1DDMA

Solution structure of the numb ptb domain complexed to a nak peptide
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
135
structure length
135
Chain Sequence
HQWQADEEAVRSATCSFSVKYLGCVEVFESRGMQVCEEALKVLRQSRRRPVRGLLHVSGDGLRVVDDETKGLIVDQTIEKVSFCAPDRNHERGFSYICRDGTTRRWMCHGFLACKDSGERLSHAVGCAFAVCLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multiple modes of peptide recognition by the PTB domain of the cell fate determinant Numb.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Signaling protein/transferase
molecule keywords NUMB PROTEIN
total genus 20
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 1999-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1ddmA00
3P6AA 1WGUA 2JP2A 4HATB 2CODA 2LOXA 4DX90 1DYNA 2COFA 3DXCA 3ULBA 1EAZA 3IVFA 4B6HA 3AJ4A 3TO1A 4GN1A 5DHAB 2COCA 4TYZA 1DDVA 1DDMA 3AU4A 2KCJA 1NU2A 3QWMA 1XX0A 3RCPA 2LYDA 1MIXA 3DXEA 1FAOA 1E5WA 1GG3A 2GJYA 2XQNM 5HE2A 4HB0B 2Z0QA 1ZSQA 4YONA 2ADZA 1NI2A 3ZDTA 3G9WA 5FI0A 2IFSA 2DHKA 2M14A 1NTYA 2RUKB 1LB1A 2IYBA 4K81A 1FGYA 3PVLA 2Y8FA 3QBVB 4K17A 5HE0A 4HDOA 4PNKA 1MIZB 1TXDA 3TCAA 4ZRJA 3PVWA 5EFXA 4CYEA 2D10A 4HAZB 2GCJA 2LKOA 4WJ7A 2K2UA 1M7RA 5KCVA 5FI1A 2YS3A 2YVCA 2K00A 3M1IB 2DN6A 3ODXA 4TKNA 4MT7A 5CLQB 2P0FA 5DI9B 2YT1A 1U5DA 2YSZA 1QC6A 1J19A 1P6SA 5HE1A 4PQ0A 4MY6A 1DDWA 2QKLA 4GXBA 1V5MA 1XR0B 2CY4A 3V5WA 1U29A 1Y19B 3MPXA 3X23A 4MK0A 2GCLA 1V88A 1K5DB 3HK0A 3PVUA 3U7DA 2ELBA 2Z0PA 2E2XA 5C6RA 3OANA 1X1FA 3TW1A 1UPQA 1IRSA 3ODWA 1SGHA 2AL6A 2N23A 5HE3A 3O96A 5JLJB 2MDXA 1M7EA 1RRPB 2P0HA 4HAWB 1Q67A 1UEFA 2LOZA 1ZM0A 2RNRB 4ZRIA 2W2XC 2PZ1A 1ZC3B 1W1HA 2VKIA 1WG7A 1V5PA 1BAKA 2CRFA 1KZGA 3KY9A 5KQ1A 3GYOA 4EKUA 1DROA 1U5FA 3FM8C 4IAPA 5DIFB 3DXDA 3KRWA 3HQCA 2X18A 3T06A 1XKEA 2W2XD 1SHCA 1LW3A 2ROVA 3U8ZA 3NSUA 2D11A 1I2HA 1H10A 3SO6A 2Q13A 1PMSA 2D9WA 2YS1A 2I1JA 2BCJA 4BBKA 2CY5A 1FHXA 3AU5A 5CLLB 3SYXA 2DYNA 1U27A 4A5KA 2H7DA 4HDQA 3ULCA 5JP4A 1EF1A 5C5BA 4HHVA 2W2WA 4HAUB 2NMBA 5DH9B 1FGZA 2ROZB 3ODOA 2MWNB 3ZVRA 2DA0A 3KRXA 2AEHA 3UZTA 4A6HA 1BTKA 4Y94A 4KVGB 3VOQA 2G35A 4F7GA 3KSYA 5J3TA 4K2PA 4KHBB 1H4RA 2EMTA 4DXAB 1WI1A 2LG1A 2J59M 2VSZA 4HB2B 1WJ1A 2D9YA 3FSSA 2RLOA 1OY2A 3PG7A 1PLSA 1EGXA 2YS5A 1BWNA 3VIAA 4HB4B 4EJNA 5LOPB 4KHAA 2Y7BA 1Y5OA 4GZUA 3F5RA 3KZ1A 4NY0A 2KUPA 3D8DA 1TQZA 1WVHA 2CAYA 1OMWA 2L2IA 5D27A 3TVVA 2DKPA 3BJIA 2DYQA 5L81A 1KZ7A 1PFJA 2P8VA 2YF0A 1XCGA 1ZVRA 1P3RA 2D9ZA 2DHJA 1X1GA 4A6FB 5LONB 1P5TA 5D3XA 1U5GA 1V89A 2UVMA 3A8QA 4CHJA 4A6KA 1GC7A 2KGXB 2RVBB 4CHMA 1W1GA 1ZC4B 3SUZA 1EVHA 1W1DA 1V5UA 1XD4A 4P7IA 1BTNA 2OTXA 3P7ZA 5D3VA 2ZPYA 1KI1B 1XODA 3WYFB 5J3YA 4DBBA 2I1KA 4IOYX 1UNQA 1UNRA 1X05A 2ELAA 2MFQA 1UPRA 2RSGA 5DHFB 4C0AA 5JHHA 5C16A 4NSWA 4K2OA 4HAYB 4KAXB 3CIKA 3ML4A 3FEHA 5JHGA 2I5FA 2GS0A 4HAXB 5D3YA 2J0JA 4ZRKA 2UZSA 2Y8GA 1N3HA 2DFKA 2I5CA 5D3WA 1MPHA 3N7CA 3SNHA 2D4QA 3A98B 1MK9B 1MK7B 2EC1A 2RGNB 2EJ8A 2R09A 