1X05A

Solution structure of the c-terminal ph domain of human pleckstrin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
129
structure length
129
Chain Sequence
GSSGSSGVILKEEFRGVIIKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGAEDPLGAIHLRGCVVTSVESNSNGRKSEEENLFEIITADEVHYFLQAATPKERTEWIKAIQMASRTGKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Pleckstrin
publication title Solution structure of the C-terminal PH domain of human pleckstrin
rcsb
source organism Homo sapiens
total genus 15
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2005-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1x05A00
1MK7B 4K2OA 1MIZB 2D9WA 3OANA 2CY5A 2EC1A 1P6SA 4HB4B 1IRSA 2NZ8B 5CLQB 1BAKA 1LW3A 4A6KA 1DDWA 1FB8A 1ZVRA 2J0KA 2KUPA 2MWNB 1FGZA 1GC7A 1FHXA 2Z0QA 4GMXB 2GS0A 2D11A 1WVHA 3N7CA 4IOYX 1V5MA 2Z0OA 1OMWA 1U5FA 3CXBB 1KZ7A 2RGNB 4K17A 5DI9B 1WGUA 4L6EA 2COFA 1TXDA 1X1GA 1PMSA 1KZGA 4HB0B 1K5GB 5JLJB 2P0HA 2DHKA 3QWMA 4HAVB 2VSZA 1LB1A 5DIFB 2J0MA 1UNRA 3ODWA 2YS5A 3SV1A 5HE1A 2ADZA 3A8PA 2HTHB 5J3QA 3AJ4A 1WGQA 3QBVB 5LONB 4KVGB 2DN6A 3GYPA 1FAOA 3SNHA 3PG7A 2GCLA 1NTVA 2CRFA 2CODA 1OY2A 1RJ2A 1BTKA 4DX8A 1ZM0A 2D9ZA 2UZRA 5KCVA 1U27A 4EKUA 3TVVA 3ULBA 5KQ4A 2G35A 3PVUA 3MPXA 1WG7A 1Y19B 1RRPB 1UEFA 3T06A 1FOEA 1X05A 1DROA 4Y94A 2DFKA 5HE2A 4D0NB 3PP2A 3FM8C 4HDOA 5GOWB 3D8DA 5DHAB 2XQNM 2DHJA 4HAXB 4A6FB 2DLWA 4TYZA 1KI1B 2D2QA 4IFSA 1ZC4B 2LULA 2QKMA 5C5BA 1EVHA 1BTNA 4MT7A 4CYEA 1M7RA 3NSUA 1EF1A 1Q67A 2W2WA 4DX90 2E2XA 2JP2A 5L81A 1H10A 4XWXA 2M14A 2W2XD 5D27A 4KAXB 3ULCA 2D4QA 2DX1A 2N0YA 1UNPA 3G9WA 1P5TA 1TQZA 5JP4A 4ZRKA 4IAPA 2M38A 3IVFA 2Y7BA 3O96A 1I7AA 1MKEA 2YS1A 2NMBA 3FEHA 2RNRB 1U2BA 2EJ8A 3AU5A 3SYXA 2COCA 2P0DA 1GC6A 3WYFB 3PZDA 1PFJA 1X1FA 3P6AA 2P8VA 4C0AA 3U7DA 2UZSA 1UPQA 5J3YA 3F0WA 2YF0A 3ZVRA 3UZTA 2VRWB 4Z2NA 3ODXA 4ZRJA 3TCAA 4K81A 4GN1A 2LYDA 4KHAA 3DXDA 5EFXA 5C16A 5C79A 4GZUA 1U5GA 2W2XC 1PLSA 5JHGA 5KQ1A 4HAWB 1MIXA 2R0DA 3PVWA 3VOQA 5JHHA 3ZDTA 1V61A 3TO1A 3ML4A 3HK0A 4H8SA 2FJLA 1W1GA 2L1CA 1E5WA 2ROVA 2P0FA 1XKEA 3RCPA 2COAA 4GMVA 4HB3B 2YRYA 2AEHA 3U8ZA 2PZ1A 1NI2A 4BBKA 1N3HA 1FGYA 2V76A 3AU4A 4DBBA 4HATB 4GPTB 1UNQA 3DXEA 5C6RA 2QKLA 4F7HA 2YT0A 2YVCA 4CHMA 4A5KA 3A98B 4HDQA 5D3XA 2MKRA 3P7ZA 2RSGA 2RLOA 2DKPA 4K2PA 5HE0A 3KRXA 2MDXA 4HB2B 3PSCA 1WJ1A 2EMTA 2D9VA 1P3RA 2GCJA 4TKNA 1OQNA 4MK0A 2D9YA 2ELAA 1J0WA 1V5PA 5C5BB 1B55A 1WJMA 2VKIA 5LOPB 1V5UA 5FI0A 4A6FA 3X23A 3VIAA 2H7EA 1NU2A 1EGXA 1ZC3B 2KGXB 4EJNA 4ZRIA 1U29A 3KSYA 4WVFB 1AQCA 2DYQA 3PVLA 2X18A 3M1IB 3PEGA 3MDBC 4EMOA 2I1JA 2CAYA 2YT1A 4A6HA 2KCJA 2ELBA 2K00A 4PNKA 2RUKB 5DH9B 2HE7A 1GG3A 3LJUX 4KHOA 1BWNA 1Y5OA 3KY9A 3QIJA 5FI1A 4B6HA 5J3TA 3SO6A 4YL8A 3WA0A 2AL6A 2I5FA 1X11A 3HW2B 3D8FA 1QQGA 2ZPYA 1J19A 1H4RA 2MFQA 4NY0A 4NSWA 2OQBA 1W1DA 5D3YA 1UPRA 2DHIA 1TJ6A 4KHBB 2YSZA 2K2JA 1ISNA 4PQ0A 2Q13A 2GJYA 2DX5A 1XR0B 2L2IA 1DDVA 3A8QA 