2G35A

Nmr structure of talin-ptb in complex with pipki
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
100
structure length
100
Chain Sequence
LKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Phosphorylation-regulated Focal Adhesion Targeting of Type Igamma Phosphatidylinositol Phosphate Kinase (PIPKIgamma) by Talin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
molecule keywords Talin-1
total genus 15
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2006-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2g35A00
2MFQA 1NTVA 2H7EA 2ADZA 1X1FA 5HE1A 1TXDA 1RJ2A 4GXBA 2YRYA 3KSYA 1ZM0A 5L81A 1UNRA 2YT1A 4TKNA 2CRFA 2Z0QA 3WA0A 3FSSA 3PVUA 4HDQA 3AJ4A 4NSWA 2KCJA 1FGZA 2CY5A 2EC1A 2RLOA 2RNRB 1WVHA 2UVMA 2EJ8A 2I5FA 5JLJB 5FI1A 3V5WA 2L2IA 1BAKA 1Y5OA 2LKOA 2K2JA 2DHKA 3RCPA 3D8FA 2DTCA 1U5GA 1U5FA 2P0DA 5HE2A 2K00A 1RRPB 4HAZB 2MKRA 1MIZB 1IRSA 3N7CA 3F5RA 4MY6A 4B6HA 2D9VA 2P0FA 2D9XA 2L1CA 2W2XC 5HE0A 4BBKA 1MPHA 2COFA 4GZUA 5D3WA 3AU5A 5GOWB 3P6AA 2AEHA 2DN6A 4HB2B 1U29A 2COCA 2RUKB 4EJNA 2HE7A 3TW1A 1BWNA 1J0WA 2D4QA 4P7IA 2KGXB 5HE3A 1AQCA 4Z2MB 1DDVA 2GS0A 1FOEA 1MK9B 3AU4A 3LJUX 2P0HA 2Y8FA 4GMVA 5LOPB 2YS1A 5KQ4A 2D9YA 1XODA 4K2PA 2MWNB 2P8VA 5EFXA 2DLWA 1DROA 3SNHA 1XD4A 2VKIA 3FEHA 5JP4A 3PVWA 4NY0A 1H4RA 5DI9B 1UPQA 2DA0A 2J0MA 3ML4A 2RVBB 1DYNA 4TYZA 1P6SA 2ELBA 3U8ZA 1B55A 3HK0A 1W1DA 1X11A 3SUZA 1LW3A 4K2OA 3T06A 4HAVB 2GCLA 1SGHA 1NU2A 2N0YA 4CHMA 2NZ8B 1BTKA 2CAYA 1OQNA 1WG7A 2N23A 2QKMA 1MIXA 1Y19B 1V61A 2E2XA 4KVGB 1U27A 4WJ7A 1M7RA 1W1HA 2R0DA 2AL6A 1X05A 2YF0A 2MDXA 5CLQB 2PZ1A 2W2XD 1WGQA 2DKQA 1KZGA 2DFKA 2D9WA 2ROVA 4HB3B 1WJ1A 1P5TA 4KHOA 2W2WA 4K17A 2IYBA 4Y94A 2HTHB 3ODXA 4K81A 4CYEA 1MKEA 3F0WA 2DKPA 3TFMA 2J0JA 1MK7B 1OY2A 2DHIA 4HAWB 3PSCA 1TQZA 1GC7A 1K5DB 2G35A 3SO6A 4IFSA 3GYPA 5DIFB 3HQCA 2LULA 1ZC3B 3PP2A 1E5WA 3CIKA 2IFSA 4DX8A 5DHFB 4IAPA 1QQGA 3VOQA 3O96A 5J3TA 4H8SA 2UZRA 1PMSA 4MK0A 3QIJA 2EMSA 5C79A 2I1JA 2CY4A 3ODWA 2D10A 4ZRJA 4HAUB 4PNKA 4KAXB 1XKEA 1K5GB 2KUPA 4F7UP 1U5EA 1X86A 2DYQA 4HAXB 1UEFA 2DYNA 5KQ1A 2XQNM 4L6EA 4F7GA 4D0NB 1TJ6A 3D8DA 3NSUA 2GCJA 3DXDA 1V5PA 1H10A 3A8PA 2LYDA 3TCAA 1ZC4B 5C6RA 3P7ZA 4WVFB 4DXAB 1UPRA 1Z87A 2OQBA 1FHOA 1GC6A 1N3HA 2LOZA 2DX5A 5FI0A 4DBBA 1LB1A 4PQ0A 4GN1A 4ZRKA 2YVCA 3IVFA 2ZPYA 5JHGA 4A5KA 2Z0OA 5C5BA 2JP2A 1SHCA 4KHBB 3GYOA 3PVLA 2Y8GA 2YSZA 2M38A 1EVHA 1W1GA 2ROZB 4A6KA 5D3VA 4GPTB 5KCVA 2VRWB 2J0KA 1UNQA 3KRWA 4HATB 3WYFB 4CHJA 1KZ7A 3UZTA 1NTYA 1FHWA 2K2UA 3OANA 3X23A 3A98B 4C0AA 2I1KA 5C16A 1MAIA 2I5CA 1WGUA 2D9ZA 1V89A 3ZVRA 3HW2B 2COAA 2DHJA 2Z0PA 5D3YA 2X18A 1DDWA 1FB8A 1KI1B 4F7HA 5DHAB 2RSGA 5LONB 1WI1A 1FGYA 1M7EA 1DDMA 1V5UA 2YS5A 4HB0B 3CXBB 3BINA 2R09A 3QBVB 1UNPA 4DX90 3KRXA 1FHXA 2M14A 3SYXA 1ISNA 2GJYA 4HDOA 4YL8A 3PZDA 2D2QA 2DX1A 3TO1A 3ULBA 4IOYX 3G9WA 2ELAA 1GG3A 5DH9B 2VSZA 2LG1A 4XWXA 5JHHA 2CODA 4HAYB 2EMTA 