2G35A

Nmr structure of talin-ptb in complex with pipki
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
100
structure length
100
Chain Sequence
LKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Talin-1
publication title Structural Basis for the Phosphorylation-regulated Focal Adhesion Targeting of Type Igamma Phosphatidylinositol Phosphate Kinase (PIPKIgamma) by Talin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
total genus 15
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2006-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2g35A00
3TVVA 1BTKA 2NZ8B 5L81A 2RLOA 2DA0A 5DH9B 4A6FB 1GG3A 1FGYA 2Z0OA 1U27A 1X11A 1BWNA 5DHAB 1X1FA 1LW3A 2ZPYA 2FJLA 3LJUX 1V5PA 1BTNA 3P7ZA 2I1KA 3A8QA 1ZC4B 2DKPA 5EFXA 2VRWB 2QKMA 1W1GA 2G35A 2W2XC 1UNQA 5D3XA 3DXCA 3VOQA 3BJIA 3KRXA 2LULA 4HDOA 1X05A 1M7RA 2J59M 2NMBA 4GPTB 4KAXB 1MAIA 4HAXB 4Z2NA 2D4QA 2H7DA 2KGXB 4P7IA 2VSZA 3PVWA 2XQNM 5JHGA 2COFA 1BAKA 2COCA 2DHIA 1RRPB 2R0DA 2RNRB 1FHWA 2CY4A 4HATB 4MK0A 1U29A 5LOPB 3V5WA 4IFSA 5FI0A 3BINA 1PMSA 3G9WA 3P6AA 1Y19B 2ELBA 3D8FA 4HB4B 1XCGA 2MFQA 1H10A 3FEHA 3T06A 1J19A 4MT7A 4F7GA 2X18A 4NSWA 2R09A 4F7UP 1WVHA 4GN1A 1TJ6A 1W1DA 4YL8A 2IFSA 5DIFB 1RJ2A 1UEFA 1X86A 1MPHA 2RGNB 4F7HA 1WJMA 3ZDTA 5FI1A 2UZSA 1U5GA 2KUPA 2UZRA 4HB3B 3QIJA 1ZVRA 2GCLA 2ADZA 3SV1A 2YSZA 5D3YA 3ML4A 1IRSA 1UNPA 2L1CA 5JLJB 1U5DA 2LOZA 3N7CA 4K81A 3AU4A 1PFJA 2GCJA 3QWMA 3SO6A 2Y8FA 2J0KA 3ULBA 2IYBA 2DHJA 3D8EA 1KZ7A 2PZ1A 2D9XA 3TFMA 2I1JA 1B55A 1WG7A 4PQ0A 2AL6A 2GS0A 1MIZB 4C0AA 4IOYX 2EJ8A 3CIKA 2YS1A 3TO1A 3AJ4A 4CYEA 5LONB 2YVCA 1V5UA 3HK0A 2N23A 1GC7A 1WGUA 1ZM0A 5C5BB 2DFKA 2YS3A 2M14A 4K2PA 2I5CA 1FHXA 1MK7B 1XKEA 4GMXB 2UVMA 4DX8A 3VIAA 2YRYA 1EF1A 3A8PA 1H4RA 5J3QA 1P5TA 1KZGA 4H8SA 2D9ZA 2MKRA 1UPQA 2EMTA 4D0NB 1UPRA 3KRWA 1V89A 3PP2A 3PEGA 1FGZA 3IVFA 3PVLA 2DHKA 2ELAA 1E5WA 3O96A 3TW1A 1AWEA 1U5EA 1NI2A 2ROVA 2KCJA 3OANA 3ZVRA 2Z0PA 3U7DA 3KY9A 3PVUA 4EKUA 4WVFB 1OY2A 2OTXA 2DKQA 2YT1A 4HAVB 4GZUA 3ODXA 4ZRJA 1ZSQA 3DXEA 5C16A 1DDWA 5D3VA 1GC6A 2D9VA 2YS5A 3SNHA 5KQ4A 1QC6A 2Z0QA 4XWXA 2MWNB 2BCJA 1LB1A 5C6RA 2K00A 2COAA 2W2XD 3NSUA 5J3TA 2P8VA 4WSFA 5HE0A 2EC1A 5C79A 2D2QA 4KHOA 5J3YA 1ISNA 1W1HA 4HAYB 2DYQA 1WI1A 4EMOA 1I2HA 5KCVA 5KQ1A 4BBKA 4WJ7A 2E2XA 4GXBA 1NU2A 4HB2B 1UNRA 2DTCA 3QBVB 1MKEA 4KHAA 2ROZB 1K5DB 1XR0B 5DI9B 1Z87A 1DDMA 3PSCA 3FSSA 4A6FA 5HE3A 3SUZA 1XODA 3F5RA 3KSYA 2EMSA 4K2OA 1DROA 3HW2B 2CY5A 3DXDA 2GJYA 3D8DA 1XX0A 5CLQB 4PNKA 2K2JA 1Q67A 5DHFB 4HHVA 3X23A 3MDBC 3PZDA 1NTVA 2D10A 4DBBA 4ZRIA 2RVBB 1KI1B 1DYNA 1QQGA 2CRFA 2M38A 2Q13A 2DLWA 2DYNA 5HE2A 2DN6A 2OQBA 2HTHB 4MY6A 4Y94A 1FB8A 3CXBB 1P3RA 1PLSA 2N0YA 4ZRKA 1P6SA 1FHOA 2LYDA 4TKNA 1DDVA 3ODOA 2DX1A 4A6HA 2I5FA 4DXAB 3KZ1A 4HAWB 4HAUB 1J0WA 1OQNA 2LKOA 3GYOA 3MPXA 1WGQA 5JHHA 3RCPA 2Y8GA 5GOWB 2CODA 3A98B 2V76A 2DX5A 2Y7BA 1DBHA 1U5FA 4CHJA 3GYPA 2D9WA 4TYZA 