2UZRA 2OQBA 4L6EA 3PSCA 1TJ6A 3BINA 1QQGA 2K2JA 2YT0A 1OQNA 2DX5A 4GMXB 5J3QA 4HB3B 1I7AA 1K5GB 1WJMA 2COAA 1MKEA 1X11A 1MAIA 1AWEA 1X86A 4HAVB 2V76A 1RJ2A 2N0YA 4WSFA 4H8SA 3PEGA 2LULA 1ISNA 1AQCA 2P0DA 2D9XA 2FJLA 4EMOA 2HE7A 2NZ8B 3TFMA 1FOEA 3D8FA 3HW2B 5C5BB 4WVFB 1J0WA 2M38A 2MKRA 4Z2NA 3MDBC 2DHIA 1FHOA 2VRWB 2QKMA 1U2BA 3CXBB 3WA0A 2J0MA 1WGQA 4F7UP 4Z2MB 1NTVA 4GPTB 4YL8A 5GOWB 1DBHA 1GC6A 2R0DA 4F7HA 3D8EA 2L1CA 3A8PA 2DKQA 1FHWA 2H7EA 5KQ4A 3PZDA 2DX1A 4D0NB 1UNPA 3F0WA 2Z0OA 3GYPA 2J0KA 3PP2A 4KHOA 2DTCA 3QIJA 2YRYA 4IFSA 3SV1A 3LJUX 4GMVA 1U5EA 2D2QA 4DX8A 2HTHB 1B55A 5C79A 2EMSA 1FB8A 4XWXA 2DLWA 1V61A 4A6FA 2D9VA 1Z87A
chains in the Genus database with same CATH superfamily
3P6AA 1WGUA 2JP2A 4HATB 2CODA 2LOXA 4DX90 1DYNA 4GNKB 2COFA 3NW8A 3DXCA 3ULBA 1EAZA 3IVFA 4B6HA 3AJ4A 3TO1A 4GN1A 5DHAB 2COCA 4TYZA 1DDVA 4HSIA 2KUQA 1DDMA 3AU4A 2KCJA 1NU2A 3QWMA 1XX0A 3RCPA 2LYDA 1MIXA 3DXEA 1FAOA 1E5WA 1GG3A 2GJYA 2XQNM 5HE2A 4HB0B 2Z0QA 1ZSQA 4YONA 2ADZA 1NI2A 2Z14A 3ZDTA 3G9WA 5FI0A 2IFSA 2DHKA 1T77A 2M14A 1NTYA 2RUKB 1LB1A 2IYBA 4K81A 1FGYA 3OHMB 3PVLA 2Y8FA 3QBVB 4K17A 5HE0A 4HDOA 4PNKA 1MIZB 1TXDA 3TCAA 4ZRJA 3PVWA 5EFXA 4CYEA 2D10A 4HAZB 2GCJA 2LKOA 4WJ7A 2K2UA 1M7RA 5KCVA 5FI1A 2YS3A 2YVCA 2K00A 2RRFA 3M1IB 2DN6A 3ODXA 4TKNA 4MT7A 5CLQB 2P0FA 5DI9B 2YT1A 1U5DA 2YSZA 1QC6A 1J19A 1P6SA 5HE1A 4PQ0A 4MY6A 1DDWA 2QKLA 4GXBA 1V5MA 1XR0B 2CY4A 3V5WA 1U29A 1Y19B 3MPXA 3X23A 4MK0A 2GCLA 1V88A 1K5DB 3HK0A 3PVUA 2Z4DA 3U7DA 2ELBA 2Z0PA 5I2SA 2E2XA 5C6RA 3OANA 1X1FA 3TW1A 1UPQA 1IRSA 3ODWA 1SGHA 2AL6A 2N23A 5HE3A 3O96A 5JLJB 2MDXA 1M7EA 1RRPB 2P0HA 4HAWB 1Q67A 1UEFA 2LOZA 1ZM0A 2RNRB 4ZRIA 2W2XC 2PZ1A 3A58A 1ZC3B 1W1HA 2VKIA 4GOUA 1WG7A 1V5PA 1BAKA 2CRFA 1KZGA 3KY9A 5KQ1A 3GYOA 4EKUA 1DROA 1U5FA 3FM8C 4IAPA 5DIFB 3DXDA 3KRWA 3HQCA 2X18A 3T06A 1XKEA 2W2XD 1SHCA 1LW3A 2ROVA 3U8ZA 3NSUA 2D11A 1I2HA 1H10A 3SO6A 2Q13A 5I2MA 1PMSA 2D9WA 2NBVA 2YS1A 2I1JA 4DIXA 2BCJA 4BBKA 4OSNA 2CY5A 1FHXA 3AU5A 5CLLB 2Z13A 3SYXA 2DYNA 1U27A 4A5KA 2H7DA 4HDQA 3ULCA 5JP4A 1EF1A 5C5BA 4HHVA 2W2WA 4HAUB 2NMBA 5DH9B 1FGZA 2ROZB 3NWFA 3ODOA 2MWNB 3ZVRA 2ZKMX 2DA0A 3KRXA 2AEHA 3UZTA 4A6HA 1BTKA 4Y94A 4KVGB 3VOQA 2G35A 4F7GA 3KSYA 5J3TA 4K2PA 4KHBB 1H4RA 2EMTA 4DXAB 1WI1A 2LG1A 2J59M 5IRSA 2VSZA 4HB2B 1WJ1A 2D9YA 3FSSA 2RLOA 1OY2A 3PG7A 1PLSA 1EGXA 2YS5A 1BWNA 3VIAA 4HB4B 4EJNA 5LOPB 4KHAA 4KHBA 4D6WA 2Y7BA 2Z59A 1Y5OA 4GZUA 3F5RA 3KZ1A 4NY0A 2KUPA 3D8DA 1TQZA 1WVHA 2CAYA 1OMWA 2L2IA 5D27A 3TVVA 2DKPA 3BJIA 2DYQA 5L81A 1KZ7A 1PFJA 2P8VA 2YF0A 1XCGA 1ZVRA 1P3RA 2D9ZA 2DHJA 4QJ4B 2KIEA 2FJUB 1X1GA 4A6FB 5LONB 1P5TA 5D3XA 1U5GA 1V89A 2UVMA 3A8QA 4CHJA 2KIGA 4A6KA 1GC7A 2KGXB 2RVBB 3HSAA 4CHMA 1W1GA 1ZC4B 3SUZA 1EVHA 1W1DA 1V5UA 1XD4A 4P7IA 1BTNA 2OTXA 3P7ZA 5D3VA 2ZPYA 1KI1B 2K8EA 1XODA 3WYFB 5J3YA 4DBBA 2I1KA 3U12A 4IOYX 1UNQA 1UNRA 1X05A 2ELAA 2MFQA 1UPRA 2RSGA 4QXAB 5DHFB 3DCXA 3NWDA 