5D3WA 2K2UA 1XODA 2I1KA 2LG1A 2I5CA 1M7EA 1MAIA 3CIKA 3GYOA 4CHJA 2R09A 1EAZA 2IFSA 1QC6A 1XD4A 3BJIA 1K5DB 1AWEA 5HE3A 4MY6A 1I2HA 2D9XA 3KZ1A 3F5RA 2J0JA 2OTXA 1U5EA 1FHOA 2EMSA 2DA0A 3FSSA 2IYBA 1WI1A 1SHCA 4HHVA 4F7UP 1ZSQA 3HQCA 3TW1A 1DYNA 2BCJA 2Y8GA 3ODOA 2LOXA 1Z87A 4HAYB 2CY4A 1DBHA 2H7DA 2Z0PA 2J59M 3DXCA 1V89A 4HAUB 2LOZA 4P7IA 3D8EA 1MPHA 4HAZB 2YS3A 4WSFA 1X86A 4YONA 2LKOA 5CLLB 1NTYA 2DYNA 5DHFB 4WJ7A 4Z2MB 2D10A 1V88A 4F7GA 1FHWA 1W1HA 2ROZB 4DXAB 3BINA 2DKQA 2N23A 3SUZA 1U5DA 1XCGA 3V5WA 2RVBB 3TFMA 2UVMA 1DDMA 1SGHA 1XX0A 1MK9B 2Y8FA 5D3VA 4GXBA 3KRWA 2DTCA
chains in the Genus database with same CATH superfamily
4QJ5B 1MK7B 4K2OA 1MIZB 2D9WA 3OANA 4D6WA 2CY5A 2KIEA 2EC1A 1P6SA 4HB4B 3NWDA 1IRSA 2NZ8B 5CLQB 1BAKA 1LW3A 4A6KA 1DDWA 1FB8A 1ZVRA 2J0KA 2KUPA 2MWNB 1FGZA 1GC7A 1FHXA 2Z0QA 3NWFA 5M4YB 4GMXB 2GS0A 2D11A 1WVHA 3N7CA 4IOYX 1V5MA 2Z0OA 1OMWA 1U5FA 3CXBB 1KZ7A 2RGNB 4K17A 5DI9B 4OSNA 1WGUA 4L6EA 2COFA 1TXDA 1X1GA 1PMSA 1KZGA 4HB0B 2R2YA 1K5GB 5JLJB 2P0HA 2DHKA 3QWMA 4HAVB 2VSZA 1LB1A 5DIFB 2J0MA 1UNRA 1T77A 3ODWA 2YS5A 3SV1A 5HE1A 2ADZA 2GUMA 2NBVA 3A8PA 2HTHB 5J3QA 3AJ4A 1WGQA 2Z4DA 3QBVB 5LONB 4KVGB 2DN6A 3GYPA 1FAOA 3SNHA 3PG7A 2GCLA 1NTVA 4QXAB 2CRFA 2CODA 1OY2A 1RJ2A 1BTKA 4DX8A 1ZM0A 2D9ZA 2UZRA 5KCVA 4L1RA 1U27A 4EKUA 2ZKMX 3TVVA 3ULBA 5KQ4A 2G35A 3PVUA 3MPXA 1WG7A 1Y19B 2Z13A 2FJUB 1RRPB 1UEFA 3T06A 5IRSA 1FOEA 1X05A 4HSIA 3FVCA 1DROA 4Y94A 2DFKA 5HE2A 4D0NB 3PP2A 3FM8C 4HDOA 5GOWB 3D8DA 5DHAB 2XQNM 2DHJA 4HAXB 4A6FB 2DLWA 4TYZA 1KI1B 2D2QA 2KUQA 4IFSA 1ZC4B 2LULA 2QKMA 5C5BA 1EVHA 4DIXA 1BTNA 4MT7A 4CYEA 1M7RA 3NSUA 1EF1A 1Q67A 3A58A 2W2WA 4DX90 4QJ4B 2E2XA 2JP2A 5L81A 1H10A 4XWXA 2M14A 2W2XD 5D27A 4KAXB 3ULCA 2D4QA 2DX1A 2N0YA 1UNPA 3G9WA 1P5TA 1TQZA 5JP4A 4ZRKA 4IAPA 2M38A 3IVFA 2Y7BA 3O96A 1I7AA 1MKEA 2YS1A 2NMBA 3FEHA 4OT1A 2RNRB 3OHMB 1U2BA 2EJ8A 3AU5A 3SYXA 2COCA 3HIEA 2P0DA 1GC6A 4GNKB 3WYFB 3PZDA 1PFJA 1X1FA 3P6AA 2P8VA 4C0AA 3U7DA 2UZSA 2K49A 1UPQA 5J3YA 3F0WA 2YF0A 3ZVRA 3UZTA 3U12A 2VRWB 4Z2NA 3ODXA 4ZRJA 3TCAA 4K81A 4GN1A 2LYDA 4KHBA 3DXDA 4KHAA 5EFXA 5C16A 5C79A 4GZUA 1U5GA 2W2XC 1PLSA 5JHGA 3NWAA 5KQ1A 4HAWB 1MIXA 2R0DA 3PVWA 3VOQA 5JHHA 3ZDTA 1V61A 3TO1A 3ML4A 2Z14A 3HK0A 4H8SA 2FJLA 1W1GA 2L1CA 1E5WA 2ROVA 2P0FA 1XKEA 3RCPA 2COAA 4GMVA 4HB3B 2YRYA 2AEHA 2K8EA 3U8ZA 2PZ1A 1NI2A 4BBKA 1N3HA 1FGYA 2V76A 3AU4A 4DBBA 4HATB 4GPTB 1UNQA 3DXEA 5C6RA 2QKLA 4F7HA 2YT0A 2YVCA 4CHMA 4A5KA 3A98B 4HDQA 5D3XA 2MKRA 3P7ZA 2RSGA 5LG4B 2RLOA 2DKPA 4K2PA 5HE0A 3KRXA 2MDXA 4HB2B 3PSCA 1WJ1A 2EMTA 2D9VA 1P3RA 2GCJA 4TKNA 1OQNA 4MK0A 2D9YA 2ELAA 1J0WA 1V5PA 5C5BB 1B55A 4QJ3B 1WJMA 2VKIA 5LOPB 1V5UA 5FI0A 4A6FA 3X23A 3VIAA 2H7EA 1NU2A 1EGXA 1ZC3B 2KGXB 4EJNA 3DCXA 4ZRIA 1U29A 5I2SA 3KSYA 4WVFB 1AQCA 2DYQA 3PVLA 2X18A 3M1IB 3PEGA 3MDBC 4EMOA 2I1JA 2CAYA 2YT1A 2RRFA 5I2MA 4A6HA 2KCJA 2ELBA 2K00A 2KR0A 4PNKA 2RUKB 5DH9B 