1X05A

Solution structure of the c-terminal ph domain of human pleckstrin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
129
structure length
129
Chain Sequence
b'GSSGSSGVILKEEFRGVIIKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGAEDPLGAIHLRGCVVTSVESNSNGRKSEEENLFEIITADEVHYFLQAATPKERTEWIKAIQMASRTGKSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pleckstrin
publication title Solution structure of the C-terminal PH domain of human pleckstrin
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 15
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2005-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1x05A00
3TCAA 2YT0A 2K2JA 3TO1A 1K5GB 1V5MA 2R0DA 5J3TA 1M7EA 5C6RA 2LOZA 1LW3A 3PEGA 2V76A 1FHXA 2YS1A 5JHHA 2L1CA 4WVFB 4P7IA 3IVFA 4K81A 1MPHA 4F7HA 4HAZB 2DHJA 1MIXA 4WSFA 3M1IB 1MK9B 1U2BA 1W1GA 4MT7A 2DLWA 1H4RA 1U27A 1DDMA 2J0KA 2J0MA 2FJLA 3FEHA 5DH9B 3U7DA 4F7GA 2DKQA 2J0JA 5FI0A 4YL8A 2EMTA 3PP2A 3FSSA 2RLOA 2RSGA 5D3XA 1OQNA 2GCLA 1DDWA 2K2UA 3UZTA 4ZRJA 4C0AA 4DX8A 4NSWA 3TVVA 3KRXA 4HDQA 2QKMA 3ULBA 2G35A 3NSUA 1UNRA 5JP4A 4K17A 4Z2MB 4HAXB 3D8EA 4A6KA 3SV1A 2COCA 2RGNB 4A5KA 1U29A 5CLLB 2DA0A 4GPTB 1WI1A 3ZVRA 5D3VA 3HK0A 1N3HA 3KY9A 4DXAB 4KHBB 2LG1A 2IFSA 4Z2NA 3DXDA 1E5WA 5DHAB 2N0YA 2J59M 5C79A 2LKOA 4A6HA 2Z0PA 3P7ZA 1W1HA 4IAPA 1TJ6A 4HAVB 1M7RA 4CYEA 2HTHB 2YVCA 1GC7A 1UNPA 1B55A 3VOQA 2AL6A 2KGXB 1LB1A 2LOXA 1Q67A 2PZ1A 3SO6A 4WJ7A 4KHAA 1KI1B 2YF0A 2D9VA 4L6EA 3F0WA 1U5FA 2YRYA 3RCPA 1UPQA 1J0WA 5DI9B 1EVHA 3HQCA 4HAYB 3CIKA 1ZSQA 1X1FA 4K2OA 5HE3A 2E2XA 2GCJA 3F5RA 3TFMA 1RJ2A 2Z0QA 5FI1A 3ZDTA 1V61A 1PMSA 3D8DA 1NTVA 2X18A 4CHJA 4D0NB 3QBVB 1V89A 4HATB 1Y19B 5C16A 4HDOA 1RRPB 2EMSA 3G9WA 2COFA 1WG7A 1P3RA 2D4QA 1WJ1A 1WGQA 1J19A 4HAUB 3BINA 2NZ8B 4TYZA 2DHIA 3AU4A 1ZC4B 1BTKA 4HAWB 1DROA 4PNKA 4IOYX 5HE1A 3N7CA 2R09A 4TKNA 3KZ1A 4HHVA 2Y7BA 3PVUA 2NMBA 2P8VA 1FHOA 1GG3A 3SYXA 3ODXA 2GJYA 3D8FA 1WVHA 1MKEA 1OMWA 3SNHA 2L2IA 1XX0A 2DTCA 2DHKA 3OANA 2EC1A 1I7AA 2ADZA 2YS5A 1FHWA 1X11A 1SHCA 1V5PA 2P0FA 1EF1A 3BJIA 1U5DA 3WA0A 2GS0A 1UEFA 1Z87A 1XCGA 2DKPA 2Y8GA 1NI2A 3FM8C 3X23A 1NTYA 2DN6A 2MFQA 4ZRKA 1ZC3B 1V88A 1UPRA 1XKEA 3QIJA 4NY0A 1DBHA 2AEHA 2D9XA 1MIZB 4EKUA 5D27A 4IFSA 2LULA 2ROVA 2D11A 3P6AA 5JLJB 2H7DA 1X05A 1Y5OA 2KUPA 2W2WA 2D10A 3CXBB 1GC6A 1UNQA 2CY4A 4YONA 3A8QA 2MKRA 5C5BB 2EJ8A 3A8PA 2Z0OA 1FB8A 2ROZB 1K5DB 5LONB 4ZRIA 1WGUA 2MWNB 2M38A 3T06A 4KVGB 1PFJA 5GOWB 2Y8FA 2Q13A 2I1JA 3PZDA 2YS3A 2D9YA 1BTNA 4GZUA 3TW1A 5HE0A 3WYFB 2P0DA 3A98B 3SUZA 4KAXB 4GMVA 2RVBB 1PLSA 2P0HA 4Y94A 2H7EA 1SGHA 1TXDA 2UZSA 2BCJA 3QWMA 1P6SA 4DBBA 2JP2A 1XR0B 2VRWB 4F7UP 2DX5A 3VIAA 2VSZA 5J3QA 2D9ZA 2W2XD 3O96A 1ZVRA 3KRWA 4A6FB 3GYOA 3MPXA 2CY5A 1IRSA 1V5UA 2D9WA 3V5WA 2I1KA 2IYBA 5D3YA 3ULCA 1FAOA 1AWEA 3PVWA 4GMXB 4EMOA 4GN1A 5HE2A 2K00A 2M14A 1FOEA 1I2HA 4HB0B 3U8ZA 2N23A 1X86A 5KCVA 1XD4A 5C5BA 4H8SA 1X1GA 