1X05A

Solution structure of the c-terminal ph domain of human pleckstrin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
129
structure length
129
Chain Sequence
GSSGSSGVILKEEFRGVIIKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGAEDPLGAIHLRGCVVTSVESNSNGRKSEEENLFEIITADEVHYFLQAATPKERTEWIKAIQMASRTGKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C-terminal PH domain of human pleckstrin
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Pleckstrin
total genus 15
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2005-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1x05A00
2GS0A 3IVFA 4K17A 1W1HA 3F5RA 2J0MA 4MK0A 2DYQA 5CLQB 4C0AA 4HAZB 2GCJA 4YL8A 2D11A 3AU5A 1V88A 5JHGA 4HAYB 1U5EA 2R0DA 4HAUB 4Y94A 2XQNM 4TKNA 5HE2A 3ODXA 4EMOA 2P0HA 2YRYA 1SHCA 2UVMA 1ZC3B 2I1JA 3KRWA 1RRPB 4HB0B 4Z2NA 2RUKB 1PLSA 2DN6A 2DTCA 1U5GA 2YS3A 2CAYA 4CYEA 1B55A 5C16A 2D9VA 2V76A 3U7DA 4MT7A 4WSFA 1GC7A 3FSSA 2EMTA 5JP4A 2Q13A 4CHMA 1ZVRA 5L81A 2UZRA 4GMXB 1FHOA 2W2XD 4GZUA 2YS5A 1BTNA 2D9XA 2EMSA 4HDQA 1NTVA 1FGYA 1UPQA 2N0YA 4HAXB 2OQBA 2DKQA 2M38A 1FHWA 3ML4A 4ZRKA 5D27A 4DX90 2ROVA 1H10A 3SUZA 1V5UA 1NTYA 1UNQA 1NU2A 2CODA 2YF0A 3MDBC 2RSGA 1UNRA 2YVCA 5KQ4A 3SYXA 5LOPB 3P6AA 3VIAA 2VKIA 1TQZA 2ELAA 2LULA 4F7HA 5DH9B 1MPHA 1RJ2A 4K2OA 5HE3A 2R09A 1OMWA 4KVGB 4GPTB 2KGXB 2CY4A 1UEFA 4WVFB 4KAXB 2L2IA 5DHFB 2D9YA 4KHOA 2RGNB 3N7CA 5D3VA 1XD4A 4F7GA 2QKMA 1DYNA 1H4RA 4HAWB 2W2XC 3CXBB 3GYOA 1X86A 2GCLA 4ZRIA 1XX0A 1ISNA 1EAZA 4KHAA 2H7EA 2Y8FA 1EVHA 1X11A 3SV1A 2D4QA 2DX1A 3D8EA 3OANA 2I5CA 1N3HA 3NSUA 1MIXA 4EKUA 2D9ZA 4IOYX 3KZ1A 3D8FA 5J3YA 5D3YA 5KQ1A 4BBKA 4GMVA 2Z0PA 3HQCA 3TVVA 4IFSA 2W2WA 2P0DA 3DXDA 2LOZA 2MWNB 1MAIA 3AJ4A 1PMSA 3QIJA 5HE0A 3O96A 1AWEA 3X23A 2DHKA 2BCJA 3ODOA 1MK7B 1V5MA 4A6FB 4CHJA 1MKEA 5C79A 3FM8C 4DBBA 1XCGA 1TJ6A 3SNHA 3DXCA 1J0WA 1BAKA 1GC6A 3ULBA 2EC1A 2J0JA 2L1CA 2K2UA 2D2QA 4A6HA 1U5FA 2LKOA 2HTHB 3HK0A 3TCAA 2RNRB 4HDOA 4L6EA 2H7DA 1P5TA 1QQGA 1OQNA 3D8DA 1M7RA 2I5FA 2PZ1A 4P7IA 5FI0A 2D10A 1U5DA 3A98B 1DBHA 1Q67A 2YT1A 2MKRA 5JLJB 2Z0OA 2MFQA 2FJLA 4IAPA 4D0NB 2COAA 4K81A 2Y7BA 1LW3A 1U2BA 2MDXA 3LJUX 1FGZA 1ZSQA 2ROZB 1XODA 5FI1A 3TFMA 2RVBB 1Y19B 2RLOA 2LOXA 3F0WA 2YT0A 1WVHA 5HE1A 3GYPA 2JP2A 4XWXA 4HHVA 1K5DB 2IYBA 3T06A 4DXAB 1ZC4B 4HATB 4K2PA 3DXEA 1PFJA 2J0KA 3QWMA 2VRWB 1ZM0A 2DHJA 2YS1A 2EJ8A 2NMBA 1QC6A 1FHXA 4HB4B 2P8VA 2GJYA 2NZ8B 2AEHA 1U29A 1P3RA 2HE7A 1W1DA 3ZVRA 1KZ7A 2M14A 3BINA 2Y8GA 2DKPA 1MK9B 4GXBA 3ULCA 3KSYA 3PP2A 3RCPA 3A8PA 4DX8A 3PG7A 2IFSA 1AQCA 5DHAB 5C5BA 1WJMA 3PVLA 2DYNA 2Z0QA 3TO1A 5DIFB 4HB2B 2COCA 4A6FA 2DA0A 3SO6A 3KY9A 4Z2MB 2DHIA 2AL6A 4H8SA 4NY0A 1NI2A 3WYFB 3MPXA 1DDVA 1IRSA 1LB1A 2QKLA 1W1GA 5J3QA 4EJNA 1WJ1A 1GG3A 1X1GA 1V89A 1Z87A 2LYDA 3QBVB 5J3TA 3KRXA 1FB8A 1I2HA 1TXDA 3ZDTA 4F7UP 1X1FA 1M7EA 2UZSA 3G9WA 1OY2A 4GN1A 4PQ0A 4YONA 5KCVA 1FAOA 4A6KA 4HAVB 5CLLB 