4C0AA 5JHHA 5C16A 4NSWA 4K2OA 4HAYB 4KAXB 3CIKA 3ML4A 3FEHA 5JHGA 2I5FA 2GS0A 4HAXB 5D3YA 2J0JA 4ZRKA 2UZSA 2Y8GA 2K49A 1N3HA 2DFKA 2I5CA 5D3WA 3FVCA 1MPHA 3N7CA 4CSQA 3SNHA 2D4QA 3A98B 1MK9B 1MK7B 2EC1A 2RGNB 4L1RA 2EJ8A 2R09A 2UZRA 2OQBA 1ZYIA 2GUMA 4L6EA 5LG4B 3PSCA 1TJ6A 3BINA 1QQGA 2K2JA 2YT0A 1OQNA 2DX5A 4GMXB 5J3QA 4HB3B 1I7AA 1K5GB 1WJMA 2COAA 2YT2A 1MKEA 1X11A 1MAIA 2R2YA 1AWEA 1X86A 3B77A 4HAVB 2V76A 1RJ2A 2N0YA 4WSFA 4H8SA 3PEGA 2LULA 1ISNA 1AQCA 2P0DA 2D9XA 2FJLA 4EMOA 2HE7A 2NZ8B 3TFMA 1FOEA 3D8FA 3HIEA 3HW2B 5C5BB 4WVFB 1J0WA 2M38A 2MKRA 4Z2NA 3MDBC 2DHIA 1FHOA 2VRWB 2QKMA 1U2BA 3CXBB 5M4YB 3WA0A 2J0MA 4QJ3B 1WGQA 4F7UP 4Z2MB 4QJ5B 1NTVA 4GPTB 4YL8A 5GOWB 1DBHA 1GC6A 2R0DA 4F7HA 3D8EA 2L1CA 3A8PA 2DKQA 1FHWA 2H7EA 5KQ4A 4OT1A 3PZDA 2DX1A 4D0NB 1UNPA 3F0WA 2Z0OA 3GYPA 2J0KA 3PP2A 4KHOA 2DTCA 3QIJA 2KR0A 2YRYA 4IFSA 3SV1A 3LJUX 4GMVA 1U5EA 3NWAA 2D2QA 4DX8A 2HTHB 1B55A 5C79A 2EMSA 1FB8A 4XWXA 2DLWA 1MI1A 1V61A 4A6FA 2D9VA 1Z87A
chains in the Genus database with same CATH topology
3P6AA 1WGUA 2JP2A 4HATB 2CODA 2LOXA 4DX90 1DYNA 2COFA 3DXCA 3ULBA 1EAZA 3IVFA 4B6HA 3AJ4A 3TO1A 4GN1A 5DHAB 2COCA 4TYZA 1DDVA 1DDMA 3AU4A 2KCJA 1NU2A 3QWMA 1XX0A 3RCPA 2LYDA 1MIXA 3DXEA 1FAOA 1E5WA 1GG3A 2GJYA 2XQNM 5HE2A 4HB0B 2Z0QA 1ZSQA 4YONA 2ADZA 1NI2A 3ZDTA 3G9WA 5FI0A 2IFSA 2DHKA 2M14A 1NTYA 2RUKB 1LB1A 2IYBA 4K81A 1FGYA 3PVLA 2Y8FA 3QBVB 4K17A 5HE0A 4HDOA 4PNKA 1MIZB 1TXDA 3TCAA 4ZRJA 3PVWA 5EFXA 4CYEA 2D10A 4HAZB 2GCJA 2LKOA 4WJ7A 2K2UA 1M7RA 5KCVA 5FI1A 2YS3A 2YVCA 2K00A 3M1IB 2DN6A 3ODXA 4TKNA 4MT7A 5CLQB 2P0FA 5DI9B 2YT1A 1U5DA 2YSZA 1QC6A 1J19A 1P6SA 5HE1A 4PQ0A 4MY6A 1DDWA 2QKLA 4GXBA 1V5MA 1XR0B 2CY4A 3V5WA 1U29A 1Y19B 3MPXA 3X23A 4MK0A 2GCLA 1V88A 1K5DB 3HK0A 3PVUA 3U7DA 2ELBA 2Z0PA 2E2XA 5C6RA 3OANA 1X1FA 3TW1A 1UPQA 1IRSA 3ODWA 1SGHA 2AL6A 2N23A 5HE3A 3O96A 5JLJB 2MDXA 1M7EA 1RRPB 2P0HA 4HAWB 1Q67A 1UEFA 2LOZA 1ZM0A 2RNRB 4ZRIA 2W2XC 2PZ1A 1ZC3B 1W1HA 2VKIA 1WG7A 1V5PA 1BAKA 2CRFA 1KZGA 3KY9A 5KQ1A 3GYOA 4EKUA 1DROA 1U5FA 3FM8C 4IAPA 5DIFB 3DXDA 3KRWA 3HQCA 2X18A 3T06A 1XKEA 2W2XD 1SHCA 1LW3A 2ROVA 3U8ZA 3NSUA 2D11A 1I2HA 1H10A 3SO6A 2Q13A 1PMSA 2D9WA 2YS1A 2I1JA 2BCJA 4BBKA 2CY5A 1FHXA 3AU5A 5CLLB 3SYXA 2DYNA 1U27A 4A5KA 2H7DA 4HDQA 3ULCA 5JP4A 1EF1A 5C5BA 4HHVA 2W2WA 4HAUB 2NMBA 5DH9B 1FGZA 2ROZB 3ODOA 2MWNB 3ZVRA 2DA0A 3KRXA 2AEHA 3UZTA 4A6HA 1BTKA 4Y94A 4KVGB 3VOQA 2G35A 4F7GA 3KSYA 5J3TA 4K2PA 4KHBB 1H4RA 2EMTA 4DXAB 1WI1A 2LG1A 2J59M 2VSZA 4HB2B 1WJ1A 2D9YA 3FSSA 2RLOA 1OY2A 3PG7A 1PLSA 1EGXA 2YS5A 1BWNA 3VIAA 4HB4B 4EJNA 5LOPB 4KHAA 2Y7BA 1Y5OA 4GZUA 3F5RA 3KZ1A 4NY0A 2KUPA 3D8DA 1TQZA 1WVHA 2CAYA 1OMWA 2L2IA 5D27A 3TVVA 2DKPA 3BJIA 2DYQA 5L81A 1KZ7A 1PFJA 2P8VA 2YF0A 1XCGA 1ZVRA 1P3RA 2D9ZA 2DHJA 1X1GA 4A6FB 5LONB 1P5TA 5D3XA 1U5GA 1V89A 2UVMA 3A8QA 4CHJA 4A6KA 1GC7A 2KGXB 2RVBB 4CHMA 1W1GA 1ZC4B 3SUZA 1EVHA 1W1DA 1V5UA 1XD4A 4P7IA 1BTNA 