2D2QA 2I5CA 2YSZA 3KSYA 4K2PA 2DX1A 1XODA 3AU5A 2CAYA 1FGZA 4MK0A 2OTXA 5KQ1A 3DXEA 2COAA 1KZGA 2VKIA 2OQBA 4KHOA 2XQNM 1KZ7A 5DHFB 1MK7B 4B6HA 3ODOA 2ELBA 3ODWA 4GXBA 3PVLA 1DDVA 4EJNA 1H10A 2QKLA 1EAZA 2RNRB 3PSCA 5CLQB 1FGYA 2DFKA 2KCJA 2ELAA 2RUKB 1MAIA 5J3YA 2DYQA 4CHMA 2HE7A 4HB3B 5EFXA 4A6FA 4PQ0A 2W2XC 2DYNA 1AQCA 3HW2B 1BWNA 2UVMA 1WJMA 4HB2B 3LJUX 2MDXA 2ZPYA 1QQGA 1QC6A 3MDBC 5JHGA 1U5EA 4BBKA 3DXCA 3PG7A 1TQZA 2CRFA 1DYNA 1P5TA 2UZRA 4HB4B 5LOPB 2I5FA 1EGXA 3GYPA 1U5GA 1NU2A 2LYDA 5DIFB 1ISNA 3AJ4A 1OY2A 5D3WA 5L81A 2CODA 1BAKA 2YT1A 4MY6A 4XWXA 1W1DA 4DX90 5KQ4A 3ML4A 1ZM0A
chains in the Genus database with same CATH superfamily
3TCAA 2YT0A 2K2JA 4QJ4B 2NBVA 1K5GB 3TO1A 1V5MA 2R0DA 5J3TA 1M7EA 5C6RA 2LOZA 1LW3A 3PEGA 2V76A 1FHXA 2YS1A 5JHHA 2L1CA 4WVFB 4P7IA 3IVFA 4K81A 1MPHA 4F7HA 4HAZB 2DHJA 3B77A 1MIXA 4GNKB 4WSFA 3M1IB 1MK9B 1U2BA 1W1GA 4MT7A 2DLWA 1H4RA 1U27A 1DDMA 2J0KA 2ZKMX 2J0MA 2FJLA 3FEHA 5DH9B 3U7DA 4F7GA 2DKQA 2J0JA 5FI0A 3HIEA 4YL8A 1MI1A 2EMTA 3PP2A 3FSSA 2RLOA 2RSGA 5D3XA 5M4YB 1OQNA 2GCLA 3OHMB 1DDWA 2K2UA 3UZTA 4ZRJA 4C0AA 4DX8A 4NSWA 3TVVA 3KRXA 4HDQA 2QKMA 3ULBA 2G35A 4QXAB 3NSUA 1UNRA 5JP4A 4K17A 4Z2MB 4HAXB 2K8EA 3D8EA 4A6KA 3SV1A 2COCA 2RGNB 4A5KA 1U29A 5CLLB 2DA0A 4GPTB 1WI1A 3NWAA 3ZVRA 5D3VA 3HK0A 1N3HA 3KY9A 4DXAB 4KHBB 2LG1A 2IFSA 4Z2NA 3DXDA 1E5WA 5DHAB 2N0YA 2J59M 5C79A 2LKOA 4A6HA 2Z0PA 3P7ZA 1W1HA 4IAPA 1TJ6A 4HAVB 1M7RA 4CYEA 2HTHB 2YVCA 1GC7A 3HSAA 1UNPA 1B55A 4QJ3B 3VOQA 2AL6A 2KGXB 4QJ5B 1LB1A 2LOXA 1Q67A 2PZ1A 3SO6A 4WJ7A 4KHAA 1KI1B 2YF0A 2D9VA 4L6EA 3F0WA 1U5FA 2YRYA 3RCPA 1UPQA 1J0WA 5DI9B 1EVHA 3HQCA 4HAYB 3CIKA 4L1RA 1ZSQA 1X1FA 3FVCA 4K2OA 5HE3A 2E2XA 2GCJA 3F5RA 3TFMA 1RJ2A 2Z0QA 5FI1A 1ZYIA 3ZDTA 1V61A 1PMSA 4OT1A 3D8DA 1NTVA 2X18A 4CHJA 4D0NB 3QBVB 1V89A 2FJUB 4HATB 1Y19B 5C16A 4HDOA 1RRPB 2EMSA 3DCXA 3G9WA 2COFA 1WG7A 1P3RA 2D4QA 1WJ1A 1WGQA 1J19A 4HAUB 5IRSA 3BINA 2NZ8B 4TYZA 2DHIA 3AU4A 1ZC4B 1BTKA 4HAWB 1DROA 4PNKA 4IOYX 5HE1A 3N7CA 2R09A 4TKNA 3KZ1A 4HHVA 2Y7BA 3PVUA 2KR0A 2NMBA 2P8VA 1FHOA 1GG3A 3SYXA 4CSQA 3ODXA 2GJYA 3D8FA 1WVHA 1MKEA 1OMWA 3A58A 2L2IA 3SNHA 1XX0A 2DTCA 2DHKA 3OANA 2EC1A 1I7AA 2ADZA 2YS5A 1FHWA 3NWFA 1X11A 1SHCA 1V5PA 2P0FA 1EF1A 3BJIA 1U5DA 3WA0A 2Z13A 2GS0A 1UEFA 1Z87A 1XCGA 2DKPA 2Y8GA 5I2SA 1NI2A 3FM8C 3X23A 1NTYA 2DN6A 2MFQA 4ZRKA 1ZC3B 1V88A 1UPRA 1XKEA 3QIJA 4NY0A 1DBHA 2AEHA 2D9XA 1MIZB 4EKUA 3NWDA 2Z59A 5LG4B 5D27A 4IFSA 1T77A 2LULA 2ROVA 2D11A 3P6AA 5JLJB 2H7DA 1X05A 1Y5OA 2KUPA 2W2WA 2D10A 3CXBB 2GUMA 1GC6A 1UNQA 2CY4A 4YONA 3A8QA 2MKRA 5C5BB 3NW8A 2EJ8A 4DIXA 3A8PA 2Z0OA 1FB8A 2ROZB 1K5DB 5LONB 4ZRIA 1WGUA 2MWNB 2M38A 3T06A 4KVGB 1PFJA 5GOWB 2Y8FA 2Q13A 2I1JA 3PZDA 2YS3A 2D9YA 1BTNA 4GZUA 3TW1A 5HE0A 3WYFB 2P0DA 3A98B 3SUZA 4KAXB 4GMVA 2RVBB 1PLSA 2P0HA 4Y94A 2H7EA 1TXDA 1SGHA 2UZSA 3U12A 2BCJA 3QWMA 1P6SA 4DBBA 2JP2A 1XR0B 2VRWB 4F7UP 2DX5A 3VIAA 4OSNA 