5D3XA 2YSZA 2J59M 3TW1A 2I1KA 1KZGA 3PEGA 1K5GB 1FOEA 3ODWA 3PZDA 4MY6A 3P7ZA 3VOQA 1I7AA 3FEHA 2ELBA 5C5BB 3V5WA 2P0FA 4TYZA 4B6HA 3A8QA 2COFA 5LONB 1V5PA 1UPRA 2D9WA 3U8ZA 1SGHA 2KUPA 4KHBB 1UNPA 1V61A 1U27A 1EF1A 2ZPYA 1XKEA 4WJ7A 1WGQA 3PVUA 3BJIA 5JHHA 2K00A 2OTXA 5DI9B 2DLWA 5C6RA 2LG1A 1X05A 1MIZB 1DROA 5EFXA 1KI1B 3PSCA 1WI1A 1WG7A 2KCJA 2CY5A 2K2JA 5GOWB 2CRFA 2X18A 2DX5A 2VSZA 3UZTA 4ZRJA 1DDWA 3AU4A 3WA0A 2ADZA 3PVWA 5D3WA 1J19A 4PNKA 4A5KA 1DDMA 2E2XA 2DFKA 3CIKA 2G35A 1P6SA 4HB3B 3HW2B 1BWNA 1WGUA 1BTKA 1EGXA 1E5WA 1XR0B 1Y5OA 4NSWA 2N23A 3M1IB
chains in the Genus database with same CATH superfamily
2GS0A 3IVFA 1ZYIA 4K17A 1W1HA 2Z13A 3F5RA 2J0MA 4MK0A 2DYQA 5CLQB 4C0AA 4HAZB 2GCJA 5LG4B 4YL8A 2D11A 3AU5A 1V88A 5JHGA 4HAYB 1U5EA 2R0DA 4HAUB 4Y94A 2XQNM 4TKNA 5HE2A 3ODXA 4EMOA 2P0HA 2YRYA 1SHCA 2UVMA 1ZC3B 2I1JA 3KRWA 1RRPB 4HB0B 4Z2NA 2RUKB 1PLSA 2DN6A 2DTCA 1U5GA 3NW8A 2YS3A 2CAYA 4GNKB 1B55A 4CYEA 5C16A 2D9VA 2V76A 3U7DA 4MT7A 4WSFA 1GC7A 3NWAA 3FSSA 2EMTA 5JP4A 2Q13A 4CHMA 1ZVRA 5L81A 2UZRA 4GMXB 1FHOA 2W2XD 2YS5A 4GZUA 1BTNA 4D6WA 2D9XA 2EMSA 4HDQA 1NTVA 1FGYA 1UPQA 2N0YA 4HAXB 2OQBA 2DKQA 2M38A 1FHWA 3ML4A 4ZRKA 5D27A 4DX90 2KR0A 2ROVA 1H10A 3SUZA 1V5UA 2K49A 1NTYA 1UNQA 1NU2A 2CODA 2YF0A 3MDBC 2RSGA 1UNRA 5I2SA 2YVCA 3NWDA 5KQ4A 3SYXA 5LOPB 3P6AA 2YT2A 3VIAA 2VKIA 1TQZA 5M4YB 2ELAA 2LULA 4F7HA 5DH9B 1MPHA 1RJ2A 4K2OA 2GUMA 5HE3A 2R09A 1OMWA 4KVGB 4GPTB 2KGXB 2CY4A 1UEFA 4WVFB 4KAXB 2L2IA 3U12A 5DHFB 2D9YA 4KHOA 2RGNB 3N7CA 3HIEA 1XD4A 4OT1A 5D3VA 4F7GA 2QKMA 2FJUB 2ZKMX 1DYNA 1H4RA 4HAWB 2W2XC 3CXBB 4QJ5B 3GYOA 1T77A 1X86A 3B77A 2GCLA 4ZRIA 1XX0A 1ISNA 1EAZA 4KHAA 2H7EA 2Y8FA 1EVHA 1X11A 3SV1A 2D4QA 2DX1A 3D8EA 3OANA 2I5CA 1N3HA 3NSUA 1MIXA 4EKUA 2D9ZA 4IOYX 3KZ1A 3D8FA 3NWFA 3FVCA 4QJ3B 5J3YA 5D3YA 5KQ1A 4BBKA 4GMVA 2Z0PA 3HQCA 3TVVA 4IFSA 2W2WA 3A58A 2P0DA 3DXDA 2LOZA 2MWNB 1MAIA 3AJ4A 1PMSA 3QIJA 5HE0A 3O96A 1AWEA 3X23A 2DHKA 2BCJA 3ODOA 1MK7B 1V5MA 4A6FB 4CHJA 1MKEA 5C79A 3FM8C 4DBBA 1XCGA 1TJ6A 4QJ4B 3SNHA 3DXCA 1J0WA 1BAKA 1GC6A 3ULBA 2EC1A 2J0JA 2L1CA 2K2UA 2D2QA 4A6HA 1U5FA 2LKOA 2HTHB 4QXAB 3HK0A 2K8EA 2RNRB 4KHBA 3TCAA 4HDOA 4L6EA 2H7DA 1P5TA 1QQGA 1OQNA 3D8DA 1M7RA 2I5FA 4GOUA 2PZ1A 4P7IA 5FI0A 2D10A 1U5DA 2RRFA 3A98B 1DBHA 1Q67A 2YT1A 2MKRA 4OSNA 5JLJB 2Z0OA 2MFQA 2FJLA 4IAPA 4D0NB 4L1RA 2COAA 4K81A 2Y7BA 1LW3A 1U2BA 2MDXA 3LJUX 1FGZA 3DCXA 1ZSQA 2ROZB 1XODA 5FI1A 3TFMA 2RVBB 1Y19B 2RLOA 2LOXA 3F0WA 2KIGA 2YT0A 1WVHA 5HE1A 3GYPA 2JP2A 4DIXA 4XWXA 4HHVA 3OHMB 1K5DB 2IYBA 3T06A 4DXAB 1ZC4B 4HATB 4K2PA 3DXEA 1PFJA 2KIEA 2KUQA 1MI1A 2J0KA 3QWMA 2VRWB 1ZM0A 2DHJA 4HSIA 2YS1A 2EJ8A 2NMBA 1QC6A 1FHXA 4HB4B 2P8VA 2GJYA 2NZ8B 2AEHA 1U29A 1P3RA 2HE7A 1W1DA 3ZVRA 1KZ7A 2M14A 3BINA 2Y8GA 2DKPA 1MK9B 3HSAA 4GXBA 3ULCA 3KSYA 3PP2A 3RCPA 3A8PA 4DX8A 3PG7A 2IFSA 1AQCA 5DHAB 5I2MA 1WJMA 3PVLA 5C5BA 2DYNA 2Z0QA 3TO1A 5DIFB 4HB2B 