2G35A

Nmr structure of talin-ptb in complex with pipki
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
100
structure length
100
Chain Sequence
LKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Talin-1
publication title Structural Basis for the Phosphorylation-regulated Focal Adhesion Targeting of Type Igamma Phosphatidylinositol Phosphate Kinase (PIPKIgamma) by Talin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
total genus 15
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2006-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2g35A00
2LOXA 3VIAA 2JP2A 1K5DB 3ODWA 3GYPA 1ZSQA 2D9WA 5FI0A 4GPTB 1FHXA 4EJNA 3CXBB 4PNKA 3ODOA 4KVGB 3PEGA 4YONA 1WJ1A 3G9WA 4Z2NA 1LB1A 1WJMA 3TW1A 2I5FA 2YS5A 4Y94A 4ZRJA 1P6SA 3QIJA 1XR0B 1DROA 5JHHA 3P7ZA 3AJ4A 3V5WA 3FM8C 5HE2A 3SV1A 4EMOA 4HAUB 5DI9B 5L81A 4F7GA 4GMXB 4A5KA 1DDMA 2IYBA 2Z0QA 2Y7BA 3VOQA 2L1CA 3PVLA 2N0YA 2R09A 1UNPA 1W1GA 1X1GA 1AQCA 2DHKA 2QKMA 1OMWA 4HB0B 2FJLA 4F7UP 1V5PA 1DYNA 3U7DA 1PFJA 2K00A 3D8DA 2IFSA 2HTHB 1MPHA 3QBVB 3ZVRA 2CY5A 1E5WA 1PLSA 4A6FB 4L6EA 2YT1A 1NTYA 1V89A 2KUPA 3DXCA 2ROVA 2DKQA 1KZ7A 1BTNA 2LULA 2UZRA 2J0JA 2Z0PA 5HE0A 4Z2MB 3O96A 3TCAA 2I1JA 1EAZA 1XD4A 2MFQA 1DDVA 1OY2A 5JLJB 2Z0OA 2E2XA 1UNQA 3T06A 2RVBB 1U5DA 1ZC3B 2CRFA 4D0NB 4MY6A 1NU2A 1MKEA 3A98B 2MWNB 4KAXB 1X1FA 1XX0A 2MKRA 1X86A 2J0KA 2DN6A 4DX90 1ZC4B 2COCA 3D8EA 2OTXA 2H7EA 1U5GA 2GS0A 2DFKA 4HB4B 3PVUA 4A6HA 3X23A 1IRSA 4A6FA 1U27A 3TO1A 3PVWA 3WA0A 1MIXA 1Q67A 4DX8A 4DXAB 2VRWB 5KQ1A 4IAPA 5DIFB 2LKOA 2VSZA 2P0HA 1SHCA 2D9YA 1TQZA 2GCLA 2DA0A 3FEHA 5JP4A 1DBHA 1J0WA 2AL6A 1WGUA 3HK0A 1EVHA 2P8VA 2DLWA 3HW2B 5CLQB 3N7CA 4B6HA 5LONB 5C16A 3PZDA 5KCVA 2CY4A 3WYFB 5DHAB 1V5UA 3UZTA 2CODA 2K2JA 1B55A 2ELBA 4CHJA 3IVFA 2D4QA 4KHBB 4HAWB 4HAVB 3KY9A 3SO6A 1AWEA 2LYDA 1EF1A 2RUKB 2HE7A 2DTCA 2YRYA 1WVHA 1GG3A 4HB2B 1U2BA 2I1KA 2J0MA 2UVMA 2YVCA 1I2HA 1ZM0A 5C79A 3SUZA 4IOYX 5D3VA 4HB3B 5D3YA 1X11A 2M14A 1TXDA 2W2WA 4HAYB 2DKPA 3GYOA 2BCJA 2G35A 2KCJA 3RCPA 3A8PA 1Z87A 4K81A 1MK9B 3KRWA 4GN1A 4HAXB 1U5FA 3ULBA 3U8ZA 3AU5A 2PZ1A 1U29A 2D9ZA 4BBKA 3KZ1A 1BAKA 1FGYA 2DYQA 1ISNA 1RJ2A 5D3XA 5DH9B 1K5GB 4CHMA 3HQCA 1DDWA 2W2XC 3BINA 2Y8GA 1TJ6A 4PQ0A 4WSFA 2W2XD 3TFMA 1X05A 1I7AA 1FAOA 1MK7B 2COAA 2P0FA 1V5MA 4ZRKA 3MPXA 3PG7A 1KZGA 4H8SA 4TKNA 2YT0A 3AU4A 3PSCA 1H4RA 4P7IA 2Q13A 1QC6A 5D27A 2KGXB 2P0DA 3QWMA 2RGNB 1UEFA 3CIKA 1V61A 3KSYA 5HE1A 2ELAA 4K2OA 4GXBA 2GJYA 4K2PA 2L2IA 1OQNA 1V88A 2I5CA 4C0AA 2D10A 2NZ8B 2LOZA 1XKEA 4WVFB 2D2QA 1W1DA 4HDOA 2YS1A 4MK0A 4KHOA 1Y19B 2EJ8A 1U5EA 4EKUA 4HATB 2RSGA 2DX5A 2YF0A 3NSUA 3PP2A 5C5BB 2YSZA 3D8FA 3KRXA 2OQBA 1XCGA 4GMVA 2RLOA 1WG7A 2DHIA 2K2UA 4CYEA 2LG1A 2ROZB 1QQGA 2AEHA 4K17A 1WI1A 3F0WA 5CLLB 3TVVA 3F5RA 3ODXA 4WJ7A 3M1IB 1FHOA 3MDBC 4HDQA 4YL8A 3SNHA 2R0DA 4A6KA 4GZUA 5J3YA 1WGQA 1UPQA 3BJIA 1P3RA 1MIZB 2GCJA 2ADZA 2VKIA 2DYNA 1FGZA 