2LG1A

Solution structure of the human akap13 ph domain and stabilizing dh helix
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
185
structure length
185
Chain Sequence
SMTKDNEVEQEDLAQSLSLVKDVIGAVDSKVASYEKKVRLNEIYTKTDSKSIMRMKSGQMFAKEDLKRKKLVRDGSVFLKNAAGRLKEVQAVLLTDILVFLQEKDQKYIFASLDQKSTVISLKKLIVREVAHEEKGLFLISMGMTDPEMVEVHASSKEERNSWIQIIQDTINTLNRDEDEGIPSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords A-kinase anchor protein 13
publication title Structural Insights into the Activation of the RhoA GTPase by the Lbc Oncoprotein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 36
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2lg1A02
2COFA 2CY5A 2GS0A 3TVVA 4EMOA 1ZSQA 1P6SA 3TFMA 1DDWA 2YS3A 1WG7A 2VSZA 5C5BB 2DYQA 3WYFB 4XWXA 2YT0A 1PMSA 4A6FA 5DHFB 3RCPA 1KZ7A 4Y94A 4K2PA 3F5RA 2I5CA 3NSUA 3TCAA 2RNRB 1NI2A 4HAWB 4HATB 4A6HA 3ODOA 1Y19B 3QBVB 1KZGA 2RVBB 1V88A 1WGUA 3A98B 4GN1A 4BBKA 1OY2A 1OMWA 2ZPYA 3AJ4A 1W1HA 1GC6A 4ZRJA 1GG3A 1X05A 1UPQA 1V61A 4IAPA 1UEFA 3AU4A 3IVFA 1QQGA 2EMSA 2DX5A 3KY9A 2YRYA 1ZM0A 5KCVA 3AU5A 2R0DA 3ZDTA 1U5DA 1SHCA 1TJ6A 3SUZA 1NTVA 1K5GB 2DN6A 2LG1A 1UNPA 1XKEA 2YVCA 2LOZA 5EFXA 4P7IA 1J0WA 5D3VA 3VOQA 2E2XA 2X18A 1WGQA 1PLSA 2DHJA 5C6RA 3A8QA 3HK0A 1P3RA 2UVMA 4YL8A 1RJ2A 1MIXA 3F0WA 3GYOA 1DROA 4PNKA 1WJMA 5J3QA 4IOYX 1H10A 4HHVA 1Y5OA 2YS1A 1MPHA 4HB0B 4KHOA 1FHXA 1I2HA 2DA0A 1EAZA 1MIZB 1DDMA 2YT1A 3ODXA 4C0AA 2I5FA 2V76A 4GMVA 4HB4B 2RUKB 4DXAB 3D8DA 2J59M 4DX8A 2ELAA 4GXBA 5L81A 3PEGA 4TKNA 1V5PA 2VRWB 3T06A 1M7EA 5DH9B 1DYNA 2LULA 2Y8FA 5HE1A 4HAYB 1V5UA 3ML4A 2DLWA 2D11A 2JP2A 2RSGA 1N3HA 2M38A 1U5EA 2Y8GA 2J0KA 3QIJA 2DTCA 2D9WA 2D10A 2D9XA 1WVHA 2K00A 3PG7A 1Q67A 4K2OA 2Z0OA 3PSCA 3ZVRA 1WJ1A 1K5DB 1DDVA 2MDXA 2K2UA 1LW3A 2LOXA 2CRFA 3D8EA 2D4QA 5CLLB 2P0DA 1EVHA 4HB3B 1BAKA 1XR0B 1U5FA 2W2XC 2AEHA 1FHWA 1U27A 2OTXA 2NZ8B 1U2BA 4GPTB 4DX90 1AWEA 1X86A 5KQ4A 2UZRA 3VIAA 1XX0A 1X1FA 1MK7B 2QKMA 2H7DA 3SO6A 4MY6A 4NSWA 1TQZA 4GMXB 4A6FB 3ODWA 2HTHB 4K17A 5D27A 2K2JA 5LOPB 4EJNA 3V5WA 1RRPB 3KRWA 4DBBA 2W2XD 3PZDA 2COAA 2DKPA 1W1DA 4KAXB 2CAYA 1WI1A 5D3WA 5LONB 3GYPA 3MPXA 4CHJA 1BTNA 1UPRA 2GCLA 4HAXB 1X11A 2Y7BA 5C79A 1NTYA 1UNRA 2COCA 2IFSA 3O96A 4Z2MB 2EMTA 2LKOA 3SNHA 2DHKA 3M1IB 3PVUA 3DXDA 2BCJA 4CHMA 2ELBA 2GCJA 3CXBB 1BTKA 2L1CA 3P7ZA 1FHOA 3KZ1A 1ZC4B 1IRSA 4HAUB 1UNQA 4EKUA 2PZ1A 2VKIA 4TYZA 2Z0PA 2QKLA 4PQ0A 3SV1A 1BWNA 2R09A 4ZRKA 1U5GA 3LJUX 3FSSA 2RGNB 4MT7A 5D3XA 5C5BA 1E5WA 2P8VA 2DKQA 3U8ZA 2MWNB 3HW2B 1SGHA 1OQNA 5DI9B 1W1GA 2CODA 1V89A 2H7EA 3U7DA 3P6AA 5DHAB 1FGZA 3PVLA 1XCGA 2KCJA 2DFKA 1FGYA 2FJLA 3BINA 3HQCA 4A5KA 5CLQB 5HE0A 1B55A 3DXCA 3FEHA 1LB1A 3BJIA 5HE2A 1U29A 3D8FA 2GJYA 2IYBA 4K81A 2N0YA 4KVGB 2D2QA 2D9ZA 2D9VA 4HDOA 2XQNM 2EC1A 4F7UP 1EF1A 4YONA 1TXDA 2LYDA 2HE7A 1ZVRA 2UZSA 2P0FA 3SYXA 2MFQA 2M14A 3PP2A 