1X05A

Solution structure of the c-terminal ph domain of human pleckstrin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
129
structure length
129
Chain Sequence
GSSGSSGVILKEEFRGVIIKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGAEDPLGAIHLRGCVVTSVESNSNGRKSEEENLFEIITADEVHYFLQAATPKERTEWIKAIQMASRTGKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pleckstrin
publication title Solution structure of the C-terminal PH domain of human pleckstrin
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 15
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2005-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1x05A00
5J3QA 1LW3A 2QKMA 3SNHA 4GMXB 2RLOA 2DHJA 3SV1A 4HATB 1X1GA 1UNQA 4F7GA 3ODOA 5CLQB 3A8QA 5C5BB 2JP2A 2HE7A 3HQCA 2AL6A 3TVVA 1XODA 5D3XA 2Q13A 3CIKA 1WJMA 1K5DB 2OTXA 1FAOA 2CODA 2M14A 4DBBA 3TCAA 3WYFB 2YSZA 2D9VA 2COCA 4F7UP 4MK0A 2KCJA 2LYDA 5C16A 3PVUA 1MIZB 3IVFA 3VOQA 4GPTB 3VIAA 2RUKB 2L1CA 2Y8FA 5DI9B 2VKIA 2G35A 1X86A 2DTCA 1X1FA 3ULCA 2DHIA 1FGZA 5CLLB 3PZDA 2DKQA 5JP4A 3ODWA 2Y8GA 2J0MA 4EJNA 2RGNB 4GMVA 5HE1A 1PFJA 1MKEA 1U29A 2DLWA 3P6AA 1FHOA 3ML4A 2UZSA 2EJ8A 5EFXA 3DXDA 2YT1A 4YL8A 1RJ2A 2RNRB 2P0HA 4XWXA 3TFMA 1WI1A 3PVLA 1KZGA 4Y94A 2KUPA 4HAZB 1V5PA 1X11A 3DXCA 1I7AA 2I5CA 4HDQA 3F0WA 5JHHA 4HAWB 4YONA 4TYZA 1EVHA 4KHOA 2GS0A 3P7ZA 1DBHA 2EMSA 3D8EA 2XQNM 4A6FA 1WGQA 4IOYX 5D3WA 4ZRIA 2IYBA 5GOWB 2GCJA 2YS5A 1X05A 1BTNA 1QQGA 3U8ZA 2J0KA 2W2XC 4HAUB 2LOZA 1P3RA 2BCJA 3D8FA 4CHMA 5FI0A 1TQZA 3A98B 2NZ8B 1V88A 1SHCA 3AU4A 2D9WA 5LONB 3V5WA 1SGHA 4HAXB 4NSWA 1MK9B 5C6RA 1W1DA 5DH9B 2J59M 1E5WA 1EAZA 4Z2NA 2CAYA 2X18A 1M7RA 1N3HA 2EMTA 1OQNA 1DDWA 1XD4A 4CYEA 2D9ZA 1J19A 4GZUA 4HB2B 3PG7A 4K17A 3BJIA 2DA0A 1UEFA 1MK7B 4L6EA 4IAPA 1DYNA 2LULA 3KRXA 5L81A 1GC6A 3PEGA 3SO6A 2VSZA 1XX0A 2FJLA 3CXBB 5JHGA 1U5DA 2L2IA 4PNKA 4DX90 3LJUX 4HB3B 3DXEA 2YRYA 1XKEA 5C5BA 2ADZA 2NMBA 5HE2A 4IFSA 1WG7A 3O96A 4DXAB 1FOEA 2ELAA 5J3TA 1WJ1A 3X23A 5D3YA 3SUZA 1NI2A 5DHFB 3AU5A 1U2BA 1XR0B 3QIJA 3M1IB 2R09A 2DFKA 3ULBA 5KQ4A 1J0WA 2DN6A 1ZC3B 1WGUA 1UNPA 1MPHA 1ZM0A 2I5FA 2MDXA 4ZRJA 3KZ1A 2DYQA 2VRWB 3N7CA 2AEHA 2V76A 4DX8A 4HB4B 1Q67A 4MY6A 1Y5OA 3ZVRA 2W2WA 5FI1A 3QBVB 2DX1A 1Y19B 3BINA 2UVMA 1EF1A 4C0AA 2D9YA 2D4QA 1EGXA 1RRPB 5J3YA 5JLJB 2ROVA 3PVWA 3TW1A 2IFSA 2D9XA 1U5FA 4A5KA 1QC6A 4K2PA 1U5GA 2K2JA 2J0JA 4HDOA 1ZC4B 2YF0A 4EMOA 3SYXA 2COAA 4MT7A 4WJ7A 4HAYB 2PZ1A 4KHBB 1P6SA 1LB1A 2Z0OA 1BAKA 2RVBB 2QKLA 2D2QA 2R0DA 1V61A 1NU2A 2HTHB 3TO1A 1FHWA 4PQ0A 5HE3A 2UZRA 2YS3A 2ROZB 3F5RA 4HHVA 3RCPA 3ODXA 2ZPYA 3PSCA 4BBKA 3KRWA 3QWMA 3T06A 2EC1A 3G9WA 3FM8C 1I2HA 1ZSQA 2YS1A 4K2OA 2Y7BA 2DX5A 1FB8A 2LOXA 1NTYA 1WVHA 3HK0A 3KSYA 4GN1A 2GJYA 2P8VA 1PLSA 2P0DA 3NSUA 2M38A 1DDMA 1Z87A 4A6HA 2MKRA 1W1GA 2KGXB 2H7DA 2CY5A 5KQ1A 3A8PA 2D11A 2GCLA 5C79A 1V5UA 3UZTA 4KVGB 2MFQA 5KCVA 4NY0A 4H8SA 2RSGA 3KY9A 1U5EA 3FEHA 1MIXA 1TXDA 