3F0WA 3WA0A 2J0JA 1NTYA 2YF0A 2HE7A 1V88A 2LOXA 2D11A 1Y5OA 2P0FA 5D27A 1MK9B 1V61A 5D3WA 1U2BA 3ODWA 4K17A 4A5KA 3PG7A 3AU5A 3SYXA 1AQCA 2QKLA 1OMWA 2W2WA 3TCAA 4KHBB 1EAZA 4YONA 1TXDA 1XD4A 2LG1A 1I7AA 5HE1A 1M7EA 1TQZA 2L2IA 4KVGB 2YT0A 1V5MA 4GMVA 2D9YA 4HAZB 4EJNA 5JP4A 1EGXA 1MIXA 2J0MA 5CLLB 2AEHA 4HDQA 4CHMA 4Z2MB 2K2UA 4HB0B 2P0DA 1ZC3B 2RUKB 4A6KA 4NY0A 4DX90 2JP2A 3M1IB 1FOEA 4L6EA 2RSGA 3HQCA 4B6HA 1X1GA 3U8ZA 1EVHA 1K5GB 4IAPA 1FAOA 2P0HA 2VKIA 3FM8C 2CAYA 3UZTA 2MDXA 3ULCA 1WJ1A 1N3HA 1SGHA 1SHCA 2H7EA 5C5BA 3WYFB
chains in the Genus database with same CATH superfamily
2R2YA 3NW8A 3TVVA 1BTKA 2NZ8B 5L81A 2RLOA 2DA0A 1MI1A 5DH9B 4A6FB 1GG3A 1FGYA 2Z0OA 1U27A 5IRSA 1X11A 2KUQA 1BWNA 5DHAB 1X1FA 1LW3A 2ZPYA 2FJLA 3LJUX 1V5PA 2YT2A 1BTNA 2Z14A 3P7ZA 2I1KA 3A8QA 1ZC4B 2DKPA 5EFXA 3OHMB 2VRWB 2QKMA 1W1GA 2G35A 2W2XC 1UNQA 5D3XA 3DXCA 3VOQA 3BJIA 3KRXA 5I2SA 2LULA 4HDOA 1X05A 1M7RA 2J59M 2NMBA 4GPTB 4KAXB 1MAIA 4HAXB 4Z2NA 2D4QA 2H7DA 2KGXB 4P7IA 2VSZA 3PVWA 2XQNM 5JHGA 4QJ5B 2COFA 1BAKA 4OSNA 2COCA 2DHIA 1RRPB 3NWFA 2R0DA 2RNRB 1FHWA 2CY4A 4HATB 2NBVA 4MK0A 1U29A 5LOPB 3V5WA 4IFSA 5FI0A 3BINA 1PMSA 3G9WA 3P6AA 1Y19B 2ELBA 3D8FA 4HB4B 1XCGA 2MFQA 1H10A 3FEHA 3T06A 1J19A 4MT7A 4F7GA 2X18A 4NSWA 2R09A 4F7UP 1WVHA 4GN1A 1TJ6A 1W1DA 4YL8A 2IFSA 5LG4B 4OT1A 5DIFB 1RJ2A 4DIXA 1UEFA 3U12A 1X86A 1MPHA 2RGNB 4F7HA 1WJMA 3ZDTA 5FI1A 2UZSA 1U5GA 2KUPA 2UZRA 4HB3B 3QIJA 1ZVRA 2GCLA 2ADZA 3SV1A 2YSZA 5D3YA 4HSIA 3ML4A 4QJ3B 1IRSA 1UNPA 2L1CA 5JLJB 1U5DA 2Z59A 2LOZA 3N7CA 4K81A 3AU4A 1PFJA 2GCJA 3QWMA 3SO6A 2Y8FA 2J0KA 3ULBA 2IYBA 2DHJA 3D8EA 1KZ7A 2PZ1A 2D9XA 3TFMA 2I1JA 1B55A 1WG7A 4PQ0A 2AL6A 2GS0A 1MIZB 4C0AA 4IOYX 2EJ8A 3CIKA 2YS1A 3TO1A 3AJ4A 4CYEA 5LONB 2YVCA 1V5UA 3HK0A 2N23A 1GC7A 1WGUA 1ZM0A 5C5BB 2DFKA 2YS3A 2M14A 4K2PA 2I5CA 1FHXA 1MK7B 1XKEA 4GMXB 2UVMA 4DX8A 3VIAA 2YRYA 1EF1A 5M4YB 3A8PA 1H4RA 5J3QA 1P5TA 1KZGA 4H8SA 2D9ZA 2MKRA 1UPQA 2EMTA 4D0NB 1UPRA 4GNKB 3KRWA 1V89A 3PP2A 3PEGA 1FGZA 3IVFA 3PVLA 2DHKA 2ELAA 3FVCA 1E5WA 3O96A 3TW1A 1AWEA 1U5EA 1NI2A 2ROVA 2KCJA 3OANA 3ZVRA 2Z0PA 3U7DA 3KY9A 3PVUA 4EKUA 4WVFB 1OY2A 2OTXA 4KHBA 2DKQA 2YT1A 4CSQA 4HAVB 4GZUA 3ODXA 4ZRJA 1ZYIA 1ZSQA 3DXEA 5C16A 1DDWA 5D3VA 3B77A 1GC6A 2D9VA 2YS5A 3SNHA 5KQ4A 1QC6A 2Z0QA 4XWXA 1T77A 2MWNB 2BCJA 2FJUB 3NWAA 1LB1A 5C6RA 2K00A 2COAA 2W2XD 3NSUA 5J3TA 2P8VA 4WSFA 5HE0A 2EC1A 5C79A 2D2QA 4KHOA 5J3YA 1ISNA 1W1HA 4HAYB 2DYQA 1WI1A 4EMOA 1I2HA 5KCVA 2RRFA 5KQ1A 4BBKA 4WJ7A 2E2XA 4GXBA 1NU2A 4HB2B 1UNRA 2DTCA 2GUMA 3QBVB 1MKEA 4KHAA 2ROZB 1K5DB 1XR0B 5DI9B 1Z87A 4QXAB 1DDMA 3PSCA 3FSSA 4A6FA 5HE3A 3SUZA 1XODA 3F5RA 3KSYA 2EMSA 4K2OA 1DROA 3HW2B 2Z13A 2CY5A 3DXDA 2GJYA 3D8DA 1XX0A 3DCXA 5CLQB 4PNKA 4L1RA 2K2JA 1Q67A 5DHFB 4HHVA 3X23A 3MDBC 3PZDA 3NWDA 3A58A 1NTVA 2D10A 4DBBA 4ZRIA 2RVBB 1KI1B 2KIGA 5I2MA 1DYNA 1QQGA 2CRFA 2M38A 2Q13A 2DLWA 2DYNA 5HE2A 3HSAA 