2HE7A 1GG3A 1MI1A 3LJUX 4KHOA 1BWNA 1Y5OA 3KY9A 3QIJA 5FI1A 3B77A 4B6HA 5J3TA 3SO6A 4YL8A 3WA0A 2AL6A 2I5FA 1X11A 3NW8A 3HW2B 3D8FA 1QQGA 2ZPYA 1J19A 1H4RA 2MFQA 4NY0A 4NSWA 2OQBA 1W1DA 5D3YA 1UPRA 2DHIA 1TJ6A 4KHBB 2YSZA 2K2JA 1ISNA 4PQ0A 2Q13A 2GJYA 2DX5A 1XR0B 2L2IA 1DDVA 3A8QA 5D3WA 2K2UA 1XODA 2I1KA 2LG1A 2I5CA 1M7EA 1MAIA 3CIKA 3GYOA 4CHJA 2R09A 2KIGA 1EAZA 2IFSA 1QC6A 1XD4A 3BJIA 3HSAA 1K5DB 1AWEA 5HE3A 4MY6A 1I2HA 2D9XA 3KZ1A 3F5RA 2J0JA 2YT2A 2OTXA 1U5EA 1FHOA 2EMSA 2DA0A 3FSSA 2IYBA 1WI1A 1SHCA 4HHVA 4F7UP 1ZSQA 3HQCA 3TW1A 1DYNA 2BCJA 2Y8GA 3ODOA 2LOXA 1Z87A 4HAYB 2CY4A 1DBHA 2H7DA 2Z0PA 2J59M 3DXCA 1V89A 4HAUB 2LOZA 4P7IA 3D8EA 1MPHA 4HAZB 2YS3A 4WSFA 1ZYIA 1X86A 4YONA 2LKOA 2Z59A 5CLLB 1NTYA 2DYNA 5DHFB 4WJ7A 4Z2MB 2D10A 1V88A 4GOUA 4F7GA 1FHWA 1W1HA 2ROZB 4DXAB 3BINA 2DKQA 2N23A 3SUZA 1U5DA 1XCGA 3V5WA 2RVBB 3TFMA 4CSQA 2UVMA 1DDMA 1SGHA 1XX0A 1MK9B 2Y8FA 5D3VA 4GXBA 3KRWA 2DTCA
chains in the Genus database with same CATH topology
1MK7B 4K2OA 1MIZB 2D9WA 3OANA 2CY5A 2EC1A 1P6SA 4HB4B 1IRSA 2NZ8B 5CLQB 1BAKA 1LW3A 4A6KA 1DDWA 1FB8A 1ZVRA 2J0KA 2KUPA 2MWNB 1FGZA 1GC7A 1FHXA 2Z0QA 4GMXB 2GS0A 2D11A 1WVHA 3N7CA 4IOYX 1V5MA 2Z0OA 1OMWA 1U5FA 3CXBB 1KZ7A 2RGNB 4K17A 5DI9B 1WGUA 4L6EA 2COFA 1TXDA 1X1GA 1PMSA 1KZGA 4HB0B 1K5GB 5JLJB 2P0HA 2DHKA 3QWMA 4HAVB 2VSZA 1LB1A 5DIFB 2J0MA 1UNRA 3ODWA 2YS5A 3SV1A 5HE1A 2ADZA 3A8PA 2HTHB 5J3QA 3AJ4A 1WGQA 3QBVB 5LONB 4KVGB 2DN6A 3GYPA 1FAOA 3SNHA 3PG7A 2GCLA 1NTVA 2CRFA 2CODA 1OY2A 1RJ2A 1BTKA 4DX8A 1ZM0A 2D9ZA 2UZRA 5KCVA 1U27A 4EKUA 3TVVA 3ULBA 5KQ4A 2G35A 3PVUA 3MPXA 1WG7A 1Y19B 1RRPB 1UEFA 3T06A 1FOEA 1X05A 1DROA 4Y94A 2DFKA 5HE2A 4D0NB 3PP2A 3FM8C 4HDOA 5GOWB 3D8DA 5DHAB 2XQNM 2DHJA 4HAXB 4A6FB 2DLWA 4TYZA 1KI1B 2D2QA 4IFSA 1ZC4B 2LULA 2QKMA 5C5BA 1EVHA 1BTNA 4MT7A 4CYEA 1M7RA 3NSUA 1EF1A 1Q67A 2W2WA 4DX90 2E2XA 2JP2A 5L81A 1H10A 4XWXA 2M14A 2W2XD 5D27A 4KAXB 3ULCA 2D4QA 2DX1A 2N0YA 1UNPA 3G9WA 1P5TA 1TQZA 5JP4A 4ZRKA 4IAPA 2M38A 3IVFA 2Y7BA 3O96A 1I7AA 1MKEA 2YS1A 2NMBA 3FEHA 2RNRB 1U2BA 2EJ8A 3AU5A 3SYXA 2COCA 2P0DA 1GC6A 3WYFB 3PZDA 1PFJA 1X1FA 3P6AA 2P8VA 4C0AA 3U7DA 2UZSA 1UPQA 5J3YA 3F0WA 2YF0A 3ZVRA 3UZTA 2VRWB 4Z2NA 3ODXA 4ZRJA 3TCAA 4K81A 4GN1A 2LYDA 4KHAA 3DXDA 5EFXA 5C16A 5C79A 4GZUA 1U5GA 2W2XC 1PLSA 5JHGA 5KQ1A 4HAWB 1MIXA 2R0DA 3PVWA 3VOQA 5JHHA 3ZDTA 1V61A 3TO1A 3ML4A 3HK0A 4H8SA 2FJLA 1W1GA 2L1CA 1E5WA 2ROVA 2P0FA 1XKEA 3RCPA 2COAA 4GMVA 4HB3B 2YRYA 2AEHA 3U8ZA 2PZ1A 1NI2A 4BBKA 1N3HA 1FGYA 2V76A 3AU4A 4DBBA 4HATB 4GPTB 1UNQA 3DXEA 5C6RA 2QKLA 4F7HA 2YT0A 2YVCA 4CHMA 4A5KA 3A98B 4HDQA 5D3XA 2MKRA 3P7ZA 2RSGA 2RLOA 2DKPA 4K2PA 5HE0A 3KRXA 2MDXA 4HB2B 3PSCA 1WJ1A 2EMTA 2D9VA 1P3RA 2GCJA 4TKNA 1OQNA 4MK0A 2D9YA 2ELAA 1J0WA 1V5PA 5C5BB 1B55A 1WJMA 2VKIA 5LOPB 1V5UA 5FI0A 4A6FA 3X23A 3VIAA 2H7EA 1NU2A 1EGXA 1ZC3B 2KGXB 4EJNA 4ZRIA 1U29A 3KSYA 4WVFB 1AQCA 2DYQA 3PVLA 2X18A 3M1IB 3PEGA 