1PFJA 3QWMA 4L6EA 1XODA 2RLOA 1EGXA 4CYEA 1KI1B 1H4RA 2YS5A 4D0NB 1NU2A 1V5MA 3WA0A 1X1GA 3MDBC 4Z2NA 5C16A 4GZUA 4WVFB 1DBHA 2J0JA 3CIKA 5JHGA 4H8SA 2Z0QA 2G35A 4HAZB 2N23A 5JLJB 2EJ8A 1MK9B 1XD4A 4B6HA 2ROVA 3DXEA 2J0MA 4HB2B 2DHIA 5J3TA 2I1KA 1I7AA 5D3YA 3X23A 2MKRA 4NY0A 1FOEA 1P5TA 1J19A 3ULBA 3A8PA 2OQBA 3ULCA 4A6KA 3UZTA 1MAIA 3FM8C 2W2WA 3PVWA 5JP4A 4HDQA 1ISNA 4WSFA 4KHAA 4WJ7A 4F7HA 5JHHA 2DYNA 3N7CA 1GC7A 5J3YA 3G9WA 1ZC3B 2DX1A 4F7GA 3KRXA 2KUPA 2P0HA 5DIFB 5HE3A 3TW1A 2YF0A 4ZRIA 2AL6A 5FI1A 3TO1A 1MKEA 2D9YA 2Q13A 4KHBB 2NMBA 1AQCA 2I1JA 4HAVB 2YSZA 4MK0A 1FAOA 2L2IA 2ROZB 3OANA 5KQ1A 2CY4A 5FI0A 1QC6A 1M7RA 1Z87A 1FB8A 2ADZA 2KGXB 5GOWB 4IFSA 3KSYA
chains in the Genus database with same CATH superfamily
2COFA 1ZYIA 2CY5A 2GS0A 3TVVA 4EMOA 5I2SA 1ZSQA 1P6SA 3TFMA 1DDWA 2YS3A 1WG7A 2VSZA 5C5BB 2DYQA 3WYFB 4XWXA 2YT0A 1PMSA 4A6FA 2ZKMX 5DHFB 3RCPA 5LG4B 1KZ7A 4Y94A 4K2PA 3F5RA 2I5CA 3NSUA 3TCAA 2RNRB 1NI2A 4HAWB 4HATB 4A6HA 3ODOA 1Y19B 3QBVB 1KZGA 2RVBB 1V88A 1WGUA 3A98B 4GN1A 4BBKA 1OY2A 3FVCA 1OMWA 2ZPYA 3AJ4A 1W1HA 1GC6A 4ZRJA 1GG3A 1X05A 1UPQA 1V61A 4IAPA 3AU4A 1UEFA 3IVFA 3NWDA 1QQGA 2EMSA 2DX5A 3KY9A 2YRYA 1ZM0A 5KCVA 3AU5A 2NBVA 2R0DA 3ZDTA 1U5DA 1SHCA 1TJ6A 1MI1A 3SUZA 1NTVA 3U12A 1K5GB 2DN6A 2GUMA 2LG1A 2K49A 1UNPA 1XKEA 2YVCA 2LOZA 4OT1A 5EFXA 4P7IA 1J0WA 5D3VA 3VOQA 2E2XA 2X18A 3NWAA 1WGQA 1PLSA 2DHJA 4CSQA 5C6RA 3A8QA 3HK0A 1P3RA 2UVMA 4YL8A 1RJ2A 1MIXA 3F0WA 3GYOA 4QJ4B 1DROA 4PNKA 4D6WA 1WJMA 5J3QA 4IOYX 1H10A 4HHVA 1Y5OA 2YS1A 1MPHA 4HB0B 4KHOA 1FHXA 1I2HA 2DA0A 1EAZA 1MIZB 1DDMA 2YT1A 3ODXA 4C0AA 2I5FA 2V76A 4GMVA 4HB4B 2RUKB 3A58A 4DXAB 3D8DA 2J59M 4DX8A 2FJUB 2ELAA 4GXBA 5L81A 3PEGA 4TKNA 1V5PA 2VRWB 3T06A 1M7EA 5DH9B 1DYNA 2LULA 2Y8FA 5HE1A 2R2YA 4HAYB 1V5UA 3ML4A 2YT2A 2DLWA 2D11A 2JP2A 4HSIA 2RSGA 5I2MA 1N3HA 2M38A 1U5EA 2Y8GA 2J0KA 3QIJA 2DTCA 2D9WA 2D10A 2D9XA 1WVHA 3HSAA 2K00A 3PG7A 1Q67A 4K2OA 2Z0OA 5IRSA 3PSCA 3ZVRA 1WJ1A 1K5DB 3B77A 1DDVA 2KUQA 2MDXA 2K2UA 1LW3A 2LOXA 2CRFA 3D8EA 2D4QA 5CLLB 2KIEA 2P0DA 1EVHA 4HB3B 1BAKA 1XR0B 1U5FA 2W2XC 2AEHA 2Z59A 1FHWA 1U27A 2OTXA 2NZ8B 2K8EA 1U2BA 4GPTB 4DX90 1AWEA 1X86A 5KQ4A 2UZRA 3VIAA 1XX0A 1X1FA 1MK7B 2QKMA 2H7DA 3SO6A 2KR0A 4MY6A 4NSWA 1TQZA 4GMXB 4A6FB 3ODWA 2HTHB 4K17A 5D27A 2K2JA 5LOPB 2Z13A 4EJNA 3HIEA 3V5WA 1RRPB 3KRWA 4DBBA 2W2XD 3PZDA 2COAA 2DKPA 1W1DA 4KAXB 2CAYA 1WI1A 5D3WA 5LONB 4QJ3B 3GYPA 3MPXA 4CHJA 1BTNA 1UPRA 2GCLA 4HAXB 1X11A 2Y7BA 5C79A 1NTYA 1UNRA 2COCA 4KHBA 2IFSA 3O96A 4Z2MB 2EMTA 4GNKB 2LKOA 3SNHA 2DHKA 3M1IB 3PVUA 3DXDA 2BCJA 4CHMA 2ELBA 2RRFA 2GCJA 3CXBB 1BTKA 2L1CA 3P7ZA 1FHOA 3KZ1A 1ZC4B 1IRSA 4HAUB 1UNQA 4EKUA 2PZ1A 2VKIA 4TYZA 2Z0PA 2QKLA 4OSNA 4PQ0A 3SV1A 1BWNA 2R09A 4ZRKA 1U5GA 3LJUX 3FSSA 2RGNB 4MT7A 5D3XA 5C5BA 1E5WA 2P8VA 2DKQA 3U8ZA 2MWNB 3HW2B 1SGHA 1OQNA 5DI9B 1W1GA 2CODA 