4GMXB 2YT0A 4HB4B 2BCJA 3VIAA 4A6FB 1FAOA 3M1IB 5C5BB 1U2BA 1P3RA 2Y7BA 1ZSQA 5J3YA 1AWEA 1V5MA 5J3QA 1XCGA 1J19A 3D8EA 2FJLA 1QC6A 1PFJA 3ULCA 2OTXA 1X1GA 1EF1A 3ODOA 3MDBC 1PLSA 4YONA 1NI2A 4Z2NA 3ZDTA 3DXCA 1BTNA 4KHAA 5CLLB 3U7DA 3BJIA 3DXEA 2YS3A 3FM8C 3KZ1A 4A6FA 2NMBA 3QWMA 1I7AA 1ZVRA 3A8QA 4EKUA 2J59M 3KY9A 1XR0B 2UZSA 1I2HA 1DBHA 4MT7A 2QKLA 5D27A 4WSFA 3SV1A 3PG7A 1OMWA 3PEGA 3TVVA 5D3XA 2H7DA 2D11A 3MPXA 1EAZA 4EMOA 2LOXA 2V76A 4A6HA 1WJMA 1V88A 1XX0A 2RGNB 1U5DA 1Q67A 1EGXA 2Q13A 4ZRIA 4HHVA
chains in the Genus database with same CATH superfamily
2MFQA 1NTVA 2H7EA 2ADZA 1X1FA 5HE1A 1TXDA 1RJ2A 4GXBA 2YRYA 3KSYA 1ZM0A 5L81A 1UNRA 2KIEA 2YT1A 3B77A 4TKNA 2CRFA 2Z0QA 3WA0A 3FSSA 4CSQA 3PVUA 4HDQA 3AJ4A 4NSWA 2KCJA 1FGZA 2CY5A 2EC1A 2RLOA 2RNRB 1WVHA 2UVMA 2EJ8A 2I5FA 5JLJB 5FI1A 3V5WA 2L2IA 1BAKA 1Y5OA 2LKOA 2K2JA 2DHKA 3RCPA 3D8FA 2DTCA 5I2MA 5I2SA 1U5GA 1U5FA 2P0DA 5HE2A 2K00A 2R2YA 1RRPB 4HAZB 2MKRA 1MIZB 1IRSA 3N7CA 3F5RA 4MY6A 4B6HA 2D9VA 2P0FA 2D9XA 2L1CA 2W2XC 5HE0A 4BBKA 1MPHA 2COFA 4QJ5B 4GZUA 5D3WA 3AU5A 5GOWB 3P6AA 2AEHA 2DN6A 4HB2B 1U29A 2COCA 2RUKB 4EJNA 2HE7A 3TW1A 1BWNA 1J0WA 2D4QA 2K49A 4P7IA 2KGXB 5HE3A 1AQCA 4Z2MB 1DDVA 2GS0A 1FOEA 1MK9B 3AU4A 3LJUX 2P0HA 2Y8FA 4GMVA 5LOPB 2YS1A 5KQ4A 2D9YA 1XODA 4K2PA 2MWNB 2P8VA 5EFXA 2DLWA 1DROA 3SNHA 1XD4A 2VKIA 3FEHA 5JP4A 3PVWA 4NY0A 1H4RA 5DI9B 1UPQA 2DA0A 2J0MA 3ML4A 2RVBB 1DYNA 4TYZA 1P6SA 2ELBA 3U8ZA 1B55A 3HK0A 1W1DA 1X11A 3SUZA 1LW3A 4K2OA 3T06A 4HAVB 2GCLA 1SGHA 5M4YB 1NU2A 1MI1A 2N0YA 3NW8A 2NZ8B 4CHMA 1BTKA 2CAYA 1OQNA 2K8EA 1WG7A 2N23A 2QKMA 1MIXA 1Y19B 1V61A 2E2XA 4KVGB 1U27A 4WJ7A 1M7RA 1W1HA 2R0DA 2AL6A 1X05A 2YF0A 4OT1A 2MDXA 5CLQB 2PZ1A 2W2XD 1WGQA 2DKQA 1KZGA 2DFKA 2D9WA 2ROVA 4HB3B 1WJ1A 1P5TA 4KHOA 2NBVA 2W2WA 4K17A 2IYBA 4Y94A 4GNKB 2HTHB 3ODXA 4K81A 4CYEA 1MKEA 3F0WA 2DKPA 3TFMA 2J0JA 1MK7B 1OY2A 2DHIA 4HAWB 3PSCA 4D6WA 1TQZA 1GC7A 1K5DB 2G35A 3SO6A 4IFSA 3GYPA 5DIFB 3HQCA 2LULA 1ZC3B 3PP2A 2KUQA 1E5WA 3CIKA 2IFSA 4DX8A 5DHFB 4IAPA 1QQGA 3VOQA 3O96A 5J3TA 4H8SA 2UZRA 1PMSA 1T77A 4MK0A 3QIJA 2EMSA 5C79A 2I1JA 2CY4A 2ZKMX 3ODWA 2D10A 4ZRJA 5LG4B 4HAUB 4PNKA 4KAXB 1XKEA 1K5GB 2KUPA 3A58A 4F7UP 1U5EA 1X86A 2DYQA 4HAXB 1UEFA 2DYNA 3NWFA 5KQ1A 2XQNM 4L6EA 4F7GA 4D0NB 1TJ6A 3D8DA 4OSNA 3NSUA 2GCJA 3DXDA 1V5PA 3HSAA 1H10A 3A8PA 2LYDA 3TCAA 1ZC4B 5C6RA 3P7ZA 4WVFB 4DXAB 1UPRA 1Z87A 2KR0A 2OQBA 1FHOA 1GC6A 3FVCA 1N3HA 2LOZA 3NWDA 2DX5A 3NWAA 3OHMB 2Z4DA 5FI0A 4DBBA 1LB1A 4PQ0A 4GN1A 4ZRKA 2YVCA 3IVFA 2ZPYA 5JHGA 4A5KA 2Z0OA 5C5BA 2JP2A 1SHCA 4KHBB 3GYOA 3PVLA 2Y8GA 2YSZA 2M38A 1EVHA 1W1GA 2ROZB 4QJ3B 4A6KA 5D3VA 4GPTB 5KCVA 2VRWB 2J0KA 1UNQA 3KRWA 4HATB 3WYFB 4CHJA 1KZ7A 3UZTA 1NTYA 1FHWA 2K2UA 3OANA 3X23A 5IRSA 2YT2A 3A98B 4C0AA 2I1KA 5C16A 1MAIA 2I5CA 1WGUA 2D9ZA 1V89A 3ZVRA 3HW2B 2COAA 2DHJA 2Z0PA 5D3YA 2GUMA 2X18A 4KHBA 1DDWA 1FB8A 3HIEA 1KI1B 4F7HA 