2OTXA 3P7ZA 5D3VA 2ZPYA 1KI1B 1XODA 3WYFB 5J3YA 4DBBA 2I1KA 4IOYX 1UNQA 1UNRA 1X05A 2ELAA 2MFQA 1UPRA 2RSGA 5DHFB 4C0AA 5JHHA 5C16A 4NSWA 4K2OA 4HAYB 4KAXB 3CIKA 3ML4A 3FEHA 5JHGA 2I5FA 2GS0A 4HAXB 5D3YA 2J0JA 4ZRKA 2UZSA 2Y8GA 1N3HA 2DFKA 2I5CA 5D3WA 1MPHA 3N7CA 3SNHA 2D4QA 3A98B 1MK9B 1MK7B 2EC1A 2RGNB 2EJ8A 2R09A 2UZRA 2OQBA 4L6EA 3PSCA 1TJ6A 3BINA 1QQGA 2K2JA 2YT0A 1OQNA 2DX5A 4GMXB 5J3QA 4HB3B 1I7AA 1K5GB 1WJMA 2COAA 1MKEA 1X11A 1MAIA 1AWEA 1X86A 4HAVB 2V76A 1RJ2A 2N0YA 4WSFA 4H8SA 3PEGA 2LULA 1ISNA 1AQCA 2P0DA 2D9XA 2FJLA 4EMOA 2HE7A 2NZ8B 3TFMA 1FOEA 3D8FA 3HW2B 5C5BB 4WVFB 1J0WA 2M38A 2MKRA 4Z2NA 3MDBC 2DHIA 1FHOA 2VRWB 2QKMA 1U2BA 3CXBB 3WA0A 2J0MA 1WGQA 4F7UP 4Z2MB 1NTVA 4GPTB 4YL8A 5GOWB 1DBHA 1GC6A 2R0DA 4F7HA 3D8EA 2L1CA 3A8PA 2DKQA 1FHWA 2H7EA 5KQ4A 3PZDA 2DX1A 4D0NB 1UNPA 3F0WA 2Z0OA 3GYPA 2J0KA 3PP2A 4KHOA 2DTCA 3QIJA 2YRYA 4IFSA 3SV1A 3LJUX 4GMVA 1U5EA 2D2QA 4DX8A 2HTHB 1B55A 5C79A 2EMSA 1FB8A 4XWXA 2DLWA 1V61A 4A6FA 2D9VA 1Z87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P6A A;  1WGU A;  2JP2 A;  4HAT B;  2COD A;  2LOX A;  4DX9 0;  1DYN A;  2COF A;  3DXC A;  3ULB A;  1EAZ A;  3IVF A;  4B6H A;  3AJ4 A;  3TO1 A;  4GN1 A;  5DHA B;  2COC A;  4TYZ A;  1DDV A;  1DDM A;  3AU4 A;  2KCJ A;  1NU2 A;  3QWM A;  1XX0 A;  3RCP A;  2LYD A;  1MIX A;  3DXE A;  1FAO A;  1E5W A;  1GG3 A;  2GJY A;  2XQN M;  5HE2 A;  4HB0 B;  2Z0Q A;  1ZSQ A;  4YON A;  2ADZ A;  1NI2 A;  3ZDT A;  3G9W A;  5FI0 A;  2IFS A;  2DHK A;  2M14 A;  1NTY A;  2RUK B;  1LB1 A;  2IYB A;  4K81 A;  1FGY A;  3PVL A;  2Y8F A;  3QBV B;  4K17 A;  5HE0 A;  4HDO A;  4PNK A;  1MIZ B;  1TXD A;  3TCA A;  4ZRJ A;  3PVW A;  5EFX A;  4CYE A;  2D10 A;  4HAZ B;  2GCJ A;  2LKO A;  4WJ7 A;  2K2U A;  1M7R A;  5KCV A;  5FI1 A;  2YS3 A;  2YVC A;  2K00 A;  3M1I B;  2DN6 A;  3ODX A;  4TKN A;  4MT7 A;  5CLQ B;  2P0F A;  5DI9 B;  2YT1 A;  1U5D A;  2YSZ A;  1QC6 A;  1J19 A;  1P6S A;  5HE1 A;  4PQ0 A;  4MY6 A;  1DDW A;  2QKL A;  4GXB A;  1V5M A;  1XR0 B;  2CY4 A;  3V5W A;  1U29 A;  1Y19 B;  3MPX A;  3X23 A;  4MK0 A;  2GCL A;  1V88 A;  1K5D B;  3HK0 A;  3PVU A;  3U7D A;  2ELB A;  2Z0P A;  2E2X A;  5C6R A;  3OAN A;  1X1F A;  3TW1 A;  1UPQ A;  1IRS A;  3ODW A;  1SGH A;  2AL6 A;  2N23 A;  5HE3 A;  3O96 A;  5JLJ B;  2MDX A;  1M7E A;  1RRP B;  2P0H A;  4HAW B;  1Q67 A;  1UEF A;  2LOZ A;  1ZM0 A;  2RNR B;  4ZRI A;  2W2X C;  2PZ1 A;  1ZC3 B;  1W1H A;  2VKI A;  1WG7 A;  1V5P A;  1BAK A;  2CRF A;  1KZG A;  3KY9 A;  5KQ1 A;  3GYO A;  4EKU A;  1DRO A;  1U5F A;  3FM8 C;  4IAP A;  5DIF B;  3DXD A;  3KRW A;  3HQC A;  2X18 A;  3T06 A;  1XKE A;  2W2X D;  1SHC A;  1LW3 A;  2ROV A;  3U8Z A;  3NSU A;  2D11 A;  1I2H A;  1H10 A;  3SO6 A;  2Q13 A;  1PMS A;  2D9W A;  2YS1 A;  2I1J A;  2BCJ A;  4BBK A;  2CY5 A;  1FHX A;  3AU5 A;  5CLL B;  3SYX A;  2DYN A;  1U27 A;  4A5K A;  2H7D A;  4HDQ A;  3ULC A;  5JP4 A;  1EF1 A;  5C5B A;  4HHV