1DDMA

Solution structure of the numb ptb domain complexed to a nak peptide
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
135
structure length
135
Chain Sequence
HQWQADEEAVRSATCSFSVKYLGCVEVFESRGMQVCEEALKVLRQSRRRPVRGLLHVSGDGLRVVDDETKGLIVDQTIEKVSFCAPDRNHERGFSYICRDGTTRRWMCHGFLACKDSGERLSHAVGCAFAVCLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/transferase
molecule keywords NUMB PROTEIN
publication title Multiple modes of peptide recognition by the PTB domain of the cell fate determinant Numb.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 20
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 1999-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1ddmA00
1V5UA 5C79A 4KAXB 3VOQA 4CYEA 3QWMA 3UZTA 1J0WA 2BCJA 1V89A 2OQBA 2DTCA 4MY6A 3PEGA 3WA0A 2MKRA 2YF0A 2W2WA 2W2XD 1SGHA 2H7EA 2GJYA 1K5DB 4K2OA 5D3YA 2DN6A 2FJLA 1IRSA 4HAUB 2EMSA 1WJMA 1DDWA 3OANA 2R0DA 3N7CA 4L6EA 2W2XC 4P7IA 2RGNB 4HB2B 4PNKA 5LONB 2P0FA 2Y8GA 2UVMA 5FI0A 1I2HA 2UZRA 4K2PA 3BJIA 1TXDA 4HDQA 2IYBA 3WYFB 2GCLA 1UNRA 2MFQA 1XCGA 1DDVA 5D27A 4HB0B 2P0HA 2LOZA 2P0DA 1FB8A 4EJNA 5FI1A 4BBKA 3M1IB 2ELBA 2UZSA 3ULBA 3ODXA 5DHAB 1OY2A 2COAA 4B6HA 2HE7A 2LG1A 2I5CA 2RSGA 1LW3A 3AU5A 5EFXA 2DHKA 2R09A 3ZVRA 3SNHA 1PFJA 1U27A 2Z0QA 3X23A 3F0WA 5D3WA 1UNPA 3NSUA 1V88A 4XWXA 5D3XA 5L81A 1DDMA 1DYNA 4Z2MB 1TJ6A 3KZ1A 1W1DA 1KZ7A 2AL6A 2D9YA 1NTVA 1FHXA 1GG3A 2MWNB 1ZM0A 1N3HA 1V61A 2QKLA 1Q67A 4DX8A 1B55A 3ODOA 1MK9B 4HHVA 4A6FB 3VIAA 2VKIA 3D8DA 3PVWA 2MDXA 4K81A 2ROVA 4KHOA 5C5BA 1WGUA 2J0MA 4GN1A 4GMVA 4GMXB 2LYDA 3TW1A 3P7ZA 2OTXA 2I1KA 1MPHA 4HB3B 4ZRIA 2K2UA 1U29A 2J0KA 1SHCA 1UPRA 3AJ4A 2M14A 2NZ8B 4GZUA 3SV1A 1ISNA 2DYNA 3LJUX 5C6RA 1FHOA 2VRWB 2P8VA 1X11A 2D10A 3A98B 3TVVA 2DFKA 2ADZA 3MPXA 5DI9B 5JHGA 3SYXA 2H7DA 1MKEA 2NMBA 1RJ2A 4IOYX 4MK0A 4A5KA 1WVHA 2DA0A 3PP2A 2JP2A 2RNRB 4MT7A 3PSCA 1U5DA 3QBVB 4ZRJA 1Y5OA 3KSYA 1XKEA 2KGXB 1E5WA 1P6SA 1KZGA 2GCJA 1W1GA 4DBBA 1EAZA 5CLLB 4EMOA 2D4QA 1MIZB 5JP4A 2XQNM 2J59M 2D11A 2EJ8A 1ZSQA 5HE2A 2LULA 1FGZA 2CY4A 1K5GB 2LKOA 2EC1A 2COFA 1Z87A 1BAKA 3TCAA 1PMSA 1U2BA 2D9WA 1FHWA 4HAXB 1WGQA 2K00A 3A8PA 5KCVA 1DBHA 1W1HA 1FAOA 1AQCA 2EMTA 4YL8A 4HDOA 3PVUA 4HATB 2DX5A 2CODA 1ZC4B 2DX1A 2E2XA 3F5RA 5HE0A 5KQ4A 2YT1A 5J3TA 2QKMA 4PQ0A 4GXBA 1J19A 1MAIA 1EF1A 4KHBB 4HAWB 3TO1A 2RUKB 2PZ1A 3FEHA 3PG7A 1P3RA 4A6HA 4ZRKA 3U8ZA 2RVBB 3P6AA 2DHJA 2KCJA 1BTKA 4WSFA 5HE3A 5HE1A 2M38A 2DKQA 2ROZB 1FOEA 2Z0OA 1V5PA 2LOXA 1EGXA 2YRYA 1U5FA 2KUPA 3KY9A 1XODA 1H4RA 2DKPA 4CHMA 3DXDA 3IVFA 4KHAA 1KI1B 4HAYB 1BWNA 4D0NB 1NTYA 2N0YA 4H8SA 4NSWA 1MK7B 5JLJB 2RLOA 2YS1A 1WG7A 4Z2NA 2YVCA 2CAYA 1GC7A 4DX90 2Z0PA 5DIFB 4CHJA 1QQGA 2HTHB 3AU4A 5GOWB 5C5BB 4TKNA 1OQNA 2COCA 3D8FA 2V76A 1AWEA 1V5MA 1BTNA 1FGYA 1P5TA 1X1GA 5J3QA 3G9WA 4TYZA 3PVLA 1NU2A 3GYPA 1M7EA 2YS5A 3CXBB 4C0AA 2YS3A 2DLWA 5JHHA 2J0JA 2YT0A 2I1JA 3HK0A 3V5WA 1WI1A 4K17A 1X86A 1ZC3B 