3DCXA 5DHAB 2Z13A 2RSGA 4DIXA 5LONB 1WI1A 1FGYA 1M7EA 1DDMA 1V5UA 2YS5A 4HB0B 3CXBB 3BINA 2R09A 3QBVB 1UNPA 4DX90 3KRXA 1FHXA 2KIGA 2M14A 3SYXA 1ISNA 2GJYA 4HDOA 4YL8A 3PZDA 4QJ4B 2D2QA 2DX1A 3TO1A 3ULBA 4IOYX 3G9WA 2ELAA 1GG3A 5DH9B 2VSZA 2LG1A 4GOUA 4XWXA 5JHHA 2CODA 4HAYB 2EMTA 4GMXB 2YT0A 4HB4B 2BCJA 3VIAA 4A6FB 1FAOA 3M1IB 5C5BB 1U2BA 1P3RA 2Y7BA 1ZSQA 5J3YA 1AWEA 1V5MA 5J3QA 1XCGA 1J19A 3D8EA 2FJLA 1QC6A 1PFJA 3ULCA 2OTXA 1X1GA 4QXAB 1EF1A 3ODOA 3MDBC 3U12A 1PLSA 4YONA 1NI2A 4Z2NA 3ZDTA 4HSIA 3DXCA 1BTNA 4KHAA 5CLLB 3U7DA 4L1RA 3BJIA 3DXEA 2YS3A 2RRFA 3FM8C 3KZ1A 4A6FA 2NMBA 3QWMA 1I7AA 1ZVRA 3A8QA 4EKUA 2J59M 3KY9A 1XR0B 2UZSA 1I2HA 1DBHA 4MT7A 2QKLA 2Z14A 5D27A 4WSFA 3SV1A 3PG7A 1OMWA 3PEGA 3TVVA 5D3XA 2H7DA 1ZYIA 2D11A 3MPXA 1EAZA 2FJUB 4EMOA 2LOXA 2V76A 4A6HA 1WJMA 1V88A 1XX0A 2RGNB 1U5DA 1Q67A 1EGXA 2Q13A 4ZRIA 2Z59A 4HHVA
chains in the Genus database with same CATH topology
2MFQA 1NTVA 2H7EA 2ADZA 1X1FA 5HE1A 1TXDA 1RJ2A 4GXBA 2YRYA 3KSYA 1ZM0A 5L81A 1UNRA 2YT1A 4TKNA 2CRFA 2Z0QA 3WA0A 3FSSA 3PVUA 4HDQA 3AJ4A 4NSWA 2KCJA 1FGZA 2CY5A 2EC1A 2RLOA 2RNRB 1WVHA 2UVMA 2EJ8A 2I5FA 5JLJB 5FI1A 3V5WA 2L2IA 1BAKA 1Y5OA 2LKOA 2K2JA 2DHKA 3RCPA 3D8FA 2DTCA 1U5GA 1U5FA 2P0DA 5HE2A 2K00A 1RRPB 4HAZB 2MKRA 1MIZB 1IRSA 3N7CA 3F5RA 4MY6A 4B6HA 2D9VA 2P0FA 2D9XA 2L1CA 2W2XC 5HE0A 4BBKA 1MPHA 2COFA 4GZUA 5D3WA 3AU5A 5GOWB 3P6AA 2AEHA 2DN6A 4HB2B 1U29A 2COCA 2RUKB 4EJNA 2HE7A 3TW1A 1BWNA 1J0WA 2D4QA 4P7IA 2KGXB 5HE3A 1AQCA 4Z2MB 1DDVA 2GS0A 1FOEA 1MK9B 3AU4A 3LJUX 2P0HA 2Y8FA 4GMVA 5LOPB 2YS1A 5KQ4A 2D9YA 1XODA 4K2PA 2MWNB 2P8VA 5EFXA 2DLWA 1DROA 3SNHA 1XD4A 2VKIA 3FEHA 5JP4A 3PVWA 4NY0A 1H4RA 5DI9B 1UPQA 2DA0A 2J0MA 3ML4A 2RVBB 1DYNA 4TYZA 1P6SA 2ELBA 3U8ZA 1B55A 3HK0A 1W1DA 1X11A 3SUZA 1LW3A 4K2OA 3T06A 4HAVB 2GCLA 1SGHA 1NU2A 2N0YA 4CHMA 2NZ8B 1BTKA 2CAYA 1OQNA 1WG7A 2N23A 2QKMA 1MIXA 1Y19B 1V61A 2E2XA 4KVGB 1U27A 4WJ7A 1M7RA 1W1HA 2R0DA 2AL6A 1X05A 2YF0A 2MDXA 5CLQB 2PZ1A 2W2XD 1WGQA 2DKQA 1KZGA 2DFKA 2D9WA 2ROVA 4HB3B 1WJ1A 1P5TA 4KHOA 2W2WA 4K17A 2IYBA 4Y94A 2HTHB 3ODXA 4K81A 4CYEA 1MKEA 3F0WA 2DKPA 3TFMA 2J0JA 1MK7B 1OY2A 2DHIA 4HAWB 3PSCA 1TQZA 1GC7A 1K5DB 2G35A 3SO6A 4IFSA 3GYPA 5DIFB 3HQCA 2LULA 1ZC3B 3PP2A 1E5WA 3CIKA 2IFSA 4DX8A 5DHFB 4IAPA 1QQGA 3VOQA 3O96A 5J3TA 4H8SA 2UZRA 1PMSA 4MK0A 3QIJA 2EMSA 5C79A 2I1JA 2CY4A 3ODWA 2D10A 4ZRJA 4HAUB 4PNKA 4KAXB 1XKEA 1K5GB 2KUPA 4F7UP 1U5EA 1X86A 2DYQA 4HAXB 1UEFA 2DYNA 5KQ1A 2XQNM 4L6EA 4F7GA 4D0NB 1TJ6A 3D8DA 3NSUA 2GCJA 3DXDA 1V5PA 1H10A 3A8PA 2LYDA 3TCAA 1ZC4B 5C6RA 3P7ZA 4WVFB 4DXAB 1UPRA 1Z87A 2OQBA 1FHOA 1GC6A 1N3HA 2LOZA 2DX5A 5FI0A 4DBBA 1LB1A 4PQ0A 4GN1A 4ZRKA 2YVCA 3IVFA 2ZPYA 5JHGA 4A5KA 2Z0OA 5C5BA 2JP2A 1SHCA 4KHBB 3GYOA 3PVLA 2Y8GA 2YSZA 2M38A 1EVHA 1W1GA 2ROZB 4A6KA 5D3VA 4GPTB 5KCVA 2VRWB 2J0KA 1UNQA 3KRWA 4HATB 3WYFB 4CHJA 1KZ7A 3UZTA 1NTYA 1FHWA 2K2UA 3OANA 3X23A 3A98B 4C0AA 