2DN6A 2OQBA 2HTHB 2Z4DA 3HIEA 4MY6A 4Y94A 1FB8A 3CXBB 1P3RA 1PLSA 2N0YA 4ZRKA 1P6SA 1FHOA 2LYDA 4TKNA 1DDVA 3ODOA 2DX1A 4A6HA 2I5FA 4DXAB 3KZ1A 4HAWB 4QJ4B 4HAUB 1J0WA 1OQNA 2LKOA 3GYOA 3MPXA 1WGQA 5JHHA 3RCPA 2Y8GA 5GOWB 2CODA 3A98B 2V76A 2DX5A 2Y7BA 1DBHA 1U5FA 4CHJA 3GYPA 2D9WA 4TYZA 3F0WA 3WA0A 2J0JA 1NTYA 2YF0A 2HE7A 1V88A 2LOXA 2D11A 1Y5OA 2KIEA 2P0FA 5D27A 1MK9B 1V61A 5D3WA 1U2BA 3ODWA 4K17A 4A5KA 3PG7A 3AU5A 3SYXA 1AQCA 2QKLA 1OMWA 2W2WA 3TCAA 4KHBB 1EAZA 4YONA 1TXDA 1XD4A 2LG1A 1I7AA 5HE1A 1M7EA 1TQZA 2L2IA 4KVGB 2YT0A 1V5MA 4GMVA 2D9YA 4HAZB 4EJNA 5JP4A 1EGXA 1MIXA 2J0MA 5CLLB 4D6WA 2AEHA 2ZKMX 4HDQA 4CHMA 4Z2MB 2K2UA 2K49A 4HB0B 2K8EA 2P0DA 1ZC3B 2RUKB 4A6KA 4NY0A 4DX90 2JP2A 3M1IB 2KR0A 1FOEA 4L6EA 2RSGA 3HQCA 4B6HA 1X1GA 3U8ZA 1EVHA 1K5GB 4IAPA 1FAOA 2P0HA 2VKIA 3FM8C 2CAYA 3UZTA 2MDXA 3ULCA 1WJ1A 1N3HA 1SGHA 4GOUA 1SHCA 2H7EA 5C5BA 3WYFB
chains in the Genus database with same CATH topology
3TVVA 1BTKA 2NZ8B 5L81A 2RLOA 2DA0A 5DH9B 4A6FB 1GG3A 1FGYA 2Z0OA 1U27A 1X11A 1BWNA 5DHAB 1X1FA 1LW3A 2ZPYA 2FJLA 3LJUX 1V5PA 1BTNA 3P7ZA 2I1KA 3A8QA 1ZC4B 2DKPA 5EFXA 2VRWB 2QKMA 1W1GA 2G35A 2W2XC 1UNQA 5D3XA 3DXCA 3VOQA 3BJIA 3KRXA 2LULA 4HDOA 1X05A 1M7RA 2J59M 2NMBA 4GPTB 4KAXB 1MAIA 4HAXB 4Z2NA 2D4QA 2H7DA 2KGXB 4P7IA 2VSZA 3PVWA 2XQNM 5JHGA 2COFA 1BAKA 2COCA 2DHIA 1RRPB 2R0DA 2RNRB 1FHWA 2CY4A 4HATB 4MK0A 1U29A 5LOPB 3V5WA 4IFSA 5FI0A 3BINA 1PMSA 3G9WA 3P6AA 1Y19B 2ELBA 3D8FA 4HB4B 1XCGA 2MFQA 1H10A 3FEHA 3T06A 1J19A 4MT7A 4F7GA 2X18A 4NSWA 2R09A 4F7UP 1WVHA 4GN1A 1TJ6A 1W1DA 4YL8A 2IFSA 5DIFB 1RJ2A 1UEFA 1X86A 1MPHA 2RGNB 4F7HA 1WJMA 3ZDTA 5FI1A 2UZSA 1U5GA 2KUPA 2UZRA 4HB3B 3QIJA 1ZVRA 2GCLA 2ADZA 3SV1A 2YSZA 5D3YA 3ML4A 1IRSA 1UNPA 2L1CA 5JLJB 1U5DA 2LOZA 3N7CA 4K81A 3AU4A 1PFJA 2GCJA 3QWMA 3SO6A 2Y8FA 2J0KA 3ULBA 2IYBA 2DHJA 3D8EA 1KZ7A 2PZ1A 2D9XA 3TFMA 2I1JA 1B55A 1WG7A 4PQ0A 2AL6A 2GS0A 1MIZB 4C0AA 4IOYX 2EJ8A 3CIKA 2YS1A 3TO1A 3AJ4A 4CYEA 5LONB 2YVCA 1V5UA 3HK0A 2N23A 1GC7A 1WGUA 1ZM0A 5C5BB 2DFKA 2YS3A 2M14A 4K2PA 2I5CA 1FHXA 1MK7B 1XKEA 4GMXB 2UVMA 4DX8A 3VIAA 2YRYA 1EF1A 3A8PA 1H4RA 5J3QA 1P5TA 1KZGA 4H8SA 2D9ZA 2MKRA 1UPQA 2EMTA 4D0NB 1UPRA 3KRWA 1V89A 3PP2A 3PEGA 1FGZA 3IVFA 3PVLA 2DHKA 2ELAA 1E5WA 3O96A 3TW1A 1AWEA 1U5EA 1NI2A 2ROVA 2KCJA 3OANA 3ZVRA 2Z0PA 3U7DA 3KY9A 3PVUA 4EKUA 4WVFB 1OY2A 2OTXA 2DKQA 2YT1A 4HAVB 4GZUA 3ODXA 4ZRJA 1ZSQA 3DXEA 5C16A 1DDWA 5D3VA 1GC6A 2D9VA 2YS5A 3SNHA 5KQ4A 1QC6A 2Z0QA 4XWXA 2MWNB 2BCJA 1LB1A 5C6RA 2K00A 2COAA 2W2XD 3NSUA 5J3TA 2P8VA 4WSFA 5HE0A 2EC1A 5C79A 2D2QA 4KHOA 5J3YA 1ISNA 1W1HA 4HAYB 2DYQA 1WI1A 4EMOA 1I2HA 5KCVA 5KQ1A 4BBKA 4WJ7A 2E2XA 4GXBA 1NU2A 4HB2B 1UNRA 2DTCA 3QBVB 1MKEA 4KHAA 2ROZB 1K5DB 1XR0B 5DI9B 1Z87A 1DDMA 3PSCA 3FSSA 4A6FA 5HE3A 3SUZA 1XODA 3F5RA 3KSYA 2EMSA 4K2OA 1DROA 3HW2B 2CY5A 3DXDA 2GJYA 3D8DA 1XX0A 5CLQB 4PNKA 2K2JA 1Q67A 5DHFB 4HHVA 3X23A 3MDBC 3PZDA 1NTVA 