2G35A

Nmr structure of talin-ptb in complex with pipki
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
100
structure length
100
Chain Sequence
LKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Talin-1
publication title Structural Basis for the Phosphorylation-regulated Focal Adhesion Targeting of Type Igamma Phosphatidylinositol Phosphate Kinase (PIPKIgamma) by Talin.
pubmed doi rcsb
source organism Mus musculus
total genus 15
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2006-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2g35A00
3PEGA 2D9VA 1MKEA 5LOPB 4HAVB 1P3RA 1OY2A 4HHVA 4PNKA 2YT1A 1V5PA 1FHXA 1GC7A 2IYBA 2H7EA 4A6KA 3PVUA 2P0DA 1U5EA 1PMSA 2P0FA 2N23A 1FAOA 2CY4A 2DHJA 2EMSA 2CAYA 1DBHA 1PLSA 5KCVA 5C16A 2RGNB 1RRPB 1X86A 1XCGA 3SYXA 3PZDA 3QWMA 5CLLB 5DIFB 2GCJA 2GJYA 3FM8C 3GYOA 2GCLA 1V88A 1WGUA 2GS0A 3LJUX 1RJ2A 2V76A 3A98B 3V5WA 5J3QA 3DXEA 4HATB 3SO6A 4HAZB 3FSSA 4K2PA 2D9YA 1K5DB 4WJ7A 3TCAA 3PVWA 1P6SA 5J3YA 1Q67A 1M7EA 2DYNA 4DX8A 2DTCA 1NU2A 1P5TA 4TYZA 3SUZA 2VRWB 4GMXB 3SV1A 2K2JA 4EMOA 2Q13A 1W1GA 3ZVRA 3PVLA 1BTKA 1WJ1A 1ZC3B 2VSZA 1U29A 4XWXA 2AL6A 2M14A 2Y8GA 2YS1A 3D8DA 5DH9B 3PP2A 1UNRA 2D9WA 3T06A 4K17A 2ZPYA 3CXBB 1FGZA 4HB0B 3PSCA 4HDOA 1W1HA 1EGXA 3KRWA 2CRFA 2DHKA 2M38A 2Z0PA 5C5BB 3TVVA 3N7CA 4MT7A 2I5FA 2COFA 3X23A 2FJLA 5C6RA 4KHAA 4KAXB 3AU5A 4IAPA 4DBBA 4Z2NA 4IFSA 3TW1A 2KUPA 2RSGA 1KZ7A 2YF0A 2D11A 1MIXA 3KSYA 1LW3A 1XKEA 2ADZA 2E2XA 2EC1A 4C0AA 1ZVRA 3OANA 1U2BA 2Y7BA 4A6FA 4D0NB 3HW2B 5J3TA 3KRXA 3O96A 2G35A 2I5CA 1ZSQA 4H8SA 2ELBA 2DYQA 5LONB 2Z0OA 4KHOA 4EKUA 2CODA 2I1KA 1BAKA 4A5KA 1XR0B 1V5UA 1GG3A 1DDWA 1FHWA 1LB1A 3AJ4A 1XX0A 2MWNB 4YL8A 1FOEA 2LULA 1FB8A 1Y5OA 1H4RA 1QQGA 4ZRJA 2D4QA 1B55A 1EVHA 3VOQA 2QKLA 1K5GB 3UZTA 4CHMA 5D3VA 1N3HA 4EJNA 3ML4A 5HE2A 5DHAB 1BWNA 2VKIA 2YS3A 1SGHA 2J0MA 2UZSA 1MAIA 1XD4A 2ROVA 2Y8FA 2DN6A 5FI0A 1Y19B 2K00A 4YONA 2YSZA 1NI2A 4NSWA 2D9ZA 3U8ZA 5FI1A 5C79A 1WG7A 2I1JA 2W2XC 2MFQA 4GN1A 2IFSA 1Z87A 3TFMA 2CY5A 3KZ1A 1U5DA 2Z0QA 3AU4A 3MPXA 3VIAA 3ODWA 3G9WA 2LOXA 4ZRIA 3ODOA 1U5GA 4L6EA 3P7ZA 4MY6A 1X1FA 4HB3B 1MK7B 4F7GA 1ZM0A 2LYDA 2LOZA 1TXDA 5L81A 2D9XA 1FGYA 1OQNA 3F5RA 4IOYX 4A6HA 1MIZB 2UVMA 2LG1A 3M1IB 1UNQA 1UNPA 1W1DA 4B6HA 4KHBB 2EJ8A 2MKRA 5HE0A 3HK0A 3BJIA 3HQCA 1V61A 5HE3A 1H10A 3SNHA 5JP4A 1NTYA 1DDVA 1TQZA 1KZGA 1NTVA 1WGQA 1FHOA 2R0DA 1UPQA 4A6FB 2DFKA 2RNRB 1DROA 2QKMA 4TKNA 1EF1A 3KY9A 4DXAB 1J19A 4HB2B 3CIKA 4GZUA 2HTHB 5KQ4A 2L2IA 4HAWB 5JHHA 1WJMA 5C5BA 1AWEA 1XODA 1J0WA 2K2UA 1TJ6A 3BINA 3ZDTA 1X11A 4WVFB 1AQCA 2X18A 3NSUA 1BTNA 1ISNA 2YVCA 3TO1A 2NZ8B 2ELAA 3RCPA 2DLWA 3GYPA 2DX5A 3FEHA 1SHCA 2YT0A 5DI9B 2YS5A 5JHGA 5D3XA 1X05A 3A8QA 2MDXA 4DX90 2J0JA 4F7HA 3ULCA 1X1GA 3IVFA 4BBKA 4HAXB 1DDMA 2R09A 3DXCA 2RLOA 2HE7A 4Z2MB 2D10A 5D3YA 1V89A 2RVBB 3MDBC 1M7RA 4F7UP 2J59M 5HE1A 4KVGB 1ZC4B 2N0YA 1KI1B 4NY0A 3QIJA 