2I1KA 5C16A 1MAIA 2I5CA 1WGUA 2D9ZA 1V89A 3ZVRA 3HW2B 2COAA 2DHJA 2Z0PA 5D3YA 2X18A 1DDWA 1FB8A 1KI1B 4F7HA 5DHAB 2RSGA 5LONB 1WI1A 1FGYA 1M7EA 1DDMA 1V5UA 2YS5A 4HB0B 3CXBB 3BINA 2R09A 3QBVB 1UNPA 4DX90 3KRXA 1FHXA 2M14A 3SYXA 1ISNA 2GJYA 4HDOA 4YL8A 3PZDA 2D2QA 2DX1A 3TO1A 3ULBA 4IOYX 3G9WA 2ELAA 1GG3A 5DH9B 2VSZA 2LG1A 4XWXA 5JHHA 2CODA 4HAYB 2EMTA 4GMXB 2YT0A 4HB4B 2BCJA 3VIAA 4A6FB 1FAOA 3M1IB 5C5BB 1U2BA 1P3RA 2Y7BA 1ZSQA 5J3YA 1AWEA 1V5MA 5J3QA 1XCGA 1J19A 3D8EA 2FJLA 1QC6A 1PFJA 3ULCA 2OTXA 1X1GA 1EF1A 3ODOA 3MDBC 1PLSA 4YONA 1NI2A 4Z2NA 3ZDTA 3DXCA 1BTNA 4KHAA 5CLLB 3U7DA 3BJIA 3DXEA 2YS3A 3FM8C 3KZ1A 4A6FA 2NMBA 3QWMA 1I7AA 1ZVRA 3A8QA 4EKUA 2J59M 3KY9A 1XR0B 2UZSA 1I2HA 1DBHA 4MT7A 2QKLA 5D27A 4WSFA 3SV1A 3PG7A 1OMWA 3PEGA 3TVVA 5D3XA 2H7DA 2D11A 3MPXA 1EAZA 4EMOA 2LOXA 2V76A 4A6HA 1WJMA 1V88A 1XX0A 2RGNB 1U5DA 1Q67A 1EGXA 2Q13A 4ZRIA 4HHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MFQ A;  1NTV A;  2H7E A;  2ADZ A;  1X1F A;  5HE1 A;  1TXD A;  1RJ2 A;  4GXB A;  2YRY A;  3KSY A;  1ZM0 A;  5L81 A;  1UNR A;  2YT1 A;  4TKN A;  2CRF A;  2Z0Q A;  3WA0 A;  3FSS A;  3PVU A;  4HDQ A;  3AJ4 A;  4NSW A;  2KCJ A;  1FGZ A;  2CY5 A;  2EC1 A;  2RLO A;  2RNR B;  1WVH A;  2UVM A;  2EJ8 A;  2I5F A;  5JLJ B;  5FI1 A;  3V5W A;  2L2I A;  1BAK A;  1Y5O A;  2LKO A;  2K2J A;  2DHK A;  3RCP A;  3D8F A;  2DTC A;  1U5G A;  1U5F A;  2P0D A;  5HE2 A;  2K00 A;  1RRP B;  4HAZ B;  2MKR A;  1MIZ B;  1IRS A;  3N7C A;  3F5R A;  4MY6 A;  4B6H A;  2D9V A;  2P0F A;  2D9X A;  2L1C A;  2W2X C;  5HE0 A;  4BBK A;  1MPH A;  2COF A;  4GZU A;  5D3W A;  3AU5 A;  5GOW B;  3P6A A;  2AEH A;  2DN6 A;  4HB2 B;  1U29 A;  2COC A;  2RUK B;  4EJN A;  2HE7 A;  3TW1 A;  1BWN A;  1J0W A;  2D4Q A;  4P7I A;  2KGX B;  5HE3 A;  1AQC A;  4Z2M B;  1DDV A;  2GS0 A;  1FOE A;  1MK9 B;  3AU4 A;  3LJU X;  2P0H A;  2Y8F A;  4GMV A;  5LOP B;  2YS1 A;  5KQ4 A;  2D9Y A;  1XOD A;  4K2P A;  2MWN B;  2P8V A;  5EFX A;  2DLW A;  1DRO A;  3SNH A;  1XD4 A;  2VKI A;  3FEH A;  5JP4 A;  3PVW A;  4NY0 A;  1H4R A;  5DI9 B;  1UPQ A;  2DA0 A;  2J0M A;  3ML4 A;  2RVB B;  1DYN A;  4TYZ A;  1P6S A;  2ELB A;  3U8Z A;  1B55 A;  3HK0 A;  1W1D A;  1X11 A;  3SUZ A;  1LW3 A;  4K2O A;  3T06 A;  4HAV B;  2GCL A;  1SGH A;  1NU2 A;  2N0Y A;  4CHM A;  2NZ8 B;  1BTK A;  2CAY A;  1OQN A;  1WG7 A;  2N23 A;  2QKM A;  1MIX A;  1Y19 B;  1V61 A;  2E2X A;  4KVG B;  1U27 A;  4WJ7 A;  1M7R A;  1W1H A;  2R0D A;  2AL6 A;  1X05 A;  2YF0 A;  2MDX A;  5CLQ B;  2PZ1 A;  2W2X D;  1WGQ A;  2DKQ A;  1KZG A;  2DFK A;  2D9W A;  2ROV A;  4HB3 B;  1WJ1 A;  1P5T A;  4KHO A;  2W2W A;  4K17 A;  2IYB A;  4Y94 A;  2HTH B;  3ODX A;  4K81 A;  4CYE A;  1MKE A;  3F0W A;  2DKP A;  3TFM A;  2J0J A;  1MK7 B;  1OY2 A;  2DHI A;  4HAW B;  3PSC A;  1TQZ A;  1GC7 A;  1K5D B;  2G35 A;  3SO6 A;  4IFS A;  3GYP A;  5DIF B;  3HQC A;  2LUL A;  1ZC3 B;  3PP2 A;  