1EVHA 1PLSA 2N23A 3BINA 1H10A 2GS0A 2Y7BA 1LB1A 2Q13A 5C16A 3D8EA 4NY0A 4A6KA 4DXAB 5LOPB 3ODWA 1X05A 1U5GA 3MDBC 1XX0A 1UPQA 3HW2B 4IFSA 1DROA 2D2QA 3SUZA 4HB4B 3TFMA 3QIJA 1UEFA 3T06A 4F7UP 2D9ZA 2D9XA 3ML4A 4HAZB 4EKUA 4YONA 2VSZA 1U5EA 1X1FA 2CY5A 1MIXA 1TQZA 4A6FA 5KQ1A 4Y94A 4WVFB 4F7HA 2IFSA 3KRWA 1WJ1A 3DXEA 3A8QA 3ZDTA 3PZDA 1XD4A 2ELAA 4WJ7A 5CLQB 3KRXA 5D3VA 2DYQA 1ZVRA 4F7GA 1UNQA 2X18A 1RRPB 1XR0B 2CRFA 3O96A 1QC6A 2G35A 5DHFB 2L1CA 2Y8FA 1OMWA 3HQCA 2YSZA 1I7AA 3CIKA 3GYOA 1Y19B 3ULCA 2D9VA 2ZPYA 4GPTB 2L2IA 3FM8C 4KVGB 3FSSA 4IAPA 5J3YA 2DHIA 2AEHA 1NI2A 1M7RA 3RCPA 2I5FA 4HAVB 1GC6A 3U7DA 5DH9B 3SO6A 3DXCA 2K2JA
chains in the Genus database with same CATH superfamily
1V5UA 3FVCA 5C79A 4KAXB 3VOQA 4CYEA 3QWMA 3UZTA 1J0WA 2BCJA 1V89A 2OQBA 2DTCA 4MY6A 3PEGA 3WA0A 2MKRA 2YF0A 2W2WA 2W2XD 4CSQA 1SGHA 2H7EA 2GJYA 1K5DB 4K2OA 5D3YA 2DN6A 2FJLA 1IRSA 4HAUB 2EMSA 1WJMA 1DDWA 3OANA 2R0DA 3N7CA 4L6EA 2W2XC 4P7IA 2RGNB 2KR0A 4HB2B 4PNKA 5LONB 4QJ5B 2P0FA 2Y8GA 2UVMA 5FI0A 1I2HA 2UZRA 4K2PA 3BJIA 1TXDA 4HDQA 2KIEA 2IYBA 2GUMA 2KUQA 3WYFB 2GCLA 1UNRA 2MFQA 1XCGA 1DDVA 5D27A 4HB0B 2P0HA 4KHBA 1T77A 2LOZA 2P0DA 1FB8A 4EJNA 5FI1A 4BBKA 3M1IB 2ELBA 2UZSA 3ULBA 3ODXA 5DHAB 1OY2A 2COAA 4B6HA 2HE7A 2LG1A 2I5CA 2RSGA 1LW3A 3AU5A 5EFXA 2DHKA 2R09A 3ZVRA 3SNHA 1PFJA 1U27A 2K8EA 2Z0QA 3X23A 3F0WA 5D3WA 1UNPA 2K49A 3NSUA 1V88A 4XWXA 5D3XA 5L81A 1DDMA 1DYNA 4Z2MB 1TJ6A 3HSAA 3KZ1A 1W1DA 1KZ7A 2AL6A 2D9YA 1NTVA 1FHXA 1GG3A 2MWNB 1ZM0A 1N3HA 1V61A 2QKLA 1Q67A 4DX8A 1B55A 3ODOA 1MK9B 4HHVA 4A6FB 3VIAA 2VKIA 3D8DA 3NW8A 3PVWA 2MDXA 4K81A 2ROVA 4KHOA 5C5BA 1WGUA 2J0MA 4GN1A 4GMVA 4GMXB 2LYDA 3TW1A 2KIGA 3OHMB 3P7ZA 2OTXA 2I1KA 1MPHA 4HB3B 4ZRIA 2K2UA 1U29A 2J0KA 1SHCA 1UPRA 3AJ4A 2M14A 2NZ8B 4GZUA 3SV1A 5M4YB 1ISNA 2DYNA 3LJUX 5C6RA 1FHOA 2VRWB 2P8VA 1X11A 4HSIA 2D10A 3A98B 3TVVA 2DFKA 2ADZA 3MPXA 5DI9B 4D6WA 5LG4B 5JHGA 3SYXA 2H7DA 1MKEA 2NMBA 1RJ2A 4IOYX 4MK0A 3NWDA 4A5KA 1WVHA 2DA0A 3PP2A 2JP2A 2RNRB 4MT7A 3PSCA 1U5DA 3QBVB 4ZRJA 1Y5OA 3KSYA 1XKEA 2KGXB 1E5WA 1P6SA 4DIXA 1KZGA 2GCJA 1W1GA 3HIEA 2Z14A 4DBBA 1EAZA 5CLLB 4EMOA 2D4QA 1MIZB 5JP4A 2XQNM 2J59M 2D11A 2EJ8A 1ZSQA 5HE2A 2LULA 1FGZA 2CY4A 1K5GB 2LKOA 2EC1A 2COFA 1Z87A 1BAKA 3TCAA 1PMSA 1U2BA 2D9WA 1FHWA 4HAXB 1WGQA 2K00A 3A8PA 5KCVA 1DBHA 1W1HA 4QJ4B 1FAOA 1AQCA 2EMTA 4YL8A 2RRFA 4HDOA 1MI1A 3PVUA 4HATB 2DX5A 4OT1A 2CODA 1ZC4B 2DX1A 2E2XA 3F5RA 5HE0A 5KQ4A 2YT1A 5J3TA 2QKMA 4PQ0A 4GXBA 1J19A 1MAIA 1EF1A 4KHBB 4HAWB 3TO1A 2RUKB 2PZ1A 3FEHA 3PG7A 1P3RA 4A6HA 4ZRKA 3U8ZA 2RVBB 3P6AA 2DHJA 2KCJA 1BTKA 4WSFA 5HE3A 5HE1A 2M38A 2DKQA 2ROZB 1FOEA 2Z0OA 1V5PA 2LOXA 1EGXA 1ZYIA 2YRYA 1U5FA 2KUPA 3KY9A 5I2SA 1XODA 1H4RA 2DKPA 4CHMA 3DXDA 3IVFA 2NBVA 4KHAA 1KI1B 4HAYB 1BWNA 4D0NB 1NTYA 2N0YA 4GNKB 4H8SA 4NSWA 1MK7B 5JLJB 3NWFA 2RLOA 2YS1A 1WG7A 4Z2NA 2YVCA 2CAYA 1GC7A 4DX90 2Z0PA 5DIFB 4CHJA 1QQGA 2HTHB 3AU4A 5GOWB 5C5BB 