2VSZA 5J3QA 4GOUA 2D9ZA 2K49A 2Z4DA 2W2XD 3O96A 1ZVRA 3KRWA 4A6FB 3GYOA 3MPXA 2CY5A 4KHBA 4D6WA 2KIGA 1IRSA 1V5UA 2KIEA 2D9WA 3V5WA 2I1KA 2IYBA 5D3YA 3ULCA 1FAOA 1AWEA 3PVWA 4GMXB 4EMOA 4GN1A 5HE2A 2K00A 2M14A 1FOEA 1I2HA 4HB0B 3U8ZA 2N23A 1X86A 5KCVA 1XD4A 5C5BA 4H8SA 1X1GA 2D2QA 2I5CA 2YSZA 2YT2A 3KSYA 4K2PA 2DX1A 1XODA 3AU5A 2CAYA 1FGZA 2R2YA 4MK0A 2OTXA 5KQ1A 3DXEA 2COAA 1KZGA 2VKIA 2OQBA 4KHOA 2XQNM 1KZ7A 5DHFB 1MK7B 4B6HA 4HSIA 3ODOA 2ELBA 3ODWA 4GXBA 3PVLA 1DDVA 4EJNA 1H10A 2QKLA 1EAZA 2RNRB 3PSCA 5CLQB 1FGYA 2DFKA 2KCJA 2ELAA 2RUKB 1MAIA 5J3YA 2DYQA 4CHMA 2HE7A 2Z14A 4HB3B 5EFXA 4A6FA 4PQ0A 2W2XC 2DYNA 1AQCA 3HW2B 1BWNA 2UVMA 1WJMA 4HB2B 3LJUX 2MDXA 2ZPYA 1QQGA 1QC6A 3MDBC 5JHGA 1U5EA 4BBKA 3DXCA 3PG7A 1TQZA 2CRFA 1DYNA 1P5TA 5I2MA 2UZRA 2KUQA 4HB4B 5LOPB 2I5FA 2RRFA 1EGXA 3GYPA 1U5GA 1NU2A 2LYDA 5DIFB 1ISNA 3AJ4A 1OY2A 5D3WA 5L81A 2CODA 1BAKA 2YT1A 4MY6A 4XWXA 1W1DA 4DX90 5KQ4A 3ML4A 1ZM0A
chains in the Genus database with same CATH topology
3TCAA 2YT0A 2K2JA 3TO1A 1K5GB 1V5MA 2R0DA 5J3TA 1M7EA 5C6RA 2LOZA 1LW3A 3PEGA 2V76A 1FHXA 2YS1A 5JHHA 2L1CA 4WVFB 4P7IA 3IVFA 4K81A 1MPHA 4F7HA 4HAZB 2DHJA 1MIXA 4WSFA 3M1IB 1MK9B 1U2BA 1W1GA 4MT7A 2DLWA 1H4RA 1U27A 1DDMA 2J0KA 2J0MA 2FJLA 3FEHA 5DH9B 3U7DA 4F7GA 2DKQA 2J0JA 5FI0A 4YL8A 2EMTA 3PP2A 3FSSA 2RLOA 2RSGA 5D3XA 1OQNA 2GCLA 1DDWA 2K2UA 3UZTA 4ZRJA 4C0AA 4DX8A 4NSWA 3TVVA 3KRXA 4HDQA 2QKMA 3ULBA 2G35A 3NSUA 1UNRA 5JP4A 4K17A 4Z2MB 4HAXB 3D8EA 4A6KA 3SV1A 2COCA 2RGNB 4A5KA 1U29A 5CLLB 2DA0A 4GPTB 1WI1A 3ZVRA 5D3VA 3HK0A 1N3HA 3KY9A 4DXAB 4KHBB 2LG1A 2IFSA 4Z2NA 3DXDA 1E5WA 5DHAB 2N0YA 2J59M 5C79A 2LKOA 4A6HA 2Z0PA 3P7ZA 1W1HA 4IAPA 1TJ6A 4HAVB 1M7RA 4CYEA 2HTHB 2YVCA 1GC7A 1UNPA 1B55A 3VOQA 2AL6A 2KGXB 1LB1A 2LOXA 1Q67A 2PZ1A 3SO6A 4WJ7A 4KHAA 1KI1B 2YF0A 2D9VA 4L6EA 3F0WA 1U5FA 2YRYA 3RCPA 1UPQA 1J0WA 5DI9B 1EVHA 3HQCA 4HAYB 3CIKA 1ZSQA 1X1FA 4K2OA 5HE3A 2E2XA 2GCJA 3F5RA 3TFMA 1RJ2A 2Z0QA 5FI1A 3ZDTA 1V61A 1PMSA 3D8DA 1NTVA 2X18A 4CHJA 4D0NB 3QBVB 1V89A 4HATB 1Y19B 5C16A 4HDOA 1RRPB 2EMSA 3G9WA 2COFA 1WG7A 1P3RA 2D4QA 1WJ1A 1WGQA 1J19A 4HAUB 3BINA 2NZ8B 4TYZA 2DHIA 3AU4A 1ZC4B 1BTKA 4HAWB 1DROA 4PNKA 4IOYX 5HE1A 3N7CA 2R09A 4TKNA 3KZ1A 4HHVA 2Y7BA 3PVUA 2NMBA 2P8VA 1FHOA 1GG3A 3SYXA 3ODXA 2GJYA 3D8FA 1WVHA 1MKEA 1OMWA 3SNHA 2L2IA 1XX0A 2DTCA 2DHKA 3OANA 2EC1A 1I7AA 2ADZA 2YS5A 1FHWA 1X11A 1SHCA 1V5PA 2P0FA 1EF1A 3BJIA 1U5DA 3WA0A 2GS0A 1UEFA 1Z87A 1XCGA 2DKPA 2Y8GA 1NI2A 3FM8C 3X23A 1NTYA 2DN6A 2MFQA 4ZRKA 1ZC3B 1V88A 1UPRA 1XKEA 3QIJA 4NY0A 1DBHA 2AEHA 2D9XA 1MIZB 4EKUA 5D27A 4IFSA 2LULA 2ROVA 2D11A 3P6AA 5JLJB 2H7DA 1X05A 1Y5OA 2KUPA 2W2WA 2D10A 3CXBB 1GC6A 1UNQA 2CY4A 4YONA 3A8QA 2MKRA 5C5BB 2EJ8A 3A8PA 2Z0OA 1FB8A 2ROZB 1K5DB 5LONB 4ZRIA 1WGUA 2MWNB 2M38A 3T06A 4KVGB 1PFJA 5GOWB 2Y8FA 2Q13A 2I1JA 3PZDA 2YS3A 2D9YA 1BTNA 4GZUA 3TW1A 5HE0A 3WYFB 2P0DA 3A98B 3SUZA 4KAXB 4GMVA 2RVBB 1PLSA 