3MDBC 4EMOA 2I1JA 2CAYA 2YT1A 4A6HA 2KCJA 2ELBA 2K00A 4PNKA 2RUKB 5DH9B 2HE7A 1GG3A 3LJUX 4KHOA 1BWNA 1Y5OA 3KY9A 3QIJA 5FI1A 4B6HA 5J3TA 3SO6A 4YL8A 3WA0A 2AL6A 2I5FA 1X11A 3HW2B 3D8FA 1QQGA 2ZPYA 1J19A 1H4RA 2MFQA 4NY0A 4NSWA 2OQBA 1W1DA 5D3YA 1UPRA 2DHIA 1TJ6A 4KHBB 2YSZA 2K2JA 1ISNA 4PQ0A 2Q13A 2GJYA 2DX5A 1XR0B 2L2IA 1DDVA 3A8QA 5D3WA 2K2UA 1XODA 2I1KA 2LG1A 2I5CA 1M7EA 1MAIA 3CIKA 3GYOA 4CHJA 2R09A 1EAZA 2IFSA 1QC6A 1XD4A 3BJIA 1K5DB 1AWEA 5HE3A 4MY6A 1I2HA 2D9XA 3KZ1A 3F5RA 2J0JA 2OTXA 1U5EA 1FHOA 2EMSA 2DA0A 3FSSA 2IYBA 1WI1A 1SHCA 4HHVA 4F7UP 1ZSQA 3HQCA 3TW1A 1DYNA 2BCJA 2Y8GA 3ODOA 2LOXA 1Z87A 4HAYB 2CY4A 1DBHA 2H7DA 2Z0PA 2J59M 3DXCA 1V89A 4HAUB 2LOZA 4P7IA 3D8EA 1MPHA 4HAZB 2YS3A 4WSFA 1X86A 4YONA 2LKOA 5CLLB 1NTYA 2DYNA 5DHFB 4WJ7A 4Z2MB 2D10A 1V88A 4F7GA 1FHWA 1W1HA 2ROZB 4DXAB 3BINA 2DKQA 2N23A 3SUZA 1U5DA 1XCGA 3V5WA 2RVBB 3TFMA 2UVMA 1DDMA 1SGHA 1XX0A 1MK9B 2Y8FA 5D3VA 4GXBA 3KRWA 2DTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MK7 B;  4K2O A;  1MIZ B;  2D9W A;  3OAN A;  2CY5 A;  2EC1 A;  1P6S A;  4HB4 B;  1IRS A;  2NZ8 B;  5CLQ B;  1BAK A;  1LW3 A;  4A6K A;  1DDW A;  1FB8 A;  1ZVR A;  2J0K A;  2KUP A;  2MWN B;  1FGZ A;  1GC7 A;  1FHX A;  2Z0Q A;  4GMX B;  2GS0 A;  2D11 A;  1WVH A;  3N7C A;  4IOY X;  1V5M A;  2Z0O A;  1OMW A;  1U5F A;  3CXB B;  1KZ7 A;  2RGN B;  4K17 A;  5DI9 B;  1WGU A;  4L6E A;  2COF A;  1TXD A;  1X1G A;  1PMS A;  1KZG A;  4HB0 B;  1K5G B;  5JLJ B;  2P0H A;  2DHK A;  3QWM A;  4HAV B;  2VSZ A;  1LB1 A;  5DIF B;  2J0M A;  1UNR A;  3ODW A;  2YS5 A;  3SV1 A;  5HE1 A;  2ADZ A;  3A8P A;  2HTH B;  5J3Q A;  3AJ4 A;  1WGQ A;  3QBV B;  5LON B;  4KVG B;  2DN6 A;  3GYP A;  1FAO A;  3SNH A;  3PG7 A;  2GCL A;  1NTV A;  2CRF A;  2COD A;  1OY2 A;  1RJ2 A;  1BTK A;  4DX8 A;  1ZM0 A;  2D9Z A;  2UZR A;  5KCV A;  1U27 A;  4EKU A;  3TVV A;  3ULB A;  5KQ4 A;  2G35 A;  3PVU A;  3MPX A;  1WG7 A;  1Y19 B;  1RRP B;  1UEF A;  3T06 A;  1FOE A;  1X05 A;  1DRO A;  4Y94 A;  2DFK A;  5HE2 A;  4D0N B;  3PP2 A;  3FM8 C;  4HDO A;  5GOW B;  3D8D A;  5DHA B;  2XQN M;  2DHJ A;  4HAX B;  4A6F B;  2DLW A;  4TYZ A;  1KI1 B;  2D2Q A;  4IFS A;  1ZC4 B;  2LUL A;  2QKM A;  5C5B A;  1EVH A;  1BTN A;  4MT7 A;  4CYE A;  1M7R A;  3NSU A;  1EF1 A;  1Q67 A;  2W2W A;  4DX9 0;  2E2X A;  2JP2 A;  5L81 A;  1H10 A;  4XWX A;  2M14 A;  2W2X D;  5D27 A;  4KAX B;  3ULC A;  2D4Q A;  2DX1 A;  2N0Y A;  1UNP A;  3G9W A;  1P5T A;  1TQZ A;  5JP4 A;  4ZRK A;  4IAP A;  2M38 A;  3IVF A;  2Y7B A;  3O96 A;  1I7A A;  1MKE A;  2YS1 A;  2NMB A;  3FEH A;  2RNR B;  1U2B A;  2EJ8 A;  3AU5 A;  3SYX A;  2COC A;  2P0D A;  1GC6 A;  3WYF B;  3PZD A;  1PFJ A;  1X1F A;  3P6A A;  2P8V A;  4C0A A;  3U7D A;  2UZS A;  1UPQ A;  5J3Y A;  3F0W A;  2YF0 A;  3ZVR A;  3UZT A;  2VRW B;  4Z2N A;  3ODX A;  4ZRJ A;  3TCA A;  4K81 A;  4GN1 A;  2LYD A;  4KHA A;  3DXD A;  5EFX A;  5C16 A;  5C79 A;  4GZU