2P0FA

Arhgap9 ph domain in complex with ins(1,3,5)p3
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
SHEVEKSGLLNMTKIAQGGRKLRKNWGPSWVVLTGNSLVFYREPPPTAPSSGWGPAGSRPESSVDLRGAALAHGRHLSSRRNVLHIRTIPGHEFLLQSDHETELRAWHRALRTVIERLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Non-canonical Interaction of Phosphoinositides with Pleckstrin Homology Domains of Tiam1 and ArhGAP9.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligand binding protein
molecule keywords Rho GTPase-activating protein 9
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2p0fA00
4GMVA 1V5UA 3KZ1A 2DHJA 3MPXA 4DXAB 3PEGA 2D9YA 2Z0OA 4GZUA 3CXBB 2EMTA 4A6FB 3TCAA 5FI0A 1BTNA 1KZGA 2J0KA 1X1FA 1U5DA 4MY6A 5KQ1A 5DHAB 1K5DB 3V5WA 1XKEA 2PZ1A 4ZRJA 4HB4B 2AEHA 1X86A 4HAUB 1ISNA 1FOEA 3VOQA 3TVVA 1V88A 1P3RA 1QQGA 3TFMA 2RLOA 4PNKA 2AL6A 5CLQB 2KUPA 1W1HA 1E5WA 2Y8FA 4HB0B 4K17A 1KZ7A 4EKUA 1WGQA 3NSUA 1M7RA 1UNPA 4K2OA 5HE3A 1DDWA 2COFA 5L81A 1FGYA 4TYZA 1XCGA 3FSSA 4KHBB 1ZM0A 3PVLA 1GC7A 1NTYA 4F7HA 3PVWA 5FI1A 1DROA 1DYNA 1UNRA 2K2UA 2GCJA 4DBBA 3G9WA 3PVUA 2EMSA 1TQZA 3SO6A 1U29A 2W2WA 2ADZA 2DHIA 3T06A 1V89A 2HE7A 2DYNA 4XWXA 4GN1A 1WJMA 1W1DA 2CAYA 3X23A 1PFJA 5DHFB 3TO1A 1FHWA 1U5EA 3CIKA 3O96A 2Q13A 3ODOA 2XQNM 1WI1A 2JP2A 5GOWB 3SUZA 4BBKA 4ZRKA 4A6KA 1PMSA 3GYPA 1U27A 4KHAA 1I7AA 1TJ6A 3ML4A 2NMBA 3ULCA 2QKMA 1U5FA 3DXEA 2Z0PA 5DI9B 3QWMA 2J0MA 4GXBA 2YS1A 2Z0QA 2UZRA 4KAXB 5KQ4A 5JP4A 2YF0A 2LOXA 3PZDA 4HAVB 2KCJA 3PG7A 2J59M 3TW1A 2ELBA 5J3TA 2VKIA 2D11A 2L1CA 1BTKA 1DDVA 4B6HA 4WVFB 1GG3A 1OY2A 5DH9B 2QKLA 3M1IB 4KHOA 2R0DA 5HE1A 1EF1A 4C0AA 2J0JA 2DX1A 2LULA 1I2HA 2H7DA 4K2PA 1AWEA 3P7ZA 1OQNA 2IFSA 2Y7BA 4EMOA 1IRSA 3KRXA 2D9VA 2D2QA 1MK9B 2P0HA 1EAZA 3FEHA 1WG7A 2DN6A 2YS3A 4HB3B 2ROZB 3LJUX 2D10A 4P7IA 1MIZB 4HAZB 3AU5A 3PSCA 2CY5A 4MT7A 2CY4A 3PP2A 5C16A 2EC1A 2DKPA 2W2XD 3ULBA 2E2XA 1GC6A 1P5TA 2P0FA 2D9XA 1X1GA 1FAOA 1W1GA 2DKQA 4MK0A 4HAYB 1NU2A 3AJ4A 1BAKA 5DIFB 2YRYA 2K00A 2HTHB 1Q67A 2GCLA 1FHXA 5HE2A 4IAPA 2UZSA 4HHVA 1UEFA 1V5MA 2I5FA 3D8EA 2Y8GA 1MK7B 1V61A 3P6AA 1OMWA 3QBVB 4HDQA 2YT0A 2DFKA 3F0WA 2P8VA 3VIAA 1AQCA 3BJIA 3SNHA 2N0YA 4NY0A 3D8FA 4A6HA 3GYOA 2I1JA 3DXCA 3ODXA 3N7CA 3WYFB 2FJLA 1WJ1A 3FM8C 3UZTA 3D8DA 5LOPB 2N23A 2NZ8B 2R09A 1QC6A 1XD4A 1FGZA 3IVFA 5C6RA 2LG1A 3AU4A 3HQCA 1XX0A 2ELAA 1DDMA 1FB8A 4IOYX 4HDOA 2RNRB 4PQ0A 3ODWA 2MDXA 1RJ2A 2MKRA 4HATB 2VSZA 2DHKA 3U7DA 1MKEA 3BINA 1V5PA 4HAWB 4L6EA 2I5CA 1UPRA 4A5KA 2G35A 2M14A 5JLJB 1X05A 1TXDA 1Y19B 1ZC4B 4Z2MB 4WJ7A 2D9ZA 4KVGB 4GMXB 4Z2NA 1DBHA 3WA0A 5J3QA 1UNQA 2H7EA 3ZVRA 2DX5A 2DA0A 1XODA 2V76A 1P6SA 4DX90 2YS5A 1EGXA 2GS0A 1M7EA 2DLWA 3A8QA 1SGHA 2LYDA 4YL8A 2EJ8A 3DXDA 4EJNA 4K81A 4YONA 2COCA 3RCPA 3ZDTA 5C79A 4TKNA 2MWNB 4HB2B 1Z87A 4IFSA 2D4QA 4GPTB 2L2IA 5D3VA 3F5RA 1U2BA 2UVMA 4HAXB 5C5BA 1PLSA 2RSGA 4A6FA 5D3YA 4D0NB 1NI2A 1K5GB 2DYQA 4ZRIA 1NTVA 1X11A 3OANA 