A;  2W2W A;  4HAU B;  2NMB A;  5DH9 B;  1FGZ A;  2ROZ B;  3ODO A;  2MWN B;  3ZVR A;  2DA0 A;  3KRX A;  2AEH A;  3UZT A;  4A6H A;  1BTK A;  4Y94 A;  4KVG B;  3VOQ A;  2G35 A;  4F7G A;  3KSY A;  5J3T A;  4K2P A;  4KHB B;  1H4R A;  2EMT A;  4DXA B;  1WI1 A;  2LG1 A;  2J59 M;  2VSZ A;  4HB2 B;  1WJ1 A;  2D9Y A;  3FSS A;  2RLO A;  1OY2 A;  3PG7 A;  1PLS A;  1EGX A;  2YS5 A;  1BWN A;  3VIA A;  4HB4 B;  4EJN A;  5LOP B;  4KHA A;  2Y7B A;  1Y5O A;  4GZU A;  3F5R A;  3KZ1 A;  4NY0 A;  2KUP A;  3D8D A;  1TQZ A;  1WVH A;  2CAY A;  1OMW A;  2L2I A;  5D27 A;  3TVV A;  2DKP A;  3BJI A;  2DYQ A;  5L81 A;  1KZ7 A;  1PFJ A;  2P8V A;  2YF0 A;  1XCG A;  1ZVR A;  1P3R A;  2D9Z A;  2DHJ A;  1X1G A;  4A6F B;  5LON B;  1P5T A;  5D3X A;  1U5G A;  1V89 A;  2UVM A;  3A8Q A;  4CHJ A;  4A6K A;  1GC7 A;  2KGX B;  2RVB B;  4CHM A;  1W1G A;  1ZC4 B;  3SUZ A;  1EVH A;  1W1D A;  1V5U A;  1XD4 A;  4P7I A;  1BTN A;  2OTX A;  3P7Z A;  5D3V A;  2ZPY A;  1KI1 B;  1XOD A;  3WYF B;  5J3Y A;  4DBB A;  2I1K A;  4IOY X;  1UNQ A;  1UNR A;  1X05 A;  2ELA A;  2MFQ A;  1UPR A;  2RSG A;  5DHF B;  4C0A A;  5JHH A;  5C16 A;  4NSW A;  4K2O A;  4HAY B;  4KAX B;  3CIK A;  3ML4 A;  3FEH A;  5JHG A;  2I5F A;  2GS0 A;  4HAX B;  5D3Y A;  2J0J A;  4ZRK A;  2UZS A;  2Y8G A;  1N3H A;  2DFK A;  2I5C A;  5D3W A;  1MPH A;  3N7C A;  3SNH A;  2D4Q A;  3A98 B;  1MK9 B;  1MK7 B;  2EC1 A;  2RGN B;  2EJ8 A;  2R09 A;  2UZR A;  2OQB A;  4L6E A;  3PSC A;  1TJ6 A;  3BIN A;  1QQG A;  2K2J A;  2YT0 A;  1OQN A;  2DX5 A;  4GMX B;  5J3Q A;  4HB3 B;  1I7A A;  1K5G B;  1WJM A;  2COA A;  1MKE A;  1X11 A;  1MAI A;  1AWE A;  1X86 A;  4HAV B;  2V76 A;  1RJ2 A;  2N0Y A;  4WSF A;  4H8S A;  3PEG A;  2LUL A;  1ISN A;  1AQC A;  2P0D A;  2D9X A;  2FJL A;  4EMO A;  2HE7 A;  2NZ8 B;  3TFM A;  1FOE A;  3D8F A;  3HW2 B;  5C5B B;  4WVF B;  1J0W A;  2M38 A;  2MKR A;  4Z2N A;  3MDB C;  2DHI A;  1FHO A;  2VRW B;  2QKM A;  1U2B A;  3CXB B;  3WA0 A;  2J0M A;  1WGQ A;  4F7U P;  4Z2M B;  1NTV A;  4GPT B;  4YL8 A;  5GOW B;  1DBH A;  1GC6 A;  2R0D A;  4F7H A;  3D8E A;  2L1C A;  3A8P A;  2DKQ A;  1FHW A;  2H7E A;  5KQ4 A;  3PZD A;  2DX1 A;  4D0N B;  1UNP A;  3F0W A;  2Z0O A;  3GYP A;  2J0K A;  3PP2 A;  4KHO A;  2DTC A;  3QIJ A;  2YRY A;  4IFS A;  3SV1 A;  3LJU X;  4GMV A;  1U5E A;  2D2Q A;  4DX8 A;  2HTH B;  1B55 A;  5C79 A;  2EMS A;  1FB8 A;  4XWX A;  2DLW A;  1V61 A;  4A6F A;  2D9V A;  1Z87 A; 
#chains in the Genus database with same CATH topology