1V89A 2H7EA 3U7DA 3P6AA 5DHAB 1FGZA 3PVLA 1XCGA 2KCJA 2DFKA 3NWFA 1FGYA 2FJLA 4GOUA 3BINA 3HQCA 4A5KA 5CLQB 5HE0A 1B55A 3DXCA 3FEHA 1LB1A 3BJIA 5HE2A 1U29A 3D8FA 2GJYA 2IYBA 4K81A 2N0YA 4KVGB 2D2QA 2D9ZA 2D9VA 4HDOA 2KIGA 2XQNM 2EC1A 4F7UP 1EF1A 4YONA 1TXDA 2LYDA 2HE7A 1ZVRA 4QJ5B 2UZSA 2P0FA 3SYXA 2MFQA 2M14A 2Z14A 3NW8A 3PP2A 1PFJA 3QWMA 4L6EA 1XODA 2RLOA 1EGXA 4CYEA 1KI1B 1H4RA 2YS5A 4D0NB 1NU2A 1V5MA 3WA0A 1X1GA 3MDBC 5M4YB 4Z2NA 5C16A 4GZUA 4WVFB 1T77A 1DBHA 2J0JA 3CIKA 5JHGA 4H8SA 4L1RA 2Z0QA 2G35A 4HAZB 2N23A 5JLJB 2EJ8A 1MK9B 3DCXA 1XD4A 4B6HA 2ROVA 3DXEA 2J0MA 4HB2B 2DHIA 5J3TA 2I1KA 1I7AA 5D3YA 3X23A 2MKRA 4NY0A 1FOEA 1P5TA 1J19A 3OHMB 3ULBA 3A8PA 2OQBA 3ULCA 4A6KA 3UZTA 1MAIA 3FM8C 2W2WA 3PVWA 5JP4A 4HDQA 1ISNA 4QXAB 4WSFA 4KHAA 4WJ7A 4F7HA 5JHHA 2DYNA 3N7CA 1GC7A 5J3YA 3G9WA 1ZC3B 2DX1A 4F7GA 3KRXA 2KUPA 2P0HA 5DIFB 5HE3A 3TW1A 2YF0A 4ZRIA 2AL6A 5FI1A 3TO1A 1MKEA 2D9YA 2Q13A 4KHBB 2NMBA 1AQCA 2I1JA 4HAVB 2YSZA 4MK0A 1FAOA 2L2IA 2ROZB 3OANA 5KQ1A 4DIXA 2Z4DA 2CY4A 5FI0A 1QC6A 1M7RA 1Z87A 1FB8A 2ADZA 2KGXB 5GOWB 4IFSA 3KSYA
chains in the Genus database with same CATH topology
2COFA 2CY5A 2GS0A 3TVVA 4EMOA 1ZSQA 1P6SA 3TFMA 1DDWA 2YS3A 1WG7A 2VSZA 5C5BB 2DYQA 3WYFB 4XWXA 2YT0A 1PMSA 4A6FA 5DHFB 3RCPA 1KZ7A 4Y94A 4K2PA 3F5RA 2I5CA 3NSUA 3TCAA 2RNRB 1NI2A 4HAWB 4HATB 4A6HA 3ODOA 1Y19B 3QBVB 1KZGA 2RVBB 1V88A 1WGUA 3A98B 4GN1A 4BBKA 1OY2A 1OMWA 2ZPYA 3AJ4A 1W1HA 1GC6A 4ZRJA 1GG3A 1X05A 1UPQA 1V61A 4IAPA 1UEFA 3AU4A 3IVFA 1QQGA 2EMSA 2DX5A 3KY9A 2YRYA 1ZM0A 5KCVA 3AU5A 2R0DA 3ZDTA 1U5DA 1SHCA 1TJ6A 3SUZA 1NTVA 1K5GB 2DN6A 2LG1A 1UNPA 1XKEA 2YVCA 2LOZA 5EFXA 4P7IA 1J0WA 5D3VA 3VOQA 2E2XA 2X18A 1WGQA 1PLSA 2DHJA 5C6RA 3A8QA 3HK0A 1P3RA 2UVMA 4YL8A 1RJ2A 1MIXA 3F0WA 3GYOA 1DROA 4PNKA 1WJMA 5J3QA 4IOYX 1H10A 4HHVA 1Y5OA 2YS1A 1MPHA 4HB0B 4KHOA 1FHXA 1I2HA 2DA0A 1EAZA 1MIZB 1DDMA 2YT1A 3ODXA 4C0AA 2I5FA 2V76A 4GMVA 4HB4B 2RUKB 4DXAB 3D8DA 2J59M 4DX8A 2ELAA 4GXBA 5L81A 3PEGA 4TKNA 1V5PA 2VRWB 3T06A 1M7EA 5DH9B 1DYNA 2LULA 2Y8FA 5HE1A 4HAYB 1V5UA 3ML4A 2DLWA 2D11A 2JP2A 2RSGA 1N3HA 2M38A 1U5EA 2Y8GA 2J0KA 3QIJA 2DTCA 2D9WA 2D10A 2D9XA 1WVHA 2K00A 3PG7A 1Q67A 4K2OA 2Z0OA 3PSCA 3ZVRA 1WJ1A 1K5DB 1DDVA 2MDXA 2K2UA 1LW3A 2LOXA 2CRFA 3D8EA 2D4QA 5CLLB 2P0DA 1EVHA 4HB3B 1BAKA 1XR0B 1U5FA 2W2XC 2AEHA 1FHWA 1U27A 2OTXA 2NZ8B 1U2BA 4GPTB 4DX90 1AWEA 1X86A 5KQ4A 2UZRA 3VIAA 1XX0A 1X1FA 1MK7B 2QKMA 2H7DA 3SO6A 4MY6A 4NSWA 1TQZA 4GMXB 4A6FB 3ODWA 2HTHB 4K17A 5D27A 2K2JA 5LOPB 4EJNA 3V5WA 1RRPB 3KRWA 4DBBA 2W2XD 3PZDA 2COAA 2DKPA 1W1DA 4KAXB 2CAYA 1WI1A 5D3WA 5LONB 3GYPA 3MPXA 4CHJA 1BTNA 1UPRA 2GCLA 4HAXB 1X11A 2Y7BA 5C79A 1NTYA 1UNRA 2COCA 2IFSA 3O96A 4Z2MB 2EMTA 2LKOA 3SNHA 2DHKA 3M1IB 3PVUA 3DXDA 2BCJA 4CHMA 2ELBA 2GCJA 3CXBB 1BTKA 2L1CA 3P7ZA 1FHOA 3KZ1A 1ZC4B 1IRSA 4HAUB 1UNQA 4EKUA 2PZ1A 2VKIA 4TYZA 