1X11A 1DDMA 5D3VA 2YSZA 1Y5OA 3PG7A 3UZTA 1W1HA 4PNKA 3ODXA 2P0FA 4EKUA 3IVFA 4XWXA 5EFXA 4HB2B 2D9XA 1FHWA 1MPHA 1I2HA 3BJIA 2YS3A 1U5GA 2RGNB 3TFMA 2GCJA 2RLOA 1KI1B 4K2OA 5DH9B 3SNHA 2NZ8B 3FM8C 4WSFA 1MK9B 5JLJB 2Z0PA 1K5DB 3T06A 2COCA 4ZRIA 2QKLA 1DDVA 1PFJA 3AJ4A 3P7ZA 2H7DA 4MK0A 4CYEA 1EGXA 3MPXA 3ULBA 1FGZA 4L6EA 2MDXA 3F0WA 4YONA 1LW3A 3FSSA 3SO6A 4K2PA 4DX8A 2M14A 3QBVB 4IOYX 1KZ7A 3WYFB 5CLQB 4KHOA 2DYQA 1XODA 2EMSA 1SHCA 4HAZB 3KRWA 4HAUB 4A6FB 4GMVA 2DKPA 3ML4A 2Y8GA 4HB4B 4D0NB 1I7AA 2UZRA 3DXEA 1V61A 2VKIA 3AU5A 2MKRA 2DHKA 1U5FA 1UNQA 2ROZB 5J3QA 1U29A 1WJ1A 1V5MA 1NI2A 4IFSA 2AL6A 3HK0A 2D10A 4WJ7A 3TW1A 3PEGA 1Z87A 2KGXB 2MWNB 3GYOA 1MIXA 4K17A 4KAXB 4KVGB 3LJUX 1FHOA 1M7EA 5C5BB 2LOXA 2EMTA 4GXBA 1U5DA 4Z2NA 2Z0QA 2CY4A 1P5TA 4F7GA 2ADZA 2CRFA 1W1DA 2D9WA 4A5KA 1ZC4B 2N23A 1TXDA 5J3YA 3TCAA 3DXCA 2R0DA 1PLSA 4IAPA 1U5EA 2J0KA 2DX5A 2W2XC 4HATB 2HTHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HW2 B;  2VRW B;  2D2Q A;  5HE1 A;  3ZVR A;  3RCP A;  1MIZ B;  5KQ4 A;  3D8E A;  1J19 A;  3P6A A;  2YVC A;  5D3Y A;  2LKO A;  2NMB A;  1FAO A;  2IYB A;  3VIA A;  2YS1 A;  2ELB A;  2I5F A;  1V5P A;  4K81 A;  2GJY A;  1RRP B;  2D4Q A;  4KHA A;  5DIF B;  4DBB A;  2ZPY A;  1FB8 A;  1B55 A;  2LG1 A;  2DLW A;  3VOQ A;  3KY9 A;  1UNP A;  2ROV A;  4GPT B;  5GOW B;  5JHH A;  3BIN A;  3X23 A;  2X18 A;  1U2B A;  1OY2 A;  2CY5 A;  1UPR A;  2P0D A;  1NU2 A;  4TKN A;  4Z2M B;  4NSW A;  4A6F A;  1NTV A;  3G9W A;  2UVM A;  3U8Z A;  2COD A;  2D9Y A;  3F5R A;  2MFQ A;  4KHB B;  2DHI A;  4GMX B;  1GC6 A;  3D8F A;  4EMO A;  4DXA B;  3ULC A;  2Z0O A;  4A6K A;  2I1J A;  1ZC3 B;  4HB3 B;  1P3R A;  1TJ6 A;  3O96 A;  3D8D A;  3AU4 A;  2D9V A;  2P0H A;  4EJN A;  2I5C A;  1UEF A;  2UZS A;  1V89 A;  4GZU A;  3DXD A;  5J3T A;  1IRS A;  1GG3 A;  1WGQ A;  2P8V A;  2LUL A;  2YT1 A;  2K2U A;  2PZ1 A;  1X1G A;  2Q13 A;  2J59 M;  1X86 A;  1ZSQ A;  4HAY B;  4GN1 A;  5DI9 B;  1WVH A;  2I1K A;  3TO1 A;  4ZRJ A;  1BAK A;  1GC7 A;  2QKM A;  2XQN M;  1U27 A;  4HDO A;  1WG7 A;  1ZVR A;  