1MAIA 2K2UA 1V89A 2Z0PA 3GYOA 2K00A 1OY2A 1H4RA 1KZ7A 1UPQA 1AQCA 3MDBC 5LOPB 1GC7A 2Z0QA 4HAVB 1FHXA 1OMWA 4P7IA 2N23A 1AWEA 4K81A 2DHKA 2LG1A 2H7EA 3MPXA 5DHAB 4EKUA 1FGYA 1DROA 1M7EA 5D27A 4WVFB 2W2XD 2E2XA 4Z2MB 5DIFB 4ZRKA 1BTKA 4A6FB 4A6KA 4KHAA 1W1HA 4TKNA 1IRSA 1NTVA 3FSSA 3HW2B 3D8DA 1TJ6A 2P0FA 4CHJA 4GXBA 1B55A 2DYNA 2D10A 4F7HA 1UNRA 4B6HA 3WA0A 3ZDTA 1U27A 2MWNB 2YVCA 2CY4A 1GG3A 5HE0A 2ELBA 3GYPA 1PMSA 2YT0A 3AJ4A 1K5GB 1V5MA 1UPRA 1P5TA 2OQBA 4KAXB 1H10A 1KI1B 1ZVRA 2I1KA 2N0YA 3OANA 4D0NB 4WSFA 2CRFA 1XCGA 1ISNA 2COFA 2I1JA 3PP2A 5D3VA 3U7DA 1DDVA 2DKPA 2LKOA 1BWNA 4HB0B
chains in the Genus database with same CATH superfamily
2Z14A 5J3QA 1LW3A 2QKMA 3SNHA 4GMXB 2RLOA 2DHJA 5I2SA 3SV1A 4HATB 1X1GA 1UNQA 4F7GA 3ODOA 5CLQB 3A8QA 5C5BB 3HSAA 2JP2A 2HE7A 3HQCA 2AL6A 3TVVA 1XODA 5D3XA 2Q13A 3CIKA 1WJMA 1K5DB 2KR0A 1FAOA 2OTXA 2CODA 2M14A 4DBBA 3TCAA 3WYFB 2YSZA 2D9VA 2COCA 4F7UP 4MK0A 2KCJA 3A58A 2LYDA 3NWFA 5C16A 2KIGA 3PVUA 1MIZB 3IVFA 3VOQA 4GPTB 3VIAA 2RUKB 2L1CA 2Y8FA 5DI9B 2VKIA 2G35A 1X86A 2DTCA 1X1FA 3ULCA 2DHIA 1FGZA 5CLLB 3PZDA 2DKQA 5JP4A 3ODWA 3OHMB 4OSNA 2Y8GA 2J0MA 4EJNA 2RGNB 4GMVA 5HE1A 1PFJA 1MKEA 1U29A 2DLWA 3P6AA 4L1RA 1FHOA 3ML4A 2UZSA 2EJ8A 5EFXA 3DXDA 2YT1A 4YL8A 1RJ2A 2RNRB 2P0HA 4XWXA 3TFMA 1WI1A 3PVLA 1KZGA 4Y94A 2KUPA 4HAZB 1V5PA 4QJ3B 1X11A 3DXCA 2FJUB 1I7AA 2I5CA 4HDQA 3F0WA 5JHHA 4HAWB 4YONA 4TYZA 1EVHA 4KHOA 3U12A 2GS0A 3P7ZA 1DBHA 2EMSA 3D8EA 2XQNM 4A6FA 1WGQA 4IOYX 5D3WA 4ZRIA 2Z59A 2IYBA 5GOWB 2GCJA 2YS5A 1X05A 1BTNA 1QQGA 3U8ZA 2J0KA 2W2XC 4HAUB 2LOZA 1P3RA 2BCJA 2RRFA 3D8FA 4CHMA 5FI0A 1TQZA 2NBVA 3NWDA 3A98B 2NZ8B 1V88A 1SHCA 3AU4A 2D9WA 5LONB 3V5WA 1SGHA 4HAXB 4NSWA 1MK9B 5C6RA 1W1DA 5DH9B 2J59M 1E5WA 1EAZA 4Z2NA 2CAYA 4QJ4B 2X18A 4QJ5B 1M7RA 1N3HA 2EMTA 1OQNA 1DDWA 1XD4A 2Z4DA 4CYEA 2D9ZA 1J19A 4GZUA 4HB2B 3PG7A 4K17A 3BJIA 2DA0A 1UEFA 1MK7B 4L6EA 4D6WA 4IAPA 4DIXA 1DYNA 2LULA 3KRXA 5L81A 1GC6A 3PEGA 3SO6A 2VSZA 1XX0A 2FJLA 3CXBB 5JHGA 1U5DA 2L2IA 4PNKA 4DX90 3LJUX 4HB3B 3DXEA 2YRYA 1XKEA 5C5BA 2ADZA 2NMBA 5HE2A 4IFSA 1WG7A 3O96A 4DXAB 1FOEA 2ELAA 5J3TA 1WJ1A 3NW8A 3X23A 5D3YA 3SUZA 1NI2A 5DHFB 2ZKMX 3AU5A 1U2BA 1XR0B 3QIJA 3M1IB 2R09A 2DFKA 3ULBA 5KQ4A 1J0WA 2DN6A 1ZC3B 1WGUA 1UNPA 1MPHA 1ZM0A 2I5FA 2MDXA 2GUMA 4ZRJA 1ZYIA 3KZ1A 2DYQA 2VRWB 3N7CA 2AEHA 2V76A 4DX8A 4HB4B 1Q67A 4MY6A 1Y5OA 3ZVRA 2W2WA 5FI1A 3QBVB 2DX1A 1Y19B 3BINA 2UVMA 1EF1A 4C0AA 2D9YA 2D4QA 1EGXA 2KUQA 1RRPB 5J3YA 5M4YB 5JLJB 2ROVA 3PVWA 3TW1A 2IFSA 2D9XA 1U5FA 4A5KA 1QC6A 4K2PA 1U5GA 2K2JA 2J0JA 4HDOA 1ZC4B 2YF0A 4EMOA 3SYXA 2COAA 4MT7A 4WJ7A 4HAYB 2PZ1A 4KHBB 5I2MA 3HIEA 3NWAA 1P6SA 1LB1A 5LG4B 2Z0OA 1BAKA 2RVBB 5IRSA 2QKLA 2D2QA 2R0DA 1V61A 1NU2A 4CSQA 2HTHB 3TO1A 1FHWA 4PQ0A 5HE3A 2UZRA 2YS3A 2ROZB 3F5RA 4HHVA 3RCPA 3ODXA 2ZPYA 3PSCA 4BBKA 3KRWA 3QWMA 3T06A 2EC1A 3G9WA 3FVCA 3FM8C 1I2HA 1ZSQA 2YS1A 4K2OA 2Y7BA 2DX5A 1FB8A 2LOXA 