2VRWB 2CODA 4CHMA 2YVCA 3QIJA 1SHCA 4F7UP 2LKOA 3A98B 1XR0B 2MFQA 5KCVA 2KGXB 1B55A 5D3WA 2P0DA 1WVHA 5D27A 3MDBC 5CLLB 2YT1A 2I1KA 1U5GA 4WSFA 1J19A 3HW2B 3HK0A 4H8SA 1LB1A 2X18A 1Y5OA 5JHGA 2CRFA 4NSWA 3KY9A 3KSYA 1UPQA 1LW3A 5D3XA 1N3HA 1ZVRA 2RUKB 1H10A 4F7GA 5JHHA 1ZC3B 4CYEA 1FHOA 3SV1A 1J0WA 2W2XC 3U8ZA 2GJYA 1KI1B 3SYXA 4CHJA 2M38A 3A8PA 5LONB 5C5BB 1ZSQA 3KRWA 2COAA 2RGNB 2YSZA 1WGUA 1RRPB 2D9WA 1BWNA 2LOZA 5EFXA 2RVBB 2ZPYA 1EVHA 1MAIA 2DTCA 1H4RA 5HE0A 2IYBA 2OQBA 2K2JA 2ROVA 1MIXA 2OTXA 2BCJA 4Y94A 1MPHA 5J3YA 4DX8A
chains in the Genus database with same CATH superfamily
4GMVA 1V5UA 3KZ1A 2DHJA 3MPXA 2Z13A 3PEGA 2D9YA 4DXAB 2Z0OA 4GZUA 3CXBB 2EMTA 4A6FB 3TCAA 2K8EA 5FI0A 3HIEA 1BTNA 1KZGA 2J0KA 1X1FA 2RRFA 1U5DA 4MY6A 5KQ1A 3NWAA 4KHBA 5DHAB 1K5DB 3V5WA 1XKEA 2PZ1A 4ZRJA 5LG4B 4HB4B 2AEHA 4HSIA 1X86A 4HAUB 1ISNA 1FOEA 3VOQA 3TVVA 1V88A 1P3RA 1QQGA 3TFMA 2NBVA 2RLOA 4PNKA 2AL6A 5CLQB 2KUPA 1W1HA 1E5WA 2Y8FA 4HB0B 4K17A 1KZ7A 3A58A 4EKUA 1WGQA 3NSUA 1M7RA 1UNPA 4OT1A 4K2OA 5HE3A 1DDWA 2COFA 5L81A 1FGYA 4TYZA 1XCGA 3FSSA 4KHBB 1ZM0A 4QJ3B 3PVLA 1GC7A 1NTYA 4F7HA 3PVWA 5FI1A 1DROA 1DYNA 1UNRA 2K2UA 2GCJA 4DBBA 3G9WA 3PVUA 2EMSA 1TQZA 3SO6A 1U29A 2W2WA 2ADZA 2DHIA 3T06A 1V89A 2HE7A 2DYNA 4XWXA 4GN1A 1MI1A 1WJMA 1W1DA 2CAYA 3X23A 1PFJA 5DHFB 3TO1A 1FHWA 1U5EA 3CIKA 3O96A 2Q13A 3ODOA 2XQNM 1WI1A 2JP2A 5GOWB 3SUZA 2ZKMX 4ZRKA 4BBKA 4A6KA 1PMSA 3GYPA 1U27A 4KHAA 1I7AA 1TJ6A 2KR0A 3ML4A 2NMBA 3ULCA 2QKMA 1U5FA 3DXEA 2Z0PA 5DI9B 3QWMA 2J0MA 4GXBA 2YS1A 2Z0QA 4OSNA 3NWDA 2KUQA 2UZRA 4GNKB 4KAXB 5KQ4A 5JP4A 2YF0A 2LOXA 3PZDA 4HAVB 2KCJA 3PG7A 2J59M 3TW1A 2ELBA 5J3TA 2VKIA 2D11A 2L1CA 1BTKA 1DDVA 4B6HA 4WVFB 1GG3A 1OY2A 5DH9B 2QKLA 3M1IB 4KHOA 2R0DA 5HE1A 3HSAA 1EF1A 4C0AA 3B77A 2J0JA 2DX1A 2LULA 1I2HA 2H7DA 4K2PA 1AWEA 3P7ZA 1OQNA 2IFSA 2Y7BA 4EMOA 1IRSA 3KRXA 2D9VA 2D2QA 1MK9B 2P0HA 1EAZA 3FEHA 1WG7A 2DN6A 2YS3A 4HB3B 2ROZB 3LJUX 2D10A 4P7IA 1MIZB 4HAZB 3AU5A 3PSCA 2CY5A 4MT7A 2CY4A 2Z4DA 5I2MA 3PP2A 5C16A 2EC1A 2DKPA 2W2XD 3ULBA 3FVCA 2E2XA 1GC6A 1P5TA 2YT2A 2P0FA 2D9XA 1X1GA 1FAOA 1W1GA 2DKQA 4MK0A 4HAYB 1NU2A 3AJ4A 1BAKA 5DIFB 2YRYA 2K00A 2HTHB 1Q67A 5IRSA 2GCLA 1FHXA 5HE2A 2UZSA 4IAPA 4HHVA 1UEFA 1V5MA 2I5FA 3D8EA 2Y8GA 1MK7B 1V61A 3P6AA 1OMWA 3QBVB 4HDQA 2YT0A 2DFKA 3F0WA 2P8VA 3VIAA 1AQCA 3BJIA 3SNHA 2N0YA 4NY0A 3D8FA 4A6HA 3GYOA 2I1JA 3DXCA 3ODXA 3N7CA 3WYFB 2FJLA 1WJ1A 4QJ5B 3FM8C 2K49A 3UZTA 3D8DA 3OHMB 5LOPB 2N23A 2NZ8B 2R09A 4D6WA 1QC6A 1XD4A 1FGZA 3IVFA 5C6RA 2LG1A 3AU4A 3HQCA 1XX0A 2ELAA 1DDMA 1FB8A 4IOYX 3NW8A 4HDOA 2RNRB 4CSQA 4PQ0A 3ODWA 2MDXA 1RJ2A 2MKRA 4HATB 2VSZA 2DHKA 3U7DA 2GUMA 1MKEA 3DCXA 3BINA 1V5PA 4HAWB 4L6EA 2I5CA 1UPRA 4A5KA 2G35A 2M14A 5JLJB 1X05A 4QXAB 1TXDA 1Y19B 1ZC4B 4Z2MB 4WJ7A 2D9ZA 4KVGB 1ZYIA 4GMXB 4Z2NA 5M4YB 1DBHA 3WA0A 4L1RA 5J3QA 2KIGA 1UNQA 2H7EA 3ZVRA 2DX5A 2DA0A 1XODA 2V76A 2R2YA 1P6SA 4DX90 2YS5A 