4P7IA 3QBVB 5CLQB 1UEFA 2NMBA 1MK9B 2JP2A 2EMTA 2DX1A 3P6AA 2OQBA 4HB4B 2BCJA 1GC6A 4K81A 4Y94A 2KGXB 2H7DA 1DYNA 3D8EA 2L1CA 5JLJB 3D8FA 2OTXA 4CHJA 1I7AA 3ULBA 1U5FA 2AEHA 3U7DA 1EAZA 1QC6A 2DA0A 4PQ0A 3DXDA 4CYEA 4MK0A 2COAA 4HAYB 5DHFB 5D3WA 5EFXA 2W2XD 1V5MA 2P8VA 5D27A 3WA0A 3ODXA 2KCJA 1MPHA 1WVHA 2D2QA 2W2WA 2LKOA 2DHIA 2RUKB 1PFJA 2DKQA 2DKPA 4HAUB 4GPTB 2J0KA 2UZRA 4WSFA 4K2OA 5GOWB 4HDQA 3F0WA 2COCA 1WI1A 4GXBA 5KQ1A 2PZ1A 3WYFB 4ZRKA 3A8PA 1IRSA 2XQNM 1E5WA 3PG7A 2P0HA 1I2HA 2ROZB 2YRYA 1UPRA 4GMVA 1OMWA 1U27A
chains in the Genus database with same CATH superfamily
3PEGA 2D9VA 1MKEA 5LOPB 4HAVB 1P3RA 4GNKB 1OY2A 4HHVA 4PNKA 2YT1A 1V5PA 1FHXA 2Z13A 1GC7A 2IYBA 3NW8A 2H7EA 4A6KA 3PVUA 2P0DA 1U5EA 1PMSA 2P0FA 2N23A 1FAOA 5I2SA 2CY4A 2DHJA 2EMSA 2CAYA 1DBHA 1PLSA 5KCVA 5C16A 2RGNB 1RRPB 1X86A 1XCGA 3SYXA 3PZDA 3QWMA 5CLLB 5DIFB 2GCJA 2GJYA 3FM8C 3GYOA 2GCLA 1V88A 1WGUA 2GS0A 3LJUX 1RJ2A 2V76A 3A98B 3V5WA 5J3QA 3DXEA 4HATB 3SO6A 4HAZB 3FSSA 4K2PA 2D9YA 1K5DB 4WJ7A 3TCAA 3PVWA 4QJ3B 1P6SA 5J3YA 1Q67A 1M7EA 2DYNA 4DX8A 2DTCA 1NU2A 1P5TA 4TYZA 3SUZA 2VRWB 4CSQA 4GMXB 3SV1A 2K2JA 4EMOA 2Q13A 1W1GA 3ZVRA 3PVLA 1BTKA 1WJ1A 1ZC3B 2VSZA 1U29A 3OHMB 4XWXA 2AL6A 2M14A 2Y8GA 2YS1A 3D8DA 5DH9B 3PP2A 1UNRA 2D9WA 3T06A 4K17A 2ZPYA 3CXBB 1FGZA 4HB0B 3PSCA 4HDOA 1W1HA 1EGXA 3KRWA 2CRFA 2DHKA 2M38A 2Z0PA 5C5BB 2NBVA 3TVVA 3N7CA 4OT1A 4MT7A 2I5FA 2COFA 3X23A 2FJLA 5C6RA 4KHAA 3A58A 4KAXB 3AU5A 4KHBA 4IAPA 4DBBA 4Z2NA 4IFSA 3TW1A 2KUPA 2RSGA 1KZ7A 2YF0A 2D11A 1MIXA 3KSYA 1LW3A 1XKEA 2ADZA 2E2XA 2EC1A 4C0AA 1ZVRA 3OANA 1U2BA 2Y7BA 4A6FA 4D0NB 3HW2B 1T77A 5J3TA 3KRXA 3O96A 2G35A 2I5CA 1ZSQA 4H8SA 2ELBA 2DYQA 5LONB 2Z0OA 4KHOA 4EKUA 2CODA 2I1KA 1BAKA 4A5KA 3FVCA 1XR0B 1V5UA 1GG3A 1DDWA 1FHWA 1LB1A 3AJ4A 1XX0A 2MWNB 4YL8A 1FOEA 2LULA 1FB8A 1Y5OA 1H4RA 1QQGA 4ZRJA 3HIEA 2D4QA 1B55A 1EVHA 3VOQA 2QKLA 1K5GB 3UZTA 2KR0A 4CHMA 5D3VA 1N3HA 4EJNA 3ML4A 5HE2A 5DHAB 2YT2A 1BWNA 2VKIA 2YS3A 1SGHA 2J0MA 2UZSA 1MAIA 1XD4A 2ROVA 2Y8FA 2DN6A 1MI1A 5FI0A 1Y19B 2K00A 4YONA 2YSZA 1NI2A 4NSWA 2D9ZA 3U8ZA 5FI1A 5C79A 1WG7A 2I1JA 2W2XC 2MFQA 4GN1A 2IFSA 1Z87A 3TFMA 2CY5A 3KZ1A 2Z4DA 1U5DA 2K49A 2Z0QA 3AU4A 3MPXA 3VIAA 4D6WA 3ODWA 3G9WA 2LOXA 4ZRIA 2R2YA 3ODOA 1U5GA 4L6EA 3P7ZA 4MY6A 1X1FA 3HSAA 4HB3B 1MK7B 4F7GA 2Z59A 1ZM0A 2LYDA 2LOZA 1TXDA 5L81A 2D9XA 1FGYA 1OQNA 3F5RA 4IOYX 4A6HA 1MIZB 2UVMA 2LG1A 3M1IB 1UNQA 1UNPA 1W1DA 4B6HA 4KHBB 2EJ8A 2MKRA 5HE0A 3HK0A 3BJIA 3HQCA 1V61A 5HE3A 1H10A 4QJ5B 4QJ4B 3SNHA 5JP4A 1NTYA 1DDVA 1TQZA 1KZGA 1NTVA 1WGQA 1FHOA 4QXAB 2R0DA 1UPQA 4A6FB 2DFKA 2RNRB 1DROA 2QKMA 4TKNA 1EF1A 3KY9A 4DXAB 1J19A 4HB2B 3CIKA 4GZUA 2HTHB 5KQ4A 2L2IA 4HAWB 5JHHA 1WJMA 5C5BA 1AWEA 1XODA 1J0WA 2K2UA 1TJ6A 3BINA 3ZDTA 1X11A 4WVFB 1AQCA 2X18A 3NSUA 1BTNA 1ISNA 2YVCA 3TO1A 2NZ8B 2ELAA 3RCPA 2DLWA 3GYPA 2DX5A 3FEHA 1SHCA 5I2MA 2YT0A 5DI9B 2YS5A 5JHGA 5D3XA 3DCXA 