1X05A

Solution structure of the c-terminal ph domain of human pleckstrin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
129
structure length
129
Chain Sequence
GSSGSSGVILKEEFRGVIIKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGAEDPLGAIHLRGCVVTSVESNSNGRKSEEENLFEIITADEVHYFLQAATPKERTEWIKAIQMASRTGKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C-terminal PH domain of human pleckstrin
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Pleckstrin
total genus 15
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2005-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1x05A00
2J59M 4HAUB 2RVBB 2QKLA 4ZRKA 5EFXA 3U7DA 3ZDTA 2CODA 2DKQA 1XCGA 2YVCA 3SV1A 2E2XA 1AWEA 1M7EA 5D3XA 1FB8A 3T06A 2OQBA 3ML4A 4GPTB 4WVFB 4B6HA 2RNRB 4GMVA 1U2BA 1FGYA 4NSWA 1P3RA 2GCJA 4HAVB 3CXBB 2EJ8A 2H7EA 2PZ1A 4KAXB 5J3QA 4WSFA 3QIJA 1NI2A 2ROVA 5C5BA 4CYEA 1WVHA 5J3TA 2ELBA 2CY5A 1IRSA 3AJ4A 4ZRIA 2D9WA 3SUZA 3NSUA 4Z2NA 2UZRA 2YT0A 2YSZA 2YS5A 2VRWB 4HB4B 4L6EA 1X1FA 1V5MA 4IOYX 2GJYA 2P0DA 4K81A 1W1HA 3ODWA 1UPRA 3P7ZA 3HW2B 2ADZA 3UZTA 3ULBA 5HE0A 3TFMA 2BCJA 1EAZA 3MPXA 1P5TA 5HE3A 4A6HA 2MDXA 3SYXA 4CHMA 2NMBA 2MKRA 4GN1A 2UVMA 2LULA 4NY0A 3DXCA 3AU4A 1ZM0A 1DDVA 3U8ZA 2EMTA 2DA0A 2LG1A 1U5EA 2D10A 4HAXB 2N0YA 1WI1A 3QBVB 3TW1A 1B55A 2GCLA 1DDWA 5DI9B 1Q67A 2YS1A 2M14A 2YRYA 2K00A 1V89A 5C6RA 2Q13A 3QWMA 1XR0B 3PZDA 3PP2A 4DX8A 1FHWA 1DROA 2MWNB 1NTYA 2AEHA 1RRPB 1MIXA 1DYNA 1FOEA 1XD4A 3PVWA 5D3VA 1UPQA 1W1DA 2Y8GA 2CY4A 2DX5A 2W2XD 5DHAB 2V76A 2Y7BA 2LOXA 4HDQA 1ZC3B 2Y8FA 1Y19B 2NZ8B 2P0HA 1KZ7A 5JP4A 1K5DB 1U5GA 5JHHA 4H8SA 1V5PA 1E5WA 1W1GA 4Z2MB 2D9YA 2DKPA 2J0JA 2YT1A 5LONB 1BWNA 1M7RA 3LJUX 4HHVA 3WA0A 4CHJA 4F7UP 1PLSA 1SGHA 1FHXA 3AU5A 1U5FA 2YS3A 3FSSA 1DBHA 4KHBB 1UNPA 3A98B 1X05A 4A5KA 3A8PA 4KHOA 1EF1A 1BTNA 2DYQA 1AQCA 2X18A 2COCA 2AL6A 1XKEA 4ZRJA 2KCJA 1X11A 5FI1A 2RSGA 5CLQB 1FGZA 2LOZA 5D3WA 4A6FB 2I1JA 3RCPA 1LW3A 5DIFB 5J3YA 2G35A 1BTKA 2Z0OA 2L1CA 4HDOA 3X23A 1FHOA 4MK0A 2IFSA 5LOPB 4P7IA 1LB1A 1V5UA 2LYDA 2COAA 1U5DA 4A6KA 1KZGA 2OTXA 1MKEA 2QKMA 3O96A 1OQNA 2ZPYA 3VOQA 1TQZA 2JP2A 4IAPA 4HB2B 2R0DA 5D3YA 1XX0A 4DBBA 1MAIA 2CAYA 5HE2A 4HAYB 2HTHB 2DLWA 4HAZB 3TO1A 1MIZB 2I5CA 2K2JA 3SO6A 2ROZB 4EJNA 4PQ0A 1NU2A 2N23A 1GC6A 2Z0PA 2VKIA 2RLOA 2D9XA 1J0WA 1P6SA 2GS0A 2M38A 2UZSA 2IYBA 4HAWB 1U27A 2KUPA 4K2PA 4PNKA 3TCAA 2D9VA 3VIAA 4GZUA 3PEGA 4IFSA 2DHKA 2RUKB 1Y5OA 3HQCA 3BJIA 1I7AA 4GMXB 2CRFA 1DDMA 3ODOA 3KSYA 1EVHA 2YF0A 4KHAA 3CIKA 1WGQA 2P0FA 1NTVA 2DN6A 4XWXA 5D27A 2P8VA 5KCVA 4MT7A 1ZSQA 3P6AA 2FJLA 1KI1B 2HE7A 5DH9B 3F0WA 3ODXA 2EMSA 5DHFB 3ZVRA 1QQGA 1X86A 4DXAB 4YONA 5C79A 1OMWA 1U29A 2KGXB 2DHIA 3N7CA 2D2QA 3PG7A 1RJ2A 4TKNA 2J0KA 1UEFA 1V61A 1X1GA 4YL8A 1J19A 1SHCA 5GOWB 3G9WA 4F7GA 2I1KA 4EMOA 1I2HA 3GYPA 2DFKA 3KY9A 2W2XC 3M1IB 5KQ1A 1Z87A 3KRXA 3SNHA 2ELAA 1EGXA 2K2UA 1OY2A 3PVUA 4BBKA 4A6FA 4HB0B 1FAOA 