4HAZB 1PMSA 3P6AA 1UNRA 3ML4A 2EMTA 1NTVA 3LJUX 1EGXA 1RRPB 2YS3A 1ZVRA 3ULCA 2N23A 1N3HA 5LOPB 1P5TA 5C6RA 1NI2A 4NSWA 3SYXA 1UPRA 4IFSA 1FB8A 2CAYA 3FSSA 1GC6A 5JHGA 1KI1B 1FHWA 2Y8FA 5C5BA 1LW3A 3A8QA 5FI1A 2H7DA 5EFXA 2DX1A 1FOEA 1W1HA 5J3QA 1J19A 1Y5OA 2NMBA 1BTKA 1M7EA 1GC7A 4KHAA 1XODA 5GOWB 2D9XA 2D9VA 2QKLA 2EC1A 5D3WA 4HHVA 4XWXA 5HE3A 2COFA 4ZRIA 3DXEA 2D11A 5KQ4A 3ZDTA 4F7HA 2DHJA 2MDXA 2RNRB 3OANA 4NY0A 3DXDA 2UZSA 1BWNA 1H10A 1SGHA 2EMSA 2V76A 1MAIA 5DHFB 2XQNM 2M38A 2X18A 1M7RA 2ZPYA 5J3TA 4MT7A 4TYZA 4DBBA 2J59M
chains in the Genus database with same CATH superfamily
2LOXA 3VIAA 2JP2A 1K5DB 3ODWA 3GYPA 1ZSQA 2D9WA 5FI0A 4GPTB 1FHXA 4EJNA 3CXBB 4PNKA 3ODOA 4KVGB 3PEGA 4YONA 1WJ1A 3G9WA 4Z2NA 1LB1A 1WJMA 3TW1A 2I5FA 2YS5A 4Y94A 4ZRJA 4GNKB 4GOUA 1P6SA 3QIJA 1XR0B 1DROA 5JHHA 3P7ZA 3AJ4A 3V5WA 3FM8C 5HE2A 3SV1A 4EMOA 4HAUB 5DI9B 5L81A 2KUQA 4F7GA 4GMXB 4QJ5B 4A5KA 1DDMA 2IYBA 2GUMA 2Z0QA 2Y7BA 3VOQA 2L1CA 3PVLA 2N0YA 2R09A 2ZKMX 1UNPA 1W1GA 1X1GA 1AQCA 2DHKA 2QKMA 1OMWA 4HB0B 2FJLA 4F7UP 1V5PA 1DYNA 3U7DA 1PFJA 2K00A 2Z59A 3D8DA 2IFSA 2HTHB 1MPHA 3QBVB 3ZVRA 2CY5A 1E5WA 1PLSA 4A6FB 4L6EA 2YT1A 1NTYA 1V89A 2KUPA 3DXCA 3B77A 5I2MA 2ROVA 2DKQA 1KZ7A 4QJ4B 1BTNA 2LULA 2UZRA 2J0JA 2Z0PA 5HE0A 4Z2MB 3U12A 3O96A 3TCAA 2I1JA 1EAZA 1XD4A 2MFQA 1DDVA 1OY2A 5JLJB 2Z0OA 2E2XA 1UNQA 3T06A 2RVBB 1U5DA 1ZC3B 2CRFA 4D0NB 4MY6A 1NU2A 1MKEA 3A98B 2MWNB 4KAXB 1X1FA 1XX0A 2MKRA 1X86A 2J0KA 2DN6A 4DX90 1ZC4B 2COCA 1T77A 3D8EA 2OTXA 2H7EA 3HIEA 1U5GA 2GS0A 2DFKA 2KIGA 4HB4B 3PVUA 4A6HA 3X23A 1IRSA 4A6FA 1U27A 2FJUB 3TO1A 3NWFA 3PVWA 3WA0A 1MIXA 1Q67A 4DX8A 4DXAB 4DIXA 2VRWB 5KQ1A 4IAPA 5DIFB 2LKOA 2VSZA 2P0HA 1SHCA 2D9YA 1TQZA 2GCLA 2DA0A 3FEHA 5JP4A 1DBHA 1J0WA 2AL6A 1WGUA 3HK0A 4L1RA 1EVHA 2P8VA 2DLWA 3HW2B 5CLQB 3N7CA 4B6HA 5LONB 5C16A 3PZDA 5KCVA 2CY4A 3WYFB 5DHAB 1V5UA 3UZTA 5I2SA 2CODA 2K2JA 4OSNA 1B55A 2ELBA 4CHJA 3IVFA 2D4QA 2KR0A 4KHBB 4HAWB 4HAVB 3KY9A 3SO6A 1AWEA 2LYDA 1EF1A 2RUKB 2HE7A 2DTCA 2YRYA 1WVHA 1GG3A 4HB2B 3DCXA 1U2BA 2I1KA 2J0MA 2UVMA 2YVCA 1I2HA 1ZM0A 5C79A 3SUZA 4IOYX 5D3VA 4QXAB 4OT1A 4HB3B 5D3YA 1X11A 2M14A 1TXDA 2K8EA 2W2WA 4HAYB 2DKPA 3GYOA 2BCJA 5IRSA 2G35A 2KCJA 3RCPA 3A8PA 1Z87A 4K81A 1MK9B 3KRWA 4GN1A 4HAXB 1U5FA 3ULBA 3U8ZA 3AU5A 2PZ1A 1U29A 2D9ZA 4BBKA 3KZ1A 5M4YB 1FGYA 1BAKA 2DYQA 1ISNA 1RJ2A 5D3XA 5DH9B 1K5GB 4CHMA 3HQCA 1DDWA 2W2XC 3BINA 2Y8GA 1TJ6A 4PQ0A 4WSFA 2W2XD 3TFMA 1X05A 1I7AA 1FAOA 4KHBA 1MK7B 5LG4B 2COAA 2P0FA 1V5MA 4ZRKA 3MPXA 4QJ3B 3PG7A 1KZGA 4H8SA 4TKNA 2YT0A 3AU4A 3PSCA 1H4RA 4P7IA 2Z4DA 4CSQA 2Q13A 1QC6A 5D27A 2KGXB 2P0DA 3QWMA 2RGNB 1UEFA 3CIKA 2Z14A 1V61A 3KSYA 5HE1A 2ELAA 4K2OA 4GXBA 2GJYA 4K2PA 2R2YA 2L2IA 1OQNA 1V88A 2I5CA 4C0AA 2D10A 2NZ8B 2LOZA 1XKEA 4WVFB 2D2QA 1W1DA 4HDOA 2YS1A 4MK0A 4KHOA 3NWAA 2RRFA 1Y19B 2EJ8A 1U5EA 4EKUA 4HATB 4HSIA 2Z13A 2RSGA 2DX5A 2YF0A 3NSUA 2YT2A 3PP2A 5C5BB 