2Z0PA 2QKLA 4PQ0A 3SV1A 1BWNA 2R09A 4ZRKA 1U5GA 3LJUX 3FSSA 2RGNB 4MT7A 5D3XA 5C5BA 1E5WA 2P8VA 2DKQA 3U8ZA 2MWNB 3HW2B 1SGHA 1OQNA 5DI9B 1W1GA 2CODA 1V89A 2H7EA 3U7DA 3P6AA 5DHAB 1FGZA 3PVLA 1XCGA 2KCJA 2DFKA 1FGYA 2FJLA 3BINA 3HQCA 4A5KA 5CLQB 5HE0A 1B55A 3DXCA 3FEHA 1LB1A 3BJIA 5HE2A 1U29A 3D8FA 2GJYA 2IYBA 4K81A 2N0YA 4KVGB 2D2QA 2D9ZA 2D9VA 4HDOA 2XQNM 2EC1A 4F7UP 1EF1A 4YONA 1TXDA 2LYDA 2HE7A 1ZVRA 2UZSA 2P0FA 3SYXA 2MFQA 2M14A 3PP2A 1PFJA 3QWMA 4L6EA 1XODA 2RLOA 1EGXA 4CYEA 1KI1B 1H4RA 2YS5A 4D0NB 1NU2A 1V5MA 3WA0A 1X1GA 3MDBC 4Z2NA 5C16A 4GZUA 4WVFB 1DBHA 2J0JA 3CIKA 5JHGA 4H8SA 2Z0QA 2G35A 4HAZB 2N23A 5JLJB 2EJ8A 1MK9B 1XD4A 4B6HA 2ROVA 3DXEA 2J0MA 4HB2B 2DHIA 5J3TA 2I1KA 1I7AA 5D3YA 3X23A 2MKRA 4NY0A 1FOEA 1P5TA 1J19A 3ULBA 3A8PA 2OQBA 3ULCA 4A6KA 3UZTA 1MAIA 3FM8C 2W2WA 3PVWA 5JP4A 4HDQA 1ISNA 4WSFA 4KHAA 4WJ7A 4F7HA 5JHHA 2DYNA 3N7CA 1GC7A 5J3YA 3G9WA 1ZC3B 2DX1A 4F7GA 3KRXA 2KUPA 2P0HA 5DIFB 5HE3A 3TW1A 2YF0A 4ZRIA 2AL6A 5FI1A 3TO1A 1MKEA 2D9YA 2Q13A 4KHBB 2NMBA 1AQCA 2I1JA 4HAVB 2YSZA 4MK0A 1FAOA 2L2IA 2ROZB 3OANA 5KQ1A 2CY4A 5FI0A 1QC6A 1M7RA 1Z87A 1FB8A 2ADZA 2KGXB 5GOWB 4IFSA 3KSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2COF A;  2CY5 A;  2GS0 A;  3TVV A;  4EMO A;  1ZSQ A;  1P6S A;  3TFM A;  1DDW A;  2YS3 A;  1WG7 A;  2VSZ A;  5C5B B;  2DYQ A;  3WYF B;  4XWX A;  2YT0 A;  1PMS A;  4A6F A;  5DHF B;  3RCP A;  1KZ7 A;  4Y94 A;  4K2P A;  3F5R A;  2I5C A;  3NSU A;  3TCA A;  2RNR B;  1NI2 A;  4HAW B;  4HAT B;  4A6H A;  3ODO A;  1Y19 B;  3QBV B;  1KZG A;  2RVB B;  1V88 A;  1WGU A;  3A98 B;  4GN1 A;  4BBK A;  1OY2 A;  1OMW A;  2ZPY A;  3AJ4 A;  1W1H A;  1GC6 A;  4ZRJ A;  1GG3 A;  1X05 A;  1UPQ A;  1V61 A;  4IAP A;  1UEF A;  3AU4 A;  3IVF A;  1QQG A;  2EMS A;  2DX5 A;  3KY9 A;  2YRY A;  1ZM0 A;  5KCV A;  3AU5 A;  2R0D A;  3ZDT A;  1U5D A;  1SHC A;  1TJ6 A;  3SUZ A;  1NTV A;  1K5G B;  2DN6 A;  2LG1 A;  1UNP A;  1XKE A;  2YVC A;  2LOZ A;  5EFX A;  4P7I A;  1J0W A;  5D3V A;  3VOQ A;  2E2X A;  2X18 A;  1WGQ A;  1PLS A;  2DHJ A;  5C6R A;  3A8Q A;  3HK0 A;  1P3R A;  2UVM A;  4YL8 A;  1RJ2 A;  1MIX A;  3F0W A;  3GYO A;  1DRO A;  4PNK A;  1WJM A;  5J3Q A;  4IOY X;  1H10 A;  4HHV A;  1Y5O A;  2YS1 A;  1MPH A;  4HB0 B;  4KHO A;  1FHX A;  1I2H A;  2DA0 A;  1EAZ A;  1MIZ B;  1DDM A;  2YT1 A;  3ODX A;  4C0A A;  2I5F A;  2V76 A;  4GMV A;  4HB4 B;  2RUK B;  4DXA B;  3D8D A;  2J59 M;  4DX8 A;  2ELA A;  4GXB A;  5L81 A;  3PEG A;  4TKN A;  1V5P A;  2VRW B;  3T06 A;  1M7E A;  5DH9 B;  1DYN A;  2LUL A;  2Y8F A;  5HE1 A;  4HAY B;  1V5U A;  3ML4 A;  2DLW A;  2D11 A;  2JP2 A;  2RSG A;  1N3H A;  2M38 A;  1U5E A;  2Y8G A;  2J0K A;  3QIJ A;  2DTC A;  2D9W A;  2D10 A;  2D9X A;  1WVH A;  2K00 A;  3PG7 A;  1Q67 A;  4K2O A;  2Z0O A;  3PSC A;  3ZVR A;  1WJ1 A;  1K5D B;  1DDV A;  2MDX A;  2K2U A;  1LW3 A;  