A;  1U5G A;  2W2X C;  1PLS A;  5JHG A;  5KQ1 A;  4HAW B;  1MIX A;  2R0D A;  3PVW A;  3VOQ A;  5JHH A;  3ZDT A;  1V61 A;  3TO1 A;  3ML4 A;  3HK0 A;  4H8S A;  2FJL A;  1W1G A;  2L1C A;  1E5W A;  2ROV A;  2P0F A;  1XKE A;  3RCP A;  2COA A;  4GMV A;  4HB3 B;  2YRY A;  2AEH A;  3U8Z A;  2PZ1 A;  1NI2 A;  4BBK A;  1N3H A;  1FGY A;  2V76 A;  3AU4 A;  4DBB A;  4HAT B;  4GPT B;  1UNQ A;  3DXE A;  5C6R A;  2QKL A;  4F7H A;  2YT0 A;  2YVC A;  4CHM A;  4A5K A;  3A98 B;  4HDQ A;  5D3X A;  2MKR A;  3P7Z A;  2RSG A;  2RLO A;  2DKP A;  4K2P A;  5HE0 A;  3KRX A;  2MDX A;  4HB2 B;  3PSC A;  1WJ1 A;  2EMT A;  2D9V A;  1P3R A;  2GCJ A;  4TKN A;  1OQN A;  4MK0 A;  2D9Y A;  2ELA A;  1J0W A;  1V5P A;  5C5B B;  1B55 A;  1WJM A;  2VKI A;  5LOP B;  1V5U A;  5FI0 A;  4A6F A;  3X23 A;  3VIA A;  2H7E A;  1NU2 A;  1EGX A;  1ZC3 B;  2KGX B;  4EJN A;  4ZRI A;  1U29 A;  3KSY A;  4WVF B;  1AQC A;  2DYQ A;  3PVL A;  2X18 A;  3M1I B;  3PEG A;  3MDB C;  4EMO A;  2I1J A;  2CAY A;  2YT1 A;  4A6H A;  2KCJ A;  2ELB A;  2K00 A;  4PNK A;  2RUK B;  5DH9 B;  2HE7 A;  1GG3 A;  3LJU X;  4KHO A;  1BWN A;  1Y5O A;  3KY9 A;  3QIJ A;  5FI1 A;  4B6H A;  5J3T A;  3SO6 A;  4YL8 A;  3WA0 A;  2AL6 A;  2I5F A;  1X11 A;  3HW2 B;  3D8F A;  1QQG A;  2ZPY A;  1J19 A;  1H4R A;  2MFQ A;  4NY0 A;  4NSW A;  2OQB A;  1W1D A;  5D3Y A;  1UPR A;  2DHI A;  1TJ6 A;  4KHB B;  2YSZ A;  2K2J A;  1ISN A;  4PQ0 A;  2Q13 A;  2GJY A;  2DX5 A;  1XR0 B;  2L2I A;  1DDV A;  3A8Q A;  5D3W A;  2K2U A;  1XOD A;  2I1K A;  2LG1 A;  2I5C A;  1M7E A;  1MAI A;  3CIK A;  3GYO A;  4CHJ A;  2R09 A;  1EAZ A;  2IFS A;  1QC6 A;  1XD4 A;  3BJI A;  1K5D B;  1AWE A;  5HE3 A;  4MY6 A;  1I2H A;  2D9X A;  3KZ1 A;  3F5R A;  2J0J A;  2OTX A;  1U5E A;  1FHO A;  2EMS A;  2DA0 A;  3FSS A;  2IYB A;  1WI1 A;  1SHC A;  4HHV A;  4F7U P;  1ZSQ A;  3HQC A;  3TW1 A;  1DYN A;  2BCJ A;  2Y8G A;  3ODO A;  2LOX A;  1Z87 A;  4HAY B;  2CY4 A;  1DBH A;  2H7D A;  2Z0P A;  2J59 M;  3DXC A;  1V89 A;  4HAU B;  2LOZ A;  4P7I A;  3D8E A;  1MPH A;  4HAZ B;  2YS3 A;  4WSF A;  1X86 A;  4YON A;  2LKO A;  5CLL B;  1NTY A;  2DYN A;  5DHF B;  4WJ7 A;  4Z2M B;  2D10 A;  1V88 A;  4F7G A;  1FHW A;  1W1H A;  2ROZ B;  4DXA B;  3BIN A;  2DKQ A;  2N23 A;  3SUZ A;  1U5D A;  1XCG A;  3V5W A;  2RVB B;  3TFM A;  2UVM A;  1DDM A;  1SGH A;  1XX0 A;  1MK9 B;  2Y8F A;  5D3V A;  4GXB A;  3KRW A;  2DTC A; 
#chains in the Genus database with same CATH topology
 4QJ5 B;  1MK7 B;  4K2O A;  1MIZ B;  2D9W A;  3OAN A;  4D6W A;  2CY5 A;  2KIE A;  2EC1 A;  1P6S A;  4HB4 B;  3NWD A;  1IRS A;  2NZ8 B;  5CLQ B;  1BAK A;  1LW3 A;  4A6K A;  1DDW A;  1FB8 A;  1ZVR A;  2J0K A;  2KUP A;  2MWN B;  1FGZ A;  1GC7 A;  1FHX A;  2Z0Q A;  3NWF A;  5M4Y B;  4GMX B;  2GS0 A;  2D11 A;  1WVH A;  3N7C A;  4IOY X;  1V5M A;  2Z0O A;  1OMW A;  1U5F A;  3CXB B;  1KZ7 A;  2RGN B;  4K17 A;  5DI9 B;  4OSN A;  1WGU A;  4L6E A;  