1NTYA 1WVHA 3HK0A 3KSYA 4KHBA 4GN1A 2GJYA 2P8VA 1PLSA 2P0DA 3NSUA 2M38A 1DDMA 1Z87A 4A6HA 2YT2A 2MKRA 1W1GA 2KGXB 2H7DA 1T77A 2CY5A 5KQ1A 3A8PA 2D11A 2GCLA 5C79A 1V5UA 3UZTA 4KVGB 2MFQA 5KCVA 4NY0A 4H8SA 2K8EA 2RSGA 3KY9A 1U5EA 3FEHA 1MIXA 4OT1A 1MI1A 1TXDA 1MAIA 2K2UA 1V89A 2Z0PA 3GYOA 2K00A 1OY2A 1H4RA 1KZ7A 1UPQA 1AQCA 3MDBC 5LOPB 1GC7A 2Z0QA 4HAVB 1FHXA 1OMWA 4P7IA 2Z13A 2N23A 1AWEA 3B77A 4K81A 2DHKA 2LG1A 2H7EA 3MPXA 5DHAB 4EKUA 1FGYA 1DROA 1M7EA 5D27A 4WVFB 2W2XD 2E2XA 2R2YA 4Z2MB 5DIFB 4ZRKA 1BTKA 4A6FB 4A6KA 4GOUA 1W1HA 4KHAA 4TKNA 1IRSA 1NTVA 3FSSA 3HW2B 3D8DA 1TJ6A 2P0FA 4GNKB 4CHJA 4GXBA 1B55A 2DYNA 2D10A 4F7HA 1UNRA 4B6HA 4QXAB 3WA0A 3ZDTA 1U27A 4HSIA 2MWNB 2YVCA 2CY4A 1GG3A 5HE0A 2ELBA 3GYPA 1PMSA 2YT0A 3AJ4A 1K5GB 2KIEA 1V5MA 1UPRA 1P5TA 2OQBA 4KAXB 1H10A 1KI1B 1ZVRA 2I1KA 2N0YA 3DCXA 3OANA 4D0NB 4WSFA 2CRFA 2K49A 1XCGA 1ISNA 2COFA 2I1JA 3PP2A 5D3VA 3U7DA 1DDVA 2DKPA 2LKOA 1BWNA 4HB0B
chains in the Genus database with same CATH topology
5J3QA 1LW3A 2QKMA 3SNHA 4GMXB 2RLOA 2DHJA 3SV1A 4HATB 1X1GA 1UNQA 4F7GA 3ODOA 5CLQB 3A8QA 5C5BB 2JP2A 2HE7A 3HQCA 2AL6A 3TVVA 1XODA 5D3XA 2Q13A 3CIKA 1WJMA 1K5DB 2OTXA 1FAOA 2CODA 2M14A 4DBBA 3TCAA 3WYFB 2YSZA 2D9VA 2COCA 4F7UP 4MK0A 2KCJA 2LYDA 5C16A 3PVUA 1MIZB 3IVFA 3VOQA 4GPTB 3VIAA 2RUKB 2L1CA 2Y8FA 5DI9B 2VKIA 2G35A 1X86A 2DTCA 1X1FA 3ULCA 2DHIA 1FGZA 5CLLB 3PZDA 2DKQA 5JP4A 3ODWA 2Y8GA 2J0MA 4EJNA 2RGNB 4GMVA 5HE1A 1PFJA 1MKEA 1U29A 2DLWA 3P6AA 1FHOA 3ML4A 2UZSA 2EJ8A 5EFXA 3DXDA 2YT1A 4YL8A 1RJ2A 2RNRB 2P0HA 4XWXA 3TFMA 1WI1A 3PVLA 1KZGA 4Y94A 2KUPA 4HAZB 1V5PA 1X11A 3DXCA 1I7AA 2I5CA 4HDQA 3F0WA 5JHHA 4HAWB 4YONA 4TYZA 1EVHA 4KHOA 2GS0A 3P7ZA 1DBHA 2EMSA 3D8EA 2XQNM 4A6FA 1WGQA 4IOYX 5D3WA 4ZRIA 2IYBA 5GOWB 2GCJA 2YS5A 1X05A 1BTNA 1QQGA 3U8ZA 2J0KA 2W2XC 4HAUB 2LOZA 1P3RA 2BCJA 3D8FA 4CHMA 5FI0A 1TQZA 3A98B 2NZ8B 1V88A 1SHCA 3AU4A 2D9WA 5LONB 3V5WA 1SGHA 4HAXB 4NSWA 1MK9B 5C6RA 1W1DA 5DH9B 2J59M 1E5WA 1EAZA 4Z2NA 2CAYA 2X18A 1M7RA 1N3HA 2EMTA 1OQNA 1DDWA 1XD4A 4CYEA 2D9ZA 1J19A 4GZUA 4HB2B 3PG7A 4K17A 3BJIA 2DA0A 1UEFA 1MK7B 4L6EA 4IAPA 1DYNA 2LULA 3KRXA 5L81A 1GC6A 3PEGA 3SO6A 2VSZA 1XX0A 2FJLA 3CXBB 5JHGA 1U5DA 2L2IA 4PNKA 4DX90 3LJUX 4HB3B 3DXEA 2YRYA 1XKEA 5C5BA 2ADZA 2NMBA 5HE2A 4IFSA 1WG7A 3O96A 4DXAB 1FOEA 2ELAA 5J3TA 1WJ1A 3X23A 5D3YA 3SUZA 1NI2A 5DHFB 3AU5A 1U2BA 1XR0B 3QIJA 3M1IB 2R09A 2DFKA 3ULBA 5KQ4A 1J0WA 2DN6A 1ZC3B 1WGUA 1UNPA 1MPHA 1ZM0A 2I5FA 2MDXA 4ZRJA 3KZ1A 2DYQA 2VRWB 3N7CA 2AEHA 2V76A 4DX8A 4HB4B 1Q67A 4MY6A 1Y5OA 3ZVRA 2W2WA 5FI1A 3QBVB 2DX1A 1Y19B 3BINA 2UVMA 1EF1A 4C0AA 2D9YA 2D4QA 1EGXA 1RRPB 5J3YA 5JLJB 2ROVA 3PVWA 3TW1A 2IFSA 2D9XA 1U5FA 4A5KA 1QC6A 4K2PA 1U5GA 2K2JA 2J0JA 4HDOA 1ZC4B 2YF0A 4EMOA 3SYXA 2COAA 4MT7A 4WJ7A 4HAYB 2PZ1A 4KHBB 1P6SA 1LB1A 2Z0OA 1BAKA 2RVBB 2QKLA 2D2QA 2R0DA 1V61A 1NU2A 2HTHB 3TO1A 1FHWA 4PQ0A 5HE3A 2UZRA 2YS3A 2ROZB 3F5RA 4HHVA 3RCPA 3ODXA 