2LOX A;  2CRF A;  3D8E A;  2D4Q A;  5CLL B;  2P0D A;  1EVH A;  4HB3 B;  1BAK A;  1XR0 B;  1U5F A;  2W2X C;  2AEH A;  1FHW A;  1U27 A;  2OTX A;  2NZ8 B;  1U2B A;  4GPT B;  4DX9 0;  1AWE A;  1X86 A;  5KQ4 A;  2UZR A;  3VIA A;  1XX0 A;  1X1F A;  1MK7 B;  2QKM A;  2H7D A;  3SO6 A;  4MY6 A;  4NSW A;  1TQZ A;  4GMX B;  4A6F B;  3ODW A;  2HTH B;  4K17 A;  5D27 A;  2K2J A;  5LOP B;  4EJN A;  3V5W A;  1RRP B;  3KRW A;  4DBB A;  2W2X D;  3PZD A;  2COA A;  2DKP A;  1W1D A;  4KAX B;  2CAY A;  1WI1 A;  5D3W A;  5LON B;  3GYP A;  3MPX A;  4CHJ A;  1BTN A;  1UPR A;  2GCL A;  4HAX B;  1X11 A;  2Y7B A;  5C79 A;  1NTY A;  1UNR A;  2COC A;  2IFS A;  3O96 A;  4Z2M B;  2EMT A;  2LKO A;  3SNH A;  2DHK A;  3M1I B;  3PVU A;  3DXD A;  2BCJ A;  4CHM A;  2ELB A;  2GCJ A;  3CXB B;  1BTK A;  2L1C A;  3P7Z A;  1FHO A;  3KZ1 A;  1ZC4 B;  1IRS A;  4HAU B;  1UNQ A;  4EKU A;  2PZ1 A;  2VKI A;  4TYZ A;  2Z0P A;  2QKL A;  4PQ0 A;  3SV1 A;  1BWN A;  2R09 A;  4ZRK A;  1U5G A;  3LJU X;  3FSS A;  2RGN B;  4MT7 A;  5D3X A;  5C5B A;  1E5W A;  2P8V A;  2DKQ A;  3U8Z A;  2MWN B;  3HW2 B;  1SGH A;  1OQN A;  5DI9 B;  1W1G A;  2COD A;  1V89 A;  2H7E A;  3U7D A;  3P6A A;  5DHA B;  1FGZ A;  3PVL A;  1XCG A;  2KCJ A;  2DFK A;  1FGY A;  2FJL A;  3BIN A;  3HQC A;  4A5K A;  5CLQ B;  5HE0 A;  1B55 A;  3DXC A;  3FEH A;  1LB1 A;  3BJI A;  5HE2 A;  1U29 A;  3D8F A;  2GJY A;  2IYB A;  4K81 A;  2N0Y A;  4KVG B;  2D2Q A;  2D9Z A;  2D9V A;  4HDO A;  2XQN M;  2EC1 A;  4F7U P;  1EF1 A;  4YON A;  1TXD A;  2LYD A;  2HE7 A;  1ZVR A;  2UZS A;  2P0F A;  3SYX A;  2MFQ A;  2M14 A;  3PP2 A;  1PFJ A;  3QWM A;  4L6E A;  1XOD A;  2RLO A;  1EGX A;  4CYE A;  1KI1 B;  1H4R A;  2YS5 A;  4D0N B;  1NU2 A;  1V5M A;  3WA0 A;  1X1G A;  3MDB C;  4Z2N A;  5C16 A;  4GZU A;  4WVF B;  1DBH A;  2J0J A;  3CIK A;  5JHG A;  4H8S A;  2Z0Q A;  2G35 A;  4HAZ B;  2N23 A;  5JLJ B;  2EJ8 A;  1MK9 B;  1XD4 A;  4B6H A;  2ROV A;  3DXE A;  2J0M A;  4HB2 B;  2DHI A;  5J3T A;  2I1K A;  1I7A A;  5D3Y A;  3X23 A;  2MKR A;  4NY0 A;  1FOE A;  1P5T A;  1J19 A;  3ULB A;  3A8P A;  2OQB A;  3ULC A;  4A6K A;  3UZT A;  1MAI A;  3FM8 C;  2W2W A;  3PVW A;  5JP4 A;  4HDQ A;  1ISN A;  4WSF A;  4KHA A;  4WJ7 A;  4F7H A;  5JHH A;  2DYN A;  3N7C A;  1GC7 A;  5J3Y A;  3G9W A;  1ZC3 B;  2DX1 A;  4F7G A;  3KRX A;  2KUP A;  2P0H A;  5DIF B;  5HE3 A;  3TW1 A;  2YF0 A;  4ZRI A;  2AL6 A;  5FI1 A;  3TO1 A;  1MKE A;  2D9Y A;  2Q13 A;  4KHB B;  2NMB A;  1AQC A;  2I1J A;  4HAV B;  2YSZ A;  4MK0 A;  1FAO A;  2L2I A;  2ROZ B;  3OAN A;  5KQ1 A;  2CY4 A;  5FI0 A;  1QC6 A;  1M7R A;  1Z87 A;  1FB8 A;  2ADZ A;  2KGX B;  5GOW B;  4IFS A;  3KSY A; 
#chains in the Genus database with same CATH topology