2COCA 4A6FA 2DA0A 3SO6A 3KY9A 4Z2MB 2DHIA 2AL6A 4H8SA 4NY0A 1NI2A 3WYFB 3MPXA 1DDVA 1IRSA 1LB1A 2QKLA 1W1GA 5J3QA 4EJNA 1WJ1A 1GG3A 1X1GA 1V89A 1Z87A 2LYDA 3QBVB 5J3TA 3KRXA 1FB8A 1I2HA 1TXDA 3ZDTA 4F7UP 1X1FA 1M7EA 2UZSA 3G9WA 1OY2A 4GN1A 4PQ0A 4YONA 5KCVA 1FAOA 4A6KA 4HAVB 2R2YA 5CLLB 5D3XA 2YSZA 2J59M 3TW1A 2I1KA 1KZGA 3PEGA 1K5GB 1FOEA 5IRSA 3ODWA 3PZDA 4MY6A 3P7ZA 3VOQA 1I7AA 3FEHA 2ELBA 5C5BB 3V5WA 2Z14A 2P0FA 4TYZA 4B6HA 3A8QA 2COFA 5LONB 1V5PA 1UPRA 2Z59A 2D9WA 3U8ZA 1SGHA 2KUPA 4KHBB 1UNPA 1V61A 1U27A 1EF1A 2ZPYA 1XKEA 4CSQA 4WJ7A 1WGQA 3PVUA 3BJIA 5JHHA 2K00A 2OTXA 5DI9B 2DLWA 5C6RA 2LG1A 2NBVA 1X05A 1MIZB 1DROA 5EFXA 1KI1B 3PSCA 1WI1A 1WG7A 2KCJA 2CY5A 2K2JA 5GOWB 2CRFA 2X18A 2DX5A 2VSZA 3UZTA 2Z4DA 4ZRJA 1DDWA 3AU4A 3WA0A 2ADZA 3PVWA 5D3WA 1J19A 4PNKA 4A5KA 1DDMA 2E2XA 2DFKA 3CIKA 2G35A 1P6SA 4HB3B 3HW2B 1BWNA 1WGUA 1BTKA 1EGXA 1E5WA 1XR0B 1Y5OA 4NSWA 2N23A 3M1IB
chains in the Genus database with same CATH topology
2GS0A 3IVFA 4K17A 1W1HA 3F5RA 2J0MA 4MK0A 2DYQA 5CLQB 4C0AA 4HAZB 2GCJA 4YL8A 2D11A 3AU5A 1V88A 5JHGA 4HAYB 1U5EA 2R0DA 4HAUB 4Y94A 2XQNM 4TKNA 5HE2A 3ODXA 4EMOA 2P0HA 2YRYA 1SHCA 2UVMA 1ZC3B 2I1JA 3KRWA 1RRPB 4HB0B 4Z2NA 2RUKB 1PLSA 2DN6A 2DTCA 1U5GA 2YS3A 2CAYA 4CYEA 1B55A 5C16A 2D9VA 2V76A 3U7DA 4MT7A 4WSFA 1GC7A 3FSSA 2EMTA 5JP4A 2Q13A 4CHMA 1ZVRA 5L81A 2UZRA 4GMXB 1FHOA 2W2XD 4GZUA 2YS5A 1BTNA 2D9XA 2EMSA 4HDQA 1NTVA 1FGYA 1UPQA 2N0YA 4HAXB 2OQBA 2DKQA 2M38A 1FHWA 3ML4A 4ZRKA 5D27A 4DX90 2ROVA 1H10A 3SUZA 1V5UA 1NTYA 1UNQA 1NU2A 2CODA 2YF0A 3MDBC 2RSGA 1UNRA 2YVCA 5KQ4A 3SYXA 5LOPB 3P6AA 3VIAA 2VKIA 1TQZA 2ELAA 2LULA 4F7HA 5DH9B 1MPHA 1RJ2A 4K2OA 5HE3A 2R09A 1OMWA 4KVGB 4GPTB 2KGXB 2CY4A 1UEFA 4WVFB 4KAXB 2L2IA 5DHFB 2D9YA 4KHOA 2RGNB 3N7CA 5D3VA 1XD4A 4F7GA 2QKMA 1DYNA 1H4RA 4HAWB 2W2XC 3CXBB 3GYOA 1X86A 2GCLA 4ZRIA 1XX0A 1ISNA 1EAZA 4KHAA 2H7EA 2Y8FA 1EVHA 1X11A 3SV1A 2D4QA 2DX1A 3D8EA 3OANA 2I5CA 1N3HA 3NSUA 1MIXA 4EKUA 2D9ZA 4IOYX 3KZ1A 3D8FA 5J3YA 5D3YA 5KQ1A 4BBKA 4GMVA 2Z0PA 3HQCA 3TVVA 4IFSA 2W2WA 2P0DA 3DXDA 2LOZA 2MWNB 1MAIA 3AJ4A 1PMSA 3QIJA 5HE0A 3O96A 1AWEA 3X23A 2DHKA 2BCJA 3ODOA 1MK7B 1V5MA 4A6FB 4CHJA 1MKEA 5C79A 3FM8C 4DBBA 1XCGA 1TJ6A 3SNHA 3DXCA 1J0WA 1BAKA 1GC6A 3ULBA 2EC1A 2J0JA 2L1CA 2K2UA 2D2QA 4A6HA 1U5FA 2LKOA 2HTHB 3HK0A 3TCAA 2RNRB 4HDOA 4L6EA 2H7DA 1P5TA 1QQGA 1OQNA 3D8DA 1M7RA 2I5FA 2PZ1A 4P7IA 5FI0A 2D10A 1U5DA 3A98B 1DBHA 1Q67A 2YT1A 2MKRA 5JLJB 2Z0OA 2MFQA 2FJLA 4IAPA 4D0NB 2COAA 4K81A 2Y7BA 1LW3A 1U2BA 2MDXA 3LJUX 1FGZA 1ZSQA 2ROZB 1XODA 5FI1A 3TFMA 2RVBB 1Y19B 2RLOA 2LOXA 3F0WA 2YT0A 1WVHA 5HE1A 3GYPA 2JP2A 4XWXA 4HHVA 1K5DB 2IYBA 3T06A 4DXAB 1ZC4B 4HATB 4K2PA 3DXEA 1PFJA 2J0KA 3QWMA 2VRWB 1ZM0A 2DHJA 2YS1A 2EJ8A 2NMBA 1QC6A 1FHXA 4HB4B 2P8VA 2GJYA 2NZ8B 2AEHA 1U29A 1P3RA 2HE7A 1W1DA 3ZVRA 1KZ7A 2M14A 3BINA 2Y8GA 2DKPA 1MK9B 4GXBA 3ULCA 3KSYA 3PP2A 3RCPA 3A8PA 4DX8A 3PG7A 2IFSA 1AQCA 