2D10A 4DBBA 4ZRIA 2RVBB 1KI1B 1DYNA 1QQGA 2CRFA 2M38A 2Q13A 2DLWA 2DYNA 5HE2A 2DN6A 2OQBA 2HTHB 4MY6A 4Y94A 1FB8A 3CXBB 1P3RA 1PLSA 2N0YA 4ZRKA 1P6SA 1FHOA 2LYDA 4TKNA 1DDVA 3ODOA 2DX1A 4A6HA 2I5FA 4DXAB 3KZ1A 4HAWB 4HAUB 1J0WA 1OQNA 2LKOA 3GYOA 3MPXA 1WGQA 5JHHA 3RCPA 2Y8GA 5GOWB 2CODA 3A98B 2V76A 2DX5A 2Y7BA 1DBHA 1U5FA 4CHJA 3GYPA 2D9WA 4TYZA 3F0WA 3WA0A 2J0JA 1NTYA 2YF0A 2HE7A 1V88A 2LOXA 2D11A 1Y5OA 2P0FA 5D27A 1MK9B 1V61A 5D3WA 1U2BA 3ODWA 4K17A 4A5KA 3PG7A 3AU5A 3SYXA 1AQCA 2QKLA 1OMWA 2W2WA 3TCAA 4KHBB 1EAZA 4YONA 1TXDA 1XD4A 2LG1A 1I7AA 5HE1A 1M7EA 1TQZA 2L2IA 4KVGB 2YT0A 1V5MA 4GMVA 2D9YA 4HAZB 4EJNA 5JP4A 1EGXA 1MIXA 2J0MA 5CLLB 2AEHA 4HDQA 4CHMA 4Z2MB 2K2UA 4HB0B 2P0DA 1ZC3B 2RUKB 4A6KA 4NY0A 4DX90 2JP2A 3M1IB 1FOEA 4L6EA 2RSGA 3HQCA 4B6HA 1X1GA 3U8ZA 1EVHA 1K5GB 4IAPA 1FAOA 2P0HA 2VKIA 3FM8C 2CAYA 3UZTA 2MDXA 3ULCA 1WJ1A 1N3HA 1SGHA 1SHCA 2H7EA 5C5BA 3WYFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TVV A;  1BTK A;  2NZ8 B;  5L81 A;  2RLO A;  2DA0 A;  5DH9 B;  4A6F B;  1GG3 A;  1FGY A;  2Z0O A;  1U27 A;  1X11 A;  1BWN A;  5DHA B;  1X1F A;  1LW3 A;  2ZPY A;  2FJL A;  3LJU X;  1V5P A;  1BTN A;  3P7Z A;  2I1K A;  3A8Q A;  1ZC4 B;  2DKP A;  5EFX A;  2VRW B;  2QKM A;  1W1G A;  2G35 A;  2W2X C;  1UNQ A;  5D3X A;  3DXC A;  3VOQ A;  3BJI A;  3KRX A;  2LUL A;  4HDO A;  1X05 A;  1M7R A;  2J59 M;  2NMB A;  4GPT B;  4KAX B;  1MAI A;  4HAX B;  4Z2N A;  2D4Q A;  2H7D A;  2KGX B;  4P7I A;  2VSZ A;  3PVW A;  2XQN M;  5JHG A;  2COF A;  1BAK A;  2COC A;  2DHI A;  1RRP B;  2R0D A;  2RNR B;  1FHW A;  2CY4 A;  4HAT B;  4MK0 A;  1U29 A;  5LOP B;  3V5W A;  4IFS A;  5FI0 A;  3BIN A;  1PMS A;  3G9W A;  3P6A A;  1Y19 B;  2ELB A;  3D8F A;  4HB4 B;  1XCG A;  2MFQ A;  1H10 A;  3FEH A;  3T06 A;  1J19 A;  4MT7 A;  4F7G A;  2X18 A;  4NSW A;  2R09 A;  4F7U P;  1WVH A;  4GN1 A;  1TJ6 A;  1W1D A;  4YL8 A;  2IFS A;  5DIF B;  1RJ2 A;  1UEF A;  1X86 A;  1MPH A;  2RGN B;  4F7H A;  1WJM A;  3ZDT A;  5FI1 A;  2UZS A;  1U5G A;  2KUP A;  2UZR A;  4HB3 B;  3QIJ A;  1ZVR A;  2GCL A;  2ADZ A;  3SV1 A;  2YSZ A;  5D3Y A;  3ML4 A;  1IRS A;  1UNP A;  2L1C A;  5JLJ B;  1U5D A;  2LOZ A;  3N7C A;  4K81 A;  3AU4 A;  1PFJ A;  2GCJ A;  3QWM A;  3SO6 A;  2Y8F A;  2J0K A;  3ULB A;  2IYB A;  2DHJ A;  3D8E A;  1KZ7 A;  2PZ1 A;  2D9X A;  3TFM A;  2I1J A;  1B55 A;  1WG7 A;  4PQ0 A;  2AL6 A;  2GS0 A;  1MIZ B;  4C0A A;  4IOY X;  2EJ8 A;  3CIK A;  2YS1 A;  3TO1 A;  3AJ4 A;  4CYE A;  5LON B;  2YVC A;  1V5U A;  3HK0 A;  2N23 A;  1GC7 A;  1WGU A;  1ZM0 A;  5C5B B;  2DFK A;  2YS3 A;  2M14 A;  4K2P A;  2I5C A;  1FHX A;  1MK7 B;  1XKE A;  4GMX B;  2UVM A;  4DX8 A;  3VIA A;  2YRY A;  1EF1 A;  3A8P A;  1H4R A;  5J3Q A;  1P5T A;  1KZG A;  4H8S A;  2D9Z A;  2MKR A;  1UPQ A;  2EMT A;  4D0N B;  1UPR A;  3KRW A;  1V89 A;  3PP2 A;  3PEG A;  1FGZ A;  3IVF A;  3PVL A;  2DHK A;  2ELA A;  1E5W A;  3O96 