2EC1 A;  2DYN A;  2RVB B;  3ZDT A;  5HE0 A;  3KRX A;  2BCJ A;  1N3H A;  2V76 A;  4HAX B;  1BWN A;  2D9Z A;  3ODO A;  2EJ8 A;  1Q67 A;  2DA0 A;  1DDW A;  3PVW A;  1W1G A;  2RUK B;  2JP2 A;  5LON B;  1XKE A;  3QWM A;  2Y7B A;  2DN6 A;  4HDQ A;  1BTN A;  4F7H A;  5L81 A;  5FI1 A;  2L2I A;  2AEH A;  2K00 A;  1V88 A;  2VSZ A;  2W2X D;  2COF A;  1KZG A;  2M38 A;  5D3X A;  1V5U A;  5DHF B;  3N7C A;  5HE2 A;  3A8P A;  2K2J A;  1MK7 B;  1MAI A;  2Y8F A;  1PMS A;  1X05 A;  2RNR B;  4HAW B;  4YL8 A;  1XX0 A;  2DFK A;  2OQB A;  4DX9 0;  1EVH A;  2LYD A;  4H8S A;  1ZM0 A;  2KUP A;  5JHG A;  3KZ1 A;  5DHA B;  4A6H A;  3A98 B;  1WJM A;  1Y19 B;  5HE3 A;  2DTC A;  5D27 A;  1XR0 B;  1EF1 A;  4HB0 B;  1SGH A;  3SYX A;  2DKQ A;  3WA0 A;  2YT0 A;  5C79 A;  3TVV A;  4B6H A;  2YF0 A;  3PSC A;  2ELA A;  5D3W A;  1XD4 A;  4WVF B;  3ODW A;  4BBK A;  1ISN A;  2DHJ A;  1J0W A;  1WI1 A;  2YRY A;  2E2X A;  2YS5 A;  4NY0 A;  1K5G B;  5JP4 A;  4PQ0 A;  5LOP B;  3A8Q A;  2J0J A;  1DYN A;  2CAY A;  1H10 A;  3FEH A;  3U7D A;  5KQ1 A;  4HAV B;  1RJ2 A;  1X1F A;  5C5B A;  3CXB B;  1H4R A;  3M1I B;  2G35 A;  5C6R A;  1QQG A;  1AQC A;  1EAZ A;  1NTY A;  4P7I A;  1WGU A;  1FGY A;  3PP2 A;  3QIJ A;  1E5W A;  5KCV A;  3CIK A;  3NSU A;  2COA A;  4Y94 A;  2H7E A;  3MDB C;  1M7R A;  4CHJ A;  1MKE A;  2J0M A;  1OMW A;  1XCG A;  2W2W A;  3PVL A;  3V5W A;  2GS0 A;  1P6S A;  2N0Y A;  3PVU A;  1UPQ A;  3OAN A;  1DBH A;  2LOZ A;  3PZD A;  1FOE A;  3KSY A;  1TQZ A;  4HHV A;  1QC6 A;  2RSG A;  2HE7 A;  4F7U P;  4MY6 A;  3HQC A;  2IFS A;  1AWE A;  1DRO A;  4ZRK A;  1OQN A;  2R09 A;  4MT7 A;  1LB1 A;  2FJL A;  1UNR A;  4TYZ A;  3SV1 A;  2D11 A;  5FI0 A;  4CHM A;  1FHX A;  3SUZ A;  1BTK A;  2KCJ A;  5C16 A;  5CLL B;  3GYP A;  2DX1 A;  4C0A A;  2GCL A;  2OTX A;  2L1C A;  1X11 A;  1DDM A;  5D3V A;  2YSZ A;  1Y5O A;  3PG7 A;  3UZT A;  1W1H A;  4PNK A;  3ODX A;  2P0F A;  4EKU A;  3IVF A;  4XWX A;  5EFX A;  4HB2 B;  2D9X A;  1FHW A;  1MPH A;  1I2H A;  3BJI A;  2YS3 A;  1U5G A;  2RGN B;  3TFM A;  2GCJ A;  2RLO A;  