1EGXA 2GS0A 1M7EA 2DLWA 3A8QA 1SGHA 2LYDA 4YL8A 2EJ8A 3DXDA 2KIEA 4EJNA 4K81A 4YONA 2COCA 3RCPA 5I2SA 3ZDTA 5C79A 4TKNA 2MWNB 4HB2B 1Z87A 4IFSA 2D4QA 4GPTB 2L2IA 5D3VA 3F5RA 1U2BA 2UVMA 4HAXB 5C5BA 1PLSA 2RSGA 2Z59A 4A6FA 5D3YA 4D0NB 1NI2A 1K5GB 2DYQA 4ZRIA 1NTVA 1X11A 3OANA 2VRWB 2CODA 4CHMA 2YVCA 3QIJA 1SHCA 4F7UP 2LKOA 3NWFA 3A98B 1XR0B 2MFQA 5KCVA 2KGXB 1B55A 5D3WA 2P0DA 1WVHA 5D27A 3MDBC 5CLLB 2YT1A 2I1KA 1U5GA 4WSFA 1J19A 3HW2B 3HK0A 4H8SA 1LB1A 2X18A 1Y5OA 5JHGA 2CRFA 4NSWA 3KY9A 3KSYA 1UPQA 4GOUA 1LW3A 5D3XA 1N3HA 1ZVRA 2RUKB 1H10A 4F7GA 5JHHA 1ZC3B 4CYEA 1FHOA 3SV1A 1J0WA 2W2XC 3U8ZA 2GJYA 1KI1B 3SYXA 4CHJA 2M38A 4QJ4B 3A8PA 5LONB 5C5BB 1ZSQA 3KRWA 2COAA 2RGNB 2FJUB 2YSZA 1WGUA 3U12A 1RRPB 2D9WA 1BWNA 2LOZA 5EFXA 2RVBB 2ZPYA 1EVHA 1MAIA 2DTCA 1H4RA 4DIXA 1T77A 5HE0A 2IYBA 2OQBA 2Z14A 2K2JA 2ROVA 1MIXA 2OTXA 2BCJA 4Y94A 1MPHA 5J3YA 4DX8A
chains in the Genus database with same CATH topology
4GMVA 1V5UA 3KZ1A 2DHJA 3MPXA 4DXAB 3PEGA 2D9YA 2Z0OA 4GZUA 3CXBB 2EMTA 4A6FB 3TCAA 5FI0A 1BTNA 1KZGA 2J0KA 1X1FA 1U5DA 4MY6A 5KQ1A 5DHAB 1K5DB 3V5WA 1XKEA 2PZ1A 4ZRJA 4HB4B 2AEHA 1X86A 4HAUB 1ISNA 1FOEA 3VOQA 3TVVA 1V88A 1P3RA 1QQGA 3TFMA 2RLOA 4PNKA 2AL6A 5CLQB 2KUPA 1W1HA 1E5WA 2Y8FA 4HB0B 4K17A 1KZ7A 4EKUA 1WGQA 3NSUA 1M7RA 1UNPA 4K2OA 5HE3A 1DDWA 2COFA 5L81A 1FGYA 4TYZA 1XCGA 3FSSA 4KHBB 1ZM0A 3PVLA 1GC7A 1NTYA 4F7HA 3PVWA 5FI1A 1DROA 1DYNA 1UNRA 2K2UA 2GCJA 4DBBA 3G9WA 3PVUA 2EMSA 1TQZA 3SO6A 1U29A 2W2WA 2ADZA 2DHIA 3T06A 1V89A 2HE7A 2DYNA 4XWXA 4GN1A 1WJMA 1W1DA 2CAYA 3X23A 1PFJA 5DHFB 3TO1A 1FHWA 1U5EA 3CIKA 3O96A 2Q13A 3ODOA 2XQNM 1WI1A 2JP2A 5GOWB 3SUZA 4BBKA 4ZRKA 4A6KA 1PMSA 3GYPA 1U27A 4KHAA 1I7AA 1TJ6A 3ML4A 2NMBA 3ULCA 2QKMA 1U5FA 3DXEA 2Z0PA 5DI9B 3QWMA 2J0MA 4GXBA 2YS1A 2Z0QA 2UZRA 4KAXB 5KQ4A 5JP4A 2YF0A 2LOXA 3PZDA 4HAVB 2KCJA 3PG7A 2J59M 3TW1A 2ELBA 5J3TA 2VKIA 2D11A 2L1CA 1BTKA 1DDVA 4B6HA 4WVFB 1GG3A 1OY2A 5DH9B 2QKLA 3M1IB 4KHOA 2R0DA 5HE1A 1EF1A 4C0AA 2J0JA 2DX1A 2LULA 1I2HA 2H7DA 4K2PA 1AWEA 3P7ZA 1OQNA 2IFSA 2Y7BA 4EMOA 1IRSA 3KRXA 2D9VA 2D2QA 1MK9B 2P0HA 1EAZA 3FEHA 1WG7A 2DN6A 2YS3A 4HB3B 2ROZB 3LJUX 2D10A 4P7IA 1MIZB 4HAZB 3AU5A 3PSCA 2CY5A 4MT7A 2CY4A 3PP2A 5C16A 2EC1A 2DKPA 2W2XD 3ULBA 2E2XA 1GC6A 1P5TA 2P0FA 2D9XA 1X1GA 1FAOA 1W1GA 2DKQA 4MK0A 4HAYB 1NU2A 3AJ4A 1BAKA 5DIFB 2YRYA 2K00A 2HTHB 1Q67A 2GCLA 1FHXA 5HE2A 4IAPA 2UZSA 4HHVA 1UEFA 1V5MA 2I5FA 3D8EA 2Y8GA 1MK7B 1V61A 3P6AA 1OMWA 3QBVB 4HDQA 2YT0A 2DFKA 3F0WA 2P8VA 3VIAA 1AQCA 3BJIA 3SNHA 2N0YA 4NY0A 3D8FA 4A6HA 3GYOA 2I1JA 3DXCA 3ODXA 3N7CA 3WYFB 2FJLA 1WJ1A 3FM8C 3UZTA 3D8DA 5LOPB 2N23A 2NZ8B 2R09A 1QC6A 1XD4A 1FGZA 3IVFA 5C6RA 2LG1A 3AU4A 3HQCA 1XX0A 2ELAA 1DDMA 1FB8A 4IOYX 4HDOA 2RNRB 4PQ0A 3ODWA 2MDXA 1RJ2A 2MKRA 4HATB 2VSZA 2DHKA 3U7DA 1MKEA 3BINA 1V5PA 4HAWB 4L6EA 2I5CA 1UPRA 4A5KA 2G35A 2M14A 5JLJB 1X05A 1TXDA 1Y19B 1ZC4B 4Z2MB 4WJ7A 2D9ZA 4KVGB 