2COF A;  1TXD A;  1X1G A;  1PMS A;  1KZG A;  4HB0 B;  2R2Y A;  1K5G B;  5JLJ B;  2P0H A;  2DHK A;  3QWM A;  4HAV B;  2VSZ A;  1LB1 A;  5DIF B;  2J0M A;  1UNR A;  1T77 A;  3ODW A;  2YS5 A;  3SV1 A;  5HE1 A;  2ADZ A;  2GUM A;  2NBV A;  3A8P A;  2HTH B;  5J3Q A;  3AJ4 A;  1WGQ A;  2Z4D A;  3QBV B;  5LON B;  4KVG B;  2DN6 A;  3GYP A;  1FAO A;  3SNH A;  3PG7 A;  2GCL A;  1NTV A;  4QXA B;  2CRF A;  2COD A;  1OY2 A;  1RJ2 A;  1BTK A;  4DX8 A;  1ZM0 A;  2D9Z A;  2UZR A;  5KCV A;  4L1R A;  1U27 A;  4EKU A;  2ZKM X;  3TVV A;  3ULB A;  5KQ4 A;  2G35 A;  3PVU A;  3MPX A;  1WG7 A;  1Y19 B;  2Z13 A;  2FJU B;  1RRP B;  1UEF A;  3T06 A;  5IRS A;  1FOE A;  1X05 A;  4HSI A;  3FVC A;  1DRO A;  4Y94 A;  2DFK A;  5HE2 A;  4D0N B;  3PP2 A;  3FM8 C;  4HDO A;  5GOW B;  3D8D A;  5DHA B;  2XQN M;  2DHJ A;  4HAX B;  4A6F B;  2DLW A;  4TYZ A;  1KI1 B;  2D2Q A;  2KUQ A;  4IFS A;  1ZC4 B;  2LUL A;  2QKM A;  5C5B A;  1EVH A;  4DIX A;  1BTN A;  4MT7 A;  4CYE A;  1M7R A;  3NSU A;  1EF1 A;  1Q67 A;  3A58 A;  2W2W A;  4DX9 0;  4QJ4 B;  2E2X A;  2JP2 A;  5L81 A;  1H10 A;  4XWX A;  2M14 A;  2W2X D;  5D27 A;  4KAX B;  3ULC A;  2D4Q A;  2DX1 A;  2N0Y A;  1UNP A;  3G9W A;  1P5T A;  1TQZ A;  5JP4 A;  4ZRK A;  4IAP A;  2M38 A;  3IVF A;  2Y7B A;  3O96 A;  1I7A A;  1MKE A;  2YS1 A;  2NMB A;  3FEH A;  4OT1 A;  2RNR B;  3OHM B;  1U2B A;  2EJ8 A;  3AU5 A;  3SYX A;  2COC A;  3HIE A;  2P0D A;  1GC6 A;  4GNK B;  3WYF B;  3PZD A;  1PFJ A;  1X1F A;  3P6A A;  2P8V A;  4C0A A;  3U7D A;  2UZS A;  2K49 A;  1UPQ A;  5J3Y A;  3F0W A;  2YF0 A;  3ZVR A;  3UZT A;  3U12 A;  2VRW B;  4Z2N A;  3ODX A;  4ZRJ A;  3TCA A;  4K81 A;  4GN1 A;  2LYD A;  4KHB A;  3DXD A;  4KHA A;  5EFX A;  5C16 A;  5C79 A;  4GZU A;  1U5G A;  2W2X C;  1PLS A;  5JHG A;  3NWA A;  5KQ1 A;  4HAW B;  1MIX A;  2R0D A;  3PVW A;  3VOQ A;  5JHH A;  3ZDT A;  1V61 A;  3TO1 A;  3ML4 A;  2Z14 A;  3HK0 A;  4H8S A;  2FJL A;  1W1G A;  2L1C A;  1E5W A;  2ROV A;  2P0F A;  1XKE A;  3RCP A;  2COA A;  4GMV A;  4HB3 B;  2YRY A;  2AEH A;  2K8E A;  3U8Z A;  2PZ1 A;  1NI2 A;  4BBK A;  1N3H A;  1FGY A;  2V76 A;  3AU4 A;  4DBB A;  4HAT B;  4GPT B;  1UNQ A;  3DXE A;  5C6R A;  2QKL A;  4F7H A;  2YT0 A;  2YVC A;  4CHM A;  4A5K A;  3A98 B;  4HDQ A;  5D3X A;  2MKR A;  3P7Z A;  2RSG A;  5LG4 B;  2RLO A;  2DKP A;  4K2P A;  5HE0 A;  3KRX A;  2MDX A;  4HB2 B;  3PSC A;  1WJ1 A;  2EMT A;  2D9V A;  1P3R A;  2GCJ A;  4TKN A;  1OQN A;  4MK0 A;  2D9Y A;  2ELA A;  1J0W A;  1V5P A;  5C5B B;  1B55 A;  4QJ3 B;  1WJM A;  2VKI A;  5LOP B;  1V5U A;  5FI0 A;  4A6F A;  3X23 A;  3VIA A;  2H7E A;  1NU2 A;  1EGX A;  1ZC3 B;  2KGX B;  4EJN A;  3DCX A;  4ZRI A;  1U29 A;  5I2S A;  3KSY A;  4WVF B;  1AQC A;  2DYQ A;  3PVL A;  2X18 A;  3M1I B;  3PEG A;  3MDB C;  4EMO A;  2I1J A;  2CAY A;  2YT1 A;  2RRF A;  5I2M A;  4A6H A;  2KCJ A;  2ELB A;  2K00 A;  2KR0 A;  4PNK A;  2RUK B;  5DH9 B;  2HE7 