1KI1 B;  4K2O A;  5DH9 B;  3SNH A;  2NZ8 B;  3FM8 C;  4WSF A;  1MK9 B;  5JLJ B;  2Z0P A;  1K5D B;  3T06 A;  2COC A;  4ZRI A;  2QKL A;  1DDV A;  1PFJ A;  3AJ4 A;  3P7Z A;  2H7D A;  4MK0 A;  4CYE A;  1EGX A;  3MPX A;  3ULB A;  1FGZ A;  4L6E A;  2MDX A;  3F0W A;  4YON A;  1LW3 A;  3FSS A;  3SO6 A;  4K2P A;  4DX8 A;  2M14 A;  3QBV B;  4IOY X;  1KZ7 A;  3WYF B;  5CLQ B;  4KHO A;  2DYQ A;  1XOD A;  2EMS A;  1SHC A;  4HAZ B;  3KRW A;  4HAU B;  4A6F B;  4GMV A;  2DKP A;  3ML4 A;  2Y8G A;  4HB4 B;  4D0N B;  1I7A A;  2UZR A;  3DXE A;  1V61 A;  2VKI A;  3AU5 A;  2MKR A;  2DHK A;  1U5F A;  1UNQ A;  2ROZ B;  5J3Q A;  1U29 A;  1WJ1 A;  1V5M A;  1NI2 A;  4IFS A;  2AL6 A;  3HK0 A;  2D10 A;  4WJ7 A;  3TW1 A;  3PEG A;  1Z87 A;  2KGX B;  2MWN B;  3GYO A;  1MIX A;  4K17 A;  4KAX B;  4KVG B;  3LJU X;  1FHO A;  1M7E A;  5C5B B;  2LOX A;  2EMT A;  4GXB A;  1U5D A;  4Z2N A;  2Z0Q A;  2CY4 A;  1P5T A;  4F7G A;  2ADZ A;  2CRF A;  1W1D A;  2D9W A;  4A5K A;  1ZC4 B;  2N23 A;  1TXD A;  5J3Y A;  3TCA A;  3DXC A;  2R0D A;  1PLS A;  4IAP A;  1U5E A;  2J0K A;  2DX5 A;  2W2X C;  4HAT B;  2HTH B; 
#chains in the Genus database with same CATH topology
 3HW2 B;  4L1R A;  2VRW B;  2D2Q A;  5HE1 A;  3ZVR A;  3RCP A;  1MIZ B;  5KQ4 A;  3D8E A;  1J19 A;  3NW8 A;  3P6A A;  2YVC A;  5D3Y A;  2LKO A;  2NMB A;  1FAO A;  2IYB A;  5I2S A;  3VIA A;  2YS1 A;  2ELB A;  2I5F A;  1V5P A;  4K81 A;  2GJY A;  1RRP B;  2D4Q A;  4KHA A;  5DIF B;  4DBB A;  2ZPY A;  1FB8 A;  1B55 A;  2LG1 A;  2DLW A;  3VOQ A;  3KY9 A;  1UNP A;  2ROV A;  4GPT B;  5GOW B;  5JHH A;  3BIN A;  3X23 A;  2X18 A;  1U2B A;  1OY2 A;  2CY5 A;  1UPR A;  2P0D A;  1NU2 A;  4TKN A;  4Z2M B;  4NSW A;  4A6F A;  1NTV A;  3G9W A;  2UVM A;  3NWA A;  3U8Z A;  2COD A;  2D9Y A;  2KIE A;  3F5R A;  2MFQ A;  4KHB B;  2DHI A;  4GMX B;  1GC6 A;  3D8F A;  4EMO A;  4DXA B;  3ULC A;  2Z0O A;  4A6K A;  2I1J A;  1ZC3 B;  4HB3 B;  1P3R A;  1TJ6 A;  3O96 A;  3D8D A;  3AU4 A;  2D9V A;  2P0H A;  4EJN A;  2I5C A;  1UEF A;  2UZS A;  1V89 A;  4GZU A;  3DXD A;  5J3T A;  1IRS