4GMXB 4Z2NA 1DBHA 3WA0A 5J3QA 1UNQA 2H7EA 3ZVRA 2DX5A 2DA0A 1XODA 2V76A 1P6SA 4DX90 2YS5A 1EGXA 2GS0A 1M7EA 2DLWA 3A8QA 1SGHA 2LYDA 4YL8A 2EJ8A 3DXDA 4EJNA 4K81A 4YONA 2COCA 3RCPA 3ZDTA 5C79A 4TKNA 2MWNB 4HB2B 1Z87A 4IFSA 2D4QA 4GPTB 2L2IA 5D3VA 3F5RA 1U2BA 2UVMA 4HAXB 5C5BA 1PLSA 2RSGA 4A6FA 5D3YA 4D0NB 1NI2A 1K5GB 2DYQA 4ZRIA 1NTVA 1X11A 3OANA 2VRWB 2CODA 4CHMA 2YVCA 3QIJA 1SHCA 4F7UP 2LKOA 3A98B 1XR0B 2MFQA 5KCVA 2KGXB 1B55A 5D3WA 2P0DA 1WVHA 5D27A 3MDBC 5CLLB 2YT1A 2I1KA 1U5GA 4WSFA 1J19A 3HW2B 3HK0A 4H8SA 1LB1A 2X18A 1Y5OA 5JHGA 2CRFA 4NSWA 3KY9A 3KSYA 1UPQA 1LW3A 5D3XA 1N3HA 1ZVRA 2RUKB 1H10A 4F7GA 5JHHA 1ZC3B 4CYEA 1FHOA 3SV1A 1J0WA 2W2XC 3U8ZA 2GJYA 1KI1B 3SYXA 4CHJA 2M38A 3A8PA 5LONB 5C5BB 1ZSQA 3KRWA 2COAA 2RGNB 2YSZA 1WGUA 1RRPB 2D9WA 1BWNA 2LOZA 5EFXA 2RVBB 2ZPYA 1EVHA 1MAIA 2DTCA 1H4RA 5HE0A 2IYBA 2OQBA 2K2JA 2ROVA 1MIXA 2OTXA 2BCJA 4Y94A 1MPHA 5J3YA 4DX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GMV A;  1V5U A;  3KZ1 A;  2DHJ A;  3MPX A;  4DXA B;  3PEG A;  2D9Y A;  2Z0O A;  4GZU A;  3CXB B;  2EMT A;  4A6F B;  3TCA A;  5FI0 A;  1BTN A;  1KZG A;  2J0K A;  1X1F A;  1U5D A;  4MY6 A;  5KQ1 A;  5DHA B;  1K5D B;  3V5W A;  1XKE A;  2PZ1 A;  4ZRJ A;  4HB4 B;  2AEH A;  1X86 A;  4HAU B;  1ISN A;  1FOE A;  3VOQ A;  3TVV A;  1V88 A;  1P3R A;  1QQG A;  3TFM A;  2RLO A;  4PNK A;  2AL6 A;  5CLQ B;  2KUP A;  1W1H A;  1E5W A;  2Y8F A;  4HB0 B;  4K17 A;  1KZ7 A;  4EKU A;  1WGQ A;  3NSU A;  1M7R A;  1UNP A;  4K2O A;  5HE3 A;  1DDW A;  2COF A;  5L81 A;  1FGY A;  4TYZ A;  1XCG A;  3FSS A;  4KHB B;  1ZM0 A;  3PVL A;  1GC7 A;  1NTY A;  4F7H A;  3PVW A;  5FI1 A;  1DRO A;  1DYN A;  1UNR A;  2K2U A;  2GCJ A;  4DBB A;  3G9W A;  3PVU A;  2EMS A;  1TQZ A;  3SO6 A;  1U29 A;  2W2W A;  2ADZ A;  2DHI A;  3T06 A;  1V89 A;  2HE7 A;  2DYN A;  4XWX A;  4GN1 A;  1WJM A;  1W1D A;  2CAY A;  3X23 A;  1PFJ A;  5DHF B;  3TO1 A;  1FHW A;  1U5E A;  3CIK A;  3O96 A;  2Q13 A;  3ODO A;  2XQN M;  1WI1 A;  2JP2 A;  5GOW B;  3SUZ A;  4BBK A;  4ZRK A;  4A6K A;  1PMS A;  3GYP A;  1U27 A;  4KHA A;  1I7A A;  1TJ6 A;  3ML4 A;  2NMB A;  3ULC A;  2QKM A;  1U5F A;  3DXE A;  2Z0P A;  5DI9 B;  3QWM A;  2J0M A;  4GXB A;  2YS1 A;  2Z0Q A;  2UZR A;  4KAX B;  5KQ4 A;  5JP4 A;  2YF0 A;  2LOX A;  3PZD A;  4HAV B;  2KCJ A;  3PG7 A;  2J59 M;  3TW1 A;  2ELB A;  5J3T A;  2VKI A;  2D11 A;  2L1C A;  1BTK A;  1DDV A;  4B6H A;  4WVF B;  1GG3 A;  1OY2 A;  5DH9 B;  2QKL A;  3M1I B;  4KHO A;  2R0D A;  5HE1 A;  1EF1 A;  4C0A A;  2J0J A;  2DX1 A;  2LUL A;  1I2H A;  2H7D A;  4K2P A;  1AWE A;  3P7Z A;  1OQN A;  2IFS A;  2Y7B A;  4EMO A;  1IRS A;  3KRX A;  2D9V A;  2D2Q A;  1MK9 B;  2P0H A;  1EAZ A;  3FEH A;  1WG7 A;  2DN6 A;  2YS3 A;  4HB3 B;  2ROZ B;  3LJU X;  2D10 A;  4P7I A;  1MIZ B;  4HAZ B;  3AU5 A;  3PSC A;  2CY5 A;  4MT7 A;  2CY4 A;  3PP2 A;  5C16 A;  2EC1 A;  2DKP A;  2W2X D;  3ULB A;  2E2X