A;  1GG3 A;  1MI1 A;  3LJU X;  4KHO A;  1BWN A;  1Y5O A;  3KY9 A;  3QIJ A;  5FI1 A;  3B77 A;  4B6H A;  5J3T A;  3SO6 A;  4YL8 A;  3WA0 A;  2AL6 A;  2I5F A;  1X11 A;  3NW8 A;  3HW2 B;  3D8F A;  1QQG A;  2ZPY A;  1J19 A;  1H4R A;  2MFQ A;  4NY0 A;  4NSW A;  2OQB A;  1W1D A;  5D3Y A;  1UPR A;  2DHI A;  1TJ6 A;  4KHB B;  2YSZ A;  2K2J A;  1ISN A;  4PQ0 A;  2Q13 A;  2GJY A;  2DX5 A;  1XR0 B;  2L2I A;  1DDV A;  3A8Q A;  5D3W A;  2K2U A;  1XOD A;  2I1K A;  2LG1 A;  2I5C A;  1M7E A;  1MAI A;  3CIK A;  3GYO A;  4CHJ A;  2R09 A;  2KIG A;  1EAZ A;  2IFS A;  1QC6 A;  1XD4 A;  3BJI A;  3HSA A;  1K5D B;  1AWE A;  5HE3 A;  4MY6 A;  1I2H A;  2D9X A;  3KZ1 A;  3F5R A;  2J0J A;  2YT2 A;  2OTX A;  1U5E A;  1FHO A;  2EMS A;  2DA0 A;  3FSS A;  2IYB A;  1WI1 A;  1SHC A;  4HHV A;  4F7U P;  1ZSQ A;  3HQC A;  3TW1 A;  1DYN A;  2BCJ A;  2Y8G A;  3ODO A;  2LOX A;  1Z87 A;  4HAY B;  2CY4 A;  1DBH A;  2H7D A;  2Z0P A;  2J59 M;  3DXC A;  1V89 A;  4HAU B;  2LOZ A;  4P7I A;  3D8E A;  1MPH A;  4HAZ B;  2YS3 A;  4WSF A;  1ZYI A;  1X86 A;  4YON A;  2LKO A;  2Z59 A;  5CLL B;  1NTY A;  2DYN A;  5DHF B;  4WJ7 A;  4Z2M B;  2D10 A;  1V88 A;  4GOU A;  4F7G A;  1FHW A;  1W1H A;  2ROZ B;  4DXA B;  3BIN A;  2DKQ A;  2N23 A;  3SUZ A;  1U5D A;  1XCG A;  3V5W A;  2RVB B;  3TFM A;  4CSQ A;  2UVM A;  1DDM A;  1SGH A;  1XX0 A;  1MK9 B;  2Y8F A;  5D3V A;  4GXB A;  3KRW A;  2DTC A; 
#chains in the Genus database with same CATH homology
 1MK7 B;  4K2O A;  1MIZ B;  2D9W A;  3OAN A;  2CY5 A;  2EC1 A;  1P6S A;  4HB4 B;  1IRS A;  2NZ8 B;  5CLQ B;  1BAK A;  1LW3 A;  4A6K A;  1DDW A;  1FB8 A;  1ZVR A;  2J0K A;  2KUP A;  2MWN B;  1FGZ A;  1GC7 A;  1FHX A;  2Z0Q A;  4GMX B;  2GS0 A;  2D11 A;  1WVH A;  3N7C A;  4IOY X;  1V5M A;  2Z0O A;  1OMW A;  1U5F A;  3CXB B;  1KZ7 A;  2RGN B;  4K17 A;  5DI9 B;  1WGU A;  4L6E A;  2COF A;  1TXD A;  1X1G A;  1PMS A;  1KZG A;  4HB0 B;  1K5G B;  5JLJ B;  2P0H A;  2DHK A;  3QWM A;  4HAV B;  2VSZ A;  1LB1 A;  5DIF B;  2J0M A;  1UNR A;  3ODW A;  2YS5 A;  3SV1 A;  5HE1 A;  2ADZ A;  3A8P A;  2HTH B;  5J3Q A;  3AJ4 A;  1WGQ A;  3QBV B;  5LON B;  4KVG B;  2DN6 A;  3GYP A;  1FAO A;  3SNH A;  3PG7 A;  2GCL A;  1NTV A;  2CRF A;  2COD A;  1OY2 A;  1RJ2 A;  1BTK A;  4DX8 A;  1ZM0 A;  2D9Z A;  2UZR A;  5KCV A;  1U27 A;  4EKU A;  3TVV A;  3ULB A;  5KQ4 A;  2G35 A;  3PVU A;  3MPX A;  1WG7 A;  1Y19 B;  1RRP B;  1UEF A;  3T06 A;  1FOE A;  1X05 A;  1DRO A;  4Y94 A;  2DFK A;  5HE2 A;  4D0N B;  3PP2 A;  3FM8 C;  4HDO A;  5GOW B;  3D8D A;  5DHA B;  2XQN M;  2DHJ A;  4HAX B;  4A6F B;  2DLW A;  4TYZ A;  1KI1 B;  2D2Q A;  4IFS A;  1ZC4 B;  2LUL A;  2QKM A;  5C5B A;  1EVH A;  1BTN A;  4MT7 A;  4CYE A;  1M7R A;  3NSU A;  1EF1 A;  1Q67 A;  2W2W A;  4DX9 0;  2E2X A;  2JP2 A;  5L81 A;  1H10 A;  4XWX A;  2M14 A;  2W2X D;  5D27 A;  4KAX B;  3ULC A;  2D4Q A;  2DX1 A;  2N0Y A;  1UNP A;  3G9W A;  1P5T A;  