2P0HA 4Y94A 2H7EA 1SGHA 1TXDA 2UZSA 2BCJA 3QWMA 1P6SA 4DBBA 2JP2A 1XR0B 2VRWB 4F7UP 2DX5A 3VIAA 2VSZA 5J3QA 2D9ZA 2W2XD 3O96A 1ZVRA 3KRWA 4A6FB 3GYOA 3MPXA 2CY5A 1IRSA 1V5UA 2D9WA 3V5WA 2I1KA 2IYBA 5D3YA 3ULCA 1FAOA 1AWEA 3PVWA 4GMXB 4EMOA 4GN1A 5HE2A 2K00A 2M14A 1FOEA 1I2HA 4HB0B 3U8ZA 2N23A 1X86A 5KCVA 1XD4A 5C5BA 4H8SA 1X1GA 2D2QA 2I5CA 2YSZA 3KSYA 4K2PA 2DX1A 1XODA 3AU5A 2CAYA 1FGZA 4MK0A 2OTXA 5KQ1A 3DXEA 2COAA 1KZGA 2VKIA 2OQBA 4KHOA 2XQNM 1KZ7A 5DHFB 1MK7B 4B6HA 3ODOA 2ELBA 3ODWA 4GXBA 3PVLA 1DDVA 4EJNA 1H10A 2QKLA 1EAZA 2RNRB 3PSCA 5CLQB 1FGYA 2DFKA 2KCJA 2ELAA 2RUKB 1MAIA 5J3YA 2DYQA 4CHMA 2HE7A 4HB3B 5EFXA 4A6FA 4PQ0A 2W2XC 2DYNA 1AQCA 3HW2B 1BWNA 2UVMA 1WJMA 4HB2B 3LJUX 2MDXA 2ZPYA 1QQGA 1QC6A 3MDBC 5JHGA 1U5EA 4BBKA 3DXCA 3PG7A 1TQZA 2CRFA 1DYNA 1P5TA 2UZRA 4HB4B 5LOPB 2I5FA 1EGXA 3GYPA 1U5GA 1NU2A 2LYDA 5DIFB 1ISNA 3AJ4A 1OY2A 5D3WA 5L81A 2CODA 1BAKA 2YT1A 4MY6A 4XWXA 1W1DA 4DX90 5KQ4A 3ML4A 1ZM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TCA A;  2YT0 A;  2K2J A;  3TO1 A;  1K5G B;  1V5M A;  2R0D A;  5J3T A;  1M7E A;  5C6R A;  2LOZ A;  1LW3 A;  3PEG A;  2V76 A;  1FHX A;  2YS1 A;  5JHH A;  2L1C A;  4WVF B;  4P7I A;  3IVF A;  4K81 A;  1MPH A;  4F7H A;  4HAZ B;  2DHJ A;  1MIX A;  4WSF A;  3M1I B;  1MK9 B;  1U2B A;  1W1G A;  4MT7 A;  2DLW A;  1H4R A;  1U27 A;  1DDM A;  2J0K A;  2J0M A;  2FJL A;  3FEH A;  5DH9 B;  3U7D A;  4F7G A;  2DKQ A;  2J0J A;  5FI0 A;  4YL8 A;  2EMT A;  3PP2 A;  3FSS A;  2RLO A;  2RSG A;  5D3X A;  1OQN A;  2GCL A;  1DDW A;  2K2U A;  3UZT A;  4ZRJ A;  4C0A A;  4DX8 A;  4NSW A;  3TVV A;  3KRX A;  4HDQ A;  2QKM A;  3ULB A;  2G35 A;  3NSU A;  1UNR A;  5JP4 A;  4K17 A;  4Z2M B;  4HAX B;  3D8E A;  4A6K A;  3SV1 A;  2COC A;  2RGN B;  4A5K A;  1U29 A;  5CLL B;  2DA0 A;  4GPT B;  1WI1 A;  3ZVR A;  5D3V A;  3HK0 A;  1N3H A;  3KY9 A;  4DXA B;  4KHB B;  2LG1 A;  2IFS A;  4Z2N A;  3DXD A;  1E5W A;  5DHA B;  2N0Y A;  2J59 M;  5C79 A;  2LKO A;  4A6H A;  2Z0P A;  3P7Z A;  1W1H A;  4IAP A;  1TJ6 A;  4HAV B;  1M7R A;  4CYE A;  2HTH B;  2YVC A;  1GC7 A;  1UNP A;  1B55 A;  3VOQ A;  2AL6 A;  2KGX B;  1LB1 A;  2LOX A;  1Q67 A;  2PZ1 A;  3SO6 A;  4WJ7 A;  4KHA A;  1KI1 B;  2YF0 A;  2D9V A;  4L6E A;  3F0W A;  1U5F A;  2YRY A;  3RCP A;  1UPQ A;  1J0W A;  5DI9 B;  1EVH A;  3HQC A;  4HAY B;  3CIK A;  1ZSQ A;  1X1F A;  4K2O A;  5HE3 A;  2E2X A;  2GCJ A;  3F5R A;  3TFM A;  1RJ2 A;  2Z0Q A;  5FI1 A;  3ZDT A;  1V61 A;  1PMS A;  3D8D A;  1NTV A;  2X18 A;  4CHJ A;  4D0N B;  3QBV B;  1V89 A;  4HAT B;  1Y19 B;  5C16 A;  4HDO A;  1RRP B;  2EMS A;  3G9W A;  2COF A;  1WG7 A;  1P3R A;  2D4Q A;  1WJ1 A;  1WGQ A;  1J19 A;  4HAU B;  3BIN A;  2NZ8 B;  4TYZ A;  2DHI A;  3AU4 A;  1ZC4 B;  1BTK A;  4HAW B;  1DRO A;  4PNK A;  4IOY X;  5HE1 A;  3N7C A;  2R09 A;  4TKN A;  3KZ1 A;  4HHV A;  2Y7B A;  3PVU A;  2NMB A;  2P8V A;  1FHO A;  1GG3 A;  3SYX A;  3ODX