A;  3TW1 A;  1AWE A;  1U5E A;  1NI2 A;  2ROV A;  2KCJ A;  3OAN A;  3ZVR A;  2Z0P A;  3U7D A;  3KY9 A;  3PVU A;  4EKU A;  4WVF B;  1OY2 A;  2OTX A;  2DKQ A;  2YT1 A;  4HAV B;  4GZU A;  3ODX A;  4ZRJ A;  1ZSQ A;  3DXE A;  5C16 A;  1DDW A;  5D3V A;  1GC6 A;  2D9V A;  2YS5 A;  3SNH A;  5KQ4 A;  1QC6 A;  2Z0Q A;  4XWX A;  2MWN B;  2BCJ A;  1LB1 A;  5C6R A;  2K00 A;  2COA A;  2W2X D;  3NSU A;  5J3T A;  2P8V A;  4WSF A;  5HE0 A;  2EC1 A;  5C79 A;  2D2Q A;  4KHO A;  5J3Y A;  1ISN A;  1W1H A;  4HAY B;  2DYQ A;  1WI1 A;  4EMO A;  1I2H A;  5KCV A;  5KQ1 A;  4BBK A;  4WJ7 A;  2E2X A;  4GXB A;  1NU2 A;  4HB2 B;  1UNR A;  2DTC A;  3QBV B;  1MKE A;  4KHA A;  2ROZ B;  1K5D B;  1XR0 B;  5DI9 B;  1Z87 A;  1DDM A;  3PSC A;  3FSS A;  4A6F A;  5HE3 A;  3SUZ A;  1XOD A;  3F5R A;  3KSY A;  2EMS A;  4K2O A;  1DRO A;  3HW2 B;  2CY5 A;  3DXD A;  2GJY A;  3D8D A;  1XX0 A;  5CLQ B;  4PNK A;  2K2J A;  1Q67 A;  5DHF B;  4HHV A;  3X23 A;  3MDB C;  3PZD A;  1NTV A;  2D10 A;  4DBB A;  4ZRI A;  2RVB B;  1KI1 B;  1DYN A;  1QQG A;  2CRF A;  2M38 A;  2Q13 A;  2DLW A;  2DYN A;  5HE2 A;  2DN6 A;  2OQB A;  2HTH B;  4MY6 A;  4Y94 A;  1FB8 A;  3CXB B;  1P3R A;  1PLS A;  2N0Y A;  4ZRK A;  1P6S A;  1FHO A;  2LYD A;  4TKN A;  1DDV A;  3ODO A;  2DX1 A;  4A6H A;  2I5F A;  4DXA B;  3KZ1 A;  4HAW B;  4HAU B;  1J0W A;  1OQN A;  2LKO A;  3GYO A;  3MPX A;  1WGQ A;  5JHH A;  3RCP A;  2Y8G A;  5GOW B;  2COD A;  3A98 B;  2V76 A;  2DX5 A;  2Y7B A;  1DBH A;  1U5F A;  4CHJ A;  3GYP A;  2D9W A;  4TYZ A;  3F0W A;  3WA0 A;  2J0J A;  1NTY A;  2YF0 A;  2HE7 A;  1V88 A;  2LOX A;  2D11 A;  1Y5O A;  2P0F A;  5D27 A;  1MK9 B;  1V61 A;  5D3W A;  1U2B A;  3ODW A;  4K17 A;  4A5K A;  3PG7 A;  3AU5 A;  3SYX A;  1AQC A;  2QKL A;  1OMW A;  2W2W A;  3TCA A;  4KHB B;  1EAZ A;  4YON A;  1TXD A;  1XD4 A;  2LG1 A;  1I7A A;  5HE1 A;  1M7E A;  1TQZ A;  2L2I A;  4KVG B;  2YT0 A;  1V5M A;  4GMV A;  2D9Y A;  4HAZ B;  4EJN A;  5JP4 A;  1EGX A;  1MIX A;  2J0M A;  5CLL B;  2AEH A;  4HDQ A;  4CHM A;  4Z2M B;  2K2U A;  4HB0 B;  2P0D A;  1ZC3 B;  2RUK B;  4A6K A;  4NY0 A;  4DX9 0;  2JP2 A;  3M1I B;  1FOE A;  4L6E A;  2RSG A;  3HQC A;  4B6H A;  1X1G A;  3U8Z A;  1EVH A;  1K5G B;  4IAP A;  1FAO A;  2P0H A;  2VKI A;  3FM8 C;  2CAY A;  3UZT A;  2MDX A;  3ULC A;  1WJ1 A;  1N3H A;  1SGH A;  1SHC A;  2H7E A;  5C5B A;  3WYF B; 
#chains in the Genus database with same CATH topology
 2R2Y A;  3NW8 A;  3TVV A;  1BTK A;  2NZ8 B;  5L81 A;  2RLO A;  2DA0 A;  1MI1 A;  5DH9 B;  4A6F B;  1GG3 A;  1FGY A;  2Z0O A;  1U27 A;  5IRS A;  1X11 A;  2KUQ A;  1BWN A;  5DHA B;  1X1F A;  1LW3 A;  2ZPY A;  2FJL A;  3LJU X;  1V5P A;  2YT2 A;  1BTN A;  2Z14 A;  3P7Z A;  2I1K A;  3A8Q A;  1ZC4 B;  2DKP A;  5EFX A;  3OHM B;  2VRW B;  2QKM A;  1W1G A;  2G35 A;  2W2X C;  1UNQ A;  5D3X A;  3DXC A;  3VOQ A;  3BJI A;  3KRX A;  5I2S A;  2LUL A;  4HDO A;  1X05 A;  