2D9ZA 4KVGB 3F5RA 4C0AA 2XQNM 2H7DA 2W2WA 3PSCA 2LKOA 1BAKA 2VSZA 4HATB 2DYNA 2I5FA 4HB3B 3D8FA 5KQ4A 2DTCA 2RGNB 3D8DA 1UNQA 3DXDA 3V5WA 4D0NB 1UNRA 2J0MA 4DX90 5L81A 4TYZA 1MK9B 1TXDA 4K2OA 3WYFB 1MPHA 3FEHA 1QC6A 3ULCA 3TVVA 2MFQA 1MK7B 4GXBA 2D11A 2COFA 5JLJB 3MDBC 1GG3A 3PVLA 1WJMA 1WJ1A 5C16A 5CLLB 3KZ1A 5FI0A 2EC1A 2R09A 3BINA 4K17A 1ISNA 1GC7A 1H4RA 3FM8C 2DX1A 1XODA 1WG7A 2Z0QA 2L2IA 1ZC4B 3IVFA 3HK0A 4F7HA 1WGUA 1V88A 4WJ7A 3D8EA 2DHJA 1N3HA 1K5GB 3DXEA 1PMSA 3OANA 3KRWA 3GYOA 5HE1A 4Y94A 1H10A 1PFJA 1ZVRA 4MY6A 4EKUA 5JHGA 1TJ6A 2D4QA 5C5BB 3A8QA
chains in the Genus database with same CATH superfamily
2J59M 4HAUB 2RVBB 2QKLA 4ZRKA 5EFXA 3U7DA 3ZDTA 2CODA 2DKQA 1XCGA 2YVCA 3SV1A 2E2XA 1AWEA 1M7EA 5D3XA 1FB8A 4OT1A 3T06A 2OQBA 3ML4A 4GPTB 4WVFB 4B6HA 2RNRB 4GMVA 1U2BA 1FGYA 4NSWA 1P3RA 2GCJA 3CXBB 4HAVB 2EJ8A 2H7EA 2KUQA 2PZ1A 4KAXB 5J3QA 3NWAA 4WSFA 3QIJA 1NI2A 2RRFA 2ROVA 5C5BA 4CYEA 1WVHA 5J3TA 2ELBA 2CY5A 2Z14A 2KIEA 1IRSA 3AJ4A 4ZRIA 2D9WA 3SUZA 3NSUA 4Z2NA 2UZRA 2YT0A 2R2YA 2YSZA 3FVCA 2YS5A 2VRWB 5IRSA 4HB4B 4L6EA 1X1FA 1V5MA 4IOYX 2GJYA 2P0DA 4K81A 1W1HA 3ODWA 1UPRA 3P7ZA 3HW2B 2ADZA 3UZTA 3ULBA 5HE0A 3TFMA 2KIGA 2BCJA 1EAZA 3MPXA 1P5TA 5HE3A 4A6HA 2MDXA 3SYXA 4CHMA 2NMBA 2MKRA 4GN1A 2UVMA 2LULA 4NY0A 3DXCA 3AU4A 1ZM0A 1DDVA 3U8ZA 2EMTA 2DA0A 2LG1A 1U5EA 2D10A 4HAXB 2N0YA 1WI1A 3QBVB 3TW1A 1B55A 2GCLA 1DDWA 5DI9B 1Q67A 2YS1A 2M14A 2YRYA 2K00A 1V89A 5C6RA 2Q13A 3QWMA 1XR0B 3PZDA 3PP2A 4DX8A 1FHWA 1DROA 4GOUA 2MWNB 1NTYA 2AEHA 1RRPB 1MIXA 1DYNA 1FOEA 1XD4A 3PVWA 5D3VA 1UPQA 1W1DA 2Y8GA 2CY4A 2DX5A 2W2XD 5DHAB 2V76A 2Y7BA 2LOXA 4HDQA 1ZC3B 2Y8FA 1Y19B 4OSNA 2NZ8B 1T77A 2P0HA 1KZ7A 5JP4A 1K5DB 1U5GA 5JHHA 4H8SA 1V5PA 1E5WA 1W1GA 4Z2MB 2D9YA 2DKPA 2J0JA 2YT1A 4CSQA 5LONB 1BWNA 1M7RA 3LJUX 4HHVA 3WA0A 4CHJA 4F7UP 1PLSA 1SGHA 4QJ5B 2Z13A 1FHXA 3AU5A 1U5FA 2YS3A 3FSSA 1DBHA 4KHBB 1UNPA 3A98B 1X05A 4A5KA 3A8PA 4KHOA 1EF1A 1BTNA 2DYQA 1AQCA 2X18A 2COCA 2AL6A 4HSIA 1XKEA 4ZRJA 2KCJA 1X11A 5FI1A 2RSGA 2KR0A 4QXAB 5CLQB 2Z59A 5I2SA 2Z4DA 3OHMB 1FGZA 3HIEA 2LOZA 5D3WA 4A6FB 2I1JA 2YT2A 3RCPA 1LW3A 5DIFB 5J3YA 2G35A 1BTKA 2GUMA 2Z0OA 2L1CA 4HDOA 3X23A 1FHOA 4MK0A 2IFSA 5LOPB 4P7IA 1LB1A 4KHBA 1V5UA 2LYDA 2COAA 1U5DA 4A6KA 1KZGA 2OTXA 1MKEA 5I2MA 2QKMA 3O96A 1OQNA 2ZPYA 3VOQA 1TQZA 2JP2A 4IAPA 4HB2B 2R0DA 5D3YA 1XX0A 4DBBA 1MAIA 2CAYA 5HE2A 4DIXA 4HAYB 2HTHB 2DLWA 4HAZB 3TO1A 1MIZB 2I5CA 2K2JA 3SO6A 2ROZB 4EJNA 4PQ0A 1NU2A 2N23A 1GC6A 2Z0PA 2VKIA 2RLOA 2D9XA 1J0WA 1P6SA 2GS0A 2M38A 2UZSA 2IYBA 4HAWB 1U27A 2KUPA 4K2PA 4PNKA 3TCAA 2K49A 2D9VA 3VIAA 4GZUA 3PEGA 4L1RA 4IFSA 2DHKA 2RUKB 1Y5OA 3HQCA 3BJIA 1I7AA 4GMXB 3NW8A 2CRFA 1DDMA 3ODOA 3KSYA 1EVHA 2YF0A 4KHAA 3CIKA 1WGQA 2P0FA 5M4YB 1NTVA 2DN6A 4XWXA 5D27A 2P8VA 5KCVA 4MT7A 1ZSQA 3P6AA 2FJLA 1KI1B 2HE7A 5DH9B 3F0WA 4D6WA 3ODXA 2EMSA 5DHFB 3ZVRA 1QQGA 1X86A 4DXAB 4YONA 5C79A 1OMWA 1U29A 2KGXB 