3NW8A 2YSZA 3D8FA 3KRXA 2OQBA 1XCGA 4GMVA 2RLOA 1WG7A 2DHIA 2K2UA 4CYEA 2LG1A 2ROZB 1QQGA 2AEHA 4K17A 1WI1A 3F0WA 5CLLB 3TVVA 3F5RA 3ODXA 4WJ7A 2K49A 3M1IB 1FHOA 3MDBC 4HDQA 4YL8A 3SNHA 2R0DA 4A6KA 4GZUA 5J3YA 1WGQA 1UPQA 3NWDA 3BJIA 1P3RA 1MIZB 2GCJA 2ADZA 2VKIA 2DYNA 1FGZA 3A58A 4HAZB 1PMSA 3P6AA 1UNRA 3ML4A 2EMTA 1NTVA 3LJUX 1EGXA 1RRPB 2YS3A 1ZVRA 3ULCA 2N23A 1N3HA 5LOPB 2NBVA 1P5TA 5C6RA 1NI2A 4NSWA 3SYXA 1UPRA 4IFSA 1FB8A 2CAYA 3FSSA 1GC6A 3HSAA 5JHGA 1KI1B 1FHWA 2Y8FA 4D6WA 5C5BA 1LW3A 3A8QA 5FI1A 2H7DA 5EFXA 2DX1A 1FOEA 1W1HA 5J3QA 1J19A 1Y5OA 2NMBA 1BTKA 1M7EA 1GC7A 4KHAA 3FVCA 1XODA 5GOWB 2D9XA 2D9VA 1MI1A 2QKLA 2EC1A 5D3WA 4HHVA 4XWXA 5HE3A 2COFA 4ZRIA 3DXEA 2D11A 5KQ4A 3ZDTA 4F7HA 3OHMB 2DHJA 2MDXA 2RNRB 3OANA 1ZYIA 4NY0A 3DXDA 2UZSA 1BWNA 1H10A 1SGHA 2EMSA 2V76A 1MAIA 5DHFB 2XQNM 2M38A 2KIEA 2X18A 1M7RA 2ZPYA 5J3TA 4MT7A 4TYZA 4DBBA 2J59M
chains in the Genus database with same CATH topology
2LOXA 3VIAA 2JP2A 1K5DB 3ODWA 3GYPA 1ZSQA 2D9WA 5FI0A 4GPTB 1FHXA 4EJNA 3CXBB 4PNKA 3ODOA 4KVGB 3PEGA 4YONA 1WJ1A 3G9WA 4Z2NA 1LB1A 1WJMA 3TW1A 2I5FA 2YS5A 4Y94A 4ZRJA 1P6SA 3QIJA 1XR0B 1DROA 5JHHA 3P7ZA 3AJ4A 3V5WA 3FM8C 5HE2A 3SV1A 4EMOA 4HAUB 5DI9B 5L81A 4F7GA 4GMXB 4A5KA 1DDMA 2IYBA 2Z0QA 2Y7BA 3VOQA 2L1CA 3PVLA 2N0YA 2R09A 1UNPA 1W1GA 1X1GA 1AQCA 2DHKA 2QKMA 1OMWA 4HB0B 2FJLA 4F7UP 1V5PA 1DYNA 3U7DA 1PFJA 2K00A 3D8DA 2IFSA 2HTHB 1MPHA 3QBVB 3ZVRA 2CY5A 1E5WA 1PLSA 4A6FB 4L6EA 2YT1A 1NTYA 1V89A 2KUPA 3DXCA 2ROVA 2DKQA 1KZ7A 1BTNA 2LULA 2UZRA 2J0JA 2Z0PA 5HE0A 4Z2MB 3O96A 3TCAA 2I1JA 1EAZA 1XD4A 2MFQA 1DDVA 1OY2A 5JLJB 2Z0OA 2E2XA 1UNQA 3T06A 2RVBB 1U5DA 1ZC3B 2CRFA 4D0NB 4MY6A 1NU2A 1MKEA 3A98B 2MWNB 4KAXB 1X1FA 1XX0A 2MKRA 1X86A 2J0KA 2DN6A 4DX90 1ZC4B 2COCA 3D8EA 2OTXA 2H7EA 1U5GA 2GS0A 2DFKA 4HB4B 3PVUA 4A6HA 3X23A 1IRSA 4A6FA 1U27A 3TO1A 3PVWA 3WA0A 1MIXA 1Q67A 4DX8A 4DXAB 2VRWB 5KQ1A 4IAPA 5DIFB 2LKOA 2VSZA 2P0HA 1SHCA 2D9YA 1TQZA 2GCLA 2DA0A 3FEHA 5JP4A 1DBHA 1J0WA 2AL6A 1WGUA 3HK0A 1EVHA 2P8VA 2DLWA 3HW2B 5CLQB 3N7CA 4B6HA 5LONB 5C16A 3PZDA 5KCVA 2CY4A 3WYFB 5DHAB 1V5UA 3UZTA 2CODA 2K2JA 1B55A 2ELBA 4CHJA 3IVFA 2D4QA 4KHBB 4HAWB 4HAVB 3KY9A 3SO6A 1AWEA 2LYDA 1EF1A 2RUKB 2HE7A 2DTCA 2YRYA 1WVHA 1GG3A 4HB2B 1U2BA 2I1KA 2J0MA 2UVMA 2YVCA 1I2HA 1ZM0A 5C79A 3SUZA 4IOYX 5D3VA 4HB3B 5D3YA 1X11A 2M14A 1TXDA 2W2WA 4HAYB 2DKPA 3GYOA 2BCJA 2G35A 2KCJA 3RCPA 3A8PA 1Z87A 4K81A 1MK9B 3KRWA 4GN1A 4HAXB 1U5FA 3ULBA 3U8ZA 3AU5A 2PZ1A 1U29A 2D9ZA 4BBKA 3KZ1A 1BAKA 1FGYA 2DYQA 1ISNA 1RJ2A 5D3XA 5DH9B 1K5GB 4CHMA 3HQCA 1DDWA 2W2XC 3BINA 2Y8GA 1TJ6A 4PQ0A 4WSFA 2W2XD 3TFMA 1X05A 1I7AA 1FAOA 1MK7B 2COAA 2P0FA 1V5MA 4ZRKA 3MPXA 3PG7A 1KZGA 4H8SA 4TKNA 2YT0A 3AU4A 3PSCA 1H4RA 4P7IA 2Q13A 1QC6A 5D27A 2KGXB 2P0DA 3QWMA 2RGNB 1UEFA 3CIKA 1V61A 3KSYA 5HE1A 2ELAA 4K2OA 4GXBA 2GJYA 4K2PA 2L2IA 1OQNA 1V88A 2I5CA 4C0AA 2D10A 2NZ8B 2LOZA 1XKEA 4WVFB 2D2QA 1W1DA 