A;  1GC6 A;  1P5T A;  2P0F A;  2D9X A;  1X1G A;  1FAO A;  1W1G A;  2DKQ A;  4MK0 A;  4HAY B;  1NU2 A;  3AJ4 A;  1BAK A;  5DIF B;  2YRY A;  2K00 A;  2HTH B;  1Q67 A;  2GCL A;  1FHX A;  5HE2 A;  4IAP A;  2UZS A;  4HHV A;  1UEF A;  1V5M A;  2I5F A;  3D8E A;  2Y8G A;  1MK7 B;  1V61 A;  3P6A A;  1OMW A;  3QBV B;  4HDQ A;  2YT0 A;  2DFK A;  3F0W A;  2P8V A;  3VIA A;  1AQC A;  3BJI A;  3SNH A;  2N0Y A;  4NY0 A;  3D8F A;  4A6H A;  3GYO A;  2I1J A;  3DXC A;  3ODX A;  3N7C A;  3WYF B;  2FJL A;  1WJ1 A;  3FM8 C;  3UZT A;  3D8D A;  5LOP B;  2N23 A;  2NZ8 B;  2R09 A;  1QC6 A;  1XD4 A;  1FGZ A;  3IVF A;  5C6R A;  2LG1 A;  3AU4 A;  3HQC A;  1XX0 A;  2ELA A;  1DDM A;  1FB8 A;  4IOY X;  4HDO A;  2RNR B;  4PQ0 A;  3ODW A;  2MDX A;  1RJ2 A;  2MKR A;  4HAT B;  2VSZ A;  2DHK A;  3U7D A;  1MKE A;  3BIN A;  1V5P A;  4HAW B;  4L6E A;  2I5C A;  1UPR A;  4A5K A;  2G35 A;  2M14 A;  5JLJ B;  1X05 A;  1TXD A;  1Y19 B;  1ZC4 B;  4Z2M B;  4WJ7 A;  2D9Z A;  4KVG B;  4GMX B;  4Z2N A;  1DBH A;  3WA0 A;  5J3Q A;  1UNQ A;  2H7E A;  3ZVR A;  2DX5 A;  2DA0 A;  1XOD A;  2V76 A;  1P6S A;  4DX9 0;  2YS5 A;  1EGX A;  2GS0 A;  1M7E A;  2DLW A;  3A8Q A;  1SGH A;  2LYD A;  4YL8 A;  2EJ8 A;  3DXD A;  4EJN A;  4K81 A;  4YON A;  2COC A;  3RCP A;  3ZDT A;  5C79 A;  4TKN A;  2MWN B;  4HB2 B;  1Z87 A;  4IFS A;  2D4Q A;  4GPT B;  2L2I A;  5D3V A;  3F5R A;  1U2B A;  2UVM A;  4HAX B;  5C5B A;  1PLS A;  2RSG A;  4A6F A;  5D3Y A;  4D0N B;  1NI2 A;  1K5G B;  2DYQ A;  4ZRI A;  1NTV A;  1X11 A;  3OAN A;  2VRW B;  2COD A;  4CHM A;  2YVC A;  3QIJ A;  1SHC A;  4F7U P;  2LKO A;  3A98 B;  1XR0 B;  2MFQ A;  5KCV A;  2KGX B;  1B55 A;  5D3W A;  2P0D A;  1WVH A;  5D27 A;  3MDB C;  5CLL B;  2YT1 A;  2I1K A;  1U5G A;  4WSF A;  1J19 A;  3HW2 B;  3HK0 A;  4H8S A;  1LB1 A;  2X18 A;  1Y5O A;  5JHG A;  2CRF A;  4NSW A;  3KY9 A;  3KSY A;  1UPQ A;  1LW3 A;  5D3X A;  1N3H A;  1ZVR A;  2RUK B;  1H10 A;  4F7G A;  5JHH A;  1ZC3 B;  4CYE A;  1FHO A;  3SV1 A;  1J0W A;  2W2X C;  3U8Z A;  2GJY A;  1KI1 B;  3SYX A;  4CHJ A;  2M38 A;  3A8P A;  5LON B;  5C5B B;  1ZSQ A;  3KRW A;  2COA A;  2RGN B;  2YSZ A;  1WGU A;  1RRP B;  2D9W A;  1BWN A;  2LOZ A;  5EFX A;  2RVB B;  2ZPY A;  1EVH A;  1MAI A;  2DTC A;  1H4R A;  5HE0 A;  2IYB A;  2OQB A;  2K2J A;  2ROV A;  1MIX A;  2OTX A;  2BCJ A;  4Y94 A;  1MPH A;  5J3Y A;  4DX8 A; 
#chains in the Genus database with same CATH topology
 4GMV A;  1V5U A;  3KZ1 A;  2DHJ A;  3MPX A;  2Z13 A;  3PEG A;  2D9Y A;  4DXA B;  2Z0O A;  4GZU A;  3CXB B;  2EMT A;  4A6F B;  3TCA A;  2K8E A;  5FI0 A;  3HIE A;  1BTN A;  1KZG A;  2J0K A;  1X1F A;  2RRF A;  1U5D A;  4MY6 A;  5KQ1 A;  3NWA A;  4KHB A;  5DHA B;  1K5D B;  3V5W A;  1XKE A;  2PZ1 A;  4ZRJ A;  5LG4 B;  4HB4 B;  2AEH A;  4HSI A;  1X86 A;  4HAU B;  1ISN A;  1FOE A;  3VOQ A;  3TVV A;  1V88 A;  1P3R A;  1QQG A;  3TFM A;  2NBV A;  2RLO A;  4PNK A;  2AL6 