2DHIA 3N7CA 2D2QA 3PG7A 1RJ2A 4TKNA 2J0KA 1UEFA 1V61A 1X1GA 4YL8A 1J19A 1ZYIA 1SHCA 5GOWB 3G9WA 4F7GA 2I1KA 4EMOA 1I2HA 3GYPA 3U12A 2DFKA 3KY9A 2W2XC 3M1IB 5KQ1A 1Z87A 3KRXA 3SNHA 4QJ4B 2ELAA 1EGXA 2K2UA 1MI1A 1OY2A 3PVUA 2K8EA 3B77A 4BBKA 4A6FA 4HB0B 1FAOA 2D9ZA 4KVGB 3F5RA 4C0AA 2XQNM 2H7DA 2W2WA 3PSCA 2LKOA 1BAKA 2VSZA 4HATB 2DYNA 2I5FA 3D8FA 4HB3B 5KQ4A 2DTCA 2RGNB 3D8DA 3NWFA 1UNQA 2ZKMX 3DXDA 3V5WA 4D0NB 1UNRA 2J0MA 4DX90 5L81A 4TYZA 1MK9B 1TXDA 4K2OA 3WYFB 1MPHA 3FEHA 3HSAA 2NBVA 1QC6A 3ULCA 3NWDA 3TVVA 2MFQA 1MK7B 4GXBA 2D11A 2COFA 4QJ3B 5JLJB 3MDBC 1GG3A 3PVLA 1WJMA 1WJ1A 5C16A 5CLLB 3KZ1A 5FI0A 2EC1A 2R09A 3BINA 4K17A 1ISNA 1GC7A 1H4RA 3FM8C 2DX1A 1XODA 1WG7A 2Z0QA 2L2IA 3DCXA 3A58A 1ZC4B 3IVFA 3HK0A 4F7HA 1WGUA 1V88A 4WJ7A 3D8EA 2DHJA 1N3HA 1K5GB 3DXEA 1PMSA 3OANA 3KRWA 3GYOA 5HE1A 4Y94A 1H10A 1PFJA 1ZVRA 4MY6A 4EKUA 5JHGA 1TJ6A 2D4QA 2FJUB 5C5BB 4GNKB 5LG4B 3A8QA
chains in the Genus database with same CATH topology
2J59M 4HAUB 2RVBB 2QKLA 4ZRKA 5EFXA 3U7DA 3ZDTA 2CODA 2DKQA 1XCGA 2YVCA 3SV1A 2E2XA 1AWEA 1M7EA 5D3XA 1FB8A 3T06A 2OQBA 3ML4A 4GPTB 4WVFB 4B6HA 2RNRB 4GMVA 1U2BA 1FGYA 4NSWA 1P3RA 2GCJA 4HAVB 3CXBB 2EJ8A 2H7EA 2PZ1A 4KAXB 5J3QA 4WSFA 3QIJA 1NI2A 2ROVA 5C5BA 4CYEA 1WVHA 5J3TA 2ELBA 2CY5A 1IRSA 3AJ4A 4ZRIA 2D9WA 3SUZA 3NSUA 4Z2NA 2UZRA 2YT0A 2YSZA 2YS5A 2VRWB 4HB4B 4L6EA 1X1FA 1V5MA 4IOYX 2GJYA 2P0DA 4K81A 1W1HA 3ODWA 1UPRA 3P7ZA 3HW2B 2ADZA 3UZTA 3ULBA 5HE0A 3TFMA 2BCJA 1EAZA 3MPXA 1P5TA 5HE3A 4A6HA 2MDXA 3SYXA 4CHMA 2NMBA 2MKRA 4GN1A 2UVMA 2LULA 4NY0A 3DXCA 3AU4A 1ZM0A 1DDVA 3U8ZA 2EMTA 2DA0A 2LG1A 1U5EA 2D10A 4HAXB 2N0YA 1WI1A 3QBVB 3TW1A 1B55A 2GCLA 1DDWA 5DI9B 1Q67A 2YS1A 2M14A 2YRYA 2K00A 1V89A 5C6RA 2Q13A 3QWMA 1XR0B 3PZDA 3PP2A 4DX8A 1FHWA 1DROA 2MWNB 1NTYA 2AEHA 1RRPB 1MIXA 1DYNA 1FOEA 1XD4A 3PVWA 5D3VA 1UPQA 1W1DA 2Y8GA 2CY4A 2DX5A 2W2XD 5DHAB 2V76A 2Y7BA 2LOXA 4HDQA 1ZC3B 2Y8FA 1Y19B 2NZ8B 2P0HA 1KZ7A 5JP4A 1K5DB 1U5GA 5JHHA 4H8SA 1V5PA 1E5WA 1W1GA 4Z2MB 2D9YA 2DKPA 2J0JA 2YT1A 5LONB 1BWNA 1M7RA 3LJUX 4HHVA 3WA0A 4CHJA 4F7UP 1PLSA 1SGHA 1FHXA 3AU5A 1U5FA 2YS3A 3FSSA 1DBHA 4KHBB 1UNPA 3A98B 1X05A 4A5KA 3A8PA 4KHOA 1EF1A 1BTNA 2DYQA 1AQCA 2X18A 2COCA 2AL6A 1XKEA 4ZRJA 2KCJA 1X11A 5FI1A 2RSGA 5CLQB 1FGZA 2LOZA 5D3WA 4A6FB 2I1JA 3RCPA 1LW3A 5DIFB 5J3YA 2G35A 1BTKA 2Z0OA 2L1CA 4HDOA 3X23A 1FHOA 4MK0A 2IFSA 5LOPB 4P7IA 1LB1A 1V5UA 2LYDA 2COAA 1U5DA 4A6KA 1KZGA 2OTXA 1MKEA 2QKMA 3O96A 1OQNA 2ZPYA 3VOQA 1TQZA 2JP2A 4IAPA 4HB2B 2R0DA 5D3YA 1XX0A 4DBBA 1MAIA 2CAYA 5HE2A 4HAYB 2HTHB 2DLWA 4HAZB 3TO1A 1MIZB 2I5CA 2K2JA 3SO6A 2ROZB 4EJNA 4PQ0A 1NU2A 2N23A 1GC6A 2Z0PA 2VKIA 2RLOA 2D9XA 1J0WA 1P6SA 2GS0A 2M38A 2UZSA 2IYBA 4HAWB 1U27A 2KUPA 4K2PA 4PNKA 3TCAA 2D9VA 3VIAA 4GZUA 3PEGA 4IFSA 2DHKA 2RUKB 1Y5OA 3HQCA 3BJIA 1I7AA 4GMXB 2CRFA 1DDMA 3ODOA 3KSYA 1EVHA 2YF0A 4KHAA 3CIKA 1WGQA 2P0FA 1NTVA 2DN6A 4XWXA 5D27A 2P8VA 5KCVA 4MT7A 