1E5W A;  3CIK A;  2IFS A;  4DX8 A;  5DHF B;  4IAP A;  1QQG A;  3VOQ A;  3O96 A;  5J3T A;  4H8S A;  2UZR A;  1PMS A;  4MK0 A;  3QIJ A;  2EMS A;  5C79 A;  2I1J A;  2CY4 A;  3ODW A;  2D10 A;  4ZRJ A;  4HAU B;  4PNK A;  4KAX B;  1XKE A;  1K5G B;  2KUP A;  4F7U P;  1U5E A;  1X86 A;  2DYQ A;  4HAX B;  1UEF A;  2DYN A;  5KQ1 A;  2XQN M;  4L6E A;  4F7G A;  4D0N B;  1TJ6 A;  3D8D A;  3NSU A;  2GCJ A;  3DXD A;  1V5P A;  1H10 A;  3A8P A;  2LYD A;  3TCA A;  1ZC4 B;  5C6R A;  3P7Z A;  4WVF B;  4DXA B;  1UPR A;  1Z87 A;  2OQB A;  1FHO A;  1GC6 A;  1N3H A;  2LOZ A;  2DX5 A;  5FI0 A;  4DBB A;  1LB1 A;  4PQ0 A;  4GN1 A;  4ZRK A;  2YVC A;  3IVF A;  2ZPY A;  5JHG A;  4A5K A;  2Z0O A;  5C5B A;  2JP2 A;  1SHC A;  4KHB B;  3GYO A;  3PVL A;  2Y8G A;  2YSZ A;  2M38 A;  1EVH A;  1W1G A;  2ROZ B;  4A6K A;  5D3V A;  4GPT B;  5KCV A;  2VRW B;  2J0K A;  1UNQ A;  3KRW A;  4HAT B;  3WYF B;  4CHJ A;  1KZ7 A;  3UZT A;  1NTY A;  1FHW A;  2K2U A;  3OAN A;  3X23 A;  3A98 B;  4C0A A;  2I1K A;  5C16 A;  1MAI A;  2I5C A;  1WGU A;  2D9Z A;  1V89 A;  3ZVR A;  3HW2 B;  2COA A;  2DHJ A;  2Z0P A;  5D3Y A;  2X18 A;  1DDW A;  1FB8 A;  1KI1 B;  4F7H A;  5DHA B;  2RSG A;  5LON B;  1WI1 A;  1FGY A;  1M7E A;  1DDM A;  1V5U A;  2YS5 A;  4HB0 B;  3CXB B;  3BIN A;  2R09 A;  3QBV B;  1UNP A;  4DX9 0;  3KRX A;  1FHX A;  2M14 A;  3SYX A;  1ISN A;  2GJY A;  4HDO A;  4YL8 A;  3PZD A;  2D2Q A;  2DX1 A;  3TO1 A;  3ULB A;  4IOY X;  3G9W A;  2ELA A;  1GG3 A;  5DH9 B;  2VSZ A;  2LG1 A;  4XWX A;  5JHH A;  2COD A;  4HAY B;  2EMT A;  4GMX B;  2YT0 A;  4HB4 B;  2BCJ A;  3VIA A;  4A6F B;  1FAO A;  3M1I B;  5C5B B;  1U2B A;  1P3R A;  2Y7B A;  1ZSQ A;  5J3Y A;  1AWE A;  1V5M A;  5J3Q A;  1XCG A;  1J19 A;  3D8E A;  2FJL A;  1QC6 A;  1PFJ A;  3ULC A;  2OTX A;  1X1G A;  1EF1 A;  3ODO A;  3MDB C;  1PLS A;  4YON A;  1NI2 A;  4Z2N A;  3ZDT A;  3DXC A;  1BTN A;  4KHA A;  5CLL B;  3U7D A;  3BJI A;  3DXE A;  2YS3 A;  3FM8 C;  3KZ1 A;  4A6F A;  2NMB A;  3QWM A;  1I7A A;  1ZVR A;  3A8Q A;  4EKU A;  2J59 M;  3KY9 A;  1XR0 B;  2UZS A;  1I2H A;  1DBH A;  4MT7 A;  2QKL A;  5D27 A;  4WSF A;  3SV1 A;  3PG7 A;  1OMW A;  3PEG A;  3TVV A;  5D3X A;  2H7D A;  2D11 A;  3MPX A;  1EAZ A;  4EMO A;  2LOX A;  2V76 A;  4A6H A;  1WJM A;  1V88 A;  1XX0 A;  2RGN B;  1U5D A;  1Q67 A;  1EGX A;  2Q13 A;  4ZRI A;  4HHV A; 
#chains in the Genus database with same CATH topology
 2MFQ A;  1NTV A;  2H7E A;  2ADZ A;  1X1F A;  5HE1 A;  1TXD A;  1RJ2 A;  4GXB A;  2YRY A;  3KSY A;  1ZM0 A;  5L81 A;  1UNR A;  2KIE A;  2YT1 A;  3B77 A;  4TKN A;  2CRF A;  2Z0Q A;  3WA0 A;  3FSS A;  4CSQ A;  3PVU A;  4HDQ A;  3AJ4 A;  4NSW A;  2KCJ A;  1FGZ A;  2CY5 A;  2EC1 A;  2RLO A;  2RNR B;  1WVH A;  2UVM A;  2EJ8 A;  2I5F A;  5JLJ B;  5FI1 A;  3V5W A;  2L2I A;  1BAK A;  1Y5O A;  2LKO A;  2K2J A;  2DHK A;  3RCP A;  3D8F A;  2DTC A;  5I2M A;  5I2S A;  1U5G A;  