1X05A 4OSNA 3A8QA 2MDXA 4DX90 2J0JA 4F7HA 3NWDA 3ULCA 4DIXA 2KIGA 4HSIA 5IRSA 1X1GA 3IVFA 4BBKA 4HAXB 1DDMA 4L1RA 2R09A 3DXCA 2RLOA 2GUMA 2HE7A 2K8EA 4Z2MB 2D10A 5D3YA 1V89A 2RVBB 3MDBC 1M7RA 3B77A 4F7UP 2J59M 5HE1A 4KVGB 1ZC4B 3NWAA 2N0YA 1KI1B 4NY0A 3QIJA 4P7IA 3QBVB 5CLQB 1UEFA 4GOUA 2NMBA 1MK9B 2JP2A 5M4YB 2EMTA 2DX1A 3P6AA 2OQBA 4HB4B 2BCJA 1GC6A 4K81A 4Y94A 2KGXB 2H7DA 1DYNA 3D8EA 2L1CA 5JLJB 3D8FA 2OTXA 4CHJA 1I7AA 3ULBA 1U5FA 2AEHA 3U7DA 1EAZA 1QC6A 2DA0A 2ZKMX 4PQ0A 2FJUB 3DXDA 4CYEA 4MK0A 2COAA 4HAYB 5DHFB 5D3WA 5EFXA 2W2XD 1V5MA 2P8VA 5D27A 3WA0A 3ODXA 2KCJA 1MPHA 1WVHA 2D2QA 2W2WA 3U12A 2LKOA 2DHIA 2RUKB 1PFJA 2DKQA 2DKPA 4HAUB 2Z14A 4GPTB 2J0KA 2KIEA 2UZRA 4WSFA 4K2OA 5GOWB 4HDQA 5LG4B 3F0WA 3NWFA 2COCA 1WI1A 4GXBA 5KQ1A 2PZ1A 3WYFB 2RRFA 4ZRKA 3A8PA 1IRSA 1ZYIA 2XQNM 1E5WA 3PG7A 2P0HA 1I2HA 2ROZB 2YRYA 1UPRA 4GMVA 2KUQA 1OMWA 1U27A
chains in the Genus database with same CATH topology
3PEGA 2D9VA 1MKEA 5LOPB 4HAVB 1P3RA 1OY2A 4HHVA 4PNKA 2YT1A 1V5PA 1FHXA 1GC7A 2IYBA 2H7EA 4A6KA 3PVUA 2P0DA 1U5EA 1PMSA 2P0FA 2N23A 1FAOA 2CY4A 2DHJA 2EMSA 2CAYA 1DBHA 1PLSA 5KCVA 5C16A 2RGNB 1RRPB 1X86A 1XCGA 3SYXA 3PZDA 3QWMA 5CLLB 5DIFB 2GCJA 2GJYA 3FM8C 3GYOA 2GCLA 1V88A 1WGUA 2GS0A 3LJUX 1RJ2A 2V76A 3A98B 3V5WA 5J3QA 3DXEA 4HATB 3SO6A 4HAZB 3FSSA 4K2PA 2D9YA 1K5DB 4WJ7A 3TCAA 3PVWA 1P6SA 5J3YA 1Q67A 1M7EA 2DYNA 4DX8A 2DTCA 1NU2A 1P5TA 4TYZA 3SUZA 2VRWB 4GMXB 3SV1A 2K2JA 4EMOA 2Q13A 1W1GA 3ZVRA 3PVLA 1BTKA 1WJ1A 1ZC3B 2VSZA 1U29A 4XWXA 2AL6A 2M14A 2Y8GA 2YS1A 3D8DA 5DH9B 3PP2A 1UNRA 2D9WA 3T06A 4K17A 2ZPYA 3CXBB 1FGZA 4HB0B 3PSCA 4HDOA 1W1HA 1EGXA 3KRWA 2CRFA 2DHKA 2M38A 2Z0PA 5C5BB 3TVVA 3N7CA 4MT7A 2I5FA 2COFA 3X23A 2FJLA 5C6RA 4KHAA 4KAXB 3AU5A 4IAPA 4DBBA 4Z2NA 4IFSA 3TW1A 2KUPA 2RSGA 1KZ7A 2YF0A 2D11A 1MIXA 3KSYA 1LW3A 1XKEA 2ADZA 2E2XA 2EC1A 4C0AA 1ZVRA 3OANA 1U2BA 2Y7BA 4A6FA 4D0NB 3HW2B 5J3TA 3KRXA 3O96A 2G35A 2I5CA 1ZSQA 4H8SA 2ELBA 2DYQA 5LONB 2Z0OA 4KHOA 4EKUA 2CODA 2I1KA 1BAKA 4A5KA 1XR0B 1V5UA 1GG3A 1DDWA 1FHWA 1LB1A 3AJ4A 1XX0A 2MWNB 4YL8A 1FOEA 2LULA 1FB8A 1Y5OA 1H4RA 1QQGA 4ZRJA 2D4QA 1B55A 1EVHA 3VOQA 2QKLA 1K5GB 3UZTA 4CHMA 5D3VA 1N3HA 4EJNA 3ML4A 5HE2A 5DHAB 1BWNA 2VKIA 2YS3A 1SGHA 2J0MA 2UZSA 1MAIA 1XD4A 2ROVA 2Y8FA 2DN6A 5FI0A 1Y19B 2K00A 4YONA 2YSZA 1NI2A 4NSWA 2D9ZA 3U8ZA 5FI1A 5C79A 1WG7A 2I1JA 2W2XC 2MFQA 4GN1A 2IFSA 1Z87A 3TFMA 2CY5A 3KZ1A 1U5DA 2Z0QA 3AU4A 3MPXA 3VIAA 3ODWA 3G9WA 2LOXA 4ZRIA 3ODOA 1U5GA 4L6EA 3P7ZA 4MY6A 1X1FA 4HB3B 1MK7B 4F7GA 1ZM0A 2LYDA 2LOZA 1TXDA 5L81A 2D9XA 1FGYA 1OQNA 3F5RA 4IOYX 4A6HA 1MIZB 2UVMA 2LG1A 3M1IB 1UNQA 1UNPA 1W1DA 4B6HA 4KHBB 2EJ8A 2MKRA 5HE0A 3HK0A 3BJIA 3HQCA 1V61A 5HE3A 1H10A 3SNHA 5JP4A 1NTYA 1DDVA 1TQZA 1KZGA 1NTVA 1WGQA 1FHOA 2R0DA 1UPQA 4A6FB 2DFKA 2RNRB 1DROA 2QKMA 4TKNA 1EF1A 3KY9A 4DXAB 1J19A 4HB2B 3CIKA 4GZUA 2HTHB 5KQ4A 2L2IA 4HAWB 5JHHA 1WJMA 5C5BA 1AWEA 1XODA 1J0WA 