 3P6A A;  1WGU A;  2JP2 A;  4HAT B;  2COD A;  2LOX A;  4DX9 0;  1DYN A;  4GNK B;  2COF A;  3NW8 A;  3DXC A;  3ULB A;  1EAZ A;  3IVF A;  4B6H A;  3AJ4 A;  3TO1 A;  4GN1 A;  5DHA B;  2COC A;  4TYZ A;  1DDV A;  4HSI A;  2KUQ A;  1DDM A;  3AU4 A;  2KCJ A;  1NU2 A;  3QWM A;  1XX0 A;  3RCP A;  2LYD A;  1MIX A;  3DXE A;  1FAO A;  1E5W A;  1GG3 A;  2GJY A;  2XQN M;  5HE2 A;  4HB0 B;  2Z0Q A;  1ZSQ A;  4YON A;  2ADZ A;  1NI2 A;  2Z14 A;  3ZDT A;  3G9W A;  5FI0 A;  2IFS A;  2DHK A;  1T77 A;  2M14 A;  1NTY A;  2RUK B;  1LB1 A;  2IYB A;  4K81 A;  1FGY A;  3OHM B;  3PVL A;  2Y8F A;  3QBV B;  4K17 A;  5HE0 A;  4HDO A;  4PNK A;  1MIZ B;  1TXD A;  3TCA A;  4ZRJ A;  3PVW A;  5EFX A;  4CYE A;  2D10 A;  4HAZ B;  2GCJ A;  2LKO A;  4WJ7 A;  2K2U A;  1M7R A;  5KCV A;  5FI1 A;  2YS3 A;  2YVC A;  2K00 A;  2RRF A;  3M1I B;  2DN6 A;  3ODX A;  4TKN A;  4MT7 A;  5CLQ B;  2P0F A;  5DI9 B;  2YT1 A;  1U5D A;  2YSZ A;  1QC6 A;  1J19 A;  1P6S A;  5HE1 A;  4PQ0 A;  4MY6 A;  1DDW A;  2QKL A;  4GXB A;  1V5M A;  1XR0 B;  2CY4 A;  3V5W A;  1U29 A;  1Y19 B;  3MPX A;  3X23 A;  4MK0 A;  2GCL A;  1V88 A;  1K5D B;  3HK0 A;  3PVU A;  2Z4D A;  3U7D A;  2ELB A;  2Z0P A;  5I2S A;  2E2X A;  5C6R A;  3OAN A;  1X1F A;  3TW1 A;  1UPQ A;  1IRS A;  3ODW A;  1SGH A;  2AL6 A;  2N23 A;  5HE3 A;  3O96 A;  5JLJ B;  2MDX A;  1M7E A;  1RRP B;  2P0H A;  4HAW B;  1Q67 A;  1UEF A;  2LOZ A;  1ZM0 A;  2RNR B;  4ZRI A;  2W2X C;  2PZ1 A;  3A58 A;  1ZC3 B;  1W1H A;  2VKI A;  4GOU A;  1WG7 A;  1V5P A;  1BAK A;  2CRF A;  1KZG A;  3KY9 A;  5KQ1 A;  3GYO A;  4EKU A;  1DRO A;  1U5F A;  3FM8 C;  4IAP A;  5DIF B;  3DXD A;  3KRW A;  3HQC A;  2X18 A;  3T06 A;  1XKE A;  2W2X D;  1SHC A;  1LW3 A;  2ROV A;  3U8Z A;  3NSU A;  2D11 A;  1I2H A;  1H10 A;  3SO6 A;  2Q13 A;  5I2M A;  1PMS A;  2D9W A;  2NBV A;  2YS1 A;  2I1J A;  4DIX A;  2BCJ A;  4BBK A;  4OSN A;  2CY5 A;  1FHX A;  3AU5 A;  5CLL B;  2Z13 A;  3SYX A;  2DYN A;  1U27 A;  4A5K A;  2H7D A;  4HDQ A;  3ULC A;  5JP4 A;  1EF1 A;  5C5B A;  4HHV A;  2W2W A;  4HAU B;  2NMB A;  5DH9 B;  1FGZ A;  2ROZ B;  3NWF A;  3ODO A;  2MWN B;  3ZVR A;  2ZKM X;  2DA0 A;  3KRX A;  2AEH A;  3UZT A;  4A6H A;  1BTK A;  4Y94 A;  4KVG B;  3VOQ A;  2G35 A;  4F7G A;  3KSY A;  5J3T A;  4K2P A;  4KHB B;  1H4R A;  2EMT A;  4DXA B;  1WI1 A;  2LG1 A;  2J59 M;  5IRS A;  2VSZ A;  4HB2 B;  1WJ1 A;  2D9Y A;  3FSS A;  2RLO A;  1OY2 A;  3PG7 A;  1PLS A;  1EGX A;  2YS5 A;  1BWN A;  3VIA A;  4HB4 B;  4EJN A;  5LOP B;  4KHA A;  4KHB A;  4D6W A;  2Y7B A;  2Z59 A;  1Y5O A;  4GZU A;  3F5R A;  3KZ1 A;  4NY0 A;  2KUP A;  3D8D A;  1TQZ A;  1WVH A;  2CAY A;  1OMW A;  2L2I A;  5D27 A;  3TVV A;  2DKP A;  3BJI A;  2DYQ A;  5L81 A;  1KZ7 A;  1PFJ A;  2P8V A;  2YF0 A;  1XCG A;  1ZVR A;  1P3R A;  2D9Z A;  2DHJ A;  4QJ4 B;  2KIE A;  2FJU B;  1X1G A;  4A6F B;  5LON B;  1P5T A;  5D3X A;  1U5G A;  1V89 A;  2UVM A;  3A8Q A;  4CHJ A;  2KIG A;  4A6K A;  1GC7 A;  2KGX B;  2RVB B;  3HSA A;  4CHM A;  1W1G A;  1ZC4 B;  3SUZ A;  1EVH A;  1W1D A;  1V5U A;  1XD4 A;  4P7I A;  1BTN A;  2OTX A;  3P7Z A;  5D3V A;  2ZPY A;  1KI1 B;  2K8E A;  1XOD A;  3WYF B;  5J3Y A;  4DBB A;  2I1K A;  3U12 A;  4IOY X;  1UNQ A;  1UNR A;  1X05 A;  2ELA A;  2MFQ A;  1UPR A;  2RSG A;  4QXA B;  5DHF B;  3DCX A;  3NWD A;  4C0A A;  5JHH A;  5C16 A;  4NSW A;  4K2O A;  4HAY B;  4KAX