A;  2GJY A;  3D8F A;  1WVH A;  1MKE A;  1OMW A;  3SNH A;  2L2I A;  1XX0 A;  2DTC A;  2DHK A;  3OAN A;  2EC1 A;  1I7A A;  2ADZ A;  2YS5 A;  1FHW A;  1X11 A;  1SHC A;  1V5P A;  2P0F A;  1EF1 A;  3BJI A;  1U5D A;  3WA0 A;  2GS0 A;  1UEF A;  1Z87 A;  1XCG A;  2DKP A;  2Y8G A;  1NI2 A;  3FM8 C;  3X23 A;  1NTY A;  2DN6 A;  2MFQ A;  4ZRK A;  1ZC3 B;  1V88 A;  1UPR A;  1XKE A;  3QIJ A;  4NY0 A;  1DBH A;  2AEH A;  2D9X A;  1MIZ B;  4EKU A;  5D27 A;  4IFS A;  2LUL A;  2ROV A;  2D11 A;  3P6A A;  5JLJ B;  2H7D A;  1X05 A;  1Y5O A;  2KUP A;  2W2W A;  2D10 A;  3CXB B;  1GC6 A;  1UNQ A;  2CY4 A;  4YON A;  3A8Q A;  2MKR A;  5C5B B;  2EJ8 A;  3A8P A;  2Z0O A;  1FB8 A;  2ROZ B;  1K5D B;  5LON B;  4ZRI A;  1WGU A;  2MWN B;  2M38 A;  3T06 A;  4KVG B;  1PFJ A;  5GOW B;  2Y8F A;  2Q13 A;  2I1J A;  3PZD A;  2YS3 A;  2D9Y A;  1BTN A;  4GZU A;  3TW1 A;  5HE0 A;  3WYF B;  2P0D A;  3A98 B;  3SUZ A;  4KAX B;  4GMV A;  2RVB B;  1PLS A;  2P0H A;  4Y94 A;  2H7E A;  1SGH A;  1TXD A;  2UZS A;  2BCJ A;  3QWM A;  1P6S A;  4DBB A;  2JP2 A;  1XR0 B;  2VRW B;  4F7U P;  2DX5 A;  3VIA A;  2VSZ A;  5J3Q A;  2D9Z A;  2W2X D;  3O96 A;  1ZVR A;  3KRW A;  4A6F B;  3GYO A;  3MPX A;  2CY5 A;  1IRS A;  1V5U A;  2D9W A;  3V5W A;  2I1K A;  2IYB A;  5D3Y A;  3ULC A;  1FAO A;  1AWE A;  3PVW A;  4GMX B;  4EMO A;  4GN1 A;  5HE2 A;  2K00 A;  2M14 A;  1FOE A;  1I2H A;  4HB0 B;  3U8Z A;  2N23 A;  1X86 A;  5KCV A;  1XD4 A;  5C5B A;  4H8S A;  1X1G A;  2D2Q A;  2I5C A;  2YSZ A;  3KSY A;  4K2P A;  2DX1 A;  1XOD A;  3AU5 A;  2CAY A;  1FGZ A;  4MK0 A;  2OTX A;  5KQ1 A;  3DXE A;  2COA A;  1KZG A;  2VKI A;  2OQB A;  4KHO A;  2XQN M;  1KZ7 A;  5DHF B;  1MK7 B;  4B6H A;  3ODO A;  2ELB A;  3ODW A;  4GXB A;  3PVL A;  1DDV A;  4EJN A;  1H10 A;  2QKL A;  1EAZ A;  2RNR B;  3PSC A;  5CLQ B;  1FGY A;  2DFK A;  2KCJ A;  2ELA A;  2RUK B;  1MAI A;  5J3Y A;  2DYQ A;  4CHM A;  2HE7 A;  4HB3 B;  5EFX A;  4A6F A;  4PQ0 A;  2W2X C;  2DYN A;  1AQC A;  3HW2 B;  1BWN A;  2UVM A;  1WJM A;  4HB2 B;  3LJU X;  2MDX A;  2ZPY A;  1QQG A;  1QC6 A;  3MDB C;  5JHG A;  1U5E A;  4BBK A;  3DXC A;  3PG7 A;  1TQZ A;  2CRF A;  1DYN A;  1P5T A;  2UZR A;  4HB4 B;  5LOP B;  2I5F A;  1EGX A;  3GYP A;  1U5G A;  1NU2 A;  2LYD A;  5DIF B;  1ISN A;  3AJ4 A;  1OY2 A;  5D3W A;  5L81 A;  2COD A;  1BAK A;  2YT1 A;  4MY6 A;  4XWX A;  1W1D A;  4DX9 0;  5KQ4 A;  3ML4 A;  1ZM0 A; 
#chains in the Genus database with same CATH topology
 3TCA A;  2YT0 A;  2K2J A;  4QJ4 B;  2NBV A;  1K5G B;  3TO1 A;  1V5M A;  2R0D A;  5J3T A;  1M7E A;  5C6R A;  2LOZ A;  1LW3 A;  3PEG A;  2V76 A;  1FHX A;  2YS1 A;  5JHH A;  2L1C A;  4WVF B;  4P7I A;  3IVF A;  4K81 A;  1MPH A;  4F7H A;  4HAZ B;  2DHJ A;  3B77 A;  1MIX A;  4GNK B;  4WSF A;  3M1I B;  1MK9 B;  1U2B A;  1W1G A;  4MT7 A;  2DLW A;  1H4R A;  1U27 A;  1DDM A;  2J0K A;  2ZKM X;  2J0M A;  2FJL A;  3FEH A;  5DH9 B;  3U7D A;  4F7G