2K2UA 1TJ6A 3BINA 3ZDTA 1X11A 4WVFB 1AQCA 2X18A 3NSUA 1BTNA 1ISNA 2YVCA 3TO1A 2NZ8B 2ELAA 3RCPA 2DLWA 3GYPA 2DX5A 3FEHA 1SHCA 2YT0A 5DI9B 2YS5A 5JHGA 5D3XA 1X05A 3A8QA 2MDXA 4DX90 2J0JA 4F7HA 3ULCA 1X1GA 3IVFA 4BBKA 4HAXB 1DDMA 2R09A 3DXCA 2RLOA 2HE7A 4Z2MB 2D10A 5D3YA 1V89A 2RVBB 3MDBC 1M7RA 4F7UP 2J59M 5HE1A 4KVGB 1ZC4B 2N0YA 1KI1B 4NY0A 3QIJA 4P7IA 3QBVB 5CLQB 1UEFA 2NMBA 1MK9B 2JP2A 2EMTA 2DX1A 3P6AA 2OQBA 4HB4B 2BCJA 1GC6A 4K81A 4Y94A 2KGXB 2H7DA 1DYNA 3D8EA 2L1CA 5JLJB 3D8FA 2OTXA 4CHJA 1I7AA 3ULBA 1U5FA 2AEHA 3U7DA 1EAZA 1QC6A 2DA0A 4PQ0A 3DXDA 4CYEA 4MK0A 2COAA 4HAYB 5DHFB 5D3WA 5EFXA 2W2XD 1V5MA 2P8VA 5D27A 3WA0A 3ODXA 2KCJA 1MPHA 1WVHA 2D2QA 2W2WA 2LKOA 2DHIA 2RUKB 1PFJA 2DKQA 2DKPA 4HAUB 4GPTB 2J0KA 2UZRA 4WSFA 4K2OA 5GOWB 4HDQA 3F0WA 2COCA 1WI1A 4GXBA 5KQ1A 2PZ1A 3WYFB 4ZRKA 3A8PA 1IRSA 2XQNM 1E5WA 3PG7A 2P0HA 1I2HA 2ROZB 2YRYA 1UPRA 4GMVA 1OMWA 1U27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PEG A;  2D9V A;  1MKE A;  5LOP B;  4HAV B;  1P3R A;  1OY2 A;  4HHV A;  4PNK A;  2YT1 A;  1V5P A;  1FHX A;  1GC7 A;  2IYB A;  2H7E A;  4A6K A;  3PVU A;  2P0D A;  1U5E A;  1PMS A;  2P0F A;  2N23 A;  1FAO A;  2CY4 A;  2DHJ A;  2EMS A;  2CAY A;  1DBH A;  1PLS A;  5KCV A;  5C16 A;  2RGN B;  1RRP B;  1X86 A;  1XCG A;  3SYX A;  3PZD A;  3QWM A;  5CLL B;  5DIF B;  2GCJ A;  2GJY A;  3FM8 C;  3GYO A;  2GCL A;  1V88 A;  1WGU A;  2GS0 A;  3LJU X;  1RJ2 A;  2V76 A;  3A98 B;  3V5W A;  5J3Q A;  3DXE A;  4HAT B;  3SO6 A;  4HAZ B;  3FSS A;  4K2P A;  2D9Y A;  1K5D B;  4WJ7 A;  3TCA A;  3PVW A;  1P6S A;  5J3Y A;  1Q67 A;  1M7E A;  2DYN A;  4DX8 A;  2DTC A;  1NU2 A;  1P5T A;  4TYZ A;  3SUZ A;  2VRW B;  4GMX B;  3SV1 A;  2K2J A;  4EMO A;  2Q13 A;  1W1G A;  3ZVR A;  3PVL A;  1BTK A;  1WJ1 A;  1ZC3 B;  2VSZ A;  1U29 A;  4XWX A;  2AL6 A;  2M14 A;  2Y8G A;  2YS1 A;  3D8D A;  5DH9 B;  3PP2 A;  1UNR A;  2D9W A;  3T06 A;  4K17 A;  2ZPY A;  3CXB B;  1FGZ A;  4HB0 B;  3PSC A;  4HDO A;  1W1H A;  1EGX A;  3KRW A;  2CRF A;  2DHK A;  2M38 A;  2Z0P A;  5C5B B;  3TVV A;  3N7C A;  4MT7 A;  2I5F A;  2COF A;  3X23 A;  2FJL A;  5C6R A;  4KHA A;  4KAX B;  3AU5 A;  4IAP A;  4DBB A;  4Z2N A;  4IFS A;  3TW1 A;  2KUP A;  2RSG A;  1KZ7 A;  2YF0 A;  2D11 A;  1MIX A;  3KSY A;  1LW3 A;  1XKE A;  2ADZ A;  2E2X A;  2EC1 A;  4C0A A;  1ZVR A;  3OAN A;  1U2B A;  2Y7B A;  4A6F A;  4D0N B;  3HW2 B;  5J3T A;  3KRX A;  3O96 A;  2G35 A;  2I5C A;  1ZSQ A;  4H8S A;  2ELB A;  2DYQ A;  5LON B;  2Z0O A;  4KHO A;  4EKU A;  2COD A;  2I1K A;  1BAK A;  4A5K A;  1XR0 B;  1V5U A;  1GG3 A;  1DDW A;  1FHW A;  1LB1 A;  3AJ4 A;  1XX0 A;  2MWN B;  4YL8 A;  1FOE A;  2LUL A;  1FB8 A;  1Y5O A;  1H4R A;  1QQG A;  4ZRJ A;  2D4Q A;  1B55 A;  1EVH A;  3VOQ A;  2QKL A;  1K5G B;  3UZT A;  4CHM A;  5D3V A;  1N3H A;  4EJN A;  3ML4 A;  5HE2 A;  5DHA B;  1BWN A;  2VKI A;  2YS3 A;  1SGH A;  2J0M A;  2UZS A;  1MAI A;  