4TKNA 3DCXA 1OQNA 2COCA 3D8FA 2V76A 1AWEA 1V5MA 1BTNA 1FGYA 1P5TA 1X1GA 5J3QA 3G9WA 4TYZA 3B77A 3PVLA 1NU2A 3GYPA 1M7EA 2YS5A 3A58A 3CXBB 4C0AA 2YS3A 2DLWA 5JHHA 2J0JA 2YT0A 2I1JA 3HK0A 4QXAB 3V5WA 1WI1A 4K17A 1X86A 1ZC3B 1EVHA 1PLSA 2N23A 3BINA 1H10A 2GS0A 2Y7BA 2Z13A 1LB1A 2Q13A 5C16A 2ZKMX 3D8EA 4NY0A 4A6KA 4DXAB 5LOPB 3ODWA 1X05A 1U5GA 1XX0A 3MDBC 1UPQA 3HW2B 3U12A 4IFSA 1DROA 2D2QA 3SUZA 4HB4B 3TFMA 3QIJA 1UEFA 2FJUB 2Z4DA 3NWAA 3T06A 5IRSA 4F7UP 2D9ZA 2D9XA 3ML4A 4HAZB 4EKUA 4YONA 2Z59A 4OSNA 2VSZA 1U5EA 1X1FA 2CY5A 1MIXA 4GOUA 4L1RA 1TQZA 4A6FA 2YT2A 5KQ1A 4Y94A 4WVFB 4F7HA 4QJ3B 2IFSA 3KRWA 1WJ1A 3DXEA 3A8QA 3ZDTA 3PZDA 1XD4A 2ELAA 4WJ7A 5CLQB 3KRXA 5D3VA 2DYQA 2R2YA 1ZVRA 4F7GA 1UNQA 2X18A 1RRPB 1XR0B 2CRFA 3O96A 1QC6A 2G35A 5DHFB 2L1CA 5I2MA 2Y8FA 1OMWA 3HQCA 2YSZA 1I7AA 3CIKA 3GYOA 1Y19B 3ULCA 2D9VA 2ZPYA 4GPTB 2L2IA 3FM8C 4KVGB 3FSSA 4IAPA 5J3YA 2DHIA 2AEHA 1NI2A 1M7RA 3RCPA 2I5FA 4HAVB 1GC6A 3U7DA 5DH9B 3SO6A 3DXCA 2K2JA
chains in the Genus database with same CATH topology
1V5UA 5C79A 4KAXB 3VOQA 4CYEA 3QWMA 3UZTA 1J0WA 2BCJA 1V89A 2OQBA 2DTCA 4MY6A 3PEGA 3WA0A 2MKRA 2YF0A 2W2WA 2W2XD 1SGHA 2H7EA 2GJYA 1K5DB 4K2OA 5D3YA 2DN6A 2FJLA 1IRSA 4HAUB 2EMSA 1WJMA 1DDWA 3OANA 2R0DA 3N7CA 4L6EA 2W2XC 4P7IA 2RGNB 4HB2B 4PNKA 5LONB 2P0FA 2Y8GA 2UVMA 5FI0A 1I2HA 2UZRA 4K2PA 3BJIA 1TXDA 4HDQA 2IYBA 3WYFB 2GCLA 1UNRA 2MFQA 1XCGA 1DDVA 5D27A 4HB0B 2P0HA 2LOZA 2P0DA 1FB8A 4EJNA 5FI1A 4BBKA 3M1IB 2ELBA 2UZSA 3ULBA 3ODXA 5DHAB 1OY2A 2COAA 4B6HA 2HE7A 2LG1A 2I5CA 2RSGA 1LW3A 3AU5A 5EFXA 2DHKA 2R09A 3ZVRA 3SNHA 1PFJA 1U27A 2Z0QA 3X23A 3F0WA 5D3WA 1UNPA 3NSUA 1V88A 4XWXA 5D3XA 5L81A 1DDMA 1DYNA 4Z2MB 1TJ6A 3KZ1A 1W1DA 1KZ7A 2AL6A 2D9YA 1NTVA 1FHXA 1GG3A 2MWNB 1ZM0A 1N3HA 1V61A 2QKLA 1Q67A 4DX8A 1B55A 3ODOA 1MK9B 4HHVA 4A6FB 3VIAA 2VKIA 3D8DA 3PVWA 2MDXA 4K81A 2ROVA 4KHOA 5C5BA 1WGUA 2J0MA 4GN1A 4GMVA 4GMXB 2LYDA 3TW1A 3P7ZA 2OTXA 2I1KA 1MPHA 4HB3B 4ZRIA 2K2UA 1U29A 2J0KA 1SHCA 1UPRA 3AJ4A 2M14A 2NZ8B 4GZUA 3SV1A 1ISNA 2DYNA 3LJUX 5C6RA 1FHOA 2VRWB 2P8VA 1X11A 2D10A 3A98B 3TVVA 2DFKA 2ADZA 3MPXA 5DI9B 5JHGA 3SYXA 2H7DA 1MKEA 2NMBA 1RJ2A 4IOYX 4MK0A 4A5KA 1WVHA 2DA0A 3PP2A 2JP2A 2RNRB 4MT7A 3PSCA 1U5DA 3QBVB 4ZRJA 1Y5OA 3KSYA 1XKEA 2KGXB 1E5WA 1P6SA 1KZGA 2GCJA 1W1GA 4DBBA 1EAZA 5CLLB 4EMOA 2D4QA 1MIZB 5JP4A 2XQNM 2J59M 2D11A 2EJ8A 1ZSQA 5HE2A 2LULA 1FGZA 2CY4A 1K5GB 2LKOA 2EC1A 2COFA 1Z87A 1BAKA 3TCAA 1PMSA 1U2BA 2D9WA 1FHWA 4HAXB 1WGQA 2K00A 3A8PA 5KCVA 1DBHA 1W1HA 1FAOA 1AQCA 2EMTA 4YL8A 4HDOA 3PVUA 4HATB 2DX5A 2CODA 1ZC4B 2DX1A 2E2XA 3F5RA 5HE0A 5KQ4A 2YT1A 5J3TA 2QKMA 4PQ0A 4GXBA 1J19A 1MAIA 1EF1A 4KHBB 4HAWB 3TO1A 2RUKB 2PZ1A 3FEHA 3PG7A 1P3RA 4A6HA 4ZRKA 3U8ZA 2RVBB 3P6AA 2DHJA 2KCJA 1BTKA 4WSFA 5HE3A 5HE1A 2M38A 2DKQA 2ROZB 1FOEA 2Z0OA 1V5PA 2LOXA 1EGXA 2YRYA 1U5FA 2KUPA 3KY9A 1XODA 1H4RA 2DKPA 4CHMA 3DXDA 3IVFA 4KHAA 1KI1B 4HAYB 1BWNA 4D0NB 1NTYA 2N0YA 