4HDOA 2YS1A 4MK0A 4KHOA 1Y19B 2EJ8A 1U5EA 4EKUA 4HATB 2RSGA 2DX5A 2YF0A 3NSUA 3PP2A 5C5BB 2YSZA 3D8FA 3KRXA 2OQBA 1XCGA 4GMVA 2RLOA 1WG7A 2DHIA 2K2UA 4CYEA 2LG1A 2ROZB 1QQGA 2AEHA 4K17A 1WI1A 3F0WA 5CLLB 3TVVA 3F5RA 3ODXA 4WJ7A 3M1IB 1FHOA 3MDBC 4HDQA 4YL8A 3SNHA 2R0DA 4A6KA 4GZUA 5J3YA 1WGQA 1UPQA 3BJIA 1P3RA 1MIZB 2GCJA 2ADZA 2VKIA 2DYNA 1FGZA 4HAZB 1PMSA 3P6AA 1UNRA 3ML4A 2EMTA 1NTVA 3LJUX 1EGXA 1RRPB 2YS3A 1ZVRA 3ULCA 2N23A 1N3HA 5LOPB 1P5TA 5C6RA 1NI2A 4NSWA 3SYXA 1UPRA 4IFSA 1FB8A 2CAYA 3FSSA 1GC6A 5JHGA 1KI1B 1FHWA 2Y8FA 5C5BA 1LW3A 3A8QA 5FI1A 2H7DA 5EFXA 2DX1A 1FOEA 1W1HA 5J3QA 1J19A 1Y5OA 2NMBA 1BTKA 1M7EA 1GC7A 4KHAA 1XODA 5GOWB 2D9XA 2D9VA 2QKLA 2EC1A 5D3WA 4HHVA 4XWXA 5HE3A 2COFA 4ZRIA 3DXEA 2D11A 5KQ4A 3ZDTA 4F7HA 2DHJA 2MDXA 2RNRB 3OANA 4NY0A 3DXDA 2UZSA 1BWNA 1H10A 1SGHA 2EMSA 2V76A 1MAIA 5DHFB 2XQNM 2M38A 2X18A 1M7RA 2ZPYA 5J3TA 4MT7A 4TYZA 4DBBA 2J59M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LOX A;  3VIA A;  2JP2 A;  1K5D B;  3ODW A;  3GYP A;  1ZSQ A;  2D9W A;  5FI0 A;  4GPT B;  1FHX A;  4EJN A;  3CXB B;  4PNK A;  3ODO A;  4KVG B;  3PEG A;  4YON A;  1WJ1 A;  3G9W A;  4Z2N A;  1LB1 A;  1WJM A;  3TW1 A;  2I5F A;  2YS5 A;  4Y94 A;  4ZRJ A;  1P6S A;  3QIJ A;  1XR0 B;  1DRO A;  5JHH A;  3P7Z A;  3AJ4 A;  3V5W A;  3FM8 C;  5HE2 A;  3SV1 A;  4EMO A;  4HAU B;  5DI9 B;  5L81 A;  4F7G A;  4GMX B;  4A5K A;  1DDM A;  2IYB A;  2Z0Q A;  2Y7B A;  3VOQ A;  2L1C A;  3PVL A;  2N0Y A;  2R09 A;  1UNP A;  1W1G A;  1X1G A;  1AQC A;  2DHK A;  2QKM A;  1OMW A;  4HB0 B;  2FJL A;  4F7U P;  1V5P A;  1DYN A;  3U7D A;  1PFJ A;  2K00 A;  3D8D A;  2IFS A;  2HTH B;  1MPH A;  3QBV B;  3ZVR A;  2CY5 A;  1E5W A;  1PLS A;  4A6F B;  4L6E A;  2YT1 A;  1NTY A;  1V89 A;  2KUP A;  3DXC A;  2ROV A;  2DKQ A;  1KZ7 A;  1BTN A;  2LUL A;  2UZR A;  2J0J A;  2Z0P A;  5HE0 A;  4Z2M B;  3O96 A;  3TCA A;  2I1J A;  1EAZ A;  1XD4 A;  2MFQ A;  1DDV A;  1OY2 A;  5JLJ B;  2Z0O A;  2E2X A;  1UNQ A;  3T06 A;  2RVB B;  1U5D A;  1ZC3 B;  2CRF A;  4D0N B;  4MY6 A;  1NU2 A;  1MKE A;  3A98 B;  2MWN B;  4KAX B;  1X1F A;  1XX0 A;  2MKR A;  1X86 A;  2J0K A;  2DN6 A;  4DX9 0;  1ZC4 B;  2COC A;  3D8E A;  2OTX A;  2H7E A;  1U5G A;  2GS0 A;  2DFK A;  4HB4 B;  3PVU A;  4A6H A;  3X23 A;  1IRS A;  4A6F A;  1U27 A;  3TO1 A;  3PVW A;  3WA0 A;  1MIX A;  1Q67 A;  4DX8 A;  4DXA B;  2VRW B;  5KQ1 A;  4IAP A;  5DIF B;  2LKO A;  2VSZ A;  2P0H A;  1SHC A;  2D9Y A;  1TQZ A;  2GCL A;  2DA0 A;  3FEH A;  5JP4 A;  1DBH A;  1J0W A;  2AL6 A;  1WGU A;  3HK0 A;  1EVH A;  2P8V A;  2DLW A;  3HW2 B;  5CLQ B;  3N7C A;  4B6H A;  5LON B;  5C16 A;  3PZD A;  5KCV A;  2CY4 A;  3WYF B;  5DHA B;  1V5U A;  3UZT A;  2COD A;  2K2J A;  1B55 A;  2ELB A;  4CHJ A;  3IVF A;  2D4Q A;  4KHB B;  4HAW B;  4HAV B;  3KY9 A;  3SO6 A;  1AWE A;  2LYD A;  1EF1 A;  2RUK B;  2HE7 A;  2DTC A;  2YRY A;  1WVH A;  1GG3 A;  4HB2 B;  1U2B