A;  5CLQ B;  2KUP A;  1W1H A;  1E5W A;  2Y8F A;  4HB0 B;  4K17 A;  1KZ7 A;  3A58 A;  4EKU A;  1WGQ A;  3NSU A;  1M7R A;  1UNP A;  4OT1 A;  4K2O A;  5HE3 A;  1DDW A;  2COF A;  5L81 A;  1FGY A;  4TYZ A;  1XCG A;  3FSS A;  4KHB B;  1ZM0 A;  4QJ3 B;  3PVL A;  1GC7 A;  1NTY A;  4F7H A;  3PVW A;  5FI1 A;  1DRO A;  1DYN A;  1UNR A;  2K2U A;  2GCJ A;  4DBB A;  3G9W A;  3PVU A;  2EMS A;  1TQZ A;  3SO6 A;  1U29 A;  2W2W A;  2ADZ A;  2DHI A;  3T06 A;  1V89 A;  2HE7 A;  2DYN A;  4XWX A;  4GN1 A;  1MI1 A;  1WJM A;  1W1D A;  2CAY A;  3X23 A;  1PFJ A;  5DHF B;  3TO1 A;  1FHW A;  1U5E A;  3CIK A;  3O96 A;  2Q13 A;  3ODO A;  2XQN M;  1WI1 A;  2JP2 A;  5GOW B;  3SUZ A;  2ZKM X;  4ZRK A;  4BBK A;  4A6K A;  1PMS A;  3GYP A;  1U27 A;  4KHA A;  1I7A A;  1TJ6 A;  2KR0 A;  3ML4 A;  2NMB A;  3ULC A;  2QKM A;  1U5F A;  3DXE A;  2Z0P A;  5DI9 B;  3QWM A;  2J0M A;  4GXB A;  2YS1 A;  2Z0Q A;  4OSN A;  3NWD A;  2KUQ A;  2UZR A;  4GNK B;  4KAX B;  5KQ4 A;  5JP4 A;  2YF0 A;  2LOX A;  3PZD A;  4HAV B;  2KCJ A;  3PG7 A;  2J59 M;  3TW1 A;  2ELB A;  5J3T A;  2VKI A;  2D11 A;  2L1C A;  1BTK A;  1DDV A;  4B6H A;  4WVF B;  1GG3 A;  1OY2 A;  5DH9 B;  2QKL A;  3M1I B;  4KHO A;  2R0D A;  5HE1 A;  3HSA A;  1EF1 A;  4C0A A;  3B77 A;  2J0J A;  2DX1 A;  2LUL A;  1I2H A;  2H7D A;  4K2P A;  1AWE A;  3P7Z A;  1OQN A;  2IFS A;  2Y7B A;  4EMO A;  1IRS A;  3KRX A;  2D9V A;  2D2Q A;  1MK9 B;  2P0H A;  1EAZ A;  3FEH A;  1WG7 A;  2DN6 A;  2YS3 A;  4HB3 B;  2ROZ B;  3LJU X;  2D10 A;  4P7I A;  1MIZ B;  4HAZ B;  3AU5 A;  3PSC A;  2CY5 A;  4MT7 A;  2CY4 A;  2Z4D A;  5I2M A;  3PP2 A;  5C16 A;  2EC1 A;  2DKP A;  2W2X D;  3ULB A;  3FVC A;  2E2X A;  1GC6 A;  1P5T A;  2YT2 A;  2P0F A;  2D9X A;  1X1G A;  1FAO A;  1W1G A;  2DKQ A;  4MK0 A;  4HAY B;  1NU2 A;  3AJ4 A;  1BAK A;  5DIF B;  2YRY A;  2K00 A;  2HTH B;  1Q67 A;  5IRS A;  2GCL A;  1FHX A;  5HE2 A;  2UZS A;  4IAP A;  4HHV A;  1UEF A;  1V5M A;  2I5F A;  3D8E A;  2Y8G A;  1MK7 B;  1V61 A;  3P6A A;  1OMW A;  3QBV B;  4HDQ A;  2YT0 A;  2DFK A;  3F0W A;  2P8V A;  3VIA A;  1AQC A;  3BJI A;  3SNH A;  2N0Y A;  4NY0 A;  3D8F A;  4A6H A;  3GYO A;  2I1J A;  3DXC A;  3ODX A;  3N7C A;  3WYF B;  2FJL A;  1WJ1 A;  4QJ5 B;  3FM8 C;  2K49 A;  3UZT A;  3D8D A;  3OHM B;  5LOP B;  2N23 A;  2NZ8 B;  2R09 A;  4D6W A;  1QC6 A;  1XD4 A;  1FGZ A;  3IVF A;  5C6R A;  2LG1 A;  3AU4 A;  3HQC A;  1XX0 A;  2ELA A;  1DDM A;  1FB8 A;  4IOY X;  3NW8 A;  4HDO A;  2RNR B;  4CSQ A;  4PQ0 A;  3ODW A;  2MDX A;  1RJ2 A;  2MKR A;  4HAT B;  2VSZ A;  2DHK A;  3U7D A;  2GUM A;  1MKE A;  3DCX A;  3BIN A;  1V5P A;  4HAW B;  4L6E A;  2I5C A;  1UPR A;  4A5K A;  2G35 A;  2M14 A;  5JLJ B;  1X05 A;  4QXA B;  1TXD A;  1Y19 B;  1ZC4 B;  4Z2M B;  4WJ7 A;  2D9Z A;  4KVG B;  1ZYI A;  4GMX B;  4Z2N A;  5M4Y B;  1DBH A;  3WA0 A;  4L1R A;  5J3Q A;  2KIG A;  1UNQ A;  2H7E A;  3ZVR A;  2DX5 A;  2DA0 A;  