1M7R A;  2J59 M;  2NMB A;  4GPT B;  4KAX B;  1MAI A;  4HAX B;  4Z2N A;  2D4Q A;  2H7D A;  2KGX B;  4P7I A;  2VSZ A;  3PVW A;  2XQN M;  5JHG A;  4QJ5 B;  2COF A;  1BAK A;  4OSN A;  2COC A;  2DHI A;  1RRP B;  3NWF A;  2R0D A;  2RNR B;  1FHW A;  2CY4 A;  4HAT B;  2NBV A;  4MK0 A;  1U29 A;  5LOP B;  3V5W A;  4IFS A;  5FI0 A;  3BIN A;  1PMS A;  3G9W A;  3P6A A;  1Y19 B;  2ELB A;  3D8F A;  4HB4 B;  1XCG A;  2MFQ A;  1H10 A;  3FEH A;  3T06 A;  1J19 A;  4MT7 A;  4F7G A;  2X18 A;  4NSW A;  2R09 A;  4F7U P;  1WVH A;  4GN1 A;  1TJ6 A;  1W1D A;  4YL8 A;  2IFS A;  5LG4 B;  4OT1 A;  5DIF B;  1RJ2 A;  4DIX A;  1UEF A;  3U12 A;  1X86 A;  1MPH A;  2RGN B;  4F7H A;  1WJM A;  3ZDT A;  5FI1 A;  2UZS A;  1U5G A;  2KUP A;  2UZR A;  4HB3 B;  3QIJ A;  1ZVR A;  2GCL A;  2ADZ A;  3SV1 A;  2YSZ A;  5D3Y A;  4HSI A;  3ML4 A;  4QJ3 B;  1IRS A;  1UNP A;  2L1C A;  5JLJ B;  1U5D A;  2Z59 A;  2LOZ A;  3N7C A;  4K81 A;  3AU4 A;  1PFJ A;  2GCJ A;  3QWM A;  3SO6 A;  2Y8F A;  2J0K A;  3ULB A;  2IYB A;  2DHJ A;  3D8E A;  1KZ7 A;  2PZ1 A;  2D9X A;  3TFM A;  2I1J A;  1B55 A;  1WG7 A;  4PQ0 A;  2AL6 A;  2GS0 A;  1MIZ B;  4C0A A;  4IOY X;  2EJ8 A;  3CIK A;  2YS1 A;  3TO1 A;  3AJ4 A;  4CYE A;  5LON B;  2YVC A;  1V5U A;  3HK0 A;  2N23 A;  1GC7 A;  1WGU A;  1ZM0 A;  5C5B B;  2DFK A;  2YS3 A;  2M14 A;  4K2P A;  2I5C A;  1FHX A;  1MK7 B;  1XKE A;  4GMX B;  2UVM A;  4DX8 A;  3VIA A;  2YRY A;  1EF1 A;  5M4Y B;  3A8P A;  1H4R A;  5J3Q A;  1P5T A;  1KZG A;  4H8S A;  2D9Z A;  2MKR A;  1UPQ A;  2EMT A;  4D0N B;  1UPR A;  4GNK B;  3KRW A;  1V89 A;  3PP2 A;  3PEG A;  1FGZ A;  3IVF A;  3PVL A;  2DHK A;  2ELA A;  3FVC A;  1E5W A;  3O96 A;  3TW1 A;  1AWE A;  1U5E A;  1NI2 A;  2ROV A;  2KCJ A;  3OAN A;  3ZVR A;  2Z0P A;  3U7D A;  3KY9 A;  3PVU A;  4EKU A;  4WVF B;  1OY2 A;  2OTX A;  4KHB A;  2DKQ A;  2YT1 A;  4CSQ A;  4HAV B;  4GZU A;  3ODX A;  4ZRJ A;  1ZYI A;  1ZSQ A;  3DXE A;  5C16 A;  1DDW A;  5D3V A;  3B77 A;  1GC6 A;  2D9V A;  2YS5 A;  3SNH A;  5KQ4 A;  1QC6 A;  2Z0Q A;  4XWX A;  1T77 A;  2MWN B;  2BCJ A;  2FJU B;  3NWA A;  1LB1 A;  5C6R A;  2K00 A;  2COA A;  2W2X D;  3NSU A;  5J3T A;  2P8V A;  4WSF A;  5HE0 A;  2EC1 A;  5C79 A;  2D2Q A;  4KHO A;  5J3Y A;  1ISN A;  1W1H A;  4HAY B;  2DYQ A;  1WI1 A;  4EMO A;  1I2H A;  5KCV A;  2RRF A;  5KQ1 A;  4BBK A;  4WJ7 A;  2E2X A;  4GXB A;  1NU2 A;  4HB2 B;  1UNR A;  2DTC A;  2GUM A;  3QBV B;  1MKE A;  4KHA A;  2ROZ B;  1K5D B;  1XR0 B;  5DI9 B;  1Z87 A;  4QXA B;  1DDM A;  3PSC A;  3FSS A;  4A6F A;  5HE3 A;  3SUZ A;  1XOD A;  3F5R A;  3KSY A;  2EMS A;  4K2O A;  1DRO A;  3HW2 B;  2Z13 A;  2CY5 A;  3DXD A;  2GJY A;  3D8D A;  1XX0 A;  3DCX A;  5CLQ B;  4PNK A;  4L1R A;  2K2J A;  1Q67 A;  5DHF B;  4HHV A;  3X23 A;  3MDB C;  3PZD A;  3NWD A;  3A58 A;  1NTV A;  2D10 A;  4DBB A;  4ZRI A;  2RVB B;  1KI1 B;  2KIG A;  5I2M A;  1DYN A;  1QQG A;  2CRF A;  2M38 A;  2Q13 A;  2DLW A;  2DYN A;  5HE2 A;  3HSA A;  2DN6 A;  2OQB A;  2HTH B;  2Z4D A;  3HIE A;  4MY6 A;  4Y94 A;  1FB8 A;  3CXB B;  1P3R A;  1PLS A;  2N0Y A;  4ZRK A;  1P6S A;  1FHO A;  2LYD A;  4TKN A;  1DDV A;  3ODO A;  2DX1 A;  4A6H A;  2I5F A;  4DXA B;  3KZ1 A;  4HAW B;  4QJ4 B;  4HAU B;  1J0W A;  1OQN A;  2LKO A;  3GYO A;  3MPX A;  1WGQ A;  5JHH A;  3RCP A;  2Y8G A;  5GOW B;  2COD A;  3A98 B;  2V76 A;  2DX5 A;  2Y7B A;  1DBH A;  1U5F A;  4CHJ A;  3GYP A;  2D9W A;  4TYZ A;  3F0W A;  3WA0 A;  2J0J A;  1NTY A;  2YF0 A;  2HE7 A;  1V88 A;  2LOX A;  2D11 A;  1Y5O A;  2KIE A;  2P0F A;  5D27 A;  1MK9 B;  1V61 A;  5D3W A;  1U2B A;  3ODW A;  4K17 A;  4A5K A;  3PG7 A;  3AU5 A;  3SYX A;  1AQC A;  2QKL A;  1OMW A;  2W2W A;  3TCA A;  4KHB B;  1EAZ A;  4YON A;  1TXD A;  1XD4 A;  2LG1 A;  1I7A A;  5HE1 A;  1M7E A;  1TQZ A;  2L2I A;  4KVG B;  2YT0 A;  1V5M A;  4GMV A;  2D9Y A;  4HAZ B;  4EJN A;  5JP4 A;  1EGX A;  1MIX A;  2J0M A;  5CLL B;  4D6W A;  2AEH A;  2ZKM X;  4HDQ A;  4CHM A;  4Z2M B;  2K2U A;  2K49 A;  4HB0 B;  2K8E A;  2P0D A;  1ZC3 B;  2RUK B;  4A6K A;  4NY0 A;  4DX9 0;  2JP2 A;  3M1I B;  2KR0 A;  1FOE A;  4L6E A;  2RSG A;  3HQC A;  4B6H A;  1X1G A;  3U8Z A;  1EVH A;  1K5G B;  4IAP A;  1FAO A;  2P0H A;  2VKI A;  3FM8 C;  2CAY A;  3UZT A;  2MDX A;  3ULC A;  1WJ1 A;  1N3H A;  1SGH A;  4GOU A;  1SHC A;  2H7E A;  5C5B A;  3WYF B; 
#chains in the Genus database with same CATH homology
 3TVV A;  1BTK A;  2NZ8 B;  5L81 A;  2RLO A;  2DA0 A;  5DH9 B;  4A6F B;  1GG3 A;  1FGY A;  2Z0O A;  1U27 A;  1X11 A;  1BWN A;  5DHA B;  1X1F A;  1LW3 A;  2ZPY A;  2FJL A;  3LJU X;  1V5P A;  1BTN A;  3P7Z A;  2I1K A;  3A8Q A;  1ZC4 B;  2DKP A;  5EFX A;  2VRW B;  2QKM A;  1W1G A;  2G35 A;  2W2X C;  1UNQ A;  5D3X A;  3DXC A;  3VOQ A;  3BJI A;  3KRX A;  2LUL A;  4HDO A;  1X05 A;  1M7R A;  2J59 M;  2NMB A;  4GPT B;  4KAX B;  1MAI A;  4HAX B;  4Z2N A;  2D4Q A;  2H7D A;  2KGX B;  4P7I A;  2VSZ A;  3PVW A;  2XQN M;  5JHG A;  2COF A;  1BAK A;  2COC A;  2DHI A;  1RRP B;  2R0D A;  2RNR B;  1FHW A;  2CY4 A;  4HAT B;  4MK0 A;  1U29 A;  5LOP B;  3V5W A;  4IFS A;  5FI0 A;  3BIN A;  1PMS A;  3G9W A;  3P6A A;  1Y19 B;  2ELB A;  3D8F A;  4HB4 B;  1XCG A;  2MFQ A;  1H10 A;  3FEH A;  3T06 A;  1J19 A;  4MT7 A;  4F7G A;  2X18 A;  4NSW A;  2R09 A;  4F7U P;  1WVH A;  4GN1 A;  1TJ6 A;  1W1D A;  4YL8 A;  2IFS A;  5DIF B;  1RJ2 A;  1UEF A;  1X86 A;  1MPH A;  2RGN B;  4F7H A;  1WJM A;  3ZDT A;  5FI1 A;  2UZS A;  1U5G A;  2KUP A;  2UZR A;  4HB3 B;  3QIJ A;  1ZVR A;  2GCL A;  2ADZ A;  3SV1 A;  2YSZ A;  5D3Y A;  3ML4 A;  1IRS A;  1UNP A;  2L1C A;  5JLJ B;  1U5D A;  2LOZ A;  3N7C A;  4K81 A;  3AU4 A;  1PFJ A;  2GCJ A;  3QWM A;  3SO6 A;  2Y8F A;  2J0K A;  3ULB A;  2IYB A;  2DHJ A;  3D8E A;  1KZ7 A;  2PZ1 A;  2D9X A;  3TFM A;  2I1J A;  1B55 A;  1WG7 A;  4PQ0 A;  2AL6 A;  2GS0 A;  1MIZ B;  4C0A A;  4IOY X;  