A;  2I1K A;  2J0M A;  2UVM A;  2YVC A;  1I2H A;  1ZM0 A;  5C79 A;  3SUZ A;  4IOY X;  5D3V A;  4HB3 B;  5D3Y A;  1X11 A;  2M14 A;  1TXD A;  2W2W A;  4HAY B;  2DKP A;  3GYO A;  2BCJ A;  2G35 A;  2KCJ A;  3RCP A;  3A8P A;  1Z87 A;  4K81 A;  1MK9 B;  3KRW A;  4GN1 A;  4HAX B;  1U5F A;  3ULB A;  3U8Z A;  3AU5 A;  2PZ1 A;  1U29 A;  2D9Z A;  4BBK A;  3KZ1 A;  1BAK A;  1FGY A;  2DYQ A;  1ISN A;  1RJ2 A;  5D3X A;  5DH9 B;  1K5G B;  4CHM A;  3HQC A;  1DDW A;  2W2X C;  3BIN A;  2Y8G A;  1TJ6 A;  4PQ0 A;  4WSF A;  2W2X D;  3TFM A;  1X05 A;  1I7A A;  1FAO A;  1MK7 B;  2COA A;  2P0F A;  1V5M A;  4ZRK A;  3MPX A;  3PG7 A;  1KZG A;  4H8S A;  4TKN A;  2YT0 A;  3AU4 A;  3PSC A;  1H4R A;  4P7I A;  2Q13 A;  1QC6 A;  5D27 A;  2KGX B;  2P0D A;  3QWM A;  2RGN B;  1UEF A;  3CIK A;  1V61 A;  3KSY A;  5HE1 A;  2ELA A;  4K2O A;  4GXB A;  2GJY A;  4K2P A;  2L2I A;  1OQN A;  1V88 A;  2I5C A;  4C0A A;  2D10 A;  2NZ8 B;  2LOZ A;  1XKE A;  4WVF B;  2D2Q A;  1W1D A;  4HDO A;  2YS1 A;  4MK0 A;  4KHO A;  1Y19 B;  2EJ8 A;  1U5E A;  4EKU A;  4HAT B;  2RSG A;  2DX5 A;  2YF0 A;  3NSU A;  3PP2 A;  5C5B B;  2YSZ A;  3D8F A;  3KRX A;  2OQB A;  1XCG A;  4GMV A;  2RLO A;  1WG7 A;  2DHI A;  2K2U A;  4CYE A;  2LG1 A;  2ROZ B;  1QQG A;  2AEH A;  4K17 A;  1WI1 A;  3F0W A;  5CLL B;  3TVV A;  3F5R A;  3ODX A;  4WJ7 A;  3M1I B;  1FHO A;  3MDB C;  4HDQ A;  4YL8 A;  3SNH A;  2R0D A;  4A6K A;  4GZU A;  5J3Y A;  1WGQ A;  1UPQ A;  3BJI A;  1P3R A;  1MIZ B;  2GCJ A;  2ADZ A;  2VKI A;  2DYN A;  1FGZ A;  4HAZ B;  1PMS A;  3P6A A;  1UNR A;  3ML4 A;  2EMT A;  1NTV A;  3LJU X;  1EGX A;  1RRP B;  2YS3 A;  1ZVR A;  3ULC A;  2N23 A;  1N3H A;  5LOP B;  1P5T A;  5C6R A;  1NI2 A;  4NSW A;  3SYX A;  1UPR A;  4IFS A;  1FB8 A;  2CAY A;  3FSS A;  1GC6 A;  5JHG A;  1KI1 B;  1FHW A;  2Y8F A;  5C5B A;  1LW3 A;  3A8Q A;  5FI1 A;  2H7D A;  5EFX A;  2DX1 A;  1FOE A;  1W1H A;  5J3Q A;  1J19 A;  1Y5O A;  2NMB A;  1BTK A;  1M7E A;  1GC7 A;  4KHA A;  1XOD A;  5GOW B;  2D9X A;  2D9V A;  2QKL A;  2EC1 A;  5D3W A;  4HHV A;  4XWX A;  5HE3 A;  2COF A;  4ZRI A;  3DXE A;  2D11 A;  5KQ4 A;  3ZDT A;  4F7H A;  2DHJ A;  2MDX A;  2RNR B;  3OAN A;  4NY0 A;  3DXD A;  2UZS A;  1BWN A;  1H10 A;  1SGH A;  2EMS A;  2V76 A;  1MAI A;  5DHF B;  2XQN M;  2M38 A;  2X18 A;  1M7R A;  2ZPY A;  5J3T A;  4MT7 A;  4TYZ A;  4DBB A;  2J59 M; 
#chains in the Genus database with same CATH topology
 2LOX A;  3VIA A;  2JP2 A;  1K5D B;  3ODW A;  3GYP A;  1ZSQ A;  2D9W A;  5FI0 A;  4GPT B;  1FHX A;  4EJN A;  3CXB B;  4PNK A;  3ODO A;  4KVG B;  3PEG A;  4YON A;  1WJ1 A;  3G9W A;  4Z2N A;  1LB1 A;  1WJM A;  3TW1 A;  2I5F A;  2YS5 A;  4Y94 A;  4ZRJ A;  4GNK B;  4GOU A;  1P6S A;  3QIJ A;  1XR0 B;  1DRO A;  5JHH A;  3P7Z A;  3AJ4 A;  3V5W A;  3FM8 C;  5HE2 A;  3SV1 A;  4EMO A;  4HAU B;  5DI9 B;  5L81 A;  2KUQ A;  4F7G A;  4GMX B;  4QJ5 B;  4A5K A;  1DDM A;  