2ZPYA 3PSCA 4BBKA 3KRWA 3QWMA 3T06A 2EC1A 3G9WA 3FM8C 1I2HA 1ZSQA 2YS1A 4K2OA 2Y7BA 2DX5A 1FB8A 2LOXA 1NTYA 1WVHA 3HK0A 3KSYA 4GN1A 2GJYA 2P8VA 1PLSA 2P0DA 3NSUA 2M38A 1DDMA 1Z87A 4A6HA 2MKRA 1W1GA 2KGXB 2H7DA 2CY5A 5KQ1A 3A8PA 2D11A 2GCLA 5C79A 1V5UA 3UZTA 4KVGB 2MFQA 5KCVA 4NY0A 4H8SA 2RSGA 3KY9A 1U5EA 3FEHA 1MIXA 1TXDA 1MAIA 2K2UA 1V89A 2Z0PA 3GYOA 2K00A 1OY2A 1H4RA 1KZ7A 1UPQA 1AQCA 3MDBC 5LOPB 1GC7A 2Z0QA 4HAVB 1FHXA 1OMWA 4P7IA 2N23A 1AWEA 4K81A 2DHKA 2LG1A 2H7EA 3MPXA 5DHAB 4EKUA 1FGYA 1DROA 1M7EA 5D27A 4WVFB 2W2XD 2E2XA 4Z2MB 5DIFB 4ZRKA 1BTKA 4A6FB 4A6KA 4KHAA 1W1HA 4TKNA 1IRSA 1NTVA 3FSSA 3HW2B 3D8DA 1TJ6A 2P0FA 4CHJA 4GXBA 1B55A 2DYNA 2D10A 4F7HA 1UNRA 4B6HA 3WA0A 3ZDTA 1U27A 2MWNB 2YVCA 2CY4A 1GG3A 5HE0A 2ELBA 3GYPA 1PMSA 2YT0A 3AJ4A 1K5GB 1V5MA 1UPRA 1P5TA 2OQBA 4KAXB 1H10A 1KI1B 1ZVRA 2I1KA 2N0YA 3OANA 4D0NB 4WSFA 2CRFA 1XCGA 1ISNA 2COFA 2I1JA 3PP2A 5D3VA 3U7DA 1DDVA 2DKPA 2LKOA 1BWNA 4HB0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J3Q A;  1LW3 A;  2QKM A;  3SNH A;  4GMX B;  2RLO A;  2DHJ A;  3SV1 A;  4HAT B;  1X1G A;  1UNQ A;  4F7G A;  3ODO A;  5CLQ B;  3A8Q A;  5C5B B;  2JP2 A;  2HE7 A;  3HQC A;  2AL6 A;  3TVV A;  1XOD A;  5D3X A;  2Q13 A;  3CIK A;  1WJM A;  1K5D B;  2OTX A;  1FAO A;  2COD A;  2M14 A;  4DBB A;  3TCA A;  3WYF B;  2YSZ A;  2D9V A;  2COC A;  4F7U P;  4MK0 A;  2KCJ A;  2LYD A;  5C16 A;  3PVU A;  1MIZ B;  3IVF A;  3VOQ A;  4GPT B;  3VIA A;  2RUK B;  2L1C A;  2Y8F A;  5DI9 B;  2VKI A;  2G35 A;  1X86 A;  2DTC A;  1X1F A;  3ULC A;  2DHI A;  1FGZ A;  5CLL B;  3PZD A;  2DKQ A;  5JP4 A;  3ODW A;  2Y8G A;  2J0M A;  4EJN A;  2RGN B;  4GMV A;  5HE1 A;  1PFJ A;  1MKE A;  1U29 A;  2DLW A;  3P6A A;  1FHO A;  3ML4 A;  2UZS A;  2EJ8 A;  5EFX A;  3DXD A;  2YT1 A;  4YL8 A;  1RJ2 A;  2RNR B;  2P0H A;  4XWX A;  3TFM A;  1WI1 A;  3PVL A;  1KZG A;  4Y94 A;  2KUP A;  4HAZ B;  1V5P A;  1X11 A;  3DXC A;  1I7A A;  2I5C A;  4HDQ A;  3F0W A;  5JHH A;  4HAW B;  4YON A;  4TYZ A;  1EVH A;  4KHO A;  2GS0 A;  3P7Z A;  1DBH A;  2EMS A;  3D8E A;  2XQN M;  4A6F A;  1WGQ A;  4IOY X;  5D3W A;  4ZRI A;  2IYB A;  5GOW B;  2GCJ A;  2YS5 A;  1X05 A;  1BTN A;  1QQG A;  3U8Z A;  2J0K A;  2W2X C;  4HAU B;  2LOZ A;  1P3R A;  2BCJ A;  3D8F A;  4CHM A;  5FI0 A;  1TQZ A;  3A98 B;  2NZ8 B;  1V88 A;  1SHC A;  3AU4 A;  2D9W A;  5LON B;  3V5W A;  1SGH A;  4HAX B;  4NSW A;  1MK9 B;  5C6R A;  1W1D A;  5DH9 B;  2J59 M;  1E5W A;  1EAZ A;  4Z2N A;  2CAY A;  2X18 A;  1M7R A;  1N3H A;  2EMT A;  1OQN A;  1DDW A;  1XD4 A;  4CYE A;  2D9Z A;  1J19 A;  4GZU A;  4HB2 B;  3PG7 A;  4K17 A;  3BJI A;  2DA0 A;  1UEF A;  1MK7 B;  4L6E A;  4IAP A;  1DYN A;  2LUL A;  3KRX A;  5L81 A;  1GC6 A;  3PEG A;  3SO6 A;  2VSZ A;  1XX0 A;  2FJL A;  3CXB B;  5JHG A;  1U5D A;  2L2I A;  4PNK A;  4DX9 0;  3LJU X;  4HB3 B;  3DXE A;  2YRY A;  1XKE A;  5C5B A;  2ADZ A;  2NMB A;  5HE2 A;  4IFS A;  