5DHAB 5C5BA 1WJMA 3PVLA 2DYNA 2Z0QA 3TO1A 5DIFB 4HB2B 2COCA 4A6FA 2DA0A 3SO6A 3KY9A 4Z2MB 2DHIA 2AL6A 4H8SA 4NY0A 1NI2A 3WYFB 3MPXA 1DDVA 1IRSA 1LB1A 2QKLA 1W1GA 5J3QA 4EJNA 1WJ1A 1GG3A 1X1GA 1V89A 1Z87A 2LYDA 3QBVB 5J3TA 3KRXA 1FB8A 1I2HA 1TXDA 3ZDTA 4F7UP 1X1FA 1M7EA 2UZSA 3G9WA 1OY2A 4GN1A 4PQ0A 4YONA 5KCVA 1FAOA 4A6KA 4HAVB 5CLLB 5D3XA 2YSZA 2J59M 3TW1A 2I1KA 1KZGA 3PEGA 1K5GB 1FOEA 3ODWA 3PZDA 4MY6A 3P7ZA 3VOQA 1I7AA 3FEHA 2ELBA 5C5BB 3V5WA 2P0FA 4TYZA 4B6HA 3A8QA 2COFA 5LONB 1V5PA 1UPRA 2D9WA 3U8ZA 1SGHA 2KUPA 4KHBB 1UNPA 1V61A 1U27A 1EF1A 2ZPYA 1XKEA 4WJ7A 1WGQA 3PVUA 3BJIA 5JHHA 2K00A 2OTXA 5DI9B 2DLWA 5C6RA 2LG1A 1X05A 1MIZB 1DROA 5EFXA 1KI1B 3PSCA 1WI1A 1WG7A 2KCJA 2CY5A 2K2JA 5GOWB 2CRFA 2X18A 2DX5A 2VSZA 3UZTA 4ZRJA 1DDWA 3AU4A 3WA0A 2ADZA 3PVWA 5D3WA 1J19A 4PNKA 4A5KA 1DDMA 2E2XA 2DFKA 3CIKA 2G35A 1P6SA 4HB3B 3HW2B 1BWNA 1WGUA 1BTKA 1EGXA 1E5WA 1XR0B 1Y5OA 4NSWA 2N23A 3M1IB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GS0 A;  3IVF A;  4K17 A;  1W1H A;  3F5R A;  2J0M A;  4MK0 A;  2DYQ A;  5CLQ B;  4C0A A;  4HAZ B;  2GCJ A;  4YL8 A;  2D11 A;  3AU5 A;  1V88 A;  5JHG A;  4HAY B;  1U5E A;  2R0D A;  4HAU B;  4Y94 A;  2XQN M;  4TKN A;  5HE2 A;  3ODX A;  4EMO A;  2P0H A;  2YRY A;  1SHC A;  2UVM A;  1ZC3 B;  2I1J A;  3KRW A;  1RRP B;  4HB0 B;  4Z2N A;  2RUK B;  1PLS A;  2DN6 A;  2DTC A;  1U5G A;  2YS3 A;  2CAY A;  4CYE A;  1B55 A;  5C16 A;  2D9V A;  2V76 A;  3U7D A;  4MT7 A;  4WSF A;  1GC7 A;  3FSS A;  2EMT A;  5JP4 A;  2Q13 A;  4CHM A;  1ZVR A;  5L81 A;  2UZR A;  4GMX B;  1FHO A;  2W2X D;  4GZU A;  2YS5 A;  1BTN A;  2D9X A;  2EMS A;  4HDQ A;  1NTV A;  1FGY A;  1UPQ A;  2N0Y A;  4HAX B;  2OQB A;  2DKQ A;  2M38 A;  1FHW A;  3ML4 A;  4ZRK A;  5D27 A;  4DX9 0;  2ROV A;  1H10 A;  3SUZ A;  1V5U A;  1NTY A;  1UNQ A;  1NU2 A;  2COD A;  2YF0 A;  3MDB C;  2RSG A;  1UNR A;  2YVC A;  5KQ4 A;  3SYX A;  5LOP B;  3P6A A;  3VIA A;  2VKI A;  1TQZ A;  2ELA A;  2LUL A;  4F7H A;  5DH9 B;  1MPH A;  1RJ2 A;  4K2O A;  5HE3 A;  2R09 A;  1OMW A;  4KVG B;  4GPT B;  2KGX B;  2CY4 A;  1UEF A;  4WVF B;  4KAX B;  2L2I A;  5DHF B;  2D9Y A;  4KHO A;  2RGN B;  3N7C A;  5D3V A;  1XD4 A;  4F7G A;  2QKM A;  1DYN A;  1H4R A;  4HAW B;  2W2X C;  3CXB B;  3GYO A;  1X86 A;  2GCL A;  4ZRI A;  1XX0 A;  1ISN A;  1EAZ A;  4KHA A;  2H7E A;  2Y8F A;  1EVH A;  1X11 A;  3SV1 A;  2D4Q A;  2DX1 A;  3D8E A;  3OAN A;  2I5C A;  1N3H A;  3NSU A;  1MIX A;  4EKU A;  2D9Z A;  4IOY X;  3KZ1 A;  3D8F A;  5J3Y A;  5D3Y A;  5KQ1 A;  4BBK A;  4GMV A;  2Z0P A;  3HQC A;  3TVV A;  4IFS A;  2W2W A;  2P0D A;  3DXD A;  2LOZ A;  2MWN B;  1MAI A;  3AJ4 A;  1PMS A;  3QIJ A;  5HE0 A;  3O96 A;  1AWE A;  3X23 A;  2DHK A;  2BCJ A;  3ODO A;  1MK7 B;  1V5M A;  4A6F B;  4CHJ A;  1MKE A;  5C79 A;  3FM8 C;  4DBB A;  1XCG A;  1TJ6 A;  3SNH A;  3DXC A;  1J0W A;  1BAK A;  1GC6 A;  3ULB A;  2EC1 A;  2J0J A;  2L1C