2EJ8 A;  3CIK A;  2YS1 A;  3TO1 A;  3AJ4 A;  4CYE A;  5LON B;  2YVC A;  1V5U A;  3HK0 A;  2N23 A;  1GC7 A;  1WGU A;  1ZM0 A;  5C5B B;  2DFK A;  2YS3 A;  2M14 A;  4K2P A;  2I5C A;  1FHX A;  1MK7 B;  1XKE A;  4GMX B;  2UVM A;  4DX8 A;  3VIA A;  2YRY A;  1EF1 A;  3A8P A;  1H4R A;  5J3Q A;  1P5T A;  1KZG A;  4H8S A;  2D9Z A;  2MKR A;  1UPQ A;  2EMT A;  4D0N B;  1UPR A;  3KRW A;  1V89 A;  3PP2 A;  3PEG A;  1FGZ A;  3IVF A;  3PVL A;  2DHK A;  2ELA A;  1E5W A;  3O96 A;  3TW1 A;  1AWE A;  1U5E A;  1NI2 A;  2ROV A;  2KCJ A;  3OAN A;  3ZVR A;  2Z0P A;  3U7D A;  3KY9 A;  3PVU A;  4EKU A;  4WVF B;  1OY2 A;  2OTX A;  2DKQ A;  2YT1 A;  4HAV B;  4GZU A;  3ODX A;  4ZRJ A;  1ZSQ A;  3DXE A;  5C16 A;  1DDW A;  5D3V A;  1GC6 A;  2D9V A;  2YS5 A;  3SNH A;  5KQ4 A;  1QC6 A;  2Z0Q A;  4XWX A;  2MWN B;  2BCJ A;  1LB1 A;  5C6R A;  2K00 A;  2COA A;  2W2X D;  3NSU A;  5J3T A;  2P8V A;  4WSF A;  5HE0 A;  2EC1 A;  5C79 A;  2D2Q A;  4KHO A;  5J3Y A;  1ISN A;  1W1H A;  4HAY B;  2DYQ A;  1WI1 A;  4EMO A;  1I2H A;  5KCV A;  5KQ1 A;  4BBK A;  4WJ7 A;  2E2X A;  4GXB A;  1NU2 A;  4HB2 B;  1UNR A;  2DTC A;  3QBV B;  1MKE A;  4KHA A;  2ROZ B;  1K5D B;  1XR0 B;  5DI9 B;  1Z87 A;  1DDM A;  3PSC A;  3FSS A;  4A6F A;  5HE3 A;  3SUZ A;  1XOD A;  3F5R A;  3KSY A;  2EMS A;  4K2O A;  1DRO A;  3HW2 B;  2CY5 A;  3DXD A;  2GJY A;  3D8D A;  1XX0 A;  5CLQ B;  4PNK A;  2K2J A;  1Q67 A;  5DHF B;  4HHV A;  3X23 A;  3MDB C;  3PZD A;  1NTV A;  2D10 A;  4DBB A;  4ZRI A;  2RVB B;  1KI1 B;  1DYN A;  1QQG A;  2CRF A;  2M38 A;  2Q13 A;  2DLW A;  2DYN A;  5HE2 A;  2DN6 A;  2OQB A;  2HTH B;  4MY6 A;  4Y94 A;  1FB8 A;  3CXB B;  1P3R A;  1PLS A;  2N0Y A;  4ZRK A;  1P6S A;  1FHO A;  2LYD A;  4TKN A;  1DDV A;  3ODO A;  2DX1 A;  4A6H A;  2I5F A;  4DXA B;  3KZ1 A;  4HAW B;  4HAU B;  1J0W A;  1OQN A;  2LKO A;  3GYO A;  3MPX A;  1WGQ A;  5JHH A;  3RCP A;  2Y8G A;  5GOW B;  2COD A;  3A98 B;  2V76 A;  2DX5 A;  2Y7B A;  1DBH A;  1U5F A;  4CHJ A;  3GYP A;  2D9W A;  4TYZ A;  3F0W A;  3WA0 A;  2J0J A;  1NTY A;  2YF0 A;  2HE7 A;  1V88 A;  2LOX A;  2D11 A;  1Y5O A;  2P0F A;  5D27 A;  1MK9 B;  1V61 A;  5D3W A;  1U2B A;  3ODW A;  4K17 A;  4A5K A;  3PG7 A;  3AU5 A;  3SYX A;  1AQC A;  2QKL A;  1OMW A;  2W2W A;  3TCA A;  4KHB B;  1EAZ A;  4YON A;  1TXD A;  1XD4 A;  2LG1 A;  1I7A A;  5HE1 A;  1M7E A;  1TQZ A;  2L2I A;  4KVG B;  2YT0 A;  1V5M A;  4GMV A;  2D9Y A;  4HAZ B;  4EJN A;  5JP4 A;  1EGX A;  1MIX A;  2J0M A;  5CLL B;  2AEH A;  4HDQ A;  4CHM A;  4Z2M B;  2K2U A;  4HB0 B;  2P0D A;  1ZC3 B;  2RUK B;  4A6K A;  4NY0 A;  4DX9 0;  2JP2 A;  3M1I B;  1FOE A;  4L6E A;  2RSG A;  3HQC A;  4B6H A;  1X1G A;  3U8Z A;  1EVH A;  1K5G B;  4IAP A;  1FAO A;  2P0H A;  2VKI A;  3FM8 C;  2CAY A;  3UZT A;  2MDX A;  3ULC A;  1WJ1 A;  1N3H A;  1SGH A;  1SHC A;  2H7E A;  5C5B A;  3WYF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...