4H8SA 4NSWA 1MK7B 5JLJB 2RLOA 2YS1A 1WG7A 4Z2NA 2YVCA 2CAYA 1GC7A 4DX90 2Z0PA 5DIFB 4CHJA 1QQGA 2HTHB 3AU4A 5GOWB 5C5BB 4TKNA 1OQNA 2COCA 3D8FA 2V76A 1AWEA 1V5MA 1BTNA 1FGYA 1P5TA 1X1GA 5J3QA 3G9WA 4TYZA 3PVLA 1NU2A 3GYPA 1M7EA 2YS5A 3CXBB 4C0AA 2YS3A 2DLWA 5JHHA 2J0JA 2YT0A 2I1JA 3HK0A 3V5WA 1WI1A 4K17A 1X86A 1ZC3B 1EVHA 1PLSA 2N23A 3BINA 1H10A 2GS0A 2Y7BA 1LB1A 2Q13A 5C16A 3D8EA 4NY0A 4A6KA 4DXAB 5LOPB 3ODWA 1X05A 1U5GA 3MDBC 1XX0A 1UPQA 3HW2B 4IFSA 1DROA 2D2QA 3SUZA 4HB4B 3TFMA 3QIJA 1UEFA 3T06A 4F7UP 2D9ZA 2D9XA 3ML4A 4HAZB 4EKUA 4YONA 2VSZA 1U5EA 1X1FA 2CY5A 1MIXA 1TQZA 4A6FA 5KQ1A 4Y94A 4WVFB 4F7HA 2IFSA 3KRWA 1WJ1A 3DXEA 3A8QA 3ZDTA 3PZDA 1XD4A 2ELAA 4WJ7A 5CLQB 3KRXA 5D3VA 2DYQA 1ZVRA 4F7GA 1UNQA 2X18A 1RRPB 1XR0B 2CRFA 3O96A 1QC6A 2G35A 5DHFB 2L1CA 2Y8FA 1OMWA 3HQCA 2YSZA 1I7AA 3CIKA 3GYOA 1Y19B 3ULCA 2D9VA 2ZPYA 4GPTB 2L2IA 3FM8C 4KVGB 3FSSA 4IAPA 5J3YA 2DHIA 2AEHA 1NI2A 1M7RA 3RCPA 2I5FA 4HAVB 1GC6A 3U7DA 5DH9B 3SO6A 3DXCA 2K2JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V5U A;  5C79 A;  4KAX B;  3VOQ A;  4CYE A;  3QWM A;  3UZT A;  1J0W A;  2BCJ A;  1V89 A;  2OQB A;  2DTC A;  4MY6 A;  3PEG A;  3WA0 A;  2MKR A;  2YF0 A;  2W2W A;  2W2X D;  1SGH A;  2H7E A;  2GJY A;  1K5D B;  4K2O A;  5D3Y A;  2DN6 A;  2FJL A;  1IRS A;  4HAU B;  2EMS A;  1WJM A;  1DDW A;  3OAN A;  2R0D A;  3N7C A;  4L6E A;  2W2X C;  4P7I A;  2RGN B;  4HB2 B;  4PNK A;  5LON B;  2P0F A;  2Y8G A;  2UVM A;  5FI0 A;  1I2H A;  2UZR A;  4K2P A;  3BJI A;  1TXD A;  4HDQ A;  2IYB A;  3WYF B;  2GCL A;  1UNR A;  2MFQ A;  1XCG A;  1DDV A;  5D27 A;  4HB0 B;  2P0H A;  2LOZ A;  2P0D A;  1FB8 A;  4EJN A;  5FI1 A;  4BBK A;  3M1I B;  2ELB A;  2UZS A;  3ULB A;  3ODX A;  5DHA B;  1OY2 A;  2COA A;  4B6H A;  2HE7 A;  2LG1 A;  2I5C A;  2RSG A;  1LW3 A;  3AU5 A;  5EFX A;  2DHK A;  2R09 A;  3ZVR A;  3SNH A;  1PFJ A;  1U27 A;  2Z0Q A;  3X23 A;  3F0W A;  5D3W A;  1UNP A;  3NSU A;  1V88 A;  4XWX A;  5D3X A;  5L81 A;  1DDM A;  1DYN A;  4Z2M B;  1TJ6 A;  3KZ1 A;  1W1D A;  1KZ7 A;  2AL6 A;  2D9Y A;  1NTV A;  1FHX A;  1GG3 A;  2MWN B;  1ZM0 A;  1N3H A;  1V61 A;  2QKL A;  1Q67 A;  4DX8 A;  1B55 A;  3ODO A;  1MK9 B;  4HHV A;  4A6F B;  3VIA A;  2VKI A;  3D8D A;  3PVW A;  2MDX A;  4K81 A;  2ROV A;  4KHO A;  5C5B A;  1WGU A;  2J0M A;  4GN1 A;  4GMV A;  4GMX B;  2LYD A;  3TW1 A;  3P7Z A;  2OTX A;  2I1K A;  1MPH A;  4HB3 B;  4ZRI A;  2K2U A;  1U29 A;  2J0K A;  1SHC A;  1UPR A;  3AJ4 A;  2M14 A;  2NZ8 B;  4GZU A;  3SV1 A;  1ISN A;  2DYN A;  3LJU X;  5C6R A;  1FHO A;  2VRW B;  2P8V A;  1X11 A;  2D10 A;  3A98 B;  3TVV A;  2DFK A;  2ADZ A;  3MPX A;  5DI9 B;  5JHG A;  3SYX A;  2H7D A;  1MKE A;  2NMB A;  1RJ2 A;  4IOY X;  4MK0 A;  4A5K A;  1WVH A;  2DA0 A;  3PP2 A;  2JP2 A;  2RNR B;  4MT7 A;  3PSC A;  1U5D A;  3QBV B;  4ZRJ A;  1Y5O A;  3KSY A;  1XKE A;  2KGX B;  1E5W A;  1P6S A;  1KZG A;  2GCJ A;  1W1G A;  4DBB A;  