1ZSQA 3P6AA 2FJLA 1KI1B 2HE7A 5DH9B 3F0WA 3ODXA 2EMSA 5DHFB 3ZVRA 1QQGA 1X86A 4DXAB 4YONA 5C79A 1OMWA 1U29A 2KGXB 2DHIA 3N7CA 2D2QA 3PG7A 1RJ2A 4TKNA 2J0KA 1UEFA 1V61A 1X1GA 4YL8A 1J19A 1SHCA 5GOWB 3G9WA 4F7GA 2I1KA 4EMOA 1I2HA 3GYPA 2DFKA 3KY9A 2W2XC 3M1IB 5KQ1A 1Z87A 3KRXA 3SNHA 2ELAA 1EGXA 2K2UA 1OY2A 3PVUA 4BBKA 4A6FA 4HB0B 1FAOA 2D9ZA 4KVGB 3F5RA 4C0AA 2XQNM 2H7DA 2W2WA 3PSCA 2LKOA 1BAKA 2VSZA 4HATB 2DYNA 2I5FA 4HB3B 3D8FA 5KQ4A 2DTCA 2RGNB 3D8DA 1UNQA 3DXDA 3V5WA 4D0NB 1UNRA 2J0MA 4DX90 5L81A 4TYZA 1MK9B 1TXDA 4K2OA 3WYFB 1MPHA 3FEHA 1QC6A 3ULCA 3TVVA 2MFQA 1MK7B 4GXBA 2D11A 2COFA 5JLJB 3MDBC 1GG3A 3PVLA 1WJMA 1WJ1A 5C16A 5CLLB 3KZ1A 5FI0A 2EC1A 2R09A 3BINA 4K17A 1ISNA 1GC7A 1H4RA 3FM8C 2DX1A 1XODA 1WG7A 2Z0QA 2L2IA 1ZC4B 3IVFA 3HK0A 4F7HA 1WGUA 1V88A 4WJ7A 3D8EA 2DHJA 1N3HA 1K5GB 3DXEA 1PMSA 3OANA 3KRWA 3GYOA 5HE1A 4Y94A 1H10A 1PFJA 1ZVRA 4MY6A 4EKUA 5JHGA 1TJ6A 2D4QA 5C5BB 3A8QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J59 M;  4HAU B;  2RVB B;  2QKL A;  4ZRK A;  5EFX A;  3U7D A;  3ZDT A;  2COD A;  2DKQ A;  1XCG A;  2YVC A;  3SV1 A;  2E2X A;  1AWE A;  1M7E A;  5D3X A;  1FB8 A;  3T06 A;  2OQB A;  3ML4 A;  4GPT B;  4WVF B;  4B6H A;  2RNR B;  4GMV A;  1U2B A;  1FGY A;  4NSW A;  1P3R A;  2GCJ A;  4HAV B;  3CXB B;  2EJ8 A;  2H7E A;  2PZ1 A;  4KAX B;  5J3Q A;  4WSF A;  3QIJ A;  1NI2 A;  2ROV A;  5C5B A;  4CYE A;  1WVH A;  5J3T A;  2ELB A;  2CY5 A;  1IRS A;  3AJ4 A;  4ZRI A;  2D9W A;  3SUZ A;  3NSU A;  4Z2N A;  2UZR A;  2YT0 A;  2YSZ A;  2YS5 A;  2VRW B;  4HB4 B;  4L6E A;  1X1F A;  1V5M A;  4IOY X;  2GJY A;  2P0D A;  4K81 A;  1W1H A;  3ODW A;  1UPR A;  3P7Z A;  3HW2 B;  2ADZ A;  3UZT A;  3ULB A;  5HE0 A;  3TFM A;  2BCJ A;  1EAZ A;  3MPX A;  1P5T A;  5HE3 A;  4A6H A;  2MDX A;  3SYX A;  4CHM A;  2NMB A;  2MKR A;  4GN1 A;  2UVM A;  2LUL A;  4NY0 A;  3DXC A;  3AU4 A;  1ZM0 A;  1DDV A;  3U8Z A;  2EMT A;  2DA0 A;  2LG1 A;  1U5E A;  2D10 A;  4HAX B;  2N0Y A;  1WI1 A;  3QBV B;  3TW1 A;  1B55 A;  2GCL A;  1DDW A;  5DI9 B;  1Q67 A;  2YS1 A;  2M14 A;  2YRY A;  2K00 A;  1V89 A;  5C6R A;  2Q13 A;  3QWM A;  1XR0 B;  3PZD A;  3PP2 A;  4DX8 A;  1FHW A;  1DRO A;  2MWN B;  1NTY A;  2AEH A;  1RRP B;  1MIX A;  1DYN A;  1FOE A;  1XD4 A;  3PVW A;  5D3V A;  1UPQ A;  1W1D A;  2Y8G A;  2CY4 A;  2DX5 A;  2W2X D;  5DHA B;  2V76 A;  2Y7B A;  2LOX A;  4HDQ A;  1ZC3 B;  2Y8F A;  1Y19 B;  2NZ8 B;  2P0H A;  1KZ7 A;  5JP4 A;  1K5D B;  1U5G A;  5JHH A;  4H8S A;  1V5P A;  1E5W A;  1W1G A;  4Z2M B;  2D9Y A;  2DKP A;  2J0J A;  2YT1 A;  5LON B;  1BWN A;  1M7R A;  3LJU X;  4HHV A;  3WA0 A;  4CHJ A;  4F7U P;  1PLS A;  1SGH A;  1FHX A;  3AU5 A;  1U5F A;  2YS3 A;  3FSS A;  1DBH A;  4KHB B;  1UNP A;  3A98 B;  1X05 A;  4A5K A;  3A8P A;  4KHO A;  1EF1 A;  1BTN A;  2DYQ A;  1AQC A;  2X18 A;  2COC A;  2AL6 A;  1XKE A;  4ZRJ A;  2KCJ A;  1X11 A;  5FI1 A;  2RSG A;  5CLQ B;  1FGZ A;  2LOZ A;  5D3W A;  4A6F B;  2I1J A;  3RCP A;  1LW3 A;  5DIF B;  5J3Y A;  2G35 A;  1BTK A;  2Z0O A;  2L1C A;  4HDO A;  3X23 A;  1FHO A;  4MK0 A;  2IFS A;  5LOP B;  4P7I A;  1LB1 A;  1V5U A;  2LYD A;  2COA A;  1U5D A;  4A6K A;  1KZG A;  2OTX A;  1MKE A;  2QKM A;  3O96 A;  1OQN A;  2ZPY A;  3VOQ A;  1TQZ A;  2JP2 A;  4IAP A;  4HB2 B;  2R0D A;  5D3Y A;  1XX0 A;  4DBB A;  1MAI A;  2CAY A;  5HE2 A;  4HAY B;  2HTH B;  2DLW A;  4HAZ B;  3TO1 A;  1MIZ B;  2I5C A;  2K2J A;  3SO6 A;  2ROZ B;  4EJN A;  4PQ0 A;  1NU2 A;  2N23 A;  1GC6 A;  2Z0P A;  2VKI A;  2RLO A;  2D9X A;  1J0W A;  1P6S A;  2GS0 A;  2M38 A;  2UZS A;  2IYB A;  4HAW B;  1U27 A;  2KUP A;  4K2P A;  4PNK A;  3TCA A;  2D9V A;  3VIA A;  4GZU A;  3PEG A;  4IFS A;  2DHK A;  2RUK B;  1Y5O A;  3HQC A;  3BJI A;  1I7A A;  4GMX B;  2CRF A;  1DDM A;  3ODO A;  3KSY A;  1EVH A;  2YF0 A;  4KHA A;  3CIK A;  1WGQ A;  2P0F A;  1NTV A;  2DN6 A;  4XWX A;  5D27 A;  2P8V A;  5KCV A;  4MT7 A;  1ZSQ A;  3P6A A;  2FJL A;  1KI1 B;  2HE7 A;  5DH9 B;  3F0W A;  3ODX A;  2EMS A;  5DHF B;  3ZVR A;  1QQG A;  1X86 A;  4DXA B;  4YON A;  5C79 A;  1OMW A;  1U29 A;  2KGX B;  2DHI A;  3N7C A;  2D2Q A;  3PG7 A;  1RJ2 A;  4TKN A;  2J0K A;  1UEF A;  1V61 A;  1X1G A;  4YL8 A;  1J19 A;  1SHC A;  5GOW B;  3G9W A;  4F7G A;  2I1K A;  4EMO A;  1I2H A;  3GYP A;  2DFK A;  3KY9 A;  2W2X C;  3M1I B;  5KQ1 A;  1Z87 A;  3KRX A;  3SNH A;  2ELA A;  1EGX A;  2K2U A;  1OY2 A;  3PVU A;  4BBK A;  4A6F A;  4HB0 B;  1FAO A;  2D9Z A;  4KVG B;  3F5R A;  4C0A A;  2XQN M;  2H7D A;  2W2W A;  3PSC A;  2LKO A;  1BAK A;  2VSZ A;  4HAT B;  2DYN A;  2I5F A;  4HB3 B;  3D8F A;  5KQ4 A;  2DTC A;  2RGN B;  3D8D A;  1UNQ A;  3DXD A;  3V5W A;  4D0N B;  1UNR A;  2J0M A;  4DX9 0;  5L81 A;  4TYZ A;  1MK9 B;  1TXD A;  4K2O A;  3WYF B;  1MPH A;  3FEH A;  1QC6 A;  3ULC A;  3TVV A;  2MFQ A;  1MK7 B;  4GXB A;  2D11 A;  2COF A;  5JLJ B;  3MDB C;  1GG3 A;  3PVL A;  1WJM A;  1WJ1 A;  5C16 A;  5CLL B;  3KZ1 A;  5FI0 A;  2EC1 A;  2R09 A;  3BIN A;  4K17 A;  1ISN A;  1GC7 A;  1H4R A;  3FM8 C;  2DX1 A;  1XOD A;  1WG7 A;  2Z0Q A;  2L2I A;  1ZC4 B;  3IVF A;  3HK0 A;  4F7H A;  1WGU A;  1V88 A;  4WJ7 A;  3D8E A;  2DHJ A;  1N3H A;  1K5G B;  3DXE A;  1PMS A;  3OAN A;  3KRW A;  3GYO A;  5HE1 A;  4Y94 A;  1H10 A;  1PFJ A;  1ZVR A;  4MY6 A;  4EKU A;  5JHG A;  1TJ6 A;  2D4Q A;  5C5B B;  3A8Q A; 
#chains in the Genus database with same CATH topology
 2J59 M;  4HAU B;  2RVB B;  2QKL A;  4ZRK A;  5EFX A;  3U7D A;  3ZDT A;  2COD A;  2DKQ A;  1XCG A;  2YVC A;  3SV1 A;  2E2X A;  1AWE A;  1M7E A;  5D3X A;  1FB8 A;  4OT1 A;  3T06 A;  2OQB A;  3ML4 A;  4GPT B;  4WVF B;  4B6H A;  2RNR B;  4GMV A;  1U2B A;  1FGY A;  4NSW A;  1P3R A;  2GCJ A;  3CXB B;  4HAV B;  2EJ8 A;  2H7E A;  2KUQ A;  2PZ1 A;  4KAX B;  5J3Q A;  3NWA A;  4WSF A;  3QIJ A;  1NI2 A;  2RRF A;  2ROV A;  5C5B A;  4CYE A;  1WVH A;  5J3T A;  