1TQZ A;  5JP4 A;  4ZRK A;  4IAP A;  2M38 A;  3IVF A;  2Y7B A;  3O96 A;  1I7A A;  1MKE A;  2YS1 A;  2NMB A;  3FEH A;  2RNR B;  1U2B A;  2EJ8 A;  3AU5 A;  3SYX A;  2COC A;  2P0D A;  1GC6 A;  3WYF B;  3PZD A;  1PFJ A;  1X1F A;  3P6A A;  2P8V A;  4C0A A;  3U7D A;  2UZS A;  1UPQ A;  5J3Y A;  3F0W A;  2YF0 A;  3ZVR A;  3UZT A;  2VRW B;  4Z2N A;  3ODX A;  4ZRJ A;  3TCA A;  4K81 A;  4GN1 A;  2LYD A;  4KHA A;  3DXD A;  5EFX A;  5C16 A;  5C79 A;  4GZU A;  1U5G A;  2W2X C;  1PLS A;  5JHG A;  5KQ1 A;  4HAW B;  1MIX A;  2R0D A;  3PVW A;  3VOQ A;  5JHH A;  3ZDT A;  1V61 A;  3TO1 A;  3ML4 A;  3HK0 A;  4H8S A;  2FJL A;  1W1G A;  2L1C A;  1E5W A;  2ROV A;  2P0F A;  1XKE A;  3RCP A;  2COA A;  4GMV A;  4HB3 B;  2YRY A;  2AEH A;  3U8Z A;  2PZ1 A;  1NI2 A;  4BBK A;  1N3H A;  1FGY A;  2V76 A;  3AU4 A;  4DBB A;  4HAT B;  4GPT B;  1UNQ A;  3DXE A;  5C6R A;  2QKL A;  4F7H A;  2YT0 A;  2YVC A;  4CHM A;  4A5K A;  3A98 B;  4HDQ A;  5D3X A;  2MKR A;  3P7Z A;  2RSG A;  2RLO A;  2DKP A;  4K2P A;  5HE0 A;  3KRX A;  2MDX A;  4HB2 B;  3PSC A;  1WJ1 A;  2EMT A;  2D9V A;  1P3R A;  2GCJ A;  4TKN A;  1OQN A;  4MK0 A;  2D9Y A;  2ELA A;  1J0W A;  1V5P A;  5C5B B;  1B55 A;  1WJM A;  2VKI A;  5LOP B;  1V5U A;  5FI0 A;  4A6F A;  3X23 A;  3VIA A;  2H7E A;  1NU2 A;  1EGX A;  1ZC3 B;  2KGX B;  4EJN A;  4ZRI A;  1U29 A;  3KSY A;  4WVF B;  1AQC A;  2DYQ A;  3PVL A;  2X18 A;  3M1I B;  3PEG A;  3MDB C;  4EMO A;  2I1J A;  2CAY A;  2YT1 A;  4A6H A;  2KCJ A;  2ELB A;  2K00 A;  4PNK A;  2RUK B;  5DH9 B;  2HE7 A;  1GG3 A;  3LJU X;  4KHO A;  1BWN A;  1Y5O A;  3KY9 A;  3QIJ A;  5FI1 A;  4B6H A;  5J3T A;  3SO6 A;  4YL8 A;  3WA0 A;  2AL6 A;  2I5F A;  1X11 A;  3HW2 B;  3D8F A;  1QQG A;  2ZPY A;  1J19 A;  1H4R A;  2MFQ A;  4NY0 A;  4NSW A;  2OQB A;  1W1D A;  5D3Y A;  1UPR A;  2DHI A;  1TJ6 A;  4KHB B;  2YSZ A;  2K2J A;  1ISN A;  4PQ0 A;  2Q13 A;  2GJY A;  2DX5 A;  1XR0 B;  2L2I A;  1DDV A;  3A8Q A;  5D3W A;  2K2U A;  1XOD A;  2I1K A;  2LG1 A;  2I5C A;  1M7E A;  1MAI A;  3CIK A;  3GYO A;  4CHJ A;  2R09 A;  1EAZ A;  2IFS A;  1QC6 A;  1XD4 A;  3BJI A;  1K5D B;  1AWE A;  5HE3 A;  4MY6 A;  1I2H A;  2D9X A;  3KZ1 A;  3F5R A;  2J0J A;  2OTX A;  1U5E A;  1FHO A;  2EMS A;  2DA0 A;  3FSS A;  2IYB A;  1WI1 A;  1SHC A;  4HHV A;  4F7U P;  1ZSQ A;  3HQC A;  3TW1 A;  1DYN A;  2BCJ A;  2Y8G A;  3ODO A;  2LOX A;  1Z87 A;  4HAY B;  2CY4 A;  1DBH A;  2H7D A;  2Z0P A;  2J59 M;  3DXC A;  1V89 A;  4HAU B;  2LOZ A;  4P7I A;  3D8E A;  1MPH A;  4HAZ B;  2YS3 A;  4WSF A;  1X86 A;  4YON A;  2LKO A;  5CLL B;  1NTY A;  2DYN A;  5DHF B;  4WJ7 A;  4Z2M B;  2D10 A;  1V88 A;  4F7G A;  1FHW A;  1W1H A;  2ROZ B;  4DXA B;  3BIN A;  2DKQ A;  2N23 A;  3SUZ A;  1U5D A;  1XCG A;  3V5W A;  2RVB B;  3TFM A;  2UVM A;  1DDM A;  1SGH A;  1XX0 A;  1MK9 B;  2Y8F A;  5D3V A;  4GXB A;  3KRW A;  2DTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...