1XOD A;  2V76 A;  2R2Y A;  1P6S A;  4DX9 0;  2YS5 A;  1EGX A;  2GS0 A;  1M7E A;  2DLW A;  3A8Q A;  1SGH A;  2LYD A;  4YL8 A;  2EJ8 A;  3DXD A;  2KIE A;  4EJN A;  4K81 A;  4YON A;  2COC A;  3RCP A;  5I2S A;  3ZDT A;  5C79 A;  4TKN A;  2MWN B;  4HB2 B;  1Z87 A;  4IFS A;  2D4Q A;  4GPT B;  2L2I A;  5D3V A;  3F5R A;  1U2B A;  2UVM A;  4HAX B;  5C5B A;  1PLS A;  2RSG A;  2Z59 A;  4A6F A;  5D3Y A;  4D0N B;  1NI2 A;  1K5G B;  2DYQ A;  4ZRI A;  1NTV A;  1X11 A;  3OAN A;  2VRW B;  2COD A;  4CHM A;  2YVC A;  3QIJ A;  1SHC A;  4F7U P;  2LKO A;  3NWF A;  3A98 B;  1XR0 B;  2MFQ A;  5KCV A;  2KGX B;  1B55 A;  5D3W A;  2P0D A;  1WVH A;  5D27 A;  3MDB C;  5CLL B;  2YT1 A;  2I1K A;  1U5G A;  4WSF A;  1J19 A;  3HW2 B;  3HK0 A;  4H8S A;  1LB1 A;  2X18 A;  1Y5O A;  5JHG A;  2CRF A;  4NSW A;  3KY9 A;  3KSY A;  1UPQ A;  4GOU A;  1LW3 A;  5D3X A;  1N3H A;  1ZVR A;  2RUK B;  1H10 A;  4F7G A;  5JHH A;  1ZC3 B;  4CYE A;  1FHO A;  3SV1 A;  1J0W A;  2W2X C;  3U8Z A;  2GJY A;  1KI1 B;  3SYX A;  4CHJ A;  2M38 A;  4QJ4 B;  3A8P A;  5LON B;  5C5B B;  1ZSQ A;  3KRW A;  2COA A;  2RGN B;  2FJU B;  2YSZ A;  1WGU A;  3U12 A;  1RRP B;  2D9W A;  1BWN A;  2LOZ A;  5EFX A;  2RVB B;  2ZPY A;  1EVH A;  1MAI A;  2DTC A;  1H4R A;  4DIX A;  1T77 A;  5HE0 A;  2IYB A;  2OQB A;  2Z14 A;  2K2J A;  2ROV A;  1MIX A;  2OTX A;  2BCJ A;  4Y94 A;  1MPH A;  5J3Y A;  4DX8 A; 
#chains in the Genus database with same CATH homology
 4GMV A;  1V5U A;  3KZ1 A;  2DHJ A;  3MPX A;  4DXA B;  3PEG A;  2D9Y A;  2Z0O A;  4GZU A;  3CXB B;  2EMT A;  4A6F B;  3TCA A;  5FI0 A;  1BTN A;  1KZG A;  2J0K A;  1X1F A;  1U5D A;  4MY6 A;  5KQ1 A;  5DHA B;  1K5D B;  3V5W A;  1XKE A;  2PZ1 A;  4ZRJ A;  4HB4 B;  2AEH A;  1X86 A;  4HAU B;  1ISN A;  1FOE A;  3VOQ A;  3TVV A;  1V88 A;  1P3R A;  1QQG A;  3TFM A;  2RLO A;  4PNK A;  2AL6 A;  5CLQ B;  2KUP A;  1W1H A;  1E5W A;  2Y8F A;  4HB0 B;  4K17 A;  1KZ7 A;  4EKU A;  1WGQ A;  3NSU A;  1M7R A;  1UNP A;  4K2O A;  5HE3 A;  1DDW A;  2COF A;  5L81 A;  1FGY A;  4TYZ A;  1XCG A;  3FSS A;  4KHB B;  1ZM0 A;  3PVL A;  1GC7 A;  1NTY A;  4F7H A;  3PVW A;  5FI1 A;  1DRO A;  1DYN A;  1UNR A;  2K2U A;  2GCJ A;  4DBB A;  3G9W A;  3PVU A;  2EMS A;  1TQZ A;  3SO6 A;  1U29 A;  2W2W A;  2ADZ A;  2DHI A;  3T06 A;  1V89 A;  2HE7 A;  2DYN A;  4XWX A;  4GN1 A;  1WJM A;  1W1D A;  2CAY A;  3X23 A;  1PFJ A;  5DHF B;  3TO1 A;  1FHW A;  1U5E A;  3CIK A;  3O96 A;  2Q13 A;  3ODO A;  2XQN M;  1WI1 A;  2JP2 A;  5GOW B;  3SUZ A;  4BBK A;  4ZRK A;  4A6K A;  1PMS A;  3GYP A;  1U27 A;  4KHA A;  1I7A A;  1TJ6 A;  3ML4 A;  2NMB A;  3ULC A;  2QKM A;  1U5F A;  3DXE A;  2Z0P A;  5DI9 B;  3QWM A;  2J0M A;  4GXB A;  2YS1 A;  2Z0Q A;  2UZR A;  4KAX B;  5KQ4 A;  5JP4 A;  2YF0 A;  2LOX A;  3PZD A;  4HAV B;  2KCJ A;  3PG7 A;  2J59 M;  3TW1 A;  2ELB A;  5J3T A;  2VKI A;  2D11 A;  2L1C A;  1BTK A;  1DDV A;  4B6H A;  4WVF