2ELB A;  2CY5 A;  2Z14 A;  2KIE A;  1IRS A;  3AJ4 A;  4ZRI A;  2D9W A;  3SUZ A;  3NSU A;  4Z2N A;  2UZR A;  2YT0 A;  2R2Y A;  2YSZ A;  3FVC A;  2YS5 A;  2VRW B;  5IRS A;  4HB4 B;  4L6E A;  1X1F A;  1V5M A;  4IOY X;  2GJY A;  2P0D A;  4K81 A;  1W1H A;  3ODW A;  1UPR A;  3P7Z A;  3HW2 B;  2ADZ A;  3UZT A;  3ULB A;  5HE0 A;  3TFM A;  2KIG A;  2BCJ A;  1EAZ A;  3MPX A;  1P5T A;  5HE3 A;  4A6H A;  2MDX A;  3SYX A;  4CHM A;  2NMB A;  2MKR A;  4GN1 A;  2UVM A;  2LUL A;  4NY0 A;  3DXC A;  3AU4 A;  1ZM0 A;  1DDV A;  3U8Z A;  2EMT A;  2DA0 A;  2LG1 A;  1U5E A;  2D10 A;  4HAX B;  2N0Y A;  1WI1 A;  3QBV B;  3TW1 A;  1B55 A;  2GCL A;  1DDW A;  5DI9 B;  1Q67 A;  2YS1 A;  2M14 A;  2YRY A;  2K00 A;  1V89 A;  5C6R A;  2Q13 A;  3QWM A;  1XR0 B;  3PZD A;  3PP2 A;  4DX8 A;  1FHW A;  1DRO A;  4GOU A;  2MWN B;  1NTY A;  2AEH A;  1RRP B;  1MIX A;  1DYN A;  1FOE A;  1XD4 A;  3PVW A;  5D3V A;  1UPQ A;  1W1D A;  2Y8G A;  2CY4 A;  2DX5 A;  2W2X D;  5DHA B;  2V76 A;  2Y7B A;  2LOX A;  4HDQ A;  1ZC3 B;  2Y8F A;  1Y19 B;  4OSN A;  2NZ8 B;  1T77 A;  2P0H A;  1KZ7 A;  5JP4 A;  1K5D B;  1U5G A;  5JHH A;  4H8S A;  1V5P A;  1E5W A;  1W1G A;  4Z2M B;  2D9Y A;  2DKP A;  2J0J A;  2YT1 A;  4CSQ A;  5LON B;  1BWN A;  1M7R A;  3LJU X;  4HHV A;  3WA0 A;  4CHJ A;  4F7U P;  1PLS A;  1SGH A;  4QJ5 B;  2Z13 A;  1FHX A;  3AU5 A;  1U5F A;  2YS3 A;  3FSS A;  1DBH A;  4KHB B;  1UNP A;  3A98 B;  1X05 A;  4A5K A;  3A8P A;  4KHO A;  1EF1 A;  1BTN A;  2DYQ A;  1AQC A;  2X18 A;  2COC A;  2AL6 A;  4HSI A;  1XKE A;  4ZRJ A;  2KCJ A;  1X11 A;  5FI1 A;  2RSG A;  2KR0 A;  4QXA B;  5CLQ B;  2Z59 A;  5I2S A;  2Z4D A;  3OHM B;  1FGZ A;  3HIE A;  2LOZ A;  5D3W A;  4A6F B;  2I1J A;  2YT2 A;  3RCP A;  1LW3 A;  5DIF B;  5J3Y A;  2G35 A;  1BTK A;  2GUM A;  2Z0O A;  2L1C A;  4HDO A;  3X23 A;  1FHO A;  4MK0 A;  2IFS A;  5LOP B;  4P7I A;  1LB1 A;  4KHB A;  1V5U A;  2LYD A;  2COA A;  1U5D A;  4A6K A;  1KZG A;  2OTX A;  1MKE A;  5I2M A;  2QKM A;  3O96 A;  1OQN A;  2ZPY A;  3VOQ A;  1TQZ A;  2JP2 A;  4IAP A;  4HB2 B;  2R0D A;  5D3Y A;  1XX0 A;  4DBB A;  1MAI A;  2CAY A;  5HE2 A;  4DIX A;  4HAY B;  2HTH B;  2DLW A;  4HAZ B;  3TO1 A;  1MIZ B;  2I5C A;  2K2J A;  3SO6 A;  2ROZ B;  4EJN A;  4PQ0 A;  1NU2 A;  2N23 A;  1GC6 A;  2Z0P A;  2VKI A;  2RLO A;  2D9X A;  1J0W A;  1P6S A;  2GS0 A;  2M38 A;  2UZS A;  2IYB A;  4HAW B;  1U27 A;  2KUP A;  4K2P A;  4PNK A;  3TCA A;  2K49 A;  2D9V A;  3VIA A;  4GZU A;  3PEG A;  4L1R A;  4IFS A;  2DHK A;  2RUK B;  1Y5O A;  3HQC A;  3BJI A;  1I7A A;  4GMX B;  3NW8 A;  2CRF A;  1DDM A;  3ODO A;  3KSY A;  1EVH A;  2YF0 A;  4KHA A;  3CIK A;  1WGQ A;  2P0F A;  5M4Y B;  1NTV A;  2DN6 A;  4XWX A;  5D27 A;  2P8V A;  5KCV A;  4MT7 A;  1ZSQ A;  3P6A A;  2FJL A;  1KI1 B;  2HE7 A;  5DH9 B;  3F0W A;  4D6W A;  3ODX A;  2EMS A;  5DHF B;  3ZVR A;  1QQG A;  1X86 A;  4DXA B;  4YON A;  5C79 A;  1OMW A;  