1XD4 A;  2ROV A;  2Y8F A;  2DN6 A;  5FI0 A;  1Y19 B;  2K00 A;  4YON A;  2YSZ A;  1NI2 A;  4NSW A;  2D9Z A;  3U8Z A;  5FI1 A;  5C79 A;  1WG7 A;  2I1J A;  2W2X C;  2MFQ A;  4GN1 A;  2IFS A;  1Z87 A;  3TFM A;  2CY5 A;  3KZ1 A;  1U5D A;  2Z0Q A;  3AU4 A;  3MPX A;  3VIA A;  3ODW A;  3G9W A;  2LOX A;  4ZRI A;  3ODO A;  1U5G A;  4L6E A;  3P7Z A;  4MY6 A;  1X1F A;  4HB3 B;  1MK7 B;  4F7G A;  1ZM0 A;  2LYD A;  2LOZ A;  1TXD A;  5L81 A;  2D9X A;  1FGY A;  1OQN A;  3F5R A;  4IOY X;  4A6H A;  1MIZ B;  2UVM A;  2LG1 A;  3M1I B;  1UNQ A;  1UNP A;  1W1D A;  4B6H A;  4KHB B;  2EJ8 A;  2MKR A;  5HE0 A;  3HK0 A;  3BJI A;  3HQC A;  1V61 A;  5HE3 A;  1H10 A;  3SNH A;  5JP4 A;  1NTY A;  1DDV A;  1TQZ A;  1KZG A;  1NTV A;  1WGQ A;  1FHO A;  2R0D A;  1UPQ A;  4A6F B;  2DFK A;  2RNR B;  1DRO A;  2QKM A;  4TKN A;  1EF1 A;  3KY9 A;  4DXA B;  1J19 A;  4HB2 B;  3CIK A;  4GZU A;  2HTH B;  5KQ4 A;  2L2I A;  4HAW B;  5JHH A;  1WJM A;  5C5B A;  1AWE A;  1XOD A;  1J0W A;  2K2U A;  1TJ6 A;  3BIN A;  3ZDT A;  1X11 A;  4WVF B;  1AQC A;  2X18 A;  3NSU A;  1BTN A;  1ISN A;  2YVC A;  3TO1 A;  2NZ8 B;  2ELA A;  3RCP A;  2DLW A;  3GYP A;  2DX5 A;  3FEH A;  1SHC A;  2YT0 A;  5DI9 B;  2YS5 A;  5JHG A;  5D3X A;  1X05 A;  3A8Q A;  2MDX A;  4DX9 0;  2J0J A;  4F7H A;  3ULC A;  1X1G A;  3IVF A;  4BBK A;  4HAX B;  1DDM A;  2R09 A;  3DXC A;  2RLO A;  2HE7 A;  4Z2M B;  2D10 A;  5D3Y A;  1V89 A;  2RVB B;  3MDB C;  1M7R A;  4F7U P;  2J59 M;  5HE1 A;  4KVG B;  1ZC4 B;  2N0Y A;  1KI1 B;  4NY0 A;  3QIJ A;  4P7I A;  3QBV B;  5CLQ B;  1UEF A;  2NMB A;  1MK9 B;  2JP2 A;  2EMT A;  2DX1 A;  3P6A A;  2OQB A;  4HB4 B;  2BCJ A;  1GC6 A;  4K81 A;  4Y94 A;  2KGX B;  2H7D A;  1DYN A;  3D8E A;  2L1C A;  5JLJ B;  3D8F A;  2OTX A;  4CHJ A;  1I7A A;  3ULB A;  1U5F A;  2AEH A;  3U7D A;  1EAZ A;  1QC6 A;  2DA0 A;  4PQ0 A;  3DXD A;  4CYE A;  4MK0 A;  2COA A;  4HAY B;  5DHF B;  5D3W A;  5EFX A;  2W2X D;  1V5M A;  2P8V A;  5D27 A;  3WA0 A;  3ODX A;  2KCJ A;  1MPH A;  1WVH A;  2D2Q A;  2W2W A;  2LKO A;  2DHI A;  2RUK B;  1PFJ A;  2DKQ A;  2DKP A;  4HAU B;  4GPT B;  2J0K A;  2UZR A;  4WSF A;  4K2O A;  5GOW B;  4HDQ A;  3F0W A;  2COC A;  1WI1 A;  4GXB A;  5KQ1 A;  2PZ1 A;  3WYF B;  4ZRK A;  3A8P A;  1IRS A;  2XQN M;  1E5W A;  3PG7 A;  2P0H A;  1I2H A;  2ROZ B;  2YRY A;  1UPR A;  4GMV A;  1OMW A;  1U27 A; 
#chains in the Genus database with same CATH topology
 3PEG A;  2D9V A;  1MKE A;  5LOP B;  4HAV B;  1P3R A;  4GNK B;  1OY2 A;  4HHV A;  4PNK A;  2YT1 A;  1V5P A;  1FHX A;  2Z13 A;  1GC7 A;  2IYB A;  3NW8 A;  2H7E A;  4A6K A;  3PVU A;  2P0D A;  1U5E A;  1PMS A;  2P0F A;  2N23 A;  1FAO A;  5I2S A;  2CY4 A;  2DHJ A;  2EMS A;  2CAY A;  1DBH A;  1PLS A;  5KCV A;  5C16 A;  2RGN B;  1RRP B;  1X86 A;  1XCG A;  3SYX A;  3PZD A;  3QWM A;  5CLL B;  5DIF B;  2GCJ A;  2GJY A;  3FM8 C;  3GYO A;  2GCL A;  1V88 A;  1WGU A;  2GS0 