B;  3CIK A;  3ML4 A;  3FEH A;  5JHG A;  2I5F A;  2GS0 A;  4HAX B;  5D3Y A;  2J0J A;  4ZRK A;  2UZS A;  2Y8G A;  2K49 A;  1N3H A;  2DFK A;  2I5C A;  5D3W A;  3FVC A;  1MPH A;  3N7C A;  4CSQ A;  3SNH A;  2D4Q A;  3A98 B;  1MK9 B;  1MK7 B;  2EC1 A;  2RGN B;  4L1R A;  2EJ8 A;  2R09 A;  2UZR A;  2OQB A;  1ZYI A;  2GUM A;  4L6E A;  5LG4 B;  3PSC A;  1TJ6 A;  3BIN A;  1QQG A;  2K2J A;  2YT0 A;  1OQN A;  2DX5 A;  4GMX B;  5J3Q A;  4HB3 B;  1I7A A;  1K5G B;  1WJM A;  2COA A;  2YT2 A;  1MKE A;  1X11 A;  1MAI A;  2R2Y A;  1AWE A;  1X86 A;  3B77 A;  4HAV B;  2V76 A;  1RJ2 A;  2N0Y A;  4WSF A;  4H8S A;  3PEG A;  2LUL A;  1ISN A;  1AQC A;  2P0D A;  2D9X A;  2FJL A;  4EMO A;  2HE7 A;  2NZ8 B;  3TFM A;  1FOE A;  3D8F A;  3HIE A;  3HW2 B;  5C5B B;  4WVF B;  1J0W A;  2M38 A;  2MKR A;  4Z2N A;  3MDB C;  2DHI A;  1FHO A;  2VRW B;  2QKM A;  1U2B A;  3CXB B;  5M4Y B;  3WA0 A;  2J0M A;  4QJ3 B;  1WGQ A;  4F7U P;  4Z2M B;  4QJ5 B;  1NTV A;  4GPT B;  4YL8 A;  5GOW B;  1DBH A;  1GC6 A;  2R0D A;  4F7H A;  3D8E A;  2L1C A;  3A8P A;  2DKQ A;  1FHW A;  2H7E A;  5KQ4 A;  4OT1 A;  3PZD A;  2DX1 A;  4D0N B;  1UNP A;  3F0W A;  2Z0O A;  3GYP A;  2J0K A;  3PP2 A;  4KHO A;  2DTC A;  3QIJ A;  2KR0 A;  2YRY A;  4IFS A;  3SV1 A;  3LJU X;  4GMV A;  1U5E A;  3NWA A;  2D2Q A;  4DX8 A;  2HTH B;  1B55 A;  5C79 A;  2EMS A;  1FB8 A;  4XWX A;  2DLW A;  1MI1 A;  1V61 A;  4A6F A;  2D9V A;  1Z87 A; 
#chains in the Genus database with same CATH homology
 3P6A A;  1WGU A;  2JP2 A;  4HAT B;  2COD A;  2LOX A;  4DX9 0;  1DYN A;  2COF A;  3DXC A;  3ULB A;  1EAZ A;  3IVF A;  4B6H A;  3AJ4 A;  3TO1 A;  4GN1 A;  5DHA B;  2COC A;  4TYZ A;  1DDV A;  1DDM A;  3AU4 A;  2KCJ A;  1NU2 A;  3QWM A;  1XX0 A;  3RCP A;  2LYD A;  1MIX A;  3DXE A;  1FAO A;  1E5W A;  1GG3 A;  2GJY A;  2XQN M;  5HE2 A;  4HB0 B;  2Z0Q A;  1ZSQ A;  4YON A;  2ADZ A;  1NI2 A;  3ZDT A;  3G9W A;  5FI0 A;  2IFS A;  2DHK A;  2M14 A;  1NTY A;  2RUK B;  1LB1 A;  2IYB A;  4K81 A;  1FGY A;  3PVL A;  2Y8F A;  3QBV B;  4K17 A;  5HE0 A;  4HDO A;  4PNK A;  1MIZ B;  1TXD A;  3TCA A;  4ZRJ A;  3PVW A;  5EFX A;  4CYE A;  2D10 A;  4HAZ B;  2GCJ A;  2LKO A;  4WJ7 A;  2K2U A;  1M7R A;  5KCV A;  5FI1 A;  2YS3 A;  2YVC A;  2K00 A;  3M1I B;  2DN6 A;  3ODX A;  4TKN A;  4MT7 A;  5CLQ B;  2P0F A;  5DI9 B;  2YT1 A;  1U5D A;  2YSZ A;  1QC6 A;  1J19 A;  1P6S A;  5HE1 A;  4PQ0 A;  4MY6 A;  1DDW A;  2QKL A;  4GXB A;  1V5M A;  1XR0 B;  2CY4 A;  3V5W A;  1U29 A;  1Y19 B;  3MPX A;  3X23 A;  4MK0 A;  2GCL A;  1V88 A;  1K5D B;  3HK0 A;  3PVU A;  3U7D A;  2ELB A;  2Z0P A;  2E2X A;  5C6R A;  3OAN A;  1X1F A;  3TW1 A;  1UPQ A;  1IRS A;  3ODW A;  1SGH A;  2AL6 A;  2N23 A;  5HE3 A;  3O96 A;  5JLJ B;  2MDX A;  1M7E A;  1RRP B;  2P0H A;  4HAW B;  1Q67 A;  1UEF A;  2LOZ A;  1ZM0 A;  2RNR B;  4ZRI A;  2W2X C;  2PZ1 A;  1ZC3 B;  1W1H A;  2VKI A;  1WG7 A;  1V5P A;  1BAK A;  2CRF A;  1KZG A;  