2IYB A;  2GUM A;  2Z0Q A;  2Y7B A;  3VOQ A;  2L1C A;  3PVL A;  2N0Y A;  2R09 A;  2ZKM X;  1UNP A;  1W1G A;  1X1G A;  1AQC A;  2DHK A;  2QKM A;  1OMW A;  4HB0 B;  2FJL A;  4F7U P;  1V5P A;  1DYN A;  3U7D A;  1PFJ A;  2K00 A;  2Z59 A;  3D8D A;  2IFS A;  2HTH B;  1MPH A;  3QBV B;  3ZVR A;  2CY5 A;  1E5W A;  1PLS A;  4A6F B;  4L6E A;  2YT1 A;  1NTY A;  1V89 A;  2KUP A;  3DXC A;  3B77 A;  5I2M A;  2ROV A;  2DKQ A;  1KZ7 A;  4QJ4 B;  1BTN A;  2LUL A;  2UZR A;  2J0J A;  2Z0P A;  5HE0 A;  4Z2M B;  3U12 A;  3O96 A;  3TCA A;  2I1J A;  1EAZ A;  1XD4 A;  2MFQ A;  1DDV A;  1OY2 A;  5JLJ B;  2Z0O A;  2E2X A;  1UNQ A;  3T06 A;  2RVB B;  1U5D A;  1ZC3 B;  2CRF A;  4D0N B;  4MY6 A;  1NU2 A;  1MKE A;  3A98 B;  2MWN B;  4KAX B;  1X1F A;  1XX0 A;  2MKR A;  1X86 A;  2J0K A;  2DN6 A;  4DX9 0;  1ZC4 B;  2COC A;  1T77 A;  3D8E A;  2OTX A;  2H7E A;  3HIE A;  1U5G A;  2GS0 A;  2DFK A;  2KIG A;  4HB4 B;  3PVU A;  4A6H A;  3X23 A;  1IRS A;  4A6F A;  1U27 A;  2FJU B;  3TO1 A;  3NWF A;  3PVW A;  3WA0 A;  1MIX A;  1Q67 A;  4DX8 A;  4DXA B;  4DIX A;  2VRW B;  5KQ1 A;  4IAP A;  5DIF B;  2LKO A;  2VSZ A;  2P0H A;  1SHC A;  2D9Y A;  1TQZ A;  2GCL A;  2DA0 A;  3FEH A;  5JP4 A;  1DBH A;  1J0W A;  2AL6 A;  1WGU A;  3HK0 A;  4L1R A;  1EVH A;  2P8V A;  2DLW A;  3HW2 B;  5CLQ B;  3N7C A;  4B6H A;  5LON B;  5C16 A;  3PZD A;  5KCV A;  2CY4 A;  3WYF B;  5DHA B;  1V5U A;  3UZT A;  5I2S A;  2COD A;  2K2J A;  4OSN A;  1B55 A;  2ELB A;  4CHJ A;  3IVF A;  2D4Q A;  2KR0 A;  4KHB B;  4HAW B;  4HAV B;  3KY9 A;  3SO6 A;  1AWE A;  2LYD A;  1EF1 A;  2RUK B;  2HE7 A;  2DTC A;  2YRY A;  1WVH A;  1GG3 A;  4HB2 B;  3DCX A;  1U2B A;  2I1K A;  2J0M A;  2UVM A;  2YVC A;  1I2H A;  1ZM0 A;  5C79 A;  3SUZ A;  4IOY X;  5D3V A;  4QXA B;  4OT1 A;  4HB3 B;  5D3Y A;  1X11 A;  2M14 A;  1TXD A;  2K8E A;  2W2W A;  4HAY B;  2DKP A;  3GYO A;  2BCJ A;  5IRS A;  2G35 A;  2KCJ A;  3RCP A;  3A8P A;  1Z87 A;  4K81 A;  1MK9 B;  3KRW A;  4GN1 A;  4HAX B;  1U5F A;  3ULB A;  3U8Z A;  3AU5 A;  2PZ1 A;  1U29 A;  2D9Z A;  4BBK A;  3KZ1 A;  5M4Y B;  1FGY A;  1BAK A;  2DYQ A;  1ISN A;  1RJ2 A;  5D3X A;  5DH9 B;  1K5G B;  4CHM A;  3HQC A;  1DDW A;  2W2X C;  3BIN A;  2Y8G A;  1TJ6 A;  4PQ0 A;  4WSF A;  2W2X D;  3TFM A;  1X05 A;  1I7A A;  1FAO A;  4KHB A;  1MK7 B;  5LG4 B;  2COA A;  2P0F A;  1V5M A;  4ZRK A;  3MPX A;  4QJ3 B;  3PG7 A;  1KZG A;  4H8S A;  4TKN A;  2YT0 A;  3AU4 A;  3PSC A;  1H4R A;  4P7I A;  2Z4D A;  4CSQ A;  2Q13 A;  1QC6 A;  5D27 A;  2KGX B;  2P0D A;  3QWM A;  2RGN B;  1UEF A;  3CIK A;  2Z14 A;  1V61 A;  3KSY A;  5HE1 A;  2ELA A;  4K2O A;  4GXB A;  2GJY A;  4K2P A;  2R2Y A;  2L2I A;  1OQN A;  1V88 A;  2I5C A;  4C0A A;  2D10 A;  2NZ8 B;  2LOZ A;  1XKE A;  4WVF B;  2D2Q A;  1W1D A;  4HDO A;  2YS1 A;  4MK0 A;  4KHO A;  3NWA A;  2RRF A;  1Y19 B;  2EJ8 A;  1U5E A;  4EKU A;  4HAT B;  4HSI A;  2Z13 A;  2RSG A;  2DX5 A;  