A;  3B77 A;  3A58 A;  1GG3 A;  1WGQ A;  2P8V A;  2LUL A;  2YT1 A;  2K2U A;  2PZ1 A;  1X1G A;  2Q13 A;  2J59 M;  1X86 A;  1ZSQ A;  4HAY B;  4GN1 A;  4QJ5 B;  5DI9 B;  1WVH A;  2I1K A;  3TO1 A;  4ZRJ A;  1BAK A;  1GC7 A;  2QKM A;  4GNK B;  2XQN M;  1U27 A;  4HDO A;  1WG7 A;  1ZVR A;  2EC1 A;  2DYN A;  2RVB B;  3ZDT A;  5HE0 A;  3KRX A;  2BCJ A;  1N3H A;  2V76 A;  1T77 A;  4HAX B;  1BWN A;  2D9Z A;  3ODO A;  2EJ8 A;  1Q67 A;  2DA0 A;  1DDW A;  3PVW A;  1W1G A;  2KUQ A;  2RUK B;  2JP2 A;  5LON B;  1XKE A;  3QWM A;  2Y7B A;  3HSA A;  2DN6 A;  4HDQ A;  1BTN A;  4F7H A;  5L81 A;  5FI1 A;  2L2I A;  2AEH A;  5LG4 B;  2K00 A;  1V88 A;  2VSZ A;  2W2X D;  2COF A;  5M4Y B;  1KZG A;  2M38 A;  5D3X A;  1V5U A;  2NBV A;  5DHF B;  2GUM A;  3FVC A;  3N7C A;  5HE2 A;  3A8P A;  2K2J A;  3OHM B;  1MK7 B;  1MAI A;  2Y8F A;  1PMS A;  1X05 A;  2RNR B;  4HAW B;  4YL8 A;  1XX0 A;  2DFK A;  2OQB A;  4DX9 0;  1EVH A;  2LYD A;  4H8S A;  1ZM0 A;  2KUP A;  5JHG A;  3KZ1 A;  5DHA B;  4A6H A;  3A98 B;  1WJM A;  1Y19 B;  5HE3 A;  2DTC A;  2Z59 A;  5D27 A;  1XR0 B;  1EF1 A;  4HB0 B;  1SGH A;  3SYX A;  2DKQ A;  3WA0 A;  2YT0 A;  5C79 A;  3TVV A;  4B6H A;  2YF0 A;  3PSC A;  2ELA A;  5D3W A;  1XD4 A;  4WVF B;  3ODW A;  4BBK A;  2KIG A;  1ISN A;  2DHJ A;  4QJ3 B;  1J0W A;  1WI1 A;  2YRY A;  2E2X A;  2YS5 A;  4NY0 A;  1K5G B;  5JP4 A;  4PQ0 A;  3DCX A;  5LOP B;  3A8Q A;  4CSQ A;  2J0J A;  1DYN A;  2CAY A;  1H10 A;  3FEH A;  3U7D A;  5KQ1 A;  4HAV B;  1RJ2 A;  1X1F A;  5C5B A;  2Z4D A;  3CXB B;  1H4R A;  3M1I B;  2G35 A;  5C6R A;  1QQG A;  4GOU A;  1AQC A;  1EAZ A;  1NTY A;  4QXA B;  4P7I A;  1WGU A;  1FGY A;  3PP2 A;  3QIJ A;  1E5W A;  5KCV A;  3CIK A;  3NSU A;  2COA A;  4Y94 A;  2H7E A;  3MDB C;  1M7R A;  4CHJ A;  2R2Y A;  1MKE A;  2J0M A;  1OMW A;  1XCG A;  2W2W A;  3PVL A;  3V5W A;  2GS0 A;  1P6S A;  2FJU B;  2N0Y A;  3PVU A;  1UPQ A;  3OAN A;  1DBH A;  2LOZ A;  3PZD A;  1FOE A;  3KSY A;  1TQZ A;  4HHV A;  1QC6 A;  2RSG A;  2HE7 A;  4F7U P;  4MY6 A;  3HQC A;  3NWD A;  2IFS A;  1AWE A;  1DRO