3KY9 A;  5KQ1 A;  3GYO A;  4EKU A;  1DRO A;  1U5F A;  3FM8 C;  4IAP A;  5DIF B;  3DXD A;  3KRW A;  3HQC A;  2X18 A;  3T06 A;  1XKE A;  2W2X D;  1SHC A;  1LW3 A;  2ROV A;  3U8Z A;  3NSU A;  2D11 A;  1I2H A;  1H10 A;  3SO6 A;  2Q13 A;  1PMS A;  2D9W A;  2YS1 A;  2I1J A;  2BCJ A;  4BBK A;  2CY5 A;  1FHX A;  3AU5 A;  5CLL B;  3SYX A;  2DYN A;  1U27 A;  4A5K A;  2H7D A;  4HDQ A;  3ULC A;  5JP4 A;  1EF1 A;  5C5B A;  4HHV A;  2W2W A;  4HAU B;  2NMB A;  5DH9 B;  1FGZ A;  2ROZ B;  3ODO A;  2MWN B;  3ZVR A;  2DA0 A;  3KRX A;  2AEH A;  3UZT A;  4A6H A;  1BTK A;  4Y94 A;  4KVG B;  3VOQ A;  2G35 A;  4F7G A;  3KSY A;  5J3T A;  4K2P A;  4KHB B;  1H4R A;  2EMT A;  4DXA B;  1WI1 A;  2LG1 A;  2J59 M;  2VSZ A;  4HB2 B;  1WJ1 A;  2D9Y A;  3FSS A;  2RLO A;  1OY2 A;  3PG7 A;  1PLS A;  1EGX A;  2YS5 A;  1BWN A;  3VIA A;  4HB4 B;  4EJN A;  5LOP B;  4KHA A;  2Y7B A;  1Y5O A;  4GZU A;  3F5R A;  3KZ1 A;  4NY0 A;  2KUP A;  3D8D A;  1TQZ A;  1WVH A;  2CAY A;  1OMW A;  2L2I A;  5D27 A;  3TVV A;  2DKP A;  3BJI A;  2DYQ A;  5L81 A;  1KZ7 A;  1PFJ A;  2P8V A;  2YF0 A;  1XCG A;  1ZVR A;  1P3R A;  2D9Z A;  2DHJ A;  1X1G A;  4A6F B;  5LON B;  1P5T A;  5D3X A;  1U5G A;  1V89 A;  2UVM A;  3A8Q A;  4CHJ A;  4A6K A;  1GC7 A;  2KGX B;  2RVB B;  4CHM A;  1W1G A;  1ZC4 B;  3SUZ A;  1EVH A;  1W1D A;  1V5U A;  1XD4 A;  4P7I A;  1BTN A;  2OTX A;  3P7Z A;  5D3V A;  2ZPY A;  1KI1 B;  1XOD A;  3WYF B;  5J3Y A;  4DBB A;  2I1K A;  4IOY X;  1UNQ A;  1UNR A;  1X05 A;  2ELA A;  2MFQ A;  1UPR A;  2RSG A;  5DHF B;  4C0A A;  5JHH A;  5C16 A;  4NSW A;  4K2O A;  4HAY B;  4KAX B;  3CIK A;  3ML4 A;  3FEH A;  5JHG A;  2I5F A;  2GS0 A;  4HAX B;  5D3Y A;  2J0J A;  4ZRK A;  2UZS A;  2Y8G A;  1N3H A;  2DFK A;  2I5C A;  5D3W A;  1MPH A;  3N7C A;  3SNH A;  2D4Q A;  3A98 B;  1MK9 B;  1MK7 B;  2EC1 A;  2RGN B;  2EJ8 A;  2R09 A;  2UZR A;  2OQB A;  4L6E A;  3PSC A;  1TJ6 A;  3BIN A;  1QQG A;  2K2J A;  2YT0 A;  1OQN A;  2DX5 A;  4GMX B;  5J3Q A;  4HB3 B;  1I7A A;  1K5G B;  1WJM A;  2COA A;  1MKE A;  1X11 A;  1MAI A;  1AWE A;  1X86 A;  4HAV B;  2V76 A;  1RJ2 A;  2N0Y A;  4WSF A;  4H8S A;  3PEG A;  2LUL A;  1ISN A;  1AQC A;  2P0D A;  2D9X A;  2FJL A;  4EMO A;  2HE7 A;  2NZ8 B;  3TFM A;  1FOE A;  3D8F A;  3HW2 B;  5C5B B;  4WVF B;  1J0W A;  2M38 A;  2MKR A;  4Z2N A;  3MDB C;  2DHI A;  1FHO A;  2VRW B;  2QKM A;  1U2B A;  3CXB B;  3WA0 A;  2J0M A;  1WGQ A;  4F7U P;  4Z2M B;  1NTV A;  4GPT B;  4YL8 A;  5GOW B;  1DBH A;  1GC6 A;  2R0D A;  4F7H A;  3D8E A;  2L1C A;  3A8P A;  2DKQ A;  1FHW A;  2H7E A;  5KQ4 A;  3PZD A;  2DX1 A;  4D0N B;  1UNP A;  3F0W A;  2Z0O A;  3GYP A;  2J0K A;  3PP2 A;  4KHO A;  2DTC A;  3QIJ A;  2YRY A;  4IFS A;  3SV1 A;  3LJU X;  4GMV A;  1U5E A;  2D2Q A;  4DX8 A;  2HTH B;  1B55 A;  5C79 A;  2EMS A;  1FB8 A;  4XWX A;  2DLW A;  1V61 A;  4A6F A;  2D9V A;  1Z87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...