1WG7 A;  3O96 A;  4DXA B;  1FOE A;  2ELA A;  5J3T A;  1WJ1 A;  3X23 A;  5D3Y A;  3SUZ A;  1NI2 A;  5DHF B;  3AU5 A;  1U2B A;  1XR0 B;  3QIJ A;  3M1I B;  2R09 A;  2DFK A;  3ULB A;  5KQ4 A;  1J0W A;  2DN6 A;  1ZC3 B;  1WGU A;  1UNP A;  1MPH A;  1ZM0 A;  2I5F A;  2MDX A;  4ZRJ A;  3KZ1 A;  2DYQ A;  2VRW B;  3N7C A;  2AEH A;  2V76 A;  4DX8 A;  4HB4 B;  1Q67 A;  4MY6 A;  1Y5O A;  3ZVR A;  2W2W A;  5FI1 A;  3QBV B;  2DX1 A;  1Y19 B;  3BIN A;  2UVM A;  1EF1 A;  4C0A A;  2D9Y A;  2D4Q A;  1EGX A;  1RRP B;  5J3Y A;  5JLJ B;  2ROV A;  3PVW A;  3TW1 A;  2IFS A;  2D9X A;  1U5F A;  4A5K A;  1QC6 A;  4K2P A;  1U5G A;  2K2J A;  2J0J A;  4HDO A;  1ZC4 B;  2YF0 A;  4EMO A;  3SYX A;  2COA A;  4MT7 A;  4WJ7 A;  4HAY B;  2PZ1 A;  4KHB B;  1P6S A;  1LB1 A;  2Z0O A;  1BAK A;  2RVB B;  2QKL A;  2D2Q A;  2R0D A;  1V61 A;  1NU2 A;  2HTH B;  3TO1 A;  1FHW A;  4PQ0 A;  5HE3 A;  2UZR A;  2YS3 A;  2ROZ B;  3F5R A;  4HHV A;  3RCP A;  3ODX A;  2ZPY A;  3PSC A;  4BBK A;  3KRW A;  3QWM A;  3T06 A;  2EC1 A;  3G9W A;  3FM8 C;  1I2H A;  1ZSQ A;  2YS1 A;  4K2O A;  2Y7B A;  2DX5 A;  1FB8 A;  2LOX A;  1NTY A;  1WVH A;  3HK0 A;  3KSY A;  4GN1 A;  2GJY A;  2P8V A;  1PLS A;  2P0D A;  3NSU A;  2M38 A;  1DDM A;  1Z87 A;  4A6H A;  2MKR A;  1W1G A;  2KGX B;  2H7D A;  2CY5 A;  5KQ1 A;  3A8P A;  2D11 A;  2GCL A;  5C79 A;  1V5U A;  3UZT A;  4KVG B;  2MFQ A;  5KCV A;  4NY0 A;  4H8S A;  2RSG A;  3KY9 A;  1U5E A;  3FEH A;  1MIX A;  1TXD A;  1MAI A;  2K2U A;  1V89 A;  2Z0P A;  3GYO A;  2K00 A;  1OY2 A;  1H4R A;  1KZ7 A;  1UPQ A;  1AQC A;  3MDB C;  5LOP B;  1GC7 A;  2Z0Q A;  4HAV B;  1FHX A;  1OMW A;  4P7I A;  2N23 A;  1AWE A;  4K81 A;  2DHK A;  2LG1 A;  2H7E A;  3MPX A;  5DHA B;  4EKU A;  1FGY A;  1DRO A;  1M7E A;  5D27 A;  4WVF B;  2W2X D;  2E2X A;  4Z2M B;  5DIF B;  4ZRK A;  1BTK A;  4A6F B;  4A6K A;  4KHA A;  1W1H A;  4TKN A;  1IRS A;  1NTV A;  3FSS A;  3HW2 B;  3D8D A;  1TJ6 A;  2P0F A;  4CHJ A;  4GXB A;  1B55 A;  2DYN A;  2D10 A;  4F7H A;  1UNR A;  4B6H A;  3WA0 A;  3ZDT A;  1U27 A;  2MWN B;  2YVC A;  2CY4 A;  1GG3 A;  5HE0 A;  2ELB A;  3GYP A;  1PMS A;  2YT0 A;  3AJ4 A;  1K5G B;  1V5M A;  1UPR A;  1P5T A;  2OQB A;  4KAX B;  1H10 A;  1KI1 B;  1ZVR A;  2I1K A;  2N0Y A;  3OAN A;  4D0N B;  4WSF A;  2CRF A;  1XCG A;  1ISN A;  2COF A;  2I1J A;  3PP2 A;  5D3V A;  3U7D A;  1DDV A;  2DKP A;  2LKO A;  1BWN A;  4HB0 B; 
#chains in the Genus database with same CATH topology
 2Z14 A;  5J3Q A;  1LW3 A;  2QKM A;  3SNH A;  4GMX B;  2RLO A;  2DHJ A;  5I2S A;  3SV1 A;  4HAT B;  1X1G A;  1UNQ A;  4F7G A;  3ODO A;  5CLQ B;  3A8Q A;  5C5B B;  3HSA A;  2JP2 A;  2HE7 A;  3HQC A;  2AL6 A;  3TVV A;  1XOD A;  5D3X A;  2Q13 A;  3CIK A;  1WJM A;  1K5D B;  2KR0 A;  1FAO A;  2OTX A;  2COD A;  2M14 A;  4DBB A;  3TCA A;  3WYF B;  2YSZ A;  2D9V A;  2COC A;  4F7U P;  4MK0 A;  2KCJ A;  3A58 A;  2LYD A;  3NWF A;  5C16 A;  2KIG