1EAZ A;  5CLL B;  4EMO A;  2D4Q A;  1MIZ B;  5JP4 A;  2XQN M;  2J59 M;  2D11 A;  2EJ8 A;  1ZSQ A;  5HE2 A;  2LUL A;  1FGZ A;  2CY4 A;  1K5G B;  2LKO A;  2EC1 A;  2COF A;  1Z87 A;  1BAK A;  3TCA A;  1PMS A;  1U2B A;  2D9W A;  1FHW A;  4HAX B;  1WGQ A;  2K00 A;  3A8P A;  5KCV A;  1DBH A;  1W1H A;  1FAO A;  1AQC A;  2EMT A;  4YL8 A;  4HDO A;  3PVU A;  4HAT B;  2DX5 A;  2COD A;  1ZC4 B;  2DX1 A;  2E2X A;  3F5R A;  5HE0 A;  5KQ4 A;  2YT1 A;  5J3T A;  2QKM A;  4PQ0 A;  4GXB A;  1J19 A;  1MAI A;  1EF1 A;  4KHB B;  4HAW B;  3TO1 A;  2RUK B;  2PZ1 A;  3FEH A;  3PG7 A;  1P3R A;  4A6H A;  4ZRK A;  3U8Z A;  2RVB B;  3P6A A;  2DHJ A;  2KCJ A;  1BTK A;  4WSF A;  5HE3 A;  5HE1 A;  2M38 A;  2DKQ A;  2ROZ B;  1FOE A;  2Z0O A;  1V5P A;  2LOX A;  1EGX A;  2YRY A;  1U5F A;  2KUP A;  3KY9 A;  1XOD A;  1H4R A;  2DKP A;  4CHM A;  3DXD A;  3IVF A;  4KHA A;  1KI1 B;  4HAY B;  1BWN A;  4D0N B;  1NTY A;  2N0Y A;  4H8S A;  4NSW A;  1MK7 B;  5JLJ B;  2RLO A;  2YS1 A;  1WG7 A;  4Z2N A;  2YVC A;  2CAY A;  1GC7 A;  4DX9 0;  2Z0P A;  5DIF B;  4CHJ A;  1QQG A;  2HTH B;  3AU4 A;  5GOW B;  5C5B B;  4TKN A;  1OQN A;  2COC A;  3D8F A;  2V76 A;  1AWE A;  1V5M A;  1BTN A;  1FGY A;  1P5T A;  1X1G A;  5J3Q A;  3G9W A;  4TYZ A;  3PVL A;  1NU2 A;  3GYP A;  1M7E A;  2YS5 A;  3CXB B;  4C0A A;  2YS3 A;  2DLW A;  5JHH A;  2J0J A;  2YT0 A;  2I1J A;  3HK0 A;  3V5W A;  1WI1 A;  4K17 A;  1X86 A;  1ZC3 B;  1EVH A;  1PLS A;  2N23 A;  3BIN A;  1H10 A;  2GS0 A;  2Y7B A;  1LB1 A;  2Q13 A;  5C16 A;  3D8E A;  4NY0 A;  4A6K A;  4DXA B;  5LOP B;  3ODW A;  1X05 A;  1U5G A;  3MDB C;  1XX0 A;  1UPQ A;  3HW2 B;  4IFS A;  1DRO A;  2D2Q A;  3SUZ A;  4HB4 B;  3TFM A;  3QIJ A;  1UEF A;  3T06 A;  4F7U P;  2D9Z A;  2D9X A;  3ML4 A;  4HAZ B;  4EKU A;  4YON A;  2VSZ A;  1U5E A;  1X1F A;  2CY5 A;  1MIX A;  1TQZ A;  4A6F A;  5KQ1 A;  4Y94 A;  4WVF B;  4F7H A;  2IFS A;  3KRW A;  1WJ1 A;  3DXE A;  3A8Q A;  3ZDT A;  3PZD A;  1XD4 A;  2ELA A;  4WJ7 A;  5CLQ B;  3KRX A;  5D3V A;  2DYQ A;  1ZVR A;  4F7G A;  1UNQ A;  2X18 A;  1RRP B;  1XR0 B;  2CRF A;  3O96 A;  1QC6 A;  2G35 A;  5DHF B;  2L1C A;  2Y8F A;  1OMW A;  3HQC A;  2YSZ A;  1I7A A;  3CIK A;  3GYO A;  1Y19 B;  3ULC A;  2D9V A;  2ZPY A;  4GPT B;  2L2I A;  3FM8 C;  4KVG B;  3FSS A;  4IAP A;  5J3Y A;  2DHI A;  2AEH A;  1NI2 A;  1M7R A;  3RCP A;  2I5F A;  4HAV B;  1GC6 A;  3U7D A;  5DH9 B;  3SO6 A;  3DXC A;  2K2J A; 
#chains in the Genus database with same CATH topology