B;  1GG3 A;  1OY2 A;  5DH9 B;  2QKL A;  3M1I B;  4KHO A;  2R0D A;  5HE1 A;  1EF1 A;  4C0A A;  2J0J A;  2DX1 A;  2LUL A;  1I2H A;  2H7D A;  4K2P A;  1AWE A;  3P7Z A;  1OQN A;  2IFS A;  2Y7B A;  4EMO A;  1IRS A;  3KRX A;  2D9V A;  2D2Q A;  1MK9 B;  2P0H A;  1EAZ A;  3FEH A;  1WG7 A;  2DN6 A;  2YS3 A;  4HB3 B;  2ROZ B;  3LJU X;  2D10 A;  4P7I A;  1MIZ B;  4HAZ B;  3AU5 A;  3PSC A;  2CY5 A;  4MT7 A;  2CY4 A;  3PP2 A;  5C16 A;  2EC1 A;  2DKP A;  2W2X D;  3ULB A;  2E2X A;  1GC6 A;  1P5T A;  2P0F A;  2D9X A;  1X1G A;  1FAO A;  1W1G A;  2DKQ A;  4MK0 A;  4HAY B;  1NU2 A;  3AJ4 A;  1BAK A;  5DIF B;  2YRY A;  2K00 A;  2HTH B;  1Q67 A;  2GCL A;  1FHX A;  5HE2 A;  4IAP A;  2UZS A;  4HHV A;  1UEF A;  1V5M A;  2I5F A;  3D8E A;  2Y8G A;  1MK7 B;  1V61 A;  3P6A A;  1OMW A;  3QBV B;  4HDQ A;  2YT0 A;  2DFK A;  3F0W A;  2P8V A;  3VIA A;  1AQC A;  3BJI A;  3SNH A;  2N0Y A;  4NY0 A;  3D8F A;  4A6H A;  3GYO A;  2I1J A;  3DXC A;  3ODX A;  3N7C A;  3WYF B;  2FJL A;  1WJ1 A;  3FM8 C;  3UZT A;  3D8D A;  5LOP B;  2N23 A;  2NZ8 B;  2R09 A;  1QC6 A;  1XD4 A;  1FGZ A;  3IVF A;  5C6R A;  2LG1 A;  3AU4 A;  3HQC A;  1XX0 A;  2ELA A;  1DDM A;  1FB8 A;  4IOY X;  4HDO A;  2RNR B;  4PQ0 A;  3ODW A;  2MDX A;  1RJ2 A;  2MKR A;  4HAT B;  2VSZ A;  2DHK A;  3U7D A;  1MKE A;  3BIN A;  1V5P A;  4HAW B;  4L6E A;  2I5C A;  1UPR A;  4A5K A;  2G35 A;  2M14 A;  5JLJ B;  1X05 A;  1TXD A;  1Y19 B;  1ZC4 B;  4Z2M B;  4WJ7 A;  2D9Z A;  4KVG B;  4GMX B;  4Z2N A;  1DBH A;  3WA0 A;  5J3Q A;  1UNQ A;  2H7E A;  3ZVR A;  2DX5 A;  2DA0 A;  1XOD A;  2V76 A;  1P6S A;  4DX9 0;  2YS5 A;  1EGX A;  2GS0 A;  1M7E A;  2DLW A;  3A8Q A;  1SGH A;  2LYD A;  4YL8 A;  2EJ8 A;  3DXD A;  4EJN A;  4K81 A;  4YON A;  2COC A;  3RCP A;  3ZDT A;  5C79 A;  4TKN A;  2MWN B;  4HB2 B;  1Z87 A;  4IFS A;  2D4Q A;  4GPT B;  2L2I A;  5D3V A;  3F5R A;  1U2B A;  2UVM A;  4HAX B;  5C5B A;  1PLS A;  2RSG A;  4A6F A;  5D3Y A;  4D0N B;  1NI2 A;  1K5G B;  2DYQ A;  4ZRI A;  1NTV A;  1X11 A;  3OAN A;  2VRW B;  2COD A;  4CHM A;  2YVC A;  3QIJ A;  1SHC A;  4F7U P;  2LKO A;  3A98 B;  1XR0 B;  2MFQ A;  5KCV A;  2KGX B;  1B55 A;  5D3W A;  2P0D A;  1WVH A;  5D27 A;  3MDB C;  5CLL B;  2YT1 A;  2I1K A;  1U5G A;  4WSF A;  1J19 A;  3HW2 B;  3HK0 A;  4H8S A;  1LB1 A;  2X18 A;  1Y5O A;  5JHG A;  2CRF A;  4NSW A;  3KY9 A;  3KSY A;  1UPQ A;  1LW3 A;  5D3X A;  1N3H A;  1ZVR A;  2RUK B;  1H10 A;  4F7G A;  5JHH A;  1ZC3 B;  4CYE A;  1FHO A;  3SV1 A;  1J0W A;  2W2X C;  3U8Z A;  2GJY A;  1KI1 B;  3SYX A;  4CHJ A;  2M38 A;  3A8P A;  5LON B;  5C5B B;  1ZSQ A;  3KRW A;  2COA A;  2RGN B;  2YSZ A;  1WGU A;  1RRP B;  2D9W A;  1BWN A;  2LOZ A;  5EFX A;  2RVB B;  2ZPY A;  1EVH A;  1MAI A;  2DTC A;  1H4R A;  5HE0 A;  2IYB A;  2OQB A;  2K2J A;  2ROV A;  1MIX A;  2OTX A;  2BCJ A;  4Y94 A;  1MPH A;  5J3Y A;  4DX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...