1U29 A;  2KGX B;  2DHI A;  3N7C A;  2D2Q A;  3PG7 A;  1RJ2 A;  4TKN A;  2J0K A;  1UEF A;  1V61 A;  1X1G A;  4YL8 A;  1J19 A;  1ZYI A;  1SHC A;  5GOW B;  3G9W A;  4F7G A;  2I1K A;  4EMO A;  1I2H A;  3GYP A;  3U12 A;  2DFK A;  3KY9 A;  2W2X C;  3M1I B;  5KQ1 A;  1Z87 A;  3KRX A;  3SNH A;  4QJ4 B;  2ELA A;  1EGX A;  2K2U A;  1MI1 A;  1OY2 A;  3PVU A;  2K8E A;  3B77 A;  4BBK A;  4A6F A;  4HB0 B;  1FAO A;  2D9Z A;  4KVG B;  3F5R A;  4C0A A;  2XQN M;  2H7D A;  2W2W A;  3PSC A;  2LKO A;  1BAK A;  2VSZ A;  4HAT B;  2DYN A;  2I5F A;  3D8F A;  4HB3 B;  5KQ4 A;  2DTC A;  2RGN B;  3D8D A;  3NWF A;  1UNQ A;  2ZKM X;  3DXD A;  3V5W A;  4D0N B;  1UNR A;  2J0M A;  4DX9 0;  5L81 A;  4TYZ A;  1MK9 B;  1TXD A;  4K2O A;  3WYF B;  1MPH A;  3FEH A;  3HSA A;  2NBV A;  1QC6 A;  3ULC A;  3NWD A;  3TVV A;  2MFQ A;  1MK7 B;  4GXB A;  2D11 A;  2COF A;  4QJ3 B;  5JLJ B;  3MDB C;  1GG3 A;  3PVL A;  1WJM A;  1WJ1 A;  5C16 A;  5CLL B;  3KZ1 A;  5FI0 A;  2EC1 A;  2R09 A;  3BIN A;  4K17 A;  1ISN A;  1GC7 A;  1H4R A;  3FM8 C;  2DX1 A;  1XOD A;  1WG7 A;  2Z0Q A;  2L2I A;  3DCX A;  3A58 A;  1ZC4 B;  3IVF A;  3HK0 A;  4F7H A;  1WGU A;  1V88 A;  4WJ7 A;  3D8E A;  2DHJ A;  1N3H A;  1K5G B;  3DXE A;  1PMS A;  3OAN A;  3KRW A;  3GYO A;  5HE1 A;  4Y94 A;  1H10 A;  1PFJ A;  1ZVR A;  4MY6 A;  4EKU A;  5JHG A;  1TJ6 A;  2D4Q A;  2FJU B;  5C5B B;  4GNK B;  5LG4 B;  3A8Q A; 
#chains in the Genus database with same CATH homology
 2J59 M;  4HAU B;  2RVB B;  2QKL A;  4ZRK A;  5EFX A;  3U7D A;  3ZDT A;  2COD A;  2DKQ A;  1XCG A;  2YVC A;  3SV1 A;  2E2X A;  1AWE A;  1M7E A;  5D3X A;  1FB8 A;  3T06 A;  2OQB A;  3ML4 A;  4GPT B;  4WVF B;  4B6H A;  2RNR B;  4GMV A;  1U2B A;  1FGY A;  4NSW A;  1P3R A;  2GCJ A;  4HAV B;  3CXB B;  2EJ8 A;  2H7E A;  2PZ1 A;  4KAX B;  5J3Q A;  4WSF A;  3QIJ A;  1NI2 A;  2ROV A;  5C5B A;  4CYE A;  1WVH A;  5J3T A;  2ELB A;  2CY5 A;  1IRS A;  3AJ4 A;  4ZRI A;  2D9W A;  3SUZ A;  3NSU A;  4Z2N A;  2UZR A;  2YT0 A;  2YSZ A;  2YS5 A;  2VRW B;  4HB4 B;  4L6E A;  1X1F A;  1V5M A;  4IOY X;  2GJY A;  2P0D A;  4K81 A;  1W1H A;  3ODW A;  1UPR A;  3P7Z A;  3HW2 B;  2ADZ A;  3UZT A;  3ULB A;  5HE0 A;  3TFM A;  2BCJ A;  1EAZ A;  3MPX A;  1P5T A;  5HE3 A;  4A6H A;  2MDX A;  3SYX A;  4CHM A;  2NMB A;  2MKR A;  4GN1 A;  2UVM A;  2LUL A;  4NY0 A;  3DXC A;  3AU4 A;  1ZM0 A;  1DDV A;  3U8Z A;  2EMT A;  2DA0 A;  2LG1 A;  1U5E A;  2D10 A;  4HAX B;  2N0Y A;  1WI1 A;  3QBV B;  3TW1 A;  1B55 A;  2GCL A;  1DDW A;  5DI9 B;  1Q67 A;  2YS1 A;  2M14 A;  2YRY A;  2K00 A;  1V89 A;  5C6R A;  2Q13 A;  3QWM A;  1XR0 B;  3PZD A;  3PP2 A;  4DX8 A;  1FHW A;  1DRO A;  2MWN B;  1NTY A;  2AEH A;  1RRP B;  1MIX A;  1DYN A;  1FOE A;  1XD4 A;  3PVW A;  5D3V A;  1UPQ A;  1W1D A;  2Y8G A;  2CY4 A;  2DX5 A;  2W2X D;  5DHA B;  2V76 A;  2Y7B A;  2LOX A;  4HDQ A;  1ZC3 B;  2Y8F A;  1Y19 B;  2NZ8 B;  2P0H A;  1KZ7 A;  