1U5F A;  2P0D A;  5HE2 A;  2K00 A;  2R2Y A;  1RRP B;  4HAZ B;  2MKR A;  1MIZ B;  1IRS A;  3N7C A;  3F5R A;  4MY6 A;  4B6H A;  2D9V A;  2P0F A;  2D9X A;  2L1C A;  2W2X C;  5HE0 A;  4BBK A;  1MPH A;  2COF A;  4QJ5 B;  4GZU A;  5D3W A;  3AU5 A;  5GOW B;  3P6A A;  2AEH A;  2DN6 A;  4HB2 B;  1U29 A;  2COC A;  2RUK B;  4EJN A;  2HE7 A;  3TW1 A;  1BWN A;  1J0W A;  2D4Q A;  2K49 A;  4P7I A;  2KGX B;  5HE3 A;  1AQC A;  4Z2M B;  1DDV A;  2GS0 A;  1FOE A;  1MK9 B;  3AU4 A;  3LJU X;  2P0H A;  2Y8F A;  4GMV A;  5LOP B;  2YS1 A;  5KQ4 A;  2D9Y A;  1XOD A;  4K2P A;  2MWN B;  2P8V A;  5EFX A;  2DLW A;  1DRO A;  3SNH A;  1XD4 A;  2VKI A;  3FEH A;  5JP4 A;  3PVW A;  4NY0 A;  1H4R A;  5DI9 B;  1UPQ A;  2DA0 A;  2J0M A;  3ML4 A;  2RVB B;  1DYN A;  4TYZ A;  1P6S A;  2ELB A;  3U8Z A;  1B55 A;  3HK0 A;  1W1D A;  1X11 A;  3SUZ A;  1LW3 A;  4K2O A;  3T06 A;  4HAV B;  2GCL A;  1SGH A;  5M4Y B;  1NU2 A;  1MI1 A;  2N0Y A;  3NW8 A;  2NZ8 B;  4CHM A;  1BTK A;  2CAY A;  1OQN A;  2K8E A;  1WG7 A;  2N23 A;  2QKM A;  1MIX A;  1Y19 B;  1V61 A;  2E2X A;  4KVG B;  1U27 A;  4WJ7 A;  1M7R A;  1W1H A;  2R0D A;  2AL6 A;  1X05 A;  2YF0 A;  4OT1 A;  2MDX A;  5CLQ B;  2PZ1 A;  2W2X D;  1WGQ A;  2DKQ A;  1KZG A;  2DFK A;  2D9W A;  2ROV A;  4HB3 B;  1WJ1 A;  1P5T A;  4KHO A;  2NBV A;  2W2W A;  4K17 A;  2IYB A;  4Y94 A;  4GNK B;  2HTH B;  3ODX A;  4K81 A;  4CYE A;  1MKE A;  3F0W A;  2DKP A;  3TFM A;  2J0J A;  1MK7 B;  1OY2 A;  2DHI A;  4HAW B;  3PSC A;  4D6W A;  1TQZ A;  1GC7 A;  1K5D B;  2G35 A;  3SO6 A;  4IFS A;  3GYP A;  5DIF B;  3HQC A;  2LUL A;  1ZC3 B;  3PP2 A;  2KUQ A;  1E5W A;  3CIK A;  2IFS A;  4DX8 A;  5DHF B;  4IAP A;  1QQG A;  3VOQ A;  3O96 A;  5J3T A;  4H8S A;  2UZR A;  1PMS A;  1T77 A;  4MK0 A;  3QIJ A;  2EMS A;  5C79 A;  2I1J A;  2CY4 A;  2ZKM X;  3ODW A;  2D10 A;  4ZRJ A;  5LG4 B;  4HAU B;  4PNK A;  4KAX B;  1XKE A;  1K5G B;  2KUP A;  3A58 A;  4F7U P;  1U5E A;  1X86 A;  2DYQ A;  4HAX B;  1UEF A;  2DYN A;  3NWF A;  5KQ1 A;  2XQN M;  4L6E A;  4F7G A;  4D0N B;  1TJ6 A;  3D8D A;  4OSN A;  3NSU A;  2GCJ A;  3DXD A;  1V5P A;  3HSA A;  1H10 A;  3A8P A;  2LYD A;  3TCA A;  1ZC4 B;  5C6R A;  3P7Z A;  4WVF B;  4DXA B;  1UPR A;  1Z87 A;  2KR0 A;  2OQB A;  1FHO A;  1GC6 A;  3FVC A;  1N3H A;  2LOZ A;  3NWD A;  2DX5 A;  3NWA A;  3OHM B;  2Z4D A;  5FI0 A;  4DBB A;  1LB1 A;  4PQ0 A;  4GN1 A;  4ZRK A;  2YVC A;  3IVF A;  2ZPY A;  5JHG A;  4A5K A;  2Z0O A;  5C5B A;  2JP2 A;  1SHC A;  4KHB B;  3GYO A;  3PVL A;  2Y8G A;  2YSZ A;  2M38 A;  1EVH A;  1W1G A;  2ROZ B;  4QJ3 B;  4A6K A;  5D3V A;  4GPT B;  5KCV A;  2VRW B;  2J0K A;  1UNQ A;  3KRW A;  4HAT B;  3WYF B;  4CHJ A;  1KZ7 A;  3UZT A;  1NTY A;  1FHW A;  2K2U A;  3OAN A;  3X23 A;  5IRS A;  2YT2 A;  3A98 B;  4C0A A;  2I1K A;  5C16 A;  1MAI A;  2I5C A;  1WGU A;  2D9Z A;  1V89 A;  3ZVR A;  3HW2 B;  2COA A;  2DHJ A;  2Z0P A;  5D3Y A;  2GUM