A;  2DKQ A;  2J0J A;  5FI0 A;  3HIE A;  4YL8 A;  1MI1 A;  2EMT A;  3PP2 A;  3FSS A;  2RLO A;  2RSG A;  5D3X A;  5M4Y B;  1OQN A;  2GCL A;  3OHM B;  1DDW A;  2K2U A;  3UZT A;  4ZRJ A;  4C0A A;  4DX8 A;  4NSW A;  3TVV A;  3KRX A;  4HDQ A;  2QKM A;  3ULB A;  2G35 A;  4QXA B;  3NSU A;  1UNR A;  5JP4 A;  4K17 A;  4Z2M B;  4HAX B;  2K8E A;  3D8E A;  4A6K A;  3SV1 A;  2COC A;  2RGN B;  4A5K A;  1U29 A;  5CLL B;  2DA0 A;  4GPT B;  1WI1 A;  3NWA A;  3ZVR A;  5D3V A;  3HK0 A;  1N3H A;  3KY9 A;  4DXA B;  4KHB B;  2LG1 A;  2IFS A;  4Z2N A;  3DXD A;  1E5W A;  5DHA B;  2N0Y A;  2J59 M;  5C79 A;  2LKO A;  4A6H A;  2Z0P A;  3P7Z A;  1W1H A;  4IAP A;  1TJ6 A;  4HAV B;  1M7R A;  4CYE A;  2HTH B;  2YVC A;  1GC7 A;  3HSA A;  1UNP A;  1B55 A;  4QJ3 B;  3VOQ A;  2AL6 A;  2KGX B;  4QJ5 B;  1LB1 A;  2LOX A;  1Q67 A;  2PZ1 A;  3SO6 A;  4WJ7 A;  4KHA A;  1KI1 B;  2YF0 A;  2D9V A;  4L6E A;  3F0W A;  1U5F A;  2YRY A;  3RCP A;  1UPQ A;  1J0W A;  5DI9 B;  1EVH A;  3HQC A;  4HAY B;  3CIK A;  4L1R A;  1ZSQ A;  1X1F A;  3FVC A;  4K2O A;  5HE3 A;  2E2X A;  2GCJ A;  3F5R A;  3TFM A;  1RJ2 A;  2Z0Q A;  5FI1 A;  1ZYI A;  3ZDT A;  1V61 A;  1PMS A;  4OT1 A;  3D8D A;  1NTV A;  2X18 A;  4CHJ A;  4D0N B;  3QBV B;  1V89 A;  2FJU B;  4HAT B;  1Y19 B;  5C16 A;  4HDO A;  1RRP B;  2EMS A;  3DCX A;  3G9W A;  2COF A;  1WG7 A;  1P3R A;  2D4Q A;  1WJ1 A;  1WGQ A;  1J19 A;  4HAU B;  5IRS A;  3BIN A;  2NZ8 B;  4TYZ A;  2DHI A;  3AU4 A;  1ZC4 B;  1BTK A;  4HAW B;  1DRO A;  4PNK A;  4IOY X;  5HE1 A;  3N7C A;  2R09 A;  4TKN A;  3KZ1 A;  4HHV A;  2Y7B A;  3PVU A;  2KR0 A;  2NMB A;  2P8V A;  1FHO A;  1GG3 A;  3SYX A;  4CSQ A;  3ODX A;  2GJY A;  3D8F A;  1WVH A;  1MKE A;  1OMW A;  3A58 A;  2L2I A;  3SNH A;  1XX0 A;  2DTC A;  2DHK A;  3OAN A;  2EC1 A;  1I7A A;  2ADZ A;  2YS5 A;  1FHW A;  3NWF A;  1X11 A;  1SHC A;  1V5P A;  2P0F A;  1EF1 A;  3BJI A;  1U5D A;  3WA0 A;  2Z13 A;  2GS0 A;  1UEF A;  1Z87 A;  1XCG A;  2DKP A;  2Y8G A;  5I2S A;  1NI2 A;  3FM8 C;  3X23 A;  1NTY A;  2DN6 A;  2MFQ A;  4ZRK A;  1ZC3 B;  1V88 A;  1UPR A;  1XKE A;  3QIJ A;  4NY0 A;  1DBH A;  2AEH A;  2D9X A;  1MIZ B;  4EKU A;  3NWD A;  2Z59 A;  5LG4 B;  5D27 A;  4IFS A;  1T77 A;  2LUL A;  2ROV A;  2D11 A;  3P6A A;  5JLJ B;  2H7D A;  1X05 A;  1Y5O A;  2KUP A;  2W2W A;  2D10 A;  3CXB B;  2GUM A;  1GC6 A;  1UNQ A;  2CY4 A;  4YON A;  3A8Q A;  2MKR A;  5C5B B;  3NW8 A;  2EJ8 A;  4DIX A;  3A8P A;  2Z0O A;  1FB8 A;  2ROZ B;  1K5D B;  5LON B;  4ZRI A;  1WGU A;  2MWN B;  2M38 A;  3T06 A;  4KVG B;  1PFJ A;  5GOW B;  2Y8F A;  2Q13 A;  2I1J A;  3PZD A;  2YS3 A;  2D9Y A;  1BTN A;  4GZU A;  3TW1 A;  5HE0 A;  3WYF B;  2P0D A;  3A98 B;  3SUZ A;  4KAX B;  4GMV A;  2RVB B;  1PLS A;  2P0H A;  4Y94 A;  2H7E A;  1TXD A;  1SGH A;  2UZS A;  3U12 A;  2BCJ A;  3QWM A;  1P6S A;  4DBB A;  2JP2 A;  1XR0 B;  2VRW B;  4F7U P;  2DX5 A;  3VIA A;  4OSN A;  2VSZ A;  