 1V5U A;  3FVC A;  5C79 A;  4KAX B;  3VOQ A;  4CYE A;  3QWM A;  3UZT A;  1J0W A;  2BCJ A;  1V89 A;  2OQB A;  2DTC A;  4MY6 A;  3PEG A;  3WA0 A;  2MKR A;  2YF0 A;  2W2W A;  2W2X D;  4CSQ A;  1SGH A;  2H7E A;  2GJY A;  1K5D B;  4K2O A;  5D3Y A;  2DN6 A;  2FJL A;  1IRS A;  4HAU B;  2EMS A;  1WJM A;  1DDW A;  3OAN A;  2R0D A;  3N7C A;  4L6E A;  2W2X C;  4P7I A;  2RGN B;  2KR0 A;  4HB2 B;  4PNK A;  5LON B;  4QJ5 B;  2P0F A;  2Y8G A;  2UVM A;  5FI0 A;  1I2H A;  2UZR A;  4K2P A;  3BJI A;  1TXD A;  4HDQ A;  2KIE A;  2IYB A;  2GUM A;  2KUQ A;  3WYF B;  2GCL A;  1UNR A;  2MFQ A;  1XCG A;  1DDV A;  5D27 A;  4HB0 B;  2P0H A;  4KHB A;  1T77 A;  2LOZ A;  2P0D A;  1FB8 A;  4EJN A;  5FI1 A;  4BBK A;  3M1I B;  2ELB A;  2UZS A;  3ULB A;  3ODX A;  5DHA B;  1OY2 A;  2COA A;  4B6H A;  2HE7 A;  2LG1 A;  2I5C A;  2RSG A;  1LW3 A;  3AU5 A;  5EFX A;  2DHK A;  2R09 A;  3ZVR A;  3SNH A;  1PFJ A;  1U27 A;  2K8E A;  2Z0Q A;  3X23 A;  3F0W A;  5D3W A;  1UNP A;  2K49 A;  3NSU A;  1V88 A;  4XWX A;  5D3X A;  5L81 A;  1DDM A;  1DYN A;  4Z2M B;  1TJ6 A;  3HSA A;  3KZ1 A;  1W1D A;  1KZ7 A;  2AL6 A;  2D9Y A;  1NTV A;  1FHX A;  1GG3 A;  2MWN B;  1ZM0 A;  1N3H A;  1V61 A;  2QKL A;  1Q67 A;  4DX8 A;  1B55 A;  3ODO A;  1MK9 B;  4HHV A;  4A6F B;  3VIA A;  2VKI A;  3D8D A;  3NW8 A;  3PVW A;  2MDX A;  4K81 A;  2ROV A;  4KHO A;  5C5B A;  1WGU A;  2J0M A;  4GN1 A;  4GMV A;  4GMX B;  2LYD A;  3TW1 A;  2KIG A;  3OHM B;  3P7Z A;  2OTX A;  2I1K A;  1MPH A;  4HB3 B;  4ZRI A;  2K2U A;  1U29 A;  2J0K A;  1SHC A;  1UPR A;  3AJ4 A;  2M14 A;  2NZ8 B;  4GZU A;  3SV1 A;  5M4Y B;  1ISN A;  2DYN A;  3LJU X;  5C6R A;  1FHO A;  2VRW B;  2P8V A;  1X11 A;  4HSI A;  2D10 A;  3A98 B;  3TVV A;  2DFK A;  2ADZ A;  3MPX A;  5DI9 B;  4D6W A;  5LG4 B;  5JHG A;  3SYX A;  2H7D A;  1MKE A;  2NMB A;  1RJ2 A;  4IOY X;  4MK0 A;  3NWD A;  4A5K A;  1WVH A;  2DA0 A;  3PP2 A;  2JP2 A;  2RNR B;  4MT7 A;  3PSC A;  1U5D A;  3QBV B;  4ZRJ A;  1Y5O A;  3KSY A;  1XKE A;  2KGX B;  1E5W A;  1P6S A;  4DIX A;  1KZG A;  2GCJ A;  1W1G A;  3HIE A;  2Z14 A;  4DBB A;  1EAZ A;  5CLL B;  4EMO A;  2D4Q A;  1MIZ B;  5JP4 A;  2XQN M;  2J59 M;  2D11 A;  2EJ8 A;  1ZSQ A;  5HE2 A;  2LUL A;  1FGZ A;  2CY4 A;  1K5G B;  2LKO A;  2EC1 A;  2COF A;  1Z87 A;  1BAK A;  3TCA A;  1PMS A;  1U2B A;  2D9W A;  1FHW A;  4HAX B;  1WGQ A;  2K00 A;  3A8P A;  5KCV A;  1DBH A;  1W1H A;  4QJ4 B;  1FAO A;  1AQC A;  2EMT A;  4YL8 A;  2RRF A;  4HDO A;  1MI1 A;  3PVU A;  4HAT B;  2DX5 A;  4OT1 A;  2COD A;  1ZC4 B;  2DX1 A;  2E2X A;  3F5R A;  5HE0 A;  5KQ4 A;  2YT1 A;  5J3T A;  2QKM A;  4PQ0 A;  4GXB A;  1J19 A;  1MAI A;  1EF1 A;  4KHB B;  4HAW B;  3TO1 A;  2RUK B;  2PZ1 A;  3FEH A;  3PG7 A;  1P3R A;  4A6H A;  4ZRK A;  3U8Z A;  2RVB B;  3P6A A;  2DHJ A;  2KCJ A;  1BTK A;  4WSF A;  5HE3 A;  5HE1 A;  2M38 A;  2DKQ A;  2ROZ B;  1FOE A;  2Z0O A;  1V5P A;  2LOX A;  1EGX A;  1ZYI A;  2YRY A;  1U5F A;  2KUP A;  3KY9 A;  5I2S A;  1XOD A;  1H4R A;  2DKP A;  4CHM A;  3DXD A;  3IVF A;  2NBV A;  4KHA A;  1KI1 B;  4HAY B;  1BWN A;  4D0N B;  1NTY A;  2N0Y A;  4GNK B;  4H8S A;  4NSW A;  1MK7 B;  5JLJ B;  3NWF A;  2RLO A;  2YS1 A;  1WG7 A;  4Z2N A;  2YVC A;  2CAY A;  1GC7 A;  4DX9 0;  2Z0P A;  5DIF B;  4CHJ A;  1QQG A;  2HTH B;  3AU4 A;  5GOW B;  5C5B B;  4TKN A;  3DCX A;  1OQN A;  2COC A;  3D8F A;  2V76 A;  