 2COF A;  1ZYI A;  2CY5 A;  2GS0 A;  3TVV A;  4EMO A;  5I2S A;  1ZSQ A;  1P6S A;  3TFM A;  1DDW A;  2YS3 A;  1WG7 A;  2VSZ A;  5C5B B;  2DYQ A;  3WYF B;  4XWX A;  2YT0 A;  1PMS A;  4A6F A;  2ZKM X;  5DHF B;  3RCP A;  5LG4 B;  1KZ7 A;  4Y94 A;  4K2P A;  3F5R A;  2I5C A;  3NSU A;  3TCA A;  2RNR B;  1NI2 A;  4HAW B;  4HAT B;  4A6H A;  3ODO A;  1Y19 B;  3QBV B;  1KZG A;  2RVB B;  1V88 A;  1WGU A;  3A98 B;  4GN1 A;  4BBK A;  1OY2 A;  3FVC A;  1OMW A;  2ZPY A;  3AJ4 A;  1W1H A;  1GC6 A;  4ZRJ A;  1GG3 A;  1X05 A;  1UPQ A;  1V61 A;  4IAP A;  3AU4 A;  1UEF A;  3IVF A;  3NWD A;  1QQG A;  2EMS A;  2DX5 A;  3KY9 A;  2YRY A;  1ZM0 A;  5KCV A;  3AU5 A;  2NBV A;  2R0D A;  3ZDT A;  1U5D A;  1SHC A;  1TJ6 A;  1MI1 A;  3SUZ A;  1NTV A;  3U12 A;  1K5G B;  2DN6 A;  2GUM A;  2LG1 A;  2K49 A;  1UNP A;  1XKE A;  2YVC A;  2LOZ A;  4OT1 A;  5EFX A;  4P7I A;  1J0W A;  5D3V A;  3VOQ A;  2E2X A;  2X18 A;  3NWA A;  1WGQ A;  1PLS A;  2DHJ A;  4CSQ A;  5C6R A;  3A8Q A;  3HK0 A;  1P3R A;  2UVM A;  4YL8 A;  1RJ2 A;  1MIX A;  3F0W A;  3GYO A;  4QJ4 B;  1DRO A;  4PNK A;  4D6W A;  1WJM A;  5J3Q A;  4IOY X;  1H10 A;  4HHV A;  1Y5O A;  2YS1 A;  1MPH A;  4HB0 B;  4KHO A;  1FHX A;  1I2H A;  2DA0 A;  1EAZ A;  1MIZ B;  1DDM A;  2YT1 A;  3ODX A;  4C0A A;  2I5F A;  2V76 A;  4GMV A;  4HB4 B;  2RUK B;  3A58 A;  4DXA B;  3D8D A;  2J59 M;  4DX8 A;  2FJU B;  2ELA A;  4GXB A;  5L81 A;  3PEG A;  4TKN A;  1V5P A;  2VRW B;  3T06 A;  1M7E A;  5DH9 B;  1DYN A;  2LUL A;  2Y8F A;  5HE1 A;  2R2Y A;  4HAY B;  1V5U A;  3ML4 A;  2YT2 A;  2DLW A;  2D11 A;  2JP2 A;  4HSI A;  2RSG A;  5I2M A;  1N3H A;  2M38 A;  1U5E A;  2Y8G A;  2J0K A;  3QIJ A;  2DTC A;  2D9W A;  2D10 A;  2D9X A;  1WVH A;  3HSA A;  2K00 A;  3PG7 A;  1Q67 A;  4K2O A;  2Z0O A;  5IRS A;  3PSC A;  3ZVR A;  1WJ1 A;  1K5D B;  3B77 A;  1DDV A;  2KUQ A;  2MDX A;  2K2U A;  1LW3 A;  2LOX A;  2CRF A;  3D8E A;  2D4Q A;  5CLL B;  2KIE A;  2P0D A;  1EVH A;  4HB3 B;  1BAK A;  1XR0 B;  1U5F A;  2W2X C;  2AEH A;  2Z59 A;  1FHW A;  1U27 A;  2OTX A;  2NZ8 B;  2K8E A;  1U2B A;  4GPT B;  4DX9 0;  1AWE A;  1X86 A;  5KQ4 A;  2UZR A;  3VIA A;  1XX0 A;  1X1F A;  1MK7 B;  2QKM A;  2H7D A;  3SO6 A;  2KR0 A;  4MY6 A;  4NSW A;  1TQZ A;  4GMX B;  4A6F B;  3ODW A;  2HTH B;  4K17 A;  5D27 A;  2K2J A;  5LOP B;  2Z13 A;  4EJN A;  3HIE A;  3V5W A;  1RRP B;  3KRW A;  4DBB A;  2W2X D;  3PZD A;  2COA A;  2DKP A;  1W1D A;  4KAX B;  2CAY A;  1WI1 A;  5D3W A;  5LON B;  4QJ3 B;  3GYP A;  3MPX A;  4CHJ A;  1BTN A;  1UPR A;  2GCL A;  4HAX B;  1X11 A;  2Y7B A;  5C79 A;  1NTY A;  1UNR A;  2COC A;  4KHB A;  2IFS A;  3O96 A;  4Z2M B;  2EMT A;  4GNK B;  2LKO A;  3SNH A;  2DHK A;  3M1I B;  3PVU A;  3DXD A;  2BCJ A;  4CHM A;  2ELB A;  2RRF A;  2GCJ A;  3CXB B;  1BTK A;  2L1C A;  3P7Z A;  1FHO A;  3KZ1 A;  1ZC4 B;  1IRS A;  4HAU B;  1UNQ A;  4EKU A;  2PZ1 A;  2VKI A;  4TYZ A;  2Z0P A;  2QKL A;  4OSN A;  4PQ0 A;  3SV1 A;  1BWN A;  2R09 A;  4ZRK A;  1U5G A;  3LJU X;  