5J3Q A;  4GOU A;  2D9Z A;  2K49 A;  2Z4D A;  2W2X D;  3O96 A;  1ZVR A;  3KRW A;  4A6F B;  3GYO A;  3MPX A;  2CY5 A;  4KHB A;  4D6W A;  2KIG A;  1IRS A;  1V5U A;  2KIE A;  2D9W A;  3V5W A;  2I1K A;  2IYB A;  5D3Y A;  3ULC A;  1FAO A;  1AWE A;  3PVW A;  4GMX B;  4EMO A;  4GN1 A;  5HE2 A;  2K00 A;  2M14 A;  1FOE A;  1I2H A;  4HB0 B;  3U8Z A;  2N23 A;  1X86 A;  5KCV A;  1XD4 A;  5C5B A;  4H8S A;  1X1G A;  2D2Q A;  2I5C A;  2YSZ A;  2YT2 A;  3KSY A;  4K2P A;  2DX1 A;  1XOD A;  3AU5 A;  2CAY A;  1FGZ A;  2R2Y A;  4MK0 A;  2OTX A;  5KQ1 A;  3DXE A;  2COA A;  1KZG A;  2VKI A;  2OQB A;  4KHO A;  2XQN M;  1KZ7 A;  5DHF B;  1MK7 B;  4B6H A;  4HSI A;  3ODO A;  2ELB A;  3ODW A;  4GXB A;  3PVL A;  1DDV A;  4EJN A;  1H10 A;  2QKL A;  1EAZ A;  2RNR B;  3PSC A;  5CLQ B;  1FGY A;  2DFK A;  2KCJ A;  2ELA A;  2RUK B;  1MAI A;  5J3Y A;  2DYQ A;  4CHM A;  2HE7 A;  2Z14 A;  4HB3 B;  5EFX A;  4A6F A;  4PQ0 A;  2W2X C;  2DYN A;  1AQC A;  3HW2 B;  1BWN A;  2UVM A;  1WJM A;  4HB2 B;  3LJU X;  2MDX A;  2ZPY A;  1QQG A;  1QC6 A;  3MDB C;  5JHG A;  1U5E A;  4BBK A;  3DXC A;  3PG7 A;  1TQZ A;  2CRF A;  1DYN A;  1P5T A;  5I2M A;  2UZR A;  2KUQ A;  4HB4 B;  5LOP B;  2I5F A;  2RRF A;  1EGX A;  3GYP A;  1U5G A;  1NU2 A;  2LYD A;  5DIF B;  1ISN A;  3AJ4 A;  1OY2 A;  5D3W A;  5L81 A;  2COD A;  1BAK A;  2YT1 A;  4MY6 A;  4XWX A;  1W1D A;  4DX9 0;  5KQ4 A;  3ML4 A;  1ZM0 A; 
#chains in the Genus database with same CATH homology
 3TCA A;  2YT0 A;  2K2J A;  3TO1 A;  1K5G B;  1V5M A;  2R0D A;  5J3T A;  1M7E A;  5C6R A;  2LOZ A;  1LW3 A;  3PEG A;  2V76 A;  1FHX A;  2YS1 A;  5JHH A;  2L1C A;  4WVF B;  4P7I A;  3IVF A;  4K81 A;  1MPH A;  4F7H A;  4HAZ B;  2DHJ A;  1MIX A;  4WSF A;  3M1I B;  1MK9 B;  1U2B A;  1W1G A;  4MT7 A;  2DLW A;  1H4R A;  1U27 A;  1DDM A;  2J0K A;  2J0M A;  2FJL A;  3FEH A;  5DH9 B;  3U7D A;  4F7G A;  2DKQ A;  2J0J A;  5FI0 A;  4YL8 A;  2EMT A;  3PP2 A;  3FSS A;  2RLO A;  2RSG A;  5D3X A;  1OQN A;  2GCL A;  1DDW A;  2K2U A;  3UZT A;  4ZRJ A;  4C0A A;  4DX8 A;  4NSW A;  3TVV A;  3KRX A;  4HDQ A;  2QKM A;  3ULB A;  2G35 A;  3NSU A;  1UNR A;  5JP4 A;  4K17 A;  4Z2M B;  4HAX B;  3D8E A;  4A6K A;  3SV1 A;  2COC A;  2RGN B;  4A5K A;  1U29 A;  5CLL B;  2DA0 A;  4GPT B;  1WI1 A;  3ZVR A;  5D3V A;  3HK0 A;  1N3H A;  3KY9 A;  4DXA B;  4KHB B;  2LG1 A;  2IFS A;  4Z2N A;  3DXD A;  1E5W A;  5DHA B;  2N0Y A;  2J59 M;  5C79 A;  2LKO A;  4A6H A;  2Z0P A;  3P7Z A;  1W1H A;  4IAP A;  1TJ6 A;  4HAV B;  1M7R A;  4CYE A;  2HTH B;  2YVC A;  1GC7 A;  1UNP A;  1B55 A;  3VOQ A;  2AL6 A;  2KGX B;  1LB1 A;  2LOX A;  1Q67 A;  2PZ1 A;  3SO6 A;  4WJ7 A;  4KHA A;  1KI1 B;  2YF0 A;  2D9V A;  4L6E A;  3F0W A;  1U5F A;  2YRY A;  3RCP A;  1UPQ A;  1J0W A;  5DI9 B;  1EVH A;  3HQC A;  4HAY B;  3CIK A;  1ZSQ A;  1X1F A;  4K2O A;  5HE3 A;  2E2X A;  2GCJ A;  3F5R A;  3TFM A;  1RJ2 A;  2Z0Q A;  5FI1 A;  3ZDT A;  