2YF0 A;  3NSU A;  2YT2 A;  3PP2 A;  5C5B B;  3NW8 A;  2YSZ A;  3D8F A;  3KRX A;  2OQB A;  1XCG A;  4GMV A;  2RLO A;  1WG7 A;  2DHI A;  2K2U A;  4CYE A;  2LG1 A;  2ROZ B;  1QQG A;  2AEH A;  4K17 A;  1WI1 A;  3F0W A;  5CLL B;  3TVV A;  3F5R A;  3ODX A;  4WJ7 A;  2K49 A;  3M1I B;  1FHO A;  3MDB C;  4HDQ A;  4YL8 A;  3SNH A;  2R0D A;  4A6K A;  4GZU A;  5J3Y A;  1WGQ A;  1UPQ A;  3NWD A;  3BJI A;  1P3R A;  1MIZ B;  2GCJ A;  2ADZ A;  2VKI A;  2DYN A;  1FGZ A;  3A58 A;  4HAZ B;  1PMS A;  3P6A A;  1UNR A;  3ML4 A;  2EMT A;  1NTV A;  3LJU X;  1EGX A;  1RRP B;  2YS3 A;  1ZVR A;  3ULC A;  2N23 A;  1N3H A;  5LOP B;  2NBV A;  1P5T A;  5C6R A;  1NI2 A;  4NSW A;  3SYX A;  1UPR A;  4IFS A;  1FB8 A;  2CAY A;  3FSS A;  1GC6 A;  3HSA A;  5JHG A;  1KI1 B;  1FHW A;  2Y8F A;  4D6W A;  5C5B A;  1LW3 A;  3A8Q A;  5FI1 A;  2H7D A;  5EFX A;  2DX1 A;  1FOE A;  1W1H A;  5J3Q A;  1J19 A;  1Y5O A;  2NMB A;  1BTK A;  1M7E A;  1GC7 A;  4KHA A;  3FVC A;  1XOD A;  5GOW B;  2D9X A;  2D9V A;  1MI1 A;  2QKL A;  2EC1 A;  5D3W A;  4HHV A;  4XWX A;  5HE3 A;  2COF A;  4ZRI A;  3DXE A;  2D11 A;  5KQ4 A;  3ZDT A;  4F7H A;  3OHM B;  2DHJ A;  2MDX A;  2RNR B;  3OAN A;  1ZYI A;  4NY0 A;  3DXD A;  2UZS A;  1BWN A;  1H10 A;  1SGH A;  2EMS A;  2V76 A;  1MAI A;  5DHF B;  2XQN M;  2M38 A;  2KIE A;  2X18 A;  1M7R A;  2ZPY A;  5J3T A;  4MT7 A;  4TYZ A;  4DBB A;  2J59 M; 
#chains in the Genus database with same CATH homology
 2LOX A;  3VIA A;  2JP2 A;  1K5D B;  3ODW A;  3GYP A;  1ZSQ A;  2D9W A;  5FI0 A;  4GPT B;  1FHX A;  4EJN A;  3CXB B;  4PNK A;  3ODO A;  4KVG B;  3PEG A;  4YON A;  1WJ1 A;  3G9W A;  4Z2N A;  1LB1 A;  1WJM A;  3TW1 A;  2I5F A;  2YS5 A;  4Y94 A;  4ZRJ A;  1P6S A;  3QIJ A;  1XR0 B;  1DRO A;  5JHH A;  3P7Z A;  3AJ4 A;  3V5W A;  3FM8 C;  5HE2 A;  3SV1 A;  4EMO A;  4HAU B;  5DI9 B;  5L81 A;  4F7G A;  4GMX B;  4A5K A;  1DDM A;  2IYB A;  2Z0Q A;  2Y7B A;  3VOQ A;  2L1C A;  3PVL A;  2N0Y A;  2R09 A;  1UNP A;  1W1G A;  1X1G A;  1AQC A;  2DHK A;  2QKM A;  1OMW A;  4HB0 B;  2FJL A;  4F7U P;  1V5P A;  1DYN A;  3U7D A;  1PFJ A;  2K00 A;  3D8D A;  2IFS A;  2HTH B;  1MPH A;  3QBV B;  3ZVR A;  2CY5 A;  1E5W A;  1PLS A;  4A6F B;  4L6E A;  2YT1 A;  1NTY A;  1V89 A;  2KUP A;  3DXC A;  2ROV A;  2DKQ A;  1KZ7 A;  1BTN A;  2LUL A;  2UZR A;  2J0J A;  2Z0P A;  5HE0 A;  4Z2M B;  3O96 A;  3TCA A;  2I1J A;  1EAZ A;  1XD4 A;  2MFQ A;  1DDV A;  1OY2 A;  5JLJ B;  2Z0O A;  2E2X A;  1UNQ A;  3T06 A;  2RVB B;  1U5D A;  1ZC3 B;  2CRF A;  4D0N B;  4MY6 A;  1NU2 A;  1MKE A;  3A98 B;  2MWN B;  4KAX B;  1X1F A;  1XX0 A;  2MKR A;  1X86 A;  2J0K A;  2DN6 A;  4DX9 0;  1ZC4 B;  2COC A;  3D8E A;  2OTX A;  2H7E A;  1U5G A;  2GS0 A;  2DFK A;  4HB4 B;  3PVU A;  4A6H A;  3X23 A;  1IRS A;  4A6F A;  1U27 A;  3TO1 A;  3PVW A;  3WA0 A;  1MIX A;  1Q67 A;  4DX8 A;  4DXA B;  2VRW B;  5KQ1 A;  4IAP A;  5DIF B;  2LKO A;  2VSZ A;  