A;  3PVU A;  1MIZ B;  3IVF A;  3VOQ A;  4GPT B;  3VIA A;  2RUK B;  2L1C A;  2Y8F A;  5DI9 B;  2VKI A;  2G35 A;  1X86 A;  2DTC A;  1X1F A;  3ULC A;  2DHI A;  1FGZ A;  5CLL B;  3PZD A;  2DKQ A;  5JP4 A;  3ODW A;  3OHM B;  4OSN A;  2Y8G A;  2J0M A;  4EJN A;  2RGN B;  4GMV A;  5HE1 A;  1PFJ A;  1MKE A;  1U29 A;  2DLW A;  3P6A A;  4L1R A;  1FHO A;  3ML4 A;  2UZS A;  2EJ8 A;  5EFX A;  3DXD A;  2YT1 A;  4YL8 A;  1RJ2 A;  2RNR B;  2P0H A;  4XWX A;  3TFM A;  1WI1 A;  3PVL A;  1KZG A;  4Y94 A;  2KUP A;  4HAZ B;  1V5P A;  4QJ3 B;  1X11 A;  3DXC A;  2FJU B;  1I7A A;  2I5C A;  4HDQ A;  3F0W A;  5JHH A;  4HAW B;  4YON A;  4TYZ A;  1EVH A;  4KHO A;  3U12 A;  2GS0 A;  3P7Z A;  1DBH A;  2EMS A;  3D8E A;  2XQN M;  4A6F A;  1WGQ A;  4IOY X;  5D3W A;  4ZRI A;  2Z59 A;  2IYB A;  5GOW B;  2GCJ A;  2YS5 A;  1X05 A;  1BTN A;  1QQG A;  3U8Z A;  2J0K A;  2W2X C;  4HAU B;  2LOZ A;  1P3R A;  2BCJ A;  2RRF A;  3D8F A;  4CHM A;  5FI0 A;  1TQZ A;  2NBV A;  3NWD A;  3A98 B;  2NZ8 B;  1V88 A;  1SHC A;  3AU4 A;  2D9W A;  5LON B;  3V5W A;  1SGH A;  4HAX B;  4NSW A;  1MK9 B;  5C6R A;  1W1D A;  5DH9 B;  2J59 M;  1E5W A;  1EAZ A;  4Z2N A;  2CAY A;  4QJ4 B;  2X18 A;  4QJ5 B;  1M7R A;  1N3H A;  2EMT A;  1OQN A;  1DDW A;  1XD4 A;  2Z4D A;  4CYE A;  2D9Z A;  1J19 A;  4GZU A;  4HB2 B;  3PG7 A;  4K17 A;  3BJI A;  2DA0 A;  1UEF A;  1MK7 B;  4L6E A;  4D6W A;  4IAP A;  4DIX A;  1DYN A;  2LUL A;  3KRX A;  5L81 A;  1GC6 A;  3PEG A;  3SO6 A;  2VSZ A;  1XX0 A;  2FJL A;  3CXB B;  5JHG A;  1U5D A;  2L2I A;  4PNK A;  4DX9 0;  3LJU X;  4HB3 B;  3DXE A;  2YRY A;  1XKE A;  5C5B A;  2ADZ A;  2NMB A;  5HE2 A;  4IFS A;  1WG7 A;  3O96 A;  4DXA B;  1FOE A;  2ELA A;  5J3T A;  1WJ1 A;  3NW8 A;  3X23 A;  5D3Y A;  3SUZ A;  1NI2 A;  5DHF B;  2ZKM X;  3AU5 A;  1U2B A;  1XR0 B;  3QIJ A;  3M1I B;  2R09 A;  2DFK A;  3ULB A;  5KQ4 A;  1J0W A;  2DN6 A;  1ZC3 B;  1WGU A;  1UNP A;  1MPH A;  1ZM0 A;  2I5F A;  2MDX A;  2GUM A;  4ZRJ A;  1ZYI A;  3KZ1 A;  2DYQ A;  2VRW B;  3N7C A;  2AEH A;  2V76 A;  4DX8 A;  4HB4 B;  1Q67 A;  4MY6 A;  1Y5O A;  3ZVR A;  2W2W A;  5FI1 A;  3QBV B;  2DX1 A;  1Y19 B;  3BIN A;  2UVM A;  1EF1 A;  4C0A A;  2D9Y A;  2D4Q A;  1EGX A;  2KUQ A;  1RRP B;  5J3Y A;  5M4Y B;  5JLJ B;  2ROV A;  3PVW A;  3TW1 A;  2IFS A;  2D9X A;  1U5F A;  4A5K A;  1QC6 A;  4K2P A;  1U5G A;  2K2J A;  2J0J A;  4HDO A;  1ZC4 B;  2YF0 A;  4EMO A;  3SYX A;  2COA A;  4MT7 A;  4WJ7 A;  4HAY B;  2PZ1 A;  4KHB B;  5I2M A;  3HIE A;  3NWA A;  1P6S A;  1LB1 A;  5LG4 B;  2Z0O A;  1BAK A;  2RVB B;  5IRS A;  2QKL A;  2D2Q A;  2R0D A;  1V61 A;  1NU2 A;  4CSQ A;  2HTH B;  3TO1 A;  1FHW A;  4PQ0 A;  5HE3 A;  2UZR A;  2YS3 A;  2ROZ B;  3F5R A;  4HHV A;  3RCP A;  3ODX A;  2ZPY A;  3PSC A;  4BBK A;  3KRW A;  3QWM A;  3T06 A;  2EC1 A;  3G9W A;  3FVC A;  3FM8 C;  1I2H A;  1ZSQ A;  2YS1 A;  4K2O A;  2Y7B A;  2DX5 A;  1FB8 A;  2LOX A;  1NTY A;  