A;  4OT1 A;  4ZRK A;  1OQN A;  2R09 A;  1ZYI A;  4MT7 A;  4D6W A;  1LB1 A;  2FJL A;  1UNR A;  4TYZ A;  3SV1 A;  2D11 A;  5FI0 A;  4CHM A;  1FHX A;  3SUZ A;  1BTK A;  2KCJ A;  5C16 A;  5CLL B;  3GYP A;  2DX1 A;  4DIX A;  4C0A A;  5IRS A;  2GCL A;  2OTX A;  2L1C A;  1X11 A;  1DDM A;  5D3V A;  2Z14 A;  2YSZ A;  1Y5O A;  3PG7 A;  3UZT A;  1W1H A;  4OSN A;  4PNK A;  3ODX A;  2P0F A;  4EKU A;  3IVF A;  4XWX A;  5EFX A;  4HB2 B;  2D9X A;  3HIE A;  1FHW A;  1MPH A;  4KHB A;  1I2H A;  2K8E A;  3BJI A;  2YS3 A;  1U5G A;  2RGN B;  3TFM A;  2GCJ A;  2RLO A;  1KI1 B;  4K2O A;  5DH9 B;  2KR0 A;  3SNH A;  2NZ8 B;  3FM8 C;  4WSF A;  1MK9 B;  5JLJ B;  2Z0P A;  1K5D B;  3T06 A;  2COC A;  4ZRI A;  2QKL A;  1DDV A;  1PFJ A;  3AJ4 A;  3P7Z A;  5I2M A;  2H7D A;  4MK0 A;  4CYE A;  1EGX A;  3MPX A;  3ULB A;  1FGZ A;  4L6E A;  2MDX A;  3F0W A;  4YON A;  1LW3 A;  3FSS A;  3SO6 A;  4K2P A;  2K49 A;  4DX8 A;  2M14 A;  3NWF A;  3QBV B;  4IOY X;  1KZ7 A;  3WYF B;  5CLQ B;  4KHO A;  2DYQ A;  1XOD A;  2EMS A;  1SHC A;  4HAZ B;  3KRW A;  4HAU B;  2RRF A;  4A6F B;  4GMV A;  2DKP A;  3ML4 A;  4QJ4 B;  2Y8G A;  4HB4 B;  4D0N B;  1I7A A;  2UZR A;  3DXE A;  1V61 A;  2VKI A;  3AU5 A;  2MKR A;  2DHK A;  1U5F A;  1UNQ A;  2ROZ B;  5J3Q A;  1U29 A;  4HSI A;  1WJ1 A;  1V5M A;  1NI2 A;  2ZKM X;  4IFS A;  2AL6 A;  3HK0 A;  2D10 A;  4WJ7 A;  3TW1 A;  3PEG A;  1Z87 A;  2KGX B;  2MWN B;  3GYO A;  1MIX A;  4K17 A;  3U12 A;  4KAX B;  4KVG B;  3LJU X;  1FHO A;  1M7E A;  5C5B B;  2LOX A;  2EMT A;  4GXB A;  1U5D A;  4Z2N A;  2Z0Q A;  2CY4 A;  1P5T A;  4F7G A;  2ADZ A;  2CRF A;  1W1D A;  1MI1 A;  2D9W A;  4A5K A;  1ZC4 B;  2N23 A;  2YT2 A;  1TXD A;  5J3Y A;  3TCA A;  3DXC A;  2R0D A;  2Z13 A;  1PLS A;  4IAP A;  1U5E A;  2J0K A;  2DX5 A;  2W2X C;  4HAT B;  2HTH B; 
#chains in the Genus database with same CATH homology