A;  2K2U A;  2D2Q A;  4A6H A;  1U5F A;  2LKO A;  2HTH B;  3HK0 A;  3TCA A;  2RNR B;  4HDO A;  4L6E A;  2H7D A;  1P5T A;  1QQG A;  1OQN A;  3D8D A;  1M7R A;  2I5F A;  2PZ1 A;  4P7I A;  5FI0 A;  2D10 A;  1U5D A;  3A98 B;  1DBH A;  1Q67 A;  2YT1 A;  2MKR A;  5JLJ B;  2Z0O A;  2MFQ A;  2FJL A;  4IAP A;  4D0N B;  2COA A;  4K81 A;  2Y7B A;  1LW3 A;  1U2B A;  2MDX A;  3LJU X;  1FGZ A;  1ZSQ A;  2ROZ B;  1XOD A;  5FI1 A;  3TFM A;  2RVB B;  1Y19 B;  2RLO A;  2LOX A;  3F0W A;  2YT0 A;  1WVH A;  5HE1 A;  3GYP A;  2JP2 A;  4XWX A;  4HHV A;  1K5D B;  2IYB A;  3T06 A;  4DXA B;  1ZC4 B;  4HAT B;  4K2P A;  3DXE A;  1PFJ A;  2J0K A;  3QWM A;  2VRW B;  1ZM0 A;  2DHJ A;  2YS1 A;  2EJ8 A;  2NMB A;  1QC6 A;  1FHX A;  4HB4 B;  2P8V A;  2GJY A;  2NZ8 B;  2AEH A;  1U29 A;  1P3R A;  2HE7 A;  1W1D A;  3ZVR A;  1KZ7 A;  2M14 A;  3BIN A;  2Y8G A;  2DKP A;  1MK9 B;  4GXB A;  3ULC A;  3KSY A;  3PP2 A;  3RCP A;  3A8P A;  4DX8 A;  3PG7 A;  2IFS A;  1AQC A;  5DHA B;  5C5B A;  1WJM A;  3PVL A;  2DYN A;  2Z0Q A;  3TO1 A;  5DIF B;  4HB2 B;  2COC A;  4A6F A;  2DA0 A;  3SO6 A;  3KY9 A;  4Z2M B;  2DHI A;  2AL6 A;  4H8S A;  4NY0 A;  1NI2 A;  3WYF B;  3MPX A;  1DDV A;  1IRS A;  1LB1 A;  2QKL A;  1W1G A;  5J3Q A;  4EJN A;  1WJ1 A;  1GG3 A;  1X1G A;  1V89 A;  1Z87 A;  2LYD A;  3QBV B;  5J3T A;  3KRX A;  1FB8 A;  1I2H A;  1TXD A;  3ZDT A;  4F7U P;  1X1F A;  1M7E A;  2UZS A;  3G9W A;  1OY2 A;  4GN1 A;  4PQ0 A;  4YON A;  5KCV A;  1FAO A;  4A6K A;  4HAV B;  5CLL B;  5D3X A;  2YSZ A;  2J59 M;  3TW1 A;  2I1K A;  1KZG A;  3PEG A;  1K5G B;  1FOE A;  3ODW A;  3PZD A;  4MY6 A;  3P7Z A;  3VOQ A;  1I7A A;  3FEH A;  2ELB A;  5C5B B;  3V5W A;  2P0F A;  4TYZ A;  4B6H A;  3A8Q A;  2COF A;  5LON B;  1V5P A;  1UPR A;  2D9W A;  3U8Z A;  1SGH A;  2KUP A;  4KHB B;  1UNP A;  1V61 A;  1U27 A;  1EF1 A;  2ZPY A;  1XKE A;  4WJ7 A;  1WGQ A;  3PVU A;  3BJI A;  5JHH A;  2K00 A;  2OTX A;  5DI9 B;  2DLW A;  5C6R A;  2LG1 A;  1X05 A;  1MIZ B;  1DRO A;  5EFX A;  1KI1 B;  3PSC A;  1WI1 A;  1WG7 A;  2KCJ A;  2CY5 A;  2K2J A;  5GOW B;  2CRF A;  2X18 A;  2DX5 A;  2VSZ A;  3UZT A;  4ZRJ A;  1DDW A;  3AU4 A;  3WA0 A;  2ADZ A;  3PVW A;  5D3W A;  1J19 A;  4PNK A;  4A5K A;  1DDM A;  2E2X A;  2DFK A;  3CIK A;  2G35 A;  1P6S A;  4HB3 B;  3HW2 B;  1BWN A;  1WGU A;  1BTK A;  1EGX A;  1E5W A;  1XR0 B;  1Y5O A;  4NSW A;  2N23 A;  3M1I B; 
#chains in the Genus database with same CATH topology
 2GS0 A;  3IVF A;  1ZYI A;  4K17 A;  1W1H A;  2Z13 A;  3F5R A;  2J0M A;  4MK0 A;  2DYQ A;  5CLQ B;  4C0A A;  4HAZ B;  2GCJ A;  5LG4 B;  4YL8 A;  2D11 A;  3AU5 A;  1V88 A;  5JHG A;  4HAY B;  1U5E A;  2R0D A;  4HAU B;  4Y94 A;  2XQN M;  4TKN A;  5HE2 A;  3ODX A;  4EMO A;  2P0H A;  2YRY A;  1SHC A;  2UVM A;  1ZC3 B;  2I1J A;  3KRW A;  1RRP B;  4HB0 B;  4Z2N A;  2RUK B;  1PLS A;  2DN6 A;  2DTC A;  1U5G A;  3NW8 A;  2YS3 A;  2CAY A;  4GNK B;  1B55 A;  