A;  3LJU X;  1RJ2 A;  2V76 A;  3A98 B;  3V5W A;  5J3Q A;  3DXE A;  4HAT B;  3SO6 A;  4HAZ B;  3FSS A;  4K2P A;  2D9Y A;  1K5D B;  4WJ7 A;  3TCA A;  3PVW A;  4QJ3 B;  1P6S A;  5J3Y A;  1Q67 A;  1M7E A;  2DYN A;  4DX8 A;  2DTC A;  1NU2 A;  1P5T A;  4TYZ A;  3SUZ A;  2VRW B;  4CSQ A;  4GMX B;  3SV1 A;  2K2J A;  4EMO A;  2Q13 A;  1W1G A;  3ZVR A;  3PVL A;  1BTK A;  1WJ1 A;  1ZC3 B;  2VSZ A;  1U29 A;  3OHM B;  4XWX A;  2AL6 A;  2M14 A;  2Y8G A;  2YS1 A;  3D8D A;  5DH9 B;  3PP2 A;  1UNR A;  2D9W A;  3T06 A;  4K17 A;  2ZPY A;  3CXB B;  1FGZ A;  4HB0 B;  3PSC A;  4HDO A;  1W1H A;  1EGX A;  3KRW A;  2CRF A;  2DHK A;  2M38 A;  2Z0P A;  5C5B B;  2NBV A;  3TVV A;  3N7C A;  4OT1 A;  4MT7 A;  2I5F A;  2COF A;  3X23 A;  2FJL A;  5C6R A;  4KHA A;  3A58 A;  4KAX B;  3AU5 A;  4KHB A;  4IAP A;  4DBB A;  4Z2N A;  4IFS A;  3TW1 A;  2KUP A;  2RSG A;  1KZ7 A;  2YF0 A;  2D11 A;  1MIX A;  3KSY A;  1LW3 A;  1XKE A;  2ADZ A;  2E2X A;  2EC1 A;  4C0A A;  1ZVR A;  3OAN A;  1U2B A;  2Y7B A;  4A6F A;  4D0N B;  3HW2 B;  1T77 A;  5J3T A;  3KRX A;  3O96 A;  2G35 A;  2I5C A;  1ZSQ A;  4H8S A;  2ELB A;  2DYQ A;  5LON B;  2Z0O A;  4KHO A;  4EKU A;  2COD A;  2I1K A;  1BAK A;  4A5K A;  3FVC A;  1XR0 B;  1V5U A;  1GG3 A;  1DDW A;  1FHW A;  1LB1 A;  3AJ4 A;  1XX0 A;  2MWN B;  4YL8 A;  1FOE A;  2LUL A;  1FB8 A;  1Y5O A;  1H4R A;  1QQG A;  4ZRJ A;  3HIE A;  2D4Q A;  1B55 A;  1EVH A;  3VOQ A;  2QKL A;  1K5G B;  3UZT A;  2KR0 A;  4CHM A;  5D3V A;  1N3H A;  4EJN A;  3ML4 A;  5HE2 A;  5DHA B;  2YT2 A;  1BWN A;  2VKI A;  2YS3 A;  1SGH A;  2J0M A;  2UZS A;  1MAI A;  1XD4 A;  2ROV A;  2Y8F A;  2DN6 A;  1MI1 A;  5FI0 A;  1Y19 B;  2K00 A;  4YON A;  2YSZ A;  1NI2 A;  4NSW A;  2D9Z A;  3U8Z A;  5FI1 A;  5C79 A;  1WG7 A;  2I1J A;  2W2X C;  2MFQ A;  4GN1 A;  2IFS A;  1Z87 A;  3TFM A;  2CY5 A;  3KZ1 A;  2Z4D A;  1U5D A;  2K49 A;  2Z0Q A;  3AU4 A;  3MPX A;  3VIA A;  4D6W A;  3ODW A;  3G9W A;  2LOX A;  4ZRI A;  2R2Y A;  3ODO A;  1U5G A;  4L6E A;  3P7Z A;  4MY6 A;  1X1F A;  3HSA A;  4HB3 B;  1MK7 B;  4F7G A;  2Z59 A;  1ZM0 A;  2LYD A;  2LOZ A;  1TXD A;  5L81 A;  2D9X A;  1FGY A;  1OQN A;  3F5R A;  4IOY X;  4A6H A;  1MIZ B;  2UVM A;  2LG1 A;  3M1I B;  1UNQ A;  1UNP A;  1W1D A;  4B6H A;  4KHB B;  2EJ8 A;  2MKR A;  5HE0 A;  3HK0 A;  3BJI A;  3HQC A;  1V61 A;  5HE3 A;  1H10 A;  4QJ5 B;  4QJ4 B;  3SNH A;  5JP4 A;  1NTY A;  1DDV A;  1TQZ A;  1KZG A;  1NTV A;  1WGQ A;  1FHO A;  4QXA B;  2R0D A;  1UPQ A;  4A6F B;  2DFK A;  2RNR B;  1DRO A;  2QKM A;  4TKN A;  1EF1 A;  3KY9 A;  4DXA B;  1J19 A;  4HB2 B;  3CIK A;  4GZU A;  2HTH B;  5KQ4 A;  2L2I A;  4HAW B;  5JHH A;  1WJM A;  5C5B A;  1AWE A;  1XOD A;  1J0W A;  2K2U A;  1TJ6 A;  3BIN A;  3ZDT A;  1X11 A;  4WVF B;  1AQC A;  2X18 A;  3NSU A;  1BTN A;  1ISN A;  2YVC A;  3TO1 A;  2NZ8 B;  2ELA A;  3RCP A;  2DLW A;  3GYP A;  2DX5 A;  3FEH A;  1SHC A;  5I2M A;  