1WVH A;  3HK0 A;  3KSY A;  4KHB A;  4GN1 A;  2GJY A;  2P8V A;  1PLS A;  2P0D A;  3NSU A;  2M38 A;  1DDM A;  1Z87 A;  4A6H A;  2YT2 A;  2MKR A;  1W1G A;  2KGX B;  2H7D A;  1T77 A;  2CY5 A;  5KQ1 A;  3A8P A;  2D11 A;  2GCL A;  5C79 A;  1V5U A;  3UZT A;  4KVG B;  2MFQ A;  5KCV A;  4NY0 A;  4H8S A;  2K8E A;  2RSG A;  3KY9 A;  1U5E A;  3FEH A;  1MIX A;  4OT1 A;  1MI1 A;  1TXD A;  1MAI A;  2K2U A;  1V89 A;  2Z0P A;  3GYO A;  2K00 A;  1OY2 A;  1H4R A;  1KZ7 A;  1UPQ A;  1AQC A;  3MDB C;  5LOP B;  1GC7 A;  2Z0Q A;  4HAV B;  1FHX A;  1OMW A;  4P7I A;  2Z13 A;  2N23 A;  1AWE A;  3B77 A;  4K81 A;  2DHK A;  2LG1 A;  2H7E A;  3MPX A;  5DHA B;  4EKU A;  1FGY A;  1DRO A;  1M7E A;  5D27 A;  4WVF B;  2W2X D;  2E2X A;  2R2Y A;  4Z2M B;  5DIF B;  4ZRK A;  1BTK A;  4A6F B;  4A6K A;  4GOU A;  1W1H A;  4KHA A;  4TKN A;  1IRS A;  1NTV A;  3FSS A;  3HW2 B;  3D8D A;  1TJ6 A;  2P0F A;  4GNK B;  4CHJ A;  4GXB A;  1B55 A;  2DYN A;  2D10 A;  4F7H A;  1UNR A;  4B6H A;  4QXA B;  3WA0 A;  3ZDT A;  1U27 A;  4HSI A;  2MWN B;  2YVC A;  2CY4 A;  1GG3 A;  5HE0 A;  2ELB A;  3GYP A;  1PMS A;  2YT0 A;  3AJ4 A;  1K5G B;  2KIE A;  1V5M A;  1UPR A;  1P5T A;  2OQB A;  4KAX B;  1H10 A;  1KI1 B;  1ZVR A;  2I1K A;  2N0Y A;  3DCX A;  3OAN A;  4D0N B;  4WSF A;  2CRF A;  2K49 A;  1XCG A;  1ISN A;  2COF A;  2I1J A;  3PP2 A;  5D3V A;  3U7D A;  1DDV A;  2DKP A;  2LKO A;  1BWN A;  4HB0 B; 
#chains in the Genus database with same CATH homology
 5J3Q A;  1LW3 A;  2QKM A;  3SNH A;  4GMX B;  2RLO A;  2DHJ A;  3SV1 A;  4HAT B;  1X1G A;  1UNQ A;  4F7G A;  3ODO A;  5CLQ B;  3A8Q A;  5C5B B;  2JP2 A;  2HE7 A;  3HQC A;  2AL6 A;  3TVV A;  1XOD A;  5D3X A;  2Q13 A;  3CIK A;  1WJM A;  1K5D B;  2OTX A;  1FAO A;  2COD A;  2M14 A;  4DBB A;  3TCA A;  3WYF B;  2YSZ A;  2D9V A;  2COC A;  4F7U P;  4MK0 A;  2KCJ A;  2LYD A;  5C16 A;  3PVU A;  1MIZ B;  3IVF A;  3VOQ A;  4GPT B;  3VIA A;  2RUK B;  2L1C A;  2Y8F A;  5DI9 B;  2VKI A;  2G35 A;  1X86 A;  2DTC A;  1X1F A;  3ULC A;  2DHI A;  1FGZ A;  5CLL B;  3PZD A;  2DKQ A;  5JP4 A;  3ODW A;  2Y8G A;  2J0M A;  4EJN A;  2RGN B;  4GMV A;  5HE1 A;  1PFJ A;  1MKE A;  1U29 A;  2DLW A;  3P6A A;  1FHO A;  3ML4 A;  2UZS A;  2EJ8 A;  5EFX A;  3DXD A;  2YT1 A;  4YL8 A;  1RJ2 A;  2RNR B;  2P0H A;  4XWX A;  3TFM A;  1WI1 A;  3PVL A;  1KZG A;  4Y94 A;  2KUP A;  4HAZ B;  1V5P A;  1X11 A;  3DXC A;  1I7A A;  2I5C A;  4HDQ A;  3F0W A;  5JHH A;  4HAW B;  4YON A;  4TYZ A;  1EVH A;  4KHO A;  2GS0 A;  3P7Z A;  1DBH A;  2EMS A;  3D8E A;  2XQN M;  4A6F A;  1WGQ A;  4IOY X;  5D3W A;  4ZRI A;  2IYB A;  5GOW B;  2GCJ A;  2YS5 A;  1X05 A;  1BTN A;  1QQG A;  3U8Z A;  2J0K A;  2W2X C;  4HAU B;  2LOZ A;  1P3R A;  2BCJ A;  3D8F A;  4CHM A;  5FI0 A;  1TQZ A;  3A98 B;  2NZ8 B;  1V88 A;  1SHC A;  3AU4 A;  2D9W A;  5LON B;  3V5W A;  1SGH A;  4HAX B;  4NSW A;  1MK9 B;  5C6R A;  1W1D A;  5DH9 B;  2J59 M;  1E5W A;  