3FSS A;  2RGN B;  4MT7 A;  5D3X A;  5C5B A;  1E5W A;  2P8V A;  2DKQ A;  3U8Z A;  2MWN B;  3HW2 B;  1SGH A;  1OQN A;  5DI9 B;  1W1G A;  2COD A;  1V89 A;  2H7E A;  3U7D A;  3P6A A;  5DHA B;  1FGZ A;  3PVL A;  1XCG A;  2KCJ A;  2DFK A;  3NWF A;  1FGY A;  2FJL A;  4GOU A;  3BIN A;  3HQC A;  4A5K A;  5CLQ B;  5HE0 A;  1B55 A;  3DXC A;  3FEH A;  1LB1 A;  3BJI A;  5HE2 A;  1U29 A;  3D8F A;  2GJY A;  2IYB A;  4K81 A;  2N0Y A;  4KVG B;  2D2Q A;  2D9Z A;  2D9V A;  4HDO A;  2KIG A;  2XQN M;  2EC1 A;  4F7U P;  1EF1 A;  4YON A;  1TXD A;  2LYD A;  2HE7 A;  1ZVR A;  4QJ5 B;  2UZS A;  2P0F A;  3SYX A;  2MFQ A;  2M14 A;  2Z14 A;  3NW8 A;  3PP2 A;  1PFJ A;  3QWM A;  4L6E A;  1XOD A;  2RLO A;  1EGX A;  4CYE A;  1KI1 B;  1H4R A;  2YS5 A;  4D0N B;  1NU2 A;  1V5M A;  3WA0 A;  1X1G A;  3MDB C;  5M4Y B;  4Z2N A;  5C16 A;  4GZU A;  4WVF B;  1T77 A;  1DBH A;  2J0J A;  3CIK A;  5JHG A;  4H8S A;  4L1R A;  2Z0Q A;  2G35 A;  4HAZ B;  2N23 A;  5JLJ B;  2EJ8 A;  1MK9 B;  3DCX A;  1XD4 A;  4B6H A;  2ROV A;  3DXE A;  2J0M A;  4HB2 B;  2DHI A;  5J3T A;  2I1K A;  1I7A A;  5D3Y A;  3X23 A;  2MKR A;  4NY0 A;  1FOE A;  1P5T A;  1J19 A;  3OHM B;  3ULB A;  3A8P A;  2OQB A;  3ULC A;  4A6K A;  3UZT A;  1MAI A;  3FM8 C;  2W2W A;  3PVW A;  5JP4 A;  4HDQ A;  1ISN A;  4QXA B;  4WSF A;  4KHA A;  4WJ7 A;  4F7H A;  5JHH A;  2DYN A;  3N7C A;  1GC7 A;  5J3Y A;  3G9W A;  1ZC3 B;  2DX1 A;  4F7G A;  3KRX A;  2KUP A;  2P0H A;  5DIF B;  5HE3 A;  3TW1 A;  2YF0 A;  4ZRI A;  2AL6 A;  5FI1 A;  3TO1 A;  1MKE A;  2D9Y A;  2Q13 A;  4KHB B;  2NMB A;  1AQC A;  2I1J A;  4HAV B;  2YSZ A;  4MK0 A;  1FAO A;  2L2I A;  2ROZ B;  3OAN A;  5KQ1 A;  4DIX A;  2Z4D A;  2CY4 A;  5FI0 A;  1QC6 A;  1M7R A;  1Z87 A;  1FB8 A;  2ADZ A;  2KGX B;  5GOW B;  4IFS A;  3KSY A; 
#chains in the Genus database with same CATH homology
 2COF A;  2CY5 A;  2GS0 A;  3TVV A;  4EMO A;  1ZSQ A;  1P6S A;  3TFM A;  1DDW A;  2YS3 A;  1WG7 A;  2VSZ A;  5C5B B;  2DYQ A;  3WYF B;  4XWX A;  2YT0 A;  1PMS A;  4A6F A;  5DHF B;  3RCP A;  1KZ7 A;  4Y94 A;  4K2P A;  3F5R A;  2I5C A;  3NSU A;  3TCA A;  2RNR B;  1NI2 A;  4HAW B;  4HAT B;  4A6H A;  3ODO A;  1Y19 B;  3QBV B;  1KZG A;  2RVB B;  1V88 A;  1WGU A;  3A98 B;  4GN1 A;  4BBK A;  1OY2 A;  1OMW A;  2ZPY A;  3AJ4 A;  1W1H A;  1GC6 A;  4ZRJ A;  1GG3 A;  1X05 A;  1UPQ A;  1V61 A;  4IAP A;  1UEF A;  3AU4 A;  3IVF A;  1QQG A;  2EMS A;  2DX5 A;  3KY9 A;  2YRY A;  1ZM0 A;  5KCV A;  3AU5 A;  2R0D A;  3ZDT A;  1U5D A;  1SHC A;  1TJ6 A;  3SUZ A;  1NTV A;  1K5G B;  2DN6 A;  2LG1 A;  1UNP A;  1XKE A;  2YVC A;  2LOZ A;  5EFX A;  4P7I A;  1J0W A;  5D3V A;  3VOQ A;  2E2X A;  2X18 A;  1WGQ A;  1PLS A;  2DHJ A;  5C6R A;  3A8Q A;  3HK0 A;  1P3R A;  2UVM A;  4YL8 A;  1RJ2 A;  1MIX A;  3F0W A;  3GYO A;  1DRO A;  4PNK A;  1WJM A;  5J3Q A;  4IOY X;  1H10 A;  4HHV A;  1Y5O