5JP4 A;  1K5D B;  1U5G A;  5JHH A;  4H8S A;  1V5P A;  1E5W A;  1W1G A;  4Z2M B;  2D9Y A;  2DKP A;  2J0J A;  2YT1 A;  5LON B;  1BWN A;  1M7R A;  3LJU X;  4HHV A;  3WA0 A;  4CHJ A;  4F7U P;  1PLS A;  1SGH A;  1FHX A;  3AU5 A;  1U5F A;  2YS3 A;  3FSS A;  1DBH A;  4KHB B;  1UNP A;  3A98 B;  1X05 A;  4A5K A;  3A8P A;  4KHO A;  1EF1 A;  1BTN A;  2DYQ A;  1AQC A;  2X18 A;  2COC A;  2AL6 A;  1XKE A;  4ZRJ A;  2KCJ A;  1X11 A;  5FI1 A;  2RSG A;  5CLQ B;  1FGZ A;  2LOZ A;  5D3W A;  4A6F B;  2I1J A;  3RCP A;  1LW3 A;  5DIF B;  5J3Y A;  2G35 A;  1BTK A;  2Z0O A;  2L1C A;  4HDO A;  3X23 A;  1FHO A;  4MK0 A;  2IFS A;  5LOP B;  4P7I A;  1LB1 A;  1V5U A;  2LYD A;  2COA A;  1U5D A;  4A6K A;  1KZG A;  2OTX A;  1MKE A;  2QKM A;  3O96 A;  1OQN A;  2ZPY A;  3VOQ A;  1TQZ A;  2JP2 A;  4IAP A;  4HB2 B;  2R0D A;  5D3Y A;  1XX0 A;  4DBB A;  1MAI A;  2CAY A;  5HE2 A;  4HAY B;  2HTH B;  2DLW A;  4HAZ B;  3TO1 A;  1MIZ B;  2I5C A;  2K2J A;  3SO6 A;  2ROZ B;  4EJN A;  4PQ0 A;  1NU2 A;  2N23 A;  1GC6 A;  2Z0P A;  2VKI A;  2RLO A;  2D9X A;  1J0W A;  1P6S A;  2GS0 A;  2M38 A;  2UZS A;  2IYB A;  4HAW B;  1U27 A;  2KUP A;  4K2P A;  4PNK A;  3TCA A;  2D9V A;  3VIA A;  4GZU A;  3PEG A;  4IFS A;  2DHK A;  2RUK B;  1Y5O A;  3HQC A;  3BJI A;  1I7A A;  4GMX B;  2CRF A;  1DDM A;  3ODO A;  3KSY A;  1EVH A;  2YF0 A;  4KHA A;  3CIK A;  1WGQ A;  2P0F A;  1NTV A;  2DN6 A;  4XWX A;  5D27 A;  2P8V A;  5KCV A;  4MT7 A;  1ZSQ A;  3P6A A;  2FJL A;  1KI1 B;  2HE7 A;  5DH9 B;  3F0W A;  3ODX A;  2EMS A;  5DHF B;  3ZVR A;  1QQG A;  1X86 A;  4DXA B;  4YON A;  5C79 A;  1OMW A;  1U29 A;  2KGX B;  2DHI A;  3N7C A;  2D2Q A;  3PG7 A;  1RJ2 A;  4TKN A;  2J0K A;  1UEF A;  1V61 A;  1X1G A;  4YL8 A;  1J19 A;  1SHC A;  5GOW B;  3G9W A;  4F7G A;  2I1K A;  4EMO A;  1I2H A;  3GYP A;  2DFK A;  3KY9 A;  2W2X C;  3M1I B;  5KQ1 A;  1Z87 A;  3KRX A;  3SNH A;  2ELA A;  1EGX A;  2K2U A;  1OY2 A;  3PVU A;  4BBK A;  4A6F A;  4HB0 B;  1FAO A;  2D9Z A;  4KVG B;  3F5R A;  4C0A A;  2XQN M;  2H7D A;  2W2W A;  3PSC A;  2LKO A;  1BAK A;  2VSZ A;  4HAT B;  2DYN A;  2I5F A;  4HB3 B;  3D8F A;  5KQ4 A;  2DTC A;  2RGN B;  3D8D A;  1UNQ A;  3DXD A;  3V5W A;  4D0N B;  1UNR A;  2J0M A;  4DX9 0;  5L81 A;  4TYZ A;  1MK9 B;  1TXD A;  4K2O A;  3WYF B;  1MPH A;  3FEH A;  1QC6 A;  3ULC A;  3TVV A;  2MFQ A;  1MK7 B;  4GXB A;  2D11 A;  2COF A;  5JLJ B;  3MDB C;  1GG3 A;  3PVL A;  1WJM A;  1WJ1 A;  5C16 A;  5CLL B;  3KZ1 A;  5FI0 A;  2EC1 A;  2R09 A;  3BIN A;  4K17 A;  1ISN A;  1GC7 A;  1H4R A;  3FM8 C;  2DX1 A;  1XOD A;  1WG7 A;  2Z0Q A;  2L2I A;  1ZC4 B;  3IVF A;  3HK0 A;  4F7H A;  1WGU A;  1V88 A;  4WJ7 A;  3D8E A;  2DHJ A;  1N3H A;  1K5G B;  3DXE A;  1PMS A;  3OAN A;  3KRW A;  3GYO A;  5HE1 A;  4Y94 A;  1H10 A;  1PFJ A;  1ZVR A;  4MY6 A;  4EKU A;  5JHG A;  1TJ6 A;  2D4Q A;  5C5B B;  3A8Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...