1EAZ A;  4Z2N A;  2CAY A;  2X18 A;  1M7R A;  1N3H A;  2EMT A;  1OQN A;  1DDW A;  1XD4 A;  4CYE A;  2D9Z A;  1J19 A;  4GZU A;  4HB2 B;  3PG7 A;  4K17 A;  3BJI A;  2DA0 A;  1UEF A;  1MK7 B;  4L6E A;  4IAP A;  1DYN A;  2LUL A;  3KRX A;  5L81 A;  1GC6 A;  3PEG A;  3SO6 A;  2VSZ A;  1XX0 A;  2FJL A;  3CXB B;  5JHG A;  1U5D A;  2L2I A;  4PNK A;  4DX9 0;  3LJU X;  4HB3 B;  3DXE A;  2YRY A;  1XKE A;  5C5B A;  2ADZ A;  2NMB A;  5HE2 A;  4IFS A;  1WG7 A;  3O96 A;  4DXA B;  1FOE A;  2ELA A;  5J3T A;  1WJ1 A;  3X23 A;  5D3Y A;  3SUZ A;  1NI2 A;  5DHF B;  3AU5 A;  1U2B A;  1XR0 B;  3QIJ A;  3M1I B;  2R09 A;  2DFK A;  3ULB A;  5KQ4 A;  1J0W A;  2DN6 A;  1ZC3 B;  1WGU A;  1UNP A;  1MPH A;  1ZM0 A;  2I5F A;  2MDX A;  4ZRJ A;  3KZ1 A;  2DYQ A;  2VRW B;  3N7C A;  2AEH A;  2V76 A;  4DX8 A;  4HB4 B;  1Q67 A;  4MY6 A;  1Y5O A;  3ZVR A;  2W2W A;  5FI1 A;  3QBV B;  2DX1 A;  1Y19 B;  3BIN A;  2UVM A;  1EF1 A;  4C0A A;  2D9Y A;  2D4Q A;  1EGX A;  1RRP B;  5J3Y A;  5JLJ B;  2ROV A;  3PVW A;  3TW1 A;  2IFS A;  2D9X A;  1U5F A;  4A5K A;  1QC6 A;  4K2P A;  1U5G A;  2K2J A;  2J0J A;  4HDO A;  1ZC4 B;  2YF0 A;  4EMO A;  3SYX A;  2COA A;  4MT7 A;  4WJ7 A;  4HAY B;  2PZ1 A;  4KHB B;  1P6S A;  1LB1 A;  2Z0O A;  1BAK A;  2RVB B;  2QKL A;  2D2Q A;  2R0D A;  1V61 A;  1NU2 A;  2HTH B;  3TO1 A;  1FHW A;  4PQ0 A;  5HE3 A;  2UZR A;  2YS3 A;  2ROZ B;  3F5R A;  4HHV A;  3RCP A;  3ODX A;  2ZPY A;  3PSC A;  4BBK A;  3KRW A;  3QWM A;  3T06 A;  2EC1 A;  3G9W A;  3FM8 C;  1I2H A;  1ZSQ A;  2YS1 A;  4K2O A;  2Y7B A;  2DX5 A;  1FB8 A;  2LOX A;  1NTY A;  1WVH A;  3HK0 A;  3KSY A;  4GN1 A;  2GJY A;  2P8V A;  1PLS A;  2P0D A;  3NSU A;  2M38 A;  1DDM A;  1Z87 A;  4A6H A;  2MKR A;  1W1G A;  2KGX B;  2H7D A;  2CY5 A;  5KQ1 A;  3A8P A;  2D11 A;  2GCL A;  5C79 A;  1V5U A;  3UZT A;  4KVG B;  2MFQ A;  5KCV A;  4NY0 A;  4H8S A;  2RSG A;  3KY9 A;  1U5E A;  3FEH A;  1MIX A;  1TXD A;  1MAI A;  2K2U A;  1V89 A;  2Z0P A;  3GYO A;  2K00 A;  1OY2 A;  1H4R A;  1KZ7 A;  1UPQ A;  1AQC A;  3MDB C;  5LOP B;  1GC7 A;  2Z0Q A;  4HAV B;  1FHX A;  1OMW A;  4P7I A;  2N23 A;  1AWE A;  4K81 A;  2DHK A;  2LG1 A;  2H7E A;  3MPX A;  5DHA B;  4EKU A;  1FGY A;  1DRO A;  1M7E A;  5D27 A;  4WVF B;  2W2X D;  2E2X A;  4Z2M B;  5DIF B;  4ZRK A;  1BTK A;  4A6F B;  4A6K A;  4KHA A;  1W1H A;  4TKN A;  1IRS A;  1NTV A;  3FSS A;  3HW2 B;  3D8D A;  1TJ6 A;  2P0F A;  4CHJ A;  4GXB A;  1B55 A;  2DYN A;  2D10 A;  4F7H A;  1UNR A;  4B6H A;  3WA0 A;  3ZDT A;  1U27 A;  2MWN B;  2YVC A;  2CY4 A;  1GG3 A;  5HE0 A;  2ELB A;  3GYP A;  1PMS A;  2YT0 A;  3AJ4 A;  1K5G B;  1V5M A;  1UPR A;  1P5T A;  2OQB A;  4KAX B;  1H10 A;  1KI1 B;  1ZVR A;  2I1K A;  2N0Y A;  3OAN A;  4D0N B;  4WSF A;  2CRF A;  1XCG A;  1ISN A;  2COF A;  2I1J A;  3PP2 A;  5D3V A;  3U7D A;  1DDV A;  2DKP A;  2LKO A;  1BWN A;  4HB0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...