 3HW2 B;  2VRW B;  2D2Q A;  5HE1 A;  3ZVR A;  3RCP A;  1MIZ B;  5KQ4 A;  3D8E A;  1J19 A;  3P6A A;  2YVC A;  5D3Y A;  2LKO A;  2NMB A;  1FAO A;  2IYB A;  3VIA A;  2YS1 A;  2ELB A;  2I5F A;  1V5P A;  4K81 A;  2GJY A;  1RRP B;  2D4Q A;  4KHA A;  5DIF B;  4DBB A;  2ZPY A;  1FB8 A;  1B55 A;  2LG1 A;  2DLW A;  3VOQ A;  3KY9 A;  1UNP A;  2ROV A;  4GPT B;  5GOW B;  5JHH A;  3BIN A;  3X23 A;  2X18 A;  1U2B A;  1OY2 A;  2CY5 A;  1UPR A;  2P0D A;  1NU2 A;  4TKN A;  4Z2M B;  4NSW A;  4A6F A;  1NTV A;  3G9W A;  2UVM A;  3U8Z A;  2COD A;  2D9Y A;  3F5R A;  2MFQ A;  4KHB B;  2DHI A;  4GMX B;  1GC6 A;  3D8F A;  4EMO A;  4DXA B;  3ULC A;  2Z0O A;  4A6K A;  2I1J A;  1ZC3 B;  4HB3 B;  1P3R A;  1TJ6 A;  3O96 A;  3D8D A;  3AU4 A;  2D9V A;  2P0H A;  4EJN A;  2I5C A;  1UEF A;  2UZS A;  1V89 A;  4GZU A;  3DXD A;  5J3T A;  1IRS A;  1GG3 A;  1WGQ A;  2P8V A;  2LUL A;  2YT1 A;  2K2U A;  2PZ1 A;  1X1G A;  2Q13 A;  2J59 M;  1X86 A;  1ZSQ A;  4HAY B;  4GN1 A;  5DI9 B;  1WVH A;  2I1K A;  3TO1 A;  4ZRJ A;  1BAK A;  1GC7 A;  2QKM A;  2XQN M;  1U27 A;  4HDO A;  1WG7 A;  1ZVR A;  2EC1 A;  2DYN A;  2RVB B;  3ZDT A;  5HE0 A;  3KRX A;  2BCJ A;  1N3H A;  2V76 A;  4HAX B;  1BWN A;  2D9Z A;  3ODO A;  2EJ8 A;  1Q67 A;  2DA0 A;  1DDW A;  3PVW A;  1W1G A;  2RUK B;  2JP2 A;  5LON B;  1XKE A;  3QWM A;  2Y7B A;  2DN6 A;  4HDQ A;  1BTN A;  4F7H A;  5L81 A;  5FI1 A;  2L2I A;  2AEH A;  2K00 A;  1V88 A;  2VSZ A;  2W2X D;  2COF A;  1KZG A;  2M38 A;  5D3X A;  1V5U A;  5DHF B;  3N7C A;  5HE2 A;  3A8P A;  2K2J A;  1MK7 B;  1MAI A;  2Y8F A;  1PMS A;  1X05 A;  2RNR B;  4HAW B;  4YL8 A;  1XX0 A;  2DFK A;  2OQB A;  4DX9 0;  1EVH A;  2LYD A;  4H8S A;  1ZM0 A;  2KUP A;  5JHG A;  3KZ1 A;  5DHA B;  4A6H A;  3A98 B;  1WJM A;  1Y19 B;  5HE3 A;  2DTC A;  5D27 A;  1XR0 B;  1EF1 A;  4HB0 B;  1SGH A;  3SYX A;  2DKQ A;  3WA0 A;  2YT0 A;  5C79 A;  3TVV A;  4B6H A;  2YF0 A;  3PSC A;  2ELA A;  5D3W A;  1XD4 A;  4WVF B;  3ODW A;  4BBK A;  1ISN A;  2DHJ A;  1J0W A;  1WI1 A;  2YRY A;  2E2X A;  2YS5 A;  4NY0 A;  1K5G B;  5JP4 A;  4PQ0 A;  5LOP B;  3A8Q A;  2J0J A;  1DYN A;  2CAY A;  1H10 A;  3FEH A;  3U7D A;  5KQ1 A;  4HAV B;  1RJ2 A;  1X1F A;  5C5B A;  3CXB B;  1H4R A;  3M1I B;  2G35 A;  5C6R A;  1QQG A;  1AQC A;  1EAZ A;  1NTY