4CYE A;  5C16 A;  2D9V A;  2V76 A;  3U7D A;  4MT7 A;  4WSF A;  1GC7 A;  3NWA A;  3FSS A;  2EMT A;  5JP4 A;  2Q13 A;  4CHM A;  1ZVR A;  5L81 A;  2UZR A;  4GMX B;  1FHO A;  2W2X D;  2YS5 A;  4GZU A;  1BTN A;  4D6W A;  2D9X A;  2EMS A;  4HDQ A;  1NTV A;  1FGY A;  1UPQ A;  2N0Y A;  4HAX B;  2OQB A;  2DKQ A;  2M38 A;  1FHW A;  3ML4 A;  4ZRK A;  5D27 A;  4DX9 0;  2KR0 A;  2ROV A;  1H10 A;  3SUZ A;  1V5U A;  2K49 A;  1NTY A;  1UNQ A;  1NU2 A;  2COD A;  2YF0 A;  3MDB C;  2RSG A;  1UNR A;  5I2S A;  2YVC A;  3NWD A;  5KQ4 A;  3SYX A;  5LOP B;  3P6A A;  2YT2 A;  3VIA A;  2VKI A;  1TQZ A;  5M4Y B;  2ELA A;  2LUL A;  4F7H A;  5DH9 B;  1MPH A;  1RJ2 A;  4K2O A;  2GUM A;  5HE3 A;  2R09 A;  1OMW A;  4KVG B;  4GPT B;  2KGX B;  2CY4 A;  1UEF A;  4WVF B;  4KAX B;  2L2I A;  3U12 A;  5DHF B;  2D9Y A;  4KHO A;  2RGN B;  3N7C A;  3HIE A;  1XD4 A;  4OT1 A;  5D3V A;  4F7G A;  2QKM A;  2FJU B;  2ZKM X;  1DYN A;  1H4R A;  4HAW B;  2W2X C;  3CXB B;  4QJ5 B;  3GYO A;  1T77 A;  1X86 A;  3B77 A;  2GCL A;  4ZRI A;  1XX0 A;  1ISN A;  1EAZ A;  4KHA A;  2H7E A;  2Y8F A;  1EVH A;  1X11 A;  3SV1 A;  2D4Q A;  2DX1 A;  3D8E A;  3OAN A;  2I5C A;  1N3H A;  3NSU A;  1MIX A;  4EKU A;  2D9Z A;  4IOY X;  3KZ1 A;  3D8F A;  3NWF A;  3FVC A;  4QJ3 B;  5J3Y A;  5D3Y A;  5KQ1 A;  4BBK A;  4GMV A;  2Z0P A;  3HQC A;  3TVV A;  4IFS A;  2W2W A;  3A58 A;  2P0D A;  3DXD A;  2LOZ A;  2MWN B;  1MAI A;  3AJ4 A;  1PMS A;  3QIJ A;  5HE0 A;  3O96 A;  1AWE A;  3X23 A;  2DHK A;  2BCJ A;  3ODO A;  1MK7 B;  1V5M A;  4A6F B;  4CHJ A;  1MKE A;  5C79 A;  3FM8 C;  4DBB A;  1XCG A;  1TJ6 A;  4QJ4 B;  3SNH A;  3DXC A;  1J0W A;  1BAK A;  1GC6 A;  3ULB A;  2EC1 A;  2J0J A;  2L1C A;  2K2U A;  2D2Q A;  4A6H A;  1U5F A;  2LKO A;  2HTH B;  4QXA B;  3HK0 A;  2K8E A;  2RNR B;  4KHB A;  3TCA A;  4HDO A;  4L6E A;  2H7D A;  1P5T A;  1QQG A;  1OQN A;  3D8D A;  1M7R A;  2I5F A;  4GOU A;  2PZ1 A;  4P7I A;  5FI0 A;  2D10 A;  1U5D A;  2RRF A;  3A98 B;  1DBH A;  1Q67 A;  2YT1 A;  2MKR A;  4OSN A;  5JLJ B;  2Z0O A;  2MFQ A;  2FJL A;  4IAP A;  4D0N B;  4L1R A;  2COA A;  4K81 A;  2Y7B A;  1LW3 A;  1U2B A;  2MDX A;  3LJU X;  1FGZ A;  3DCX A;  1ZSQ A;  2ROZ B;  1XOD A;  5FI1 A;  3TFM A;  2RVB B;  1Y19 B;  2RLO A;  2LOX A;  3F0W A;  2KIG A;  2YT0 A;  1WVH A;  5HE1 A;  3GYP A;  2JP2 A;  4DIX A;  4XWX A;  4HHV A;  3OHM B;  1K5D B;  2IYB A;  3T06 A;  4DXA B;  1ZC4 B;  4HAT B;  4K2P A;  3DXE A;  1PFJ A;  2KIE A;  2KUQ A;  1MI1 A;  2J0K A;  3QWM A;  2VRW B;  1ZM0 A;  2DHJ A;  4HSI A;  2YS1 A;  2EJ8 A;  2NMB A;  1QC6 A;  1FHX A;  4HB4 B;  2P8V A;  2GJY A;  2NZ8 B;  2AEH A;  1U29 A;  1P3R A;  2HE7 A;  1W1D A;  3ZVR A;  1KZ7 A;  2M14 A;  3BIN A;  2Y8G A;  2DKP A;  1MK9 B;  3HSA A;  4GXB A;  3ULC A;  3KSY A;  3PP2 A;  3RCP A;  3A8P A;  4DX8 A;  3PG7 A;  2IFS A;  1AQC A;  5DHA B;  5I2M A;  1WJM A;  3PVL A;  5C5B A;  2DYN A;  2Z0Q A;  3TO1 A;  5DIF