2P0H A;  1SHC A;  2D9Y A;  1TQZ A;  2GCL A;  2DA0 A;  3FEH A;  5JP4 A;  1DBH A;  1J0W A;  2AL6 A;  1WGU A;  3HK0 A;  1EVH A;  2P8V A;  2DLW A;  3HW2 B;  5CLQ B;  3N7C A;  4B6H A;  5LON B;  5C16 A;  3PZD A;  5KCV A;  2CY4 A;  3WYF B;  5DHA B;  1V5U A;  3UZT A;  2COD A;  2K2J A;  1B55 A;  2ELB A;  4CHJ A;  3IVF A;  2D4Q A;  4KHB B;  4HAW B;  4HAV B;  3KY9 A;  3SO6 A;  1AWE A;  2LYD A;  1EF1 A;  2RUK B;  2HE7 A;  2DTC A;  2YRY A;  1WVH A;  1GG3 A;  4HB2 B;  1U2B A;  2I1K A;  2J0M A;  2UVM A;  2YVC A;  1I2H A;  1ZM0 A;  5C79 A;  3SUZ A;  4IOY X;  5D3V A;  4HB3 B;  5D3Y A;  1X11 A;  2M14 A;  1TXD A;  2W2W A;  4HAY B;  2DKP A;  3GYO A;  2BCJ A;  2G35 A;  2KCJ A;  3RCP A;  3A8P A;  1Z87 A;  4K81 A;  1MK9 B;  3KRW A;  4GN1 A;  4HAX B;  1U5F A;  3ULB A;  3U8Z A;  3AU5 A;  2PZ1 A;  1U29 A;  2D9Z A;  4BBK A;  3KZ1 A;  1BAK A;  1FGY A;  2DYQ A;  1ISN A;  1RJ2 A;  5D3X A;  5DH9 B;  1K5G B;  4CHM A;  3HQC A;  1DDW A;  2W2X C;  3BIN A;  2Y8G A;  1TJ6 A;  4PQ0 A;  4WSF A;  2W2X D;  3TFM A;  1X05 A;  1I7A A;  1FAO A;  1MK7 B;  2COA A;  2P0F A;  1V5M A;  4ZRK A;  3MPX A;  3PG7 A;  1KZG A;  4H8S A;  4TKN A;  2YT0 A;  3AU4 A;  3PSC A;  1H4R A;  4P7I A;  2Q13 A;  1QC6 A;  5D27 A;  2KGX B;  2P0D A;  3QWM A;  2RGN B;  1UEF A;  3CIK A;  1V61 A;  3KSY A;  5HE1 A;  2ELA A;  4K2O A;  4GXB A;  2GJY A;  4K2P A;  2L2I A;  1OQN A;  1V88 A;  2I5C A;  4C0A A;  2D10 A;  2NZ8 B;  2LOZ A;  1XKE A;  4WVF B;  2D2Q A;  1W1D A;  4HDO A;  2YS1 A;  4MK0 A;  4KHO A;  1Y19 B;  2EJ8 A;  1U5E A;  4EKU A;  4HAT B;  2RSG A;  2DX5 A;  2YF0 A;  3NSU A;  3PP2 A;  5C5B B;  2YSZ A;  3D8F A;  3KRX A;  2OQB A;  1XCG A;  4GMV A;  2RLO A;  1WG7 A;  2DHI A;  2K2U A;  4CYE A;  2LG1 A;  2ROZ B;  1QQG A;  2AEH A;  4K17 A;  1WI1 A;  3F0W A;  5CLL B;  3TVV A;  3F5R A;  3ODX A;  4WJ7 A;  3M1I B;  1FHO A;  3MDB C;  4HDQ A;  4YL8 A;  3SNH A;  2R0D A;  4A6K A;  4GZU A;  5J3Y A;  1WGQ A;  1UPQ A;  3BJI A;  1P3R A;  1MIZ B;  2GCJ A;  2ADZ A;  2VKI A;  2DYN A;  1FGZ A;  4HAZ B;  1PMS A;  3P6A A;  1UNR A;  3ML4 A;  2EMT A;  1NTV A;  3LJU X;  1EGX A;  1RRP B;  2YS3 A;  1ZVR A;  3ULC A;  2N23 A;  1N3H A;  5LOP B;  1P5T A;  5C6R A;  1NI2 A;  4NSW A;  3SYX A;  1UPR A;  4IFS A;  1FB8 A;  2CAY A;  3FSS A;  1GC6 A;  5JHG A;  1KI1 B;  1FHW A;  2Y8F A;  5C5B A;  1LW3 A;  3A8Q A;  5FI1 A;  2H7D A;  5EFX A;  2DX1 A;  1FOE A;  1W1H A;  5J3Q A;  1J19 A;  1Y5O A;  2NMB A;  1BTK A;  1M7E A;  1GC7 A;  4KHA A;  1XOD A;  5GOW B;  2D9X A;  2D9V A;  2QKL A;  2EC1 A;  5D3W A;  4HHV A;  4XWX A;  5HE3 A;  2COF A;  4ZRI A;  3DXE A;  2D11 A;  5KQ4 A;  3ZDT A;  4F7H A;  2DHJ A;  2MDX A;  2RNR B;  3OAN A;  4NY0 A;  3DXD A;  2UZS A;  1BWN A;  1H10 A;  1SGH A;  2EMS A;  2V76 A;  1MAI A;  5DHF B;  2XQN M;  2M38 A;  2X18 A;  1M7R A;  2ZPY A;  5J3T A;  4MT7 A;  4TYZ A;  4DBB A;  2J59 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...