A;  4P7I A;  1WGU A;  1FGY A;  3PP2 A;  3QIJ A;  1E5W A;  5KCV A;  3CIK A;  3NSU A;  2COA A;  4Y94 A;  2H7E A;  3MDB C;  1M7R A;  4CHJ A;  1MKE A;  2J0M A;  1OMW A;  1XCG A;  2W2W A;  3PVL A;  3V5W A;  2GS0 A;  1P6S A;  2N0Y A;  3PVU A;  1UPQ A;  3OAN A;  1DBH A;  2LOZ A;  3PZD A;  1FOE A;  3KSY A;  1TQZ A;  4HHV A;  1QC6 A;  2RSG A;  2HE7 A;  4F7U P;  4MY6 A;  3HQC A;  2IFS A;  1AWE A;  1DRO A;  4ZRK A;  1OQN A;  2R09 A;  4MT7 A;  1LB1 A;  2FJL A;  1UNR A;  4TYZ A;  3SV1 A;  2D11 A;  5FI0 A;  4CHM A;  1FHX A;  3SUZ A;  1BTK A;  2KCJ A;  5C16 A;  5CLL B;  3GYP A;  2DX1 A;  4C0A A;  2GCL A;  2OTX A;  2L1C A;  1X11 A;  1DDM A;  5D3V A;  2YSZ A;  1Y5O A;  3PG7 A;  3UZT A;  1W1H A;  4PNK A;  3ODX A;  2P0F A;  4EKU A;  3IVF A;  4XWX A;  5EFX A;  4HB2 B;  2D9X A;  1FHW A;  1MPH A;  1I2H A;  3BJI A;  2YS3 A;  1U5G A;  2RGN B;  3TFM A;  2GCJ A;  2RLO A;  1KI1 B;  4K2O A;  5DH9 B;  3SNH A;  2NZ8 B;  3FM8 C;  4WSF A;  1MK9 B;  5JLJ B;  2Z0P A;  1K5D B;  3T06 A;  2COC A;  4ZRI A;  2QKL A;  1DDV A;  1PFJ A;  3AJ4 A;  3P7Z A;  2H7D A;  4MK0 A;  4CYE A;  1EGX A;  3MPX A;  3ULB A;  1FGZ A;  4L6E A;  2MDX A;  3F0W A;  4YON A;  1LW3 A;  3FSS A;  3SO6 A;  4K2P A;  4DX8 A;  2M14 A;  3QBV B;  4IOY X;  1KZ7 A;  3WYF B;  5CLQ B;  4KHO A;  2DYQ A;  1XOD A;  2EMS A;  1SHC A;  4HAZ B;  3KRW A;  4HAU B;  4A6F B;  4GMV A;  2DKP A;  3ML4 A;  2Y8G A;  4HB4 B;  4D0N B;  1I7A A;  2UZR A;  3DXE A;  1V61 A;  2VKI A;  3AU5 A;  2MKR A;  2DHK A;  1U5F A;  1UNQ A;  2ROZ B;  5J3Q A;  1U29 A;  1WJ1 A;  1V5M A;  1NI2 A;  4IFS A;  2AL6 A;  3HK0 A;  2D10 A;  4WJ7 A;  3TW1 A;  3PEG A;  1Z87 A;  2KGX B;  2MWN B;  3GYO A;  1MIX A;  4K17 A;  4KAX B;  4KVG B;  3LJU X;  1FHO A;  1M7E A;  5C5B B;  2LOX A;  2EMT A;  4GXB A;  1U5D A;  4Z2N A;  2Z0Q A;  2CY4 A;  1P5T A;  4F7G A;  2ADZ A;  2CRF A;  1W1D A;  2D9W A;  4A5K A;  1ZC4 B;  2N23 A;  1TXD A;  5J3Y A;  3TCA A;  3DXC A;  2R0D A;  1PLS A;  4IAP A;  1U5E A;  2J0K A;  2DX5 A;  2W2X C;  4HAT B;  2HTH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...