2YT0 A;  5DI9 B;  2YS5 A;  5JHG A;  5D3X A;  3DCX A;  1X05 A;  4OSN A;  3A8Q A;  2MDX A;  4DX9 0;  2J0J A;  4F7H A;  3NWD A;  3ULC A;  4DIX A;  2KIG A;  4HSI A;  5IRS A;  1X1G A;  3IVF A;  4BBK A;  4HAX B;  1DDM A;  4L1R A;  2R09 A;  3DXC A;  2RLO A;  2GUM A;  2HE7 A;  2K8E A;  4Z2M B;  2D10 A;  5D3Y A;  1V89 A;  2RVB B;  3MDB C;  1M7R A;  3B77 A;  4F7U P;  2J59 M;  5HE1 A;  4KVG B;  1ZC4 B;  3NWA A;  2N0Y A;  1KI1 B;  4NY0 A;  3QIJ A;  4P7I A;  3QBV B;  5CLQ B;  1UEF A;  4GOU A;  2NMB A;  1MK9 B;  2JP2 A;  5M4Y B;  2EMT A;  2DX1 A;  3P6A A;  2OQB A;  4HB4 B;  2BCJ A;  1GC6 A;  4K81 A;  4Y94 A;  2KGX B;  2H7D A;  1DYN A;  3D8E A;  2L1C A;  5JLJ B;  3D8F A;  2OTX A;  4CHJ A;  1I7A A;  3ULB A;  1U5F A;  2AEH A;  3U7D A;  1EAZ A;  1QC6 A;  2DA0 A;  2ZKM X;  4PQ0 A;  2FJU B;  3DXD A;  4CYE A;  4MK0 A;  2COA A;  4HAY B;  5DHF B;  5D3W A;  5EFX A;  2W2X D;  1V5M A;  2P8V A;  5D27 A;  3WA0 A;  3ODX A;  2KCJ A;  1MPH A;  1WVH A;  2D2Q A;  2W2W A;  3U12 A;  2LKO A;  2DHI A;  2RUK B;  1PFJ A;  2DKQ A;  2DKP A;  4HAU B;  2Z14 A;  4GPT B;  2J0K A;  2KIE A;  2UZR A;  4WSF A;  4K2O A;  5GOW B;  4HDQ A;  5LG4 B;  3F0W A;  3NWF A;  2COC A;  1WI1 A;  4GXB A;  5KQ1 A;  2PZ1 A;  3WYF B;  2RRF A;  4ZRK A;  3A8P A;  1IRS A;  1ZYI A;  2XQN M;  1E5W A;  3PG7 A;  2P0H A;  1I2H A;  2ROZ B;  2YRY A;  1UPR A;  4GMV A;  2KUQ A;  1OMW A;  1U27 A; 
#chains in the Genus database with same CATH homology
 3PEG A;  2D9V A;  1MKE A;  5LOP B;  4HAV B;  1P3R A;  1OY2 A;  4HHV A;  4PNK A;  2YT1 A;  1V5P A;  1FHX A;  1GC7 A;  2IYB A;  2H7E A;  4A6K A;  3PVU A;  2P0D A;  1U5E A;  1PMS A;  2P0F A;  2N23 A;  1FAO A;  2CY4 A;  2DHJ A;  2EMS A;  2CAY A;  1DBH A;  1PLS A;  5KCV A;  5C16 A;  2RGN B;  1RRP B;  1X86 A;  1XCG A;  3SYX A;  3PZD A;  3QWM A;  5CLL B;  5DIF B;  2GCJ A;  2GJY A;  3FM8 C;  3GYO A;  2GCL A;  1V88 A;  1WGU A;  2GS0 A;  3LJU X;  1RJ2 A;  2V76 A;  3A98 B;  3V5W A;  5J3Q A;  3DXE A;  4HAT B;  3SO6 A;  4HAZ B;  3FSS A;  4K2P A;  2D9Y A;  1K5D B;  4WJ7 A;  3TCA A;  3PVW A;  1P6S A;  5J3Y A;  1Q67 A;  1M7E A;  2DYN A;  4DX8 A;  2DTC A;  1NU2 A;  1P5T A;  4TYZ A;  3SUZ A;  2VRW B;  4GMX B;  3SV1 A;  2K2J A;  4EMO A;  2Q13 A;  1W1G A;  3ZVR A;  3PVL A;  1BTK A;  1WJ1 A;  1ZC3 B;  2VSZ A;  1U29 A;  4XWX A;  2AL6 A;  2M14 A;  2Y8G A;  2YS1 A;  3D8D A;  5DH9 B;  3PP2 A;  1UNR A;  2D9W A;  3T06 A;  4K17 A;  2ZPY A;  3CXB B;  1FGZ A;  4HB0 B;  3PSC A;  4HDO A;  1W1H A;  1EGX A;  3KRW A;  2CRF A;  2DHK A;  2M38 A;  2Z0P A;  5C5B B;  3TVV A;  3N7C A;  4MT7 A;  2I5F A;  2COF A;  3X23 A;  2FJL A;  5C6R A;  4KHA A;  4KAX B;  3AU5 A;  4IAP A;  4DBB A;  4Z2N A;  4IFS A;  3TW1 A;  2KUP A;  2RSG A;  1KZ7 A;  2YF0 A;  2D11 A;  1MIX A;  3KSY A;  1LW3 A;  1XKE A;  2ADZ A;  2E2X A;  2EC1 A;  4C0A A;  1ZVR A;  3OAN A;  1U2B A;  2Y7B A;  4A6F A;  4D0N B;  3HW2 B;  5J3T A;  3KRX A;  3O96 A;  