A;  2X18 A;  4KHB A;  1DDW A;  1FB8 A;  3HIE A;  1KI1 B;  4F7H A;  3DCX A;  5DHA B;  2Z13 A;  2RSG A;  4DIX A;  5LON B;  1WI1 A;  1FGY A;  1M7E A;  1DDM A;  1V5U A;  2YS5 A;  4HB0 B;  3CXB B;  3BIN A;  2R09 A;  3QBV B;  1UNP A;  4DX9 0;  3KRX A;  1FHX A;  2KIG A;  2M14 A;  3SYX A;  1ISN A;  2GJY A;  4HDO A;  4YL8 A;  3PZD A;  4QJ4 B;  2D2Q A;  2DX1 A;  3TO1 A;  3ULB A;  4IOY X;  3G9W A;  2ELA A;  1GG3 A;  5DH9 B;  2VSZ A;  2LG1 A;  4GOU A;  4XWX A;  5JHH A;  2COD A;  4HAY B;  2EMT A;  4GMX B;  2YT0 A;  4HB4 B;  2BCJ A;  3VIA A;  4A6F B;  1FAO A;  3M1I B;  5C5B B;  1U2B A;  1P3R A;  2Y7B A;  1ZSQ A;  5J3Y A;  1AWE A;  1V5M A;  5J3Q A;  1XCG A;  1J19 A;  3D8E A;  2FJL A;  1QC6 A;  1PFJ A;  3ULC A;  2OTX A;  1X1G A;  4QXA B;  1EF1 A;  3ODO A;  3MDB C;  3U12 A;  1PLS A;  4YON A;  1NI2 A;  4Z2N A;  3ZDT A;  4HSI A;  3DXC A;  1BTN A;  4KHA A;  5CLL B;  3U7D A;  4L1R A;  3BJI A;  3DXE A;  2YS3 A;  2RRF A;  3FM8 C;  3KZ1 A;  4A6F A;  2NMB A;  3QWM A;  1I7A A;  1ZVR A;  3A8Q A;  4EKU A;  2J59 M;  3KY9 A;  1XR0 B;  2UZS A;  1I2H A;  1DBH A;  4MT7 A;  2QKL A;  2Z14 A;  5D27 A;  4WSF A;  3SV1 A;  3PG7 A;  1OMW A;  3PEG A;  3TVV A;  5D3X A;  2H7D A;  1ZYI A;  2D11 A;  3MPX A;  1EAZ A;  2FJU B;  4EMO A;  2LOX A;  2V76 A;  4A6H A;  1WJM A;  1V88 A;  1XX0 A;  2RGN B;  1U5D A;  1Q67 A;  1EGX A;  2Q13 A;  4ZRI A;  2Z59 A;  4HHV A; 
#chains in the Genus database with same CATH homology
 2MFQ A;  1NTV A;  2H7E A;  2ADZ A;  1X1F A;  5HE1 A;  1TXD A;  1RJ2 A;  4GXB A;  2YRY A;  3KSY A;  1ZM0 A;  5L81 A;  1UNR A;  2YT1 A;  4TKN A;  2CRF A;  2Z0Q A;  3WA0 A;  3FSS A;  3PVU A;  4HDQ A;  3AJ4 A;  4NSW A;  2KCJ A;  1FGZ A;  2CY5 A;  2EC1 A;  2RLO A;  2RNR B;  1WVH A;  2UVM A;  2EJ8 A;  2I5F A;  5JLJ B;  5FI1 A;  3V5W A;  2L2I A;  1BAK A;  1Y5O A;  2LKO A;  2K2J A;  2DHK A;  3RCP A;  3D8F A;  2DTC A;  1U5G A;  1U5F A;  2P0D A;  5HE2 A;  2K00 A;  1RRP B;  4HAZ B;  2MKR A;  1MIZ B;  1IRS A;  3N7C A;  3F5R A;  4MY6 A;  4B6H A;  2D9V A;  2P0F A;  2D9X A;  2L1C A;  2W2X C;  5HE0 A;  4BBK A;  1MPH A;  2COF A;  4GZU A;  5D3W A;  3AU5 A;  5GOW B;  3P6A A;  2AEH A;  2DN6 A;  4HB2 B;  1U29 A;  2COC A;  2RUK B;  4EJN A;  2HE7 A;  3TW1 A;  1BWN A;  1J0W A;  2D4Q A;  4P7I A;  2KGX B;  5HE3 A;  1AQC A;  4Z2M B;  1DDV A;  2GS0 A;  1FOE A;  1MK9 B;  3AU4 A;  3LJU X;  2P0H A;  2Y8F A;  4GMV A;  5LOP B;  2YS1 A;  5KQ4 A;  2D9Y A;  1XOD A;  4K2P A;  2MWN B;  2P8V A;  5EFX A;  2DLW A;  1DRO A;  3SNH A;  1XD4 A;  2VKI A;  3FEH A;  5JP4 A;  3PVW A;  4NY0 A;  1H4R A;  5DI9 B;  1UPQ A;  2DA0 A;  2J0M A;  3ML4 A;  2RVB B;  1DYN A;  4TYZ A;  1P6S A;  2ELB A;  3U8Z A;  1B55 A;  3HK0 A;  1W1D A;  1X11 A;  3SUZ A;  1LW3 A;  4K2O A;  3T06 A;  4HAV B;  2GCL A;  1SGH A;  1NU2 A;  2N0Y A;  4CHM A;  2NZ8 B;  1BTK A;  2CAY A;  1OQN A;  1WG7 A;  2N23 A;  2QKM A;  1MIX A;  1Y19 B;  1V61 A;  2E2X A;  