1V61 A;  1PMS A;  3D8D A;  1NTV A;  2X18 A;  4CHJ A;  4D0N B;  3QBV B;  1V89 A;  4HAT B;  1Y19 B;  5C16 A;  4HDO A;  1RRP B;  2EMS A;  3G9W A;  2COF A;  1WG7 A;  1P3R A;  2D4Q A;  1WJ1 A;  1WGQ A;  1J19 A;  4HAU B;  3BIN A;  2NZ8 B;  4TYZ A;  2DHI A;  3AU4 A;  1ZC4 B;  1BTK A;  4HAW B;  1DRO A;  4PNK A;  4IOY X;  5HE1 A;  3N7C A;  2R09 A;  4TKN A;  3KZ1 A;  4HHV A;  2Y7B A;  3PVU A;  2NMB A;  2P8V A;  1FHO A;  1GG3 A;  3SYX A;  3ODX A;  2GJY A;  3D8F A;  1WVH A;  1MKE A;  1OMW A;  3SNH A;  2L2I A;  1XX0 A;  2DTC A;  2DHK A;  3OAN A;  2EC1 A;  1I7A A;  2ADZ A;  2YS5 A;  1FHW A;  1X11 A;  1SHC A;  1V5P A;  2P0F A;  1EF1 A;  3BJI A;  1U5D A;  3WA0 A;  2GS0 A;  1UEF A;  1Z87 A;  1XCG A;  2DKP A;  2Y8G A;  1NI2 A;  3FM8 C;  3X23 A;  1NTY A;  2DN6 A;  2MFQ A;  4ZRK A;  1ZC3 B;  1V88 A;  1UPR A;  1XKE A;  3QIJ A;  4NY0 A;  1DBH A;  2AEH A;  2D9X A;  1MIZ B;  4EKU A;  5D27 A;  4IFS A;  2LUL A;  2ROV A;  2D11 A;  3P6A A;  5JLJ B;  2H7D A;  1X05 A;  1Y5O A;  2KUP A;  2W2W A;  2D10 A;  3CXB B;  1GC6 A;  1UNQ A;  2CY4 A;  4YON A;  3A8Q A;  2MKR A;  5C5B B;  2EJ8 A;  3A8P A;  2Z0O A;  1FB8 A;  2ROZ B;  1K5D B;  5LON B;  4ZRI A;  1WGU A;  2MWN B;  2M38 A;  3T06 A;  4KVG B;  1PFJ A;  5GOW B;  2Y8F A;  2Q13 A;  2I1J A;  3PZD A;  2YS3 A;  2D9Y A;  1BTN A;  4GZU A;  3TW1 A;  5HE0 A;  3WYF B;  2P0D A;  3A98 B;  3SUZ A;  4KAX B;  4GMV A;  2RVB B;  1PLS A;  2P0H A;  4Y94 A;  2H7E A;  1SGH A;  1TXD A;  2UZS A;  2BCJ A;  3QWM A;  1P6S A;  4DBB A;  2JP2 A;  1XR0 B;  2VRW B;  4F7U P;  2DX5 A;  3VIA A;  2VSZ A;  5J3Q A;  2D9Z A;  2W2X D;  3O96 A;  1ZVR A;  3KRW A;  4A6F B;  3GYO A;  3MPX A;  2CY5 A;  1IRS A;  1V5U A;  2D9W A;  3V5W A;  2I1K A;  2IYB A;  5D3Y A;  3ULC A;  1FAO A;  1AWE A;  3PVW A;  4GMX B;  4EMO A;  4GN1 A;  5HE2 A;  2K00 A;  2M14 A;  1FOE A;  1I2H A;  4HB0 B;  3U8Z A;  2N23 A;  1X86 A;  5KCV A;  1XD4 A;  5C5B A;  4H8S A;  1X1G A;  2D2Q A;  2I5C A;  2YSZ A;  3KSY A;  4K2P A;  2DX1 A;  1XOD A;  3AU5 A;  2CAY A;  1FGZ A;  4MK0 A;  2OTX A;  5KQ1 A;  3DXE A;  2COA A;  1KZG A;  2VKI A;  2OQB A;  4KHO A;  2XQN M;  1KZ7 A;  5DHF B;  1MK7 B;  4B6H A;  3ODO A;  2ELB A;  3ODW A;  4GXB A;  3PVL A;  1DDV A;  4EJN A;  1H10 A;  2QKL A;  1EAZ A;  2RNR B;  3PSC A;  5CLQ B;  1FGY A;  2DFK A;  2KCJ A;  2ELA A;  2RUK B;  1MAI A;  5J3Y A;  2DYQ A;  4CHM A;  2HE7 A;  4HB3 B;  5EFX A;  4A6F A;  4PQ0 A;  2W2X C;  2DYN A;  1AQC A;  3HW2 B;  1BWN A;  2UVM A;  1WJM A;  4HB2 B;  3LJU X;  2MDX A;  2ZPY A;  1QQG A;  1QC6 A;  3MDB C;  5JHG A;  1U5E A;  4BBK A;  3DXC A;  3PG7 A;  1TQZ A;  2CRF A;  1DYN A;  1P5T A;  2UZR A;  4HB4 B;  5LOP B;  2I5F A;  1EGX A;  3GYP A;  1U5G A;  1NU2 A;  2LYD A;  5DIF B;  1ISN A;  3AJ4 A;  1OY2 A;  5D3W A;  5L81 A;  2COD A;  1BAK A;  2YT1 A;  4MY6 A;  4XWX A;  1W1D A;  4DX9 0;  5KQ4 A;  3ML4 A;  1ZM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...