2G35 A;  2I5C A;  1ZSQ A;  4H8S A;  2ELB A;  2DYQ A;  5LON B;  2Z0O A;  4KHO A;  4EKU A;  2COD A;  2I1K A;  1BAK A;  4A5K A;  1XR0 B;  1V5U A;  1GG3 A;  1DDW A;  1FHW A;  1LB1 A;  3AJ4 A;  1XX0 A;  2MWN B;  4YL8 A;  1FOE A;  2LUL A;  1FB8 A;  1Y5O A;  1H4R A;  1QQG A;  4ZRJ A;  2D4Q A;  1B55 A;  1EVH A;  3VOQ A;  2QKL A;  1K5G B;  3UZT A;  4CHM A;  5D3V A;  1N3H A;  4EJN A;  3ML4 A;  5HE2 A;  5DHA B;  1BWN A;  2VKI A;  2YS3 A;  1SGH A;  2J0M A;  2UZS A;  1MAI A;  1XD4 A;  2ROV A;  2Y8F A;  2DN6 A;  5FI0 A;  1Y19 B;  2K00 A;  4YON A;  2YSZ A;  1NI2 A;  4NSW A;  2D9Z A;  3U8Z A;  5FI1 A;  5C79 A;  1WG7 A;  2I1J A;  2W2X C;  2MFQ A;  4GN1 A;  2IFS A;  1Z87 A;  3TFM A;  2CY5 A;  3KZ1 A;  1U5D A;  2Z0Q A;  3AU4 A;  3MPX A;  3VIA A;  3ODW A;  3G9W A;  2LOX A;  4ZRI A;  3ODO A;  1U5G A;  4L6E A;  3P7Z A;  4MY6 A;  1X1F A;  4HB3 B;  1MK7 B;  4F7G A;  1ZM0 A;  2LYD A;  2LOZ A;  1TXD A;  5L81 A;  2D9X A;  1FGY A;  1OQN A;  3F5R A;  4IOY X;  4A6H A;  1MIZ B;  2UVM A;  2LG1 A;  3M1I B;  1UNQ A;  1UNP A;  1W1D A;  4B6H A;  4KHB B;  2EJ8 A;  2MKR A;  5HE0 A;  3HK0 A;  3BJI A;  3HQC A;  1V61 A;  5HE3 A;  1H10 A;  3SNH A;  5JP4 A;  1NTY A;  1DDV A;  1TQZ A;  1KZG A;  1NTV A;  1WGQ A;  1FHO A;  2R0D A;  1UPQ A;  4A6F B;  2DFK A;  2RNR B;  1DRO A;  2QKM A;  4TKN A;  1EF1 A;  3KY9 A;  4DXA B;  1J19 A;  4HB2 B;  3CIK A;  4GZU A;  2HTH B;  5KQ4 A;  2L2I A;  4HAW B;  5JHH A;  1WJM A;  5C5B A;  1AWE A;  1XOD A;  1J0W A;  2K2U A;  1TJ6 A;  3BIN A;  3ZDT A;  1X11 A;  4WVF B;  1AQC A;  2X18 A;  3NSU A;  1BTN A;  1ISN A;  2YVC A;  3TO1 A;  2NZ8 B;  2ELA A;  3RCP A;  2DLW A;  3GYP A;  2DX5 A;  3FEH A;  1SHC A;  2YT0 A;  5DI9 B;  2YS5 A;  5JHG A;  5D3X A;  1X05 A;  3A8Q A;  2MDX A;  4DX9 0;  2J0J A;  4F7H A;  3ULC A;  1X1G A;  3IVF A;  4BBK A;  4HAX B;  1DDM A;  2R09 A;  3DXC A;  2RLO A;  2HE7 A;  4Z2M B;  2D10 A;  5D3Y A;  1V89 A;  2RVB B;  3MDB C;  1M7R A;  4F7U P;  2J59 M;  5HE1 A;  4KVG B;  1ZC4 B;  2N0Y A;  1KI1 B;  4NY0 A;  3QIJ A;  4P7I A;  3QBV B;  5CLQ B;  1UEF A;  2NMB A;  1MK9 B;  2JP2 A;  2EMT A;  2DX1 A;  3P6A A;  2OQB A;  4HB4 B;  2BCJ A;  1GC6 A;  4K81 A;  4Y94 A;  2KGX B;  2H7D A;  1DYN A;  3D8E A;  2L1C A;  5JLJ B;  3D8F A;  2OTX A;  4CHJ A;  1I7A A;  3ULB A;  1U5F A;  2AEH A;  3U7D A;  1EAZ A;  1QC6 A;  2DA0 A;  4PQ0 A;  3DXD A;  4CYE A;  4MK0 A;  2COA A;  4HAY B;  5DHF B;  5D3W A;  5EFX A;  2W2X D;  1V5M A;  2P8V A;  5D27 A;  3WA0 A;  3ODX A;  2KCJ A;  1MPH A;  1WVH A;  2D2Q A;  2W2W A;  2LKO A;  2DHI A;  2RUK B;  1PFJ A;  2DKQ A;  2DKP A;  4HAU B;  4GPT B;  2J0K A;  2UZR A;  4WSF A;  4K2O A;  5GOW B;  4HDQ A;  3F0W A;  2COC A;  1WI1 A;  4GXB A;  5KQ1 A;  2PZ1 A;  3WYF B;  4ZRK A;  3A8P A;  1IRS A;  2XQN M;  1E5W A;  3PG7 A;  2P0H A;  1I2H A;  2ROZ B;  2YRY A;  1UPR A;  4GMV A;  1OMW A;  1U27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...