1AWE A;  1V5M A;  1BTN A;  1FGY A;  1P5T A;  1X1G A;  5J3Q A;  3G9W A;  4TYZ A;  3B77 A;  3PVL A;  1NU2 A;  3GYP A;  1M7E A;  2YS5 A;  3A58 A;  3CXB B;  4C0A A;  2YS3 A;  2DLW A;  5JHH A;  2J0J A;  2YT0 A;  2I1J A;  3HK0 A;  4QXA B;  3V5W A;  1WI1 A;  4K17 A;  1X86 A;  1ZC3 B;  1EVH A;  1PLS A;  2N23 A;  3BIN A;  1H10 A;  2GS0 A;  2Y7B A;  2Z13 A;  1LB1 A;  2Q13 A;  5C16 A;  2ZKM X;  3D8E A;  4NY0 A;  4A6K A;  4DXA B;  5LOP B;  3ODW A;  1X05 A;  1U5G A;  1XX0 A;  3MDB C;  1UPQ A;  3HW2 B;  3U12 A;  4IFS A;  1DRO A;  2D2Q A;  3SUZ A;  4HB4 B;  3TFM A;  3QIJ A;  1UEF A;  2FJU B;  2Z4D A;  3NWA A;  3T06 A;  5IRS A;  4F7U P;  2D9Z A;  2D9X A;  3ML4 A;  4HAZ B;  4EKU A;  4YON A;  2Z59 A;  4OSN A;  2VSZ A;  1U5E A;  1X1F A;  2CY5 A;  1MIX A;  4GOU A;  4L1R A;  1TQZ A;  4A6F A;  2YT2 A;  5KQ1 A;  4Y94 A;  4WVF B;  4F7H A;  4QJ3 B;  2IFS A;  3KRW A;  1WJ1 A;  3DXE A;  3A8Q A;  3ZDT A;  3PZD A;  1XD4 A;  2ELA A;  4WJ7 A;  5CLQ B;  3KRX A;  5D3V A;  2DYQ A;  2R2Y A;  1ZVR A;  4F7G A;  1UNQ A;  2X18 A;  1RRP B;  1XR0 B;  2CRF A;  3O96 A;  1QC6 A;  2G35 A;  5DHF B;  2L1C A;  5I2M A;  2Y8F A;  1OMW A;  3HQC A;  2YSZ A;  1I7A A;  3CIK A;  3GYO A;  1Y19 B;  3ULC A;  2D9V A;  2ZPY A;  4GPT B;  2L2I A;  3FM8 C;  4KVG B;  3FSS A;  4IAP A;  5J3Y A;  2DHI A;  2AEH A;  1NI2 A;  1M7R A;  3RCP A;  2I5F A;  4HAV B;  1GC6 A;  3U7D A;  5DH9 B;  3SO6 A;  3DXC A;  2K2J A; 
#chains in the Genus database with same CATH homology
 1V5U A;  5C79 A;  4KAX B;  3VOQ A;  4CYE A;  3QWM A;  3UZT A;  1J0W A;  2BCJ A;  1V89 A;  2OQB A;  2DTC A;  4MY6 A;  3PEG A;  3WA0 A;  2MKR A;  2YF0 A;  2W2W A;  2W2X D;  1SGH A;  2H7E A;  2GJY A;  1K5D B;  4K2O A;  5D3Y A;  2DN6 A;  2FJL A;  1IRS A;  4HAU B;  2EMS A;  1WJM A;  1DDW A;  3OAN A;  2R0D A;  3N7C A;  4L6E A;  2W2X C;  4P7I A;  2RGN B;  4HB2 B;  4PNK A;  5LON B;  2P0F A;  2Y8G A;  2UVM A;  5FI0 A;  1I2H A;  2UZR A;  4K2P A;  3BJI A;  1TXD A;  4HDQ A;  2IYB A;  3WYF B;  2GCL A;  1UNR A;  2MFQ A;  1XCG A;  1DDV A;  5D27 A;  4HB0 B;  2P0H A;  2LOZ A;  2P0D A;  1FB8 A;  4EJN A;  5FI1 A;  4BBK A;  3M1I B;  2ELB A;  2UZS A;  3ULB A;  3ODX A;  5DHA B;  1OY2 A;  2COA A;  4B6H A;  2HE7 A;  2LG1 A;  2I5C A;  2RSG A;  1LW3 A;  3AU5 A;  5EFX A;  2DHK A;  2R09 A;  3ZVR A;  3SNH A;  1PFJ A;  1U27 A;  2Z0Q A;  3X23 A;  3F0W A;  5D3W A;  1UNP A;  3NSU A;  1V88 A;  4XWX A;  5D3X A;  5L81 A;  1DDM A;  1DYN A;  4Z2M B;  1TJ6 A;  3KZ1 A;  1W1D A;  1KZ7 A;  2AL6 A;  2D9Y A;  1NTV A;  1FHX A;  1GG3 A;  2MWN B;  1ZM0 A;  1N3H A;  1V61 A;  2QKL A;  1Q67 A;  4DX8 A;  1B55 A;  3ODO A;  1MK9 B;  4HHV A;  4A6F B;  3VIA A;  2VKI A;  3D8D A;  3PVW A;  2MDX A;  4K81 A;  2ROV A;  4KHO A;  5C5B A;  1WGU A;  2J0M A;  4GN1 A;  4GMV A;  4GMX B;  2LYD A;  3TW1 A;  3P7Z A;  2OTX A;  2I1K A;  1MPH A;  4HB3 B;  4ZRI A;  2K2U A;  1U29 A;  2J0K A;  1SHC A;  1UPR A;  3AJ4 A;  2M14 A;  