B;  4HB2 B;  2COC A;  4A6F A;  2DA0 A;  3SO6 A;  3KY9 A;  4Z2M B;  2DHI A;  2AL6 A;  4H8S A;  4NY0 A;  1NI2 A;  3WYF B;  3MPX A;  1DDV A;  1IRS A;  1LB1 A;  2QKL A;  1W1G A;  5J3Q A;  4EJN A;  1WJ1 A;  1GG3 A;  1X1G A;  1V89 A;  1Z87 A;  2LYD A;  3QBV B;  5J3T A;  3KRX A;  1FB8 A;  1I2H A;  1TXD A;  3ZDT A;  4F7U P;  1X1F A;  1M7E A;  2UZS A;  3G9W A;  1OY2 A;  4GN1 A;  4PQ0 A;  4YON A;  5KCV A;  1FAO A;  4A6K A;  4HAV B;  2R2Y A;  5CLL B;  5D3X A;  2YSZ A;  2J59 M;  3TW1 A;  2I1K A;  1KZG A;  3PEG A;  1K5G B;  1FOE A;  5IRS A;  3ODW A;  3PZD A;  4MY6 A;  3P7Z A;  3VOQ A;  1I7A A;  3FEH A;  2ELB A;  5C5B B;  3V5W A;  2Z14 A;  2P0F A;  4TYZ A;  4B6H A;  3A8Q A;  2COF A;  5LON B;  1V5P A;  1UPR A;  2Z59 A;  2D9W A;  3U8Z A;  1SGH A;  2KUP A;  4KHB B;  1UNP A;  1V61 A;  1U27 A;  1EF1 A;  2ZPY A;  1XKE A;  4CSQ A;  4WJ7 A;  1WGQ A;  3PVU A;  3BJI A;  5JHH A;  2K00 A;  2OTX A;  5DI9 B;  2DLW A;  5C6R A;  2LG1 A;  2NBV A;  1X05 A;  1MIZ B;  1DRO A;  5EFX A;  1KI1 B;  3PSC A;  1WI1 A;  1WG7 A;  2KCJ A;  2CY5 A;  2K2J A;  5GOW B;  2CRF A;  2X18 A;  2DX5 A;  2VSZ A;  3UZT A;  2Z4D A;  4ZRJ A;  1DDW A;  3AU4 A;  3WA0 A;  2ADZ A;  3PVW A;  5D3W A;  1J19 A;  4PNK A;  4A5K A;  1DDM A;  2E2X A;  2DFK A;  3CIK A;  2G35 A;  1P6S A;  4HB3 B;  3HW2 B;  1BWN A;  1WGU A;  1BTK A;  1EGX A;  1E5W A;  1XR0 B;  1Y5O A;  4NSW A;  2N23 A;  3M1I B; 
#chains in the Genus database with same CATH homology
 2GS0 A;  3IVF A;  4K17 A;  1W1H A;  3F5R A;  2J0M A;  4MK0 A;  2DYQ A;  5CLQ B;  4C0A A;  4HAZ B;  2GCJ A;  4YL8 A;  2D11 A;  3AU5 A;  1V88 A;  5JHG A;  4HAY B;  1U5E A;  2R0D A;  4HAU B;  4Y94 A;  2XQN M;  4TKN A;  5HE2 A;  3ODX A;  4EMO A;  2P0H A;  2YRY A;  1SHC A;  2UVM A;  1ZC3 B;  2I1J A;  3KRW A;  1RRP B;  4HB0 B;  4Z2N A;  2RUK B;  1PLS A;  2DN6 A;  2DTC A;  1U5G A;  2YS3 A;  2CAY A;  4CYE A;  1B55 A;  5C16 A;  2D9V A;  2V76 A;  3U7D A;  4MT7 A;  4WSF A;  1GC7 A;  3FSS A;  2EMT A;  5JP4 A;  2Q13 A;  4CHM A;  1ZVR A;  5L81 A;  2UZR A;  4GMX B;  1FHO A;  2W2X D;  4GZU A;  2YS5 A;  1BTN A;  2D9X A;  2EMS A;  4HDQ A;  1NTV A;  1FGY A;  1UPQ A;  2N0Y A;  4HAX B;  2OQB A;  2DKQ A;  2M38 A;  1FHW A;  3ML4 A;  4ZRK A;  5D27 A;  4DX9 0;  2ROV A;  1H10 A;  3SUZ A;  1V5U A;  1NTY A;  1UNQ A;  1NU2 A;  2COD A;  2YF0 A;  3MDB C;  2RSG A;  1UNR A;  2YVC A;  5KQ4 A;  3SYX A;  5LOP B;  3P6A A;  3VIA A;  2VKI A;  1TQZ A;  2ELA A;  2LUL A;  4F7H A;  5DH9 B;  1MPH A;  1RJ2 A;  4K2O A;  5HE3 A;  2R09 A;  1OMW A;  4KVG B;  4GPT B;  2KGX B;  2CY4 A;  1UEF A;  4WVF B;  4KAX B;  2L2I A;  5DHF B;  2D9Y A;  4KHO A;  2RGN B;  3N7C A;  5D3V A;  1XD4 A;  4F7G A;  2QKM A;  1DYN A;  1H4R A;  4HAW B;  2W2X C;  3CXB B;  3GYO A;  1X86 A;  2GCL A;  4ZRI A;  1XX0 A;  1ISN A;  1EAZ A;  4KHA A;  2H7E A;  2Y8F A;  1EVH A;  1X11 A;  3SV1 A;  2D4Q A;  2DX1 A;  3D8E A;  3OAN A;  2I5C A;  1N3H A;  3NSU