4KVG B;  1U27 A;  4WJ7 A;  1M7R A;  1W1H A;  2R0D A;  2AL6 A;  1X05 A;  2YF0 A;  2MDX A;  5CLQ B;  2PZ1 A;  2W2X D;  1WGQ A;  2DKQ A;  1KZG A;  2DFK A;  2D9W A;  2ROV A;  4HB3 B;  1WJ1 A;  1P5T A;  4KHO A;  2W2W A;  4K17 A;  2IYB A;  4Y94 A;  2HTH B;  3ODX A;  4K81 A;  4CYE A;  1MKE A;  3F0W A;  2DKP A;  3TFM A;  2J0J A;  1MK7 B;  1OY2 A;  2DHI A;  4HAW B;  3PSC A;  1TQZ A;  1GC7 A;  1K5D B;  2G35 A;  3SO6 A;  4IFS A;  3GYP A;  5DIF B;  3HQC A;  2LUL A;  1ZC3 B;  3PP2 A;  1E5W A;  3CIK A;  2IFS A;  4DX8 A;  5DHF B;  4IAP A;  1QQG A;  3VOQ A;  3O96 A;  5J3T A;  4H8S A;  2UZR A;  1PMS A;  4MK0 A;  3QIJ A;  2EMS A;  5C79 A;  2I1J A;  2CY4 A;  3ODW A;  2D10 A;  4ZRJ A;  4HAU B;  4PNK A;  4KAX B;  1XKE A;  1K5G B;  2KUP A;  4F7U P;  1U5E A;  1X86 A;  2DYQ A;  4HAX B;  1UEF A;  2DYN A;  5KQ1 A;  2XQN M;  4L6E A;  4F7G A;  4D0N B;  1TJ6 A;  3D8D A;  3NSU A;  2GCJ A;  3DXD A;  1V5P A;  1H10 A;  3A8P A;  2LYD A;  3TCA A;  1ZC4 B;  5C6R A;  3P7Z A;  4WVF B;  4DXA B;  1UPR A;  1Z87 A;  2OQB A;  1FHO A;  1GC6 A;  1N3H A;  2LOZ A;  2DX5 A;  5FI0 A;  4DBB A;  1LB1 A;  4PQ0 A;  4GN1 A;  4ZRK A;  2YVC A;  3IVF A;  2ZPY A;  5JHG A;  4A5K A;  2Z0O A;  5C5B A;  2JP2 A;  1SHC A;  4KHB B;  3GYO A;  3PVL A;  2Y8G A;  2YSZ A;  2M38 A;  1EVH A;  1W1G A;  2ROZ B;  4A6K A;  5D3V A;  4GPT B;  5KCV A;  2VRW B;  2J0K A;  1UNQ A;  3KRW A;  4HAT B;  3WYF B;  4CHJ A;  1KZ7 A;  3UZT A;  1NTY A;  1FHW A;  2K2U A;  3OAN A;  3X23 A;  3A98 B;  4C0A A;  2I1K A;  5C16 A;  1MAI A;  2I5C A;  1WGU A;  2D9Z A;  1V89 A;  3ZVR A;  3HW2 B;  2COA A;  2DHJ A;  2Z0P A;  5D3Y A;  2X18 A;  1DDW A;  1FB8 A;  1KI1 B;  4F7H A;  5DHA B;  2RSG A;  5LON B;  1WI1 A;  1FGY A;  1M7E A;  1DDM A;  1V5U A;  2YS5 A;  4HB0 B;  3CXB B;  3BIN A;  2R09 A;  3QBV B;  1UNP A;  4DX9 0;  3KRX A;  1FHX A;  2M14 A;  3SYX A;  1ISN A;  2GJY A;  4HDO A;  4YL8 A;  3PZD A;  2D2Q A;  2DX1 A;  3TO1 A;  3ULB A;  4IOY X;  3G9W A;  2ELA A;  1GG3 A;  5DH9 B;  2VSZ A;  2LG1 A;  4XWX A;  5JHH A;  2COD A;  4HAY B;  2EMT A;  4GMX B;  2YT0 A;  4HB4 B;  2BCJ A;  3VIA A;  4A6F B;  1FAO A;  3M1I B;  5C5B B;  1U2B A;  1P3R A;  2Y7B A;  1ZSQ A;  5J3Y A;  1AWE A;  1V5M A;  5J3Q A;  1XCG A;  1J19 A;  3D8E A;  2FJL A;  1QC6 A;  1PFJ A;  3ULC A;  2OTX A;  1X1G A;  1EF1 A;  3ODO A;  3MDB C;  1PLS A;  4YON A;  1NI2 A;  4Z2N A;  3ZDT A;  3DXC A;  1BTN A;  4KHA A;  5CLL B;  3U7D A;  3BJI A;  3DXE A;  2YS3 A;  3FM8 C;  3KZ1 A;  4A6F A;  2NMB A;  3QWM A;  1I7A A;  1ZVR A;  3A8Q A;  4EKU A;  2J59 M;  3KY9 A;  1XR0 B;  2UZS A;  1I2H A;  1DBH A;  4MT7 A;  2QKL A;  5D27 A;  4WSF A;  3SV1 A;  3PG7 A;  1OMW A;  3PEG A;  3TVV A;  5D3X A;  2H7D A;  2D11 A;  3MPX A;  1EAZ A;  4EMO A;  2LOX A;  2V76 A;  4A6H A;  1WJM A;  1V88 A;  1XX0 A;  2RGN B;  1U5D A;  1Q67 A;  1EGX A;  2Q13 A;  4ZRI A;  4HHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...