2NZ8 B;  4GZU A;  3SV1 A;  1ISN A;  2DYN A;  3LJU X;  5C6R A;  1FHO A;  2VRW B;  2P8V A;  1X11 A;  2D10 A;  3A98 B;  3TVV A;  2DFK A;  2ADZ A;  3MPX A;  5DI9 B;  5JHG A;  3SYX A;  2H7D A;  1MKE A;  2NMB A;  1RJ2 A;  4IOY X;  4MK0 A;  4A5K A;  1WVH A;  2DA0 A;  3PP2 A;  2JP2 A;  2RNR B;  4MT7 A;  3PSC A;  1U5D A;  3QBV B;  4ZRJ A;  1Y5O A;  3KSY A;  1XKE A;  2KGX B;  1E5W A;  1P6S A;  1KZG A;  2GCJ A;  1W1G A;  4DBB A;  1EAZ A;  5CLL B;  4EMO A;  2D4Q A;  1MIZ B;  5JP4 A;  2XQN M;  2J59 M;  2D11 A;  2EJ8 A;  1ZSQ A;  5HE2 A;  2LUL A;  1FGZ A;  2CY4 A;  1K5G B;  2LKO A;  2EC1 A;  2COF A;  1Z87 A;  1BAK A;  3TCA A;  1PMS A;  1U2B A;  2D9W A;  1FHW A;  4HAX B;  1WGQ A;  2K00 A;  3A8P A;  5KCV A;  1DBH A;  1W1H A;  1FAO A;  1AQC A;  2EMT A;  4YL8 A;  4HDO A;  3PVU A;  4HAT B;  2DX5 A;  2COD A;  1ZC4 B;  2DX1 A;  2E2X A;  3F5R A;  5HE0 A;  5KQ4 A;  2YT1 A;  5J3T A;  2QKM A;  4PQ0 A;  4GXB A;  1J19 A;  1MAI A;  1EF1 A;  4KHB B;  4HAW B;  3TO1 A;  2RUK B;  2PZ1 A;  3FEH A;  3PG7 A;  1P3R A;  4A6H A;  4ZRK A;  3U8Z A;  2RVB B;  3P6A A;  2DHJ A;  2KCJ A;  1BTK A;  4WSF A;  5HE3 A;  5HE1 A;  2M38 A;  2DKQ A;  2ROZ B;  1FOE A;  2Z0O A;  1V5P A;  2LOX A;  1EGX A;  2YRY A;  1U5F A;  2KUP A;  3KY9 A;  1XOD A;  1H4R A;  2DKP A;  4CHM A;  3DXD A;  3IVF A;  4KHA A;  1KI1 B;  4HAY B;  1BWN A;  4D0N B;  1NTY A;  2N0Y A;  4H8S A;  4NSW A;  1MK7 B;  5JLJ B;  2RLO A;  2YS1 A;  1WG7 A;  4Z2N A;  2YVC A;  2CAY A;  1GC7 A;  4DX9 0;  2Z0P A;  5DIF B;  4CHJ A;  1QQG A;  2HTH B;  3AU4 A;  5GOW B;  5C5B B;  4TKN A;  1OQN A;  2COC A;  3D8F A;  2V76 A;  1AWE A;  1V5M A;  1BTN A;  1FGY A;  1P5T A;  1X1G A;  5J3Q A;  3G9W A;  4TYZ A;  3PVL A;  1NU2 A;  3GYP A;  1M7E A;  2YS5 A;  3CXB B;  4C0A A;  2YS3 A;  2DLW A;  5JHH A;  2J0J A;  2YT0 A;  2I1J A;  3HK0 A;  3V5W A;  1WI1 A;  4K17 A;  1X86 A;  1ZC3 B;  1EVH A;  1PLS A;  2N23 A;  3BIN A;  1H10 A;  2GS0 A;  2Y7B A;  1LB1 A;  2Q13 A;  5C16 A;  3D8E A;  4NY0 A;  4A6K A;  4DXA B;  5LOP B;  3ODW A;  1X05 A;  1U5G A;  3MDB C;  1XX0 A;  1UPQ A;  3HW2 B;  4IFS A;  1DRO A;  2D2Q A;  3SUZ A;  4HB4 B;  3TFM A;  3QIJ A;  1UEF A;  3T06 A;  4F7U P;  2D9Z A;  2D9X A;  3ML4 A;  4HAZ B;  4EKU A;  4YON A;  2VSZ A;  1U5E A;  1X1F A;  2CY5 A;  1MIX A;  1TQZ A;  4A6F A;  5KQ1 A;  4Y94 A;  4WVF B;  4F7H A;  2IFS A;  3KRW A;  1WJ1 A;  3DXE A;  3A8Q A;  3ZDT A;  3PZD A;  1XD4 A;  2ELA A;  4WJ7 A;  5CLQ B;  3KRX A;  5D3V A;  2DYQ A;  1ZVR A;  4F7G A;  1UNQ A;  2X18 A;  1RRP B;  1XR0 B;  2CRF A;  3O96 A;  1QC6 A;  2G35 A;  5DHF B;  2L1C A;  2Y8F A;  1OMW A;  3HQC A;  2YSZ A;  1I7A A;  3CIK A;  3GYO A;  1Y19 B;  3ULC A;  2D9V A;  2ZPY A;  4GPT B;  2L2I A;  3FM8 C;  4KVG B;  3FSS A;  4IAP A;  5J3Y A;  2DHI A;  2AEH A;  1NI2 A;  1M7R A;  3RCP A;  2I5F A;  4HAV B;  1GC6 A;  3U7D A;  5DH9 B;  3SO6 A;  3DXC A;  2K2J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...