A;  1MIX A;  4EKU A;  2D9Z A;  4IOY X;  3KZ1 A;  3D8F A;  5J3Y A;  5D3Y A;  5KQ1 A;  4BBK A;  4GMV A;  2Z0P A;  3HQC A;  3TVV A;  4IFS A;  2W2W A;  2P0D A;  3DXD A;  2LOZ A;  2MWN B;  1MAI A;  3AJ4 A;  1PMS A;  3QIJ A;  5HE0 A;  3O96 A;  1AWE A;  3X23 A;  2DHK A;  2BCJ A;  3ODO A;  1MK7 B;  1V5M A;  4A6F B;  4CHJ A;  1MKE A;  5C79 A;  3FM8 C;  4DBB A;  1XCG A;  1TJ6 A;  3SNH A;  3DXC A;  1J0W A;  1BAK A;  1GC6 A;  3ULB A;  2EC1 A;  2J0J A;  2L1C A;  2K2U A;  2D2Q A;  4A6H A;  1U5F A;  2LKO A;  2HTH B;  3HK0 A;  3TCA A;  2RNR B;  4HDO A;  4L6E A;  2H7D A;  1P5T A;  1QQG A;  1OQN A;  3D8D A;  1M7R A;  2I5F A;  2PZ1 A;  4P7I A;  5FI0 A;  2D10 A;  1U5D A;  3A98 B;  1DBH A;  1Q67 A;  2YT1 A;  2MKR A;  5JLJ B;  2Z0O A;  2MFQ A;  2FJL A;  4IAP A;  4D0N B;  2COA A;  4K81 A;  2Y7B A;  1LW3 A;  1U2B A;  2MDX A;  3LJU X;  1FGZ A;  1ZSQ A;  2ROZ B;  1XOD A;  5FI1 A;  3TFM A;  2RVB B;  1Y19 B;  2RLO A;  2LOX A;  3F0W A;  2YT0 A;  1WVH A;  5HE1 A;  3GYP A;  2JP2 A;  4XWX A;  4HHV A;  1K5D B;  2IYB A;  3T06 A;  4DXA B;  1ZC4 B;  4HAT B;  4K2P A;  3DXE A;  1PFJ A;  2J0K A;  3QWM A;  2VRW B;  1ZM0 A;  2DHJ A;  2YS1 A;  2EJ8 A;  2NMB A;  1QC6 A;  1FHX A;  4HB4 B;  2P8V A;  2GJY A;  2NZ8 B;  2AEH A;  1U29 A;  1P3R A;  2HE7 A;  1W1D A;  3ZVR A;  1KZ7 A;  2M14 A;  3BIN A;  2Y8G A;  2DKP A;  1MK9 B;  4GXB A;  3ULC A;  3KSY A;  3PP2 A;  3RCP A;  3A8P A;  4DX8 A;  3PG7 A;  2IFS A;  1AQC A;  5DHA B;  5C5B A;  1WJM A;  3PVL A;  2DYN A;  2Z0Q A;  3TO1 A;  5DIF B;  4HB2 B;  2COC A;  4A6F A;  2DA0 A;  3SO6 A;  3KY9 A;  4Z2M B;  2DHI A;  2AL6 A;  4H8S A;  4NY0 A;  1NI2 A;  3WYF B;  3MPX A;  1DDV A;  1IRS A;  1LB1 A;  2QKL A;  1W1G A;  5J3Q A;  4EJN A;  1WJ1 A;  1GG3 A;  1X1G A;  1V89 A;  1Z87 A;  2LYD A;  3QBV B;  5J3T A;  3KRX A;  1FB8 A;  1I2H A;  1TXD A;  3ZDT A;  4F7U P;  1X1F A;  1M7E A;  2UZS A;  3G9W A;  1OY2 A;  4GN1 A;  4PQ0 A;  4YON A;  5KCV A;  1FAO A;  4A6K A;  4HAV B;  5CLL B;  5D3X A;  2YSZ A;  2J59 M;  3TW1 A;  2I1K A;  1KZG A;  3PEG A;  1K5G B;  1FOE A;  3ODW A;  3PZD A;  4MY6 A;  3P7Z A;  3VOQ A;  1I7A A;  3FEH A;  2ELB A;  5C5B B;  3V5W A;  2P0F A;  4TYZ A;  4B6H A;  3A8Q A;  2COF A;  5LON B;  1V5P A;  1UPR A;  2D9W A;  3U8Z A;  1SGH A;  2KUP A;  4KHB B;  1UNP A;  1V61 A;  1U27 A;  1EF1 A;  2ZPY A;  1XKE A;  4WJ7 A;  1WGQ A;  3PVU A;  3BJI A;  5JHH A;  2K00 A;  2OTX A;  5DI9 B;  2DLW A;  5C6R A;  2LG1 A;  1X05 A;  1MIZ B;  1DRO A;  5EFX A;  1KI1 B;  3PSC A;  1WI1 A;  1WG7 A;  2KCJ A;  2CY5 A;  2K2J A;  5GOW B;  2CRF A;  2X18 A;  2DX5 A;  2VSZ A;  3UZT A;  4ZRJ A;  1DDW A;  3AU4 A;  3WA0 A;  2ADZ A;  3PVW A;  5D3W A;  1J19 A;  4PNK A;  4A5K A;  1DDM A;  2E2X A;  2DFK A;  3CIK A;  2G35 A;  1P6S A;  4HB3 B;  3HW2 B;  1BWN A;  1WGU A;  1BTK A;  1EGX A;  1E5W A;  1XR0 B;  1Y5O A;  4NSW A;  2N23 A;  3M1I B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...