A;  2YS1 A;  1MPH A;  4HB0 B;  4KHO A;  1FHX A;  1I2H A;  2DA0 A;  1EAZ A;  1MIZ B;  1DDM A;  2YT1 A;  3ODX A;  4C0A A;  2I5F A;  2V76 A;  4GMV A;  4HB4 B;  2RUK B;  4DXA B;  3D8D A;  2J59 M;  4DX8 A;  2ELA A;  4GXB A;  5L81 A;  3PEG A;  4TKN A;  1V5P A;  2VRW B;  3T06 A;  1M7E A;  5DH9 B;  1DYN A;  2LUL A;  2Y8F A;  5HE1 A;  4HAY B;  1V5U A;  3ML4 A;  2DLW A;  2D11 A;  2JP2 A;  2RSG A;  1N3H A;  2M38 A;  1U5E A;  2Y8G A;  2J0K A;  3QIJ A;  2DTC A;  2D9W A;  2D10 A;  2D9X A;  1WVH A;  2K00 A;  3PG7 A;  1Q67 A;  4K2O A;  2Z0O A;  3PSC A;  3ZVR A;  1WJ1 A;  1K5D B;  1DDV A;  2MDX A;  2K2U A;  1LW3 A;  2LOX A;  2CRF A;  3D8E A;  2D4Q A;  5CLL B;  2P0D A;  1EVH A;  4HB3 B;  1BAK A;  1XR0 B;  1U5F A;  2W2X C;  2AEH A;  1FHW A;  1U27 A;  2OTX A;  2NZ8 B;  1U2B A;  4GPT B;  4DX9 0;  1AWE A;  1X86 A;  5KQ4 A;  2UZR A;  3VIA A;  1XX0 A;  1X1F A;  1MK7 B;  2QKM A;  2H7D A;  3SO6 A;  4MY6 A;  4NSW A;  1TQZ A;  4GMX B;  4A6F B;  3ODW A;  2HTH B;  4K17 A;  5D27 A;  2K2J A;  5LOP B;  4EJN A;  3V5W A;  1RRP B;  3KRW A;  4DBB A;  2W2X D;  3PZD A;  2COA A;  2DKP A;  1W1D A;  4KAX B;  2CAY A;  1WI1 A;  5D3W A;  5LON B;  3GYP A;  3MPX A;  4CHJ A;  1BTN A;  1UPR A;  2GCL A;  4HAX B;  1X11 A;  2Y7B A;  5C79 A;  1NTY A;  1UNR A;  2COC A;  2IFS A;  3O96 A;  4Z2M B;  2EMT A;  2LKO A;  3SNH A;  2DHK A;  3M1I B;  3PVU A;  3DXD A;  2BCJ A;  4CHM A;  2ELB A;  2GCJ A;  3CXB B;  1BTK A;  2L1C A;  3P7Z A;  1FHO A;  3KZ1 A;  1ZC4 B;  1IRS A;  4HAU B;  1UNQ A;  4EKU A;  2PZ1 A;  2VKI A;  4TYZ A;  2Z0P A;  2QKL A;  4PQ0 A;  3SV1 A;  1BWN A;  2R09 A;  4ZRK A;  1U5G A;  3LJU X;  3FSS A;  2RGN B;  4MT7 A;  5D3X A;  5C5B A;  1E5W A;  2P8V A;  2DKQ A;  3U8Z A;  2MWN B;  3HW2 B;  1SGH A;  1OQN A;  5DI9 B;  1W1G A;  2COD A;  1V89 A;  2H7E A;  3U7D A;  3P6A A;  5DHA B;  1FGZ A;  3PVL A;  1XCG A;  2KCJ A;  2DFK A;  1FGY A;  2FJL A;  3BIN A;  3HQC A;  4A5K A;  5CLQ B;  5HE0 A;  1B55 A;  3DXC A;  3FEH A;  1LB1 A;  3BJI A;  5HE2 A;  1U29 A;  3D8F A;  2GJY A;  2IYB A;  4K81 A;  2N0Y A;  4KVG B;  2D2Q A;  2D9Z A;  2D9V A;  4HDO A;  2XQN M;  2EC1 A;  4F7U P;  1EF1 A;  4YON A;  1TXD A;  2LYD A;  2HE7 A;  1ZVR A;  2UZS A;  2P0F A;  3SYX A;  2MFQ A;  2M14 A;  3PP2 A;  1PFJ A;  3QWM A;  4L6E A;  1XOD A;  2RLO A;  1EGX A;  4CYE A;  1KI1 B;  1H4R A;  2YS5 A;  4D0N B;  1NU2 A;  1V5M A;  3WA0 A;  1X1G A;  3MDB C;  4Z2N A;  5C16 A;  4GZU A;  4WVF B;  1DBH A;  2J0J A;  3CIK A;  5JHG A;  4H8S A;  2Z0Q A;  2G35 A;  4HAZ B;  2N23 A;  5JLJ B;  2EJ8 A;  1MK9 B;  1XD4 A;  4B6H A;  2ROV A;  3DXE A;  2J0M A;  4HB2 B;  2DHI A;  5J3T A;  2I1K A;  1I7A A;  5D3Y A;  3X23 A;  2MKR A;  4NY0 A;  1FOE A;  1P5T A;  1J19 A;  3ULB A;  3A8P A;  2OQB A;  3ULC A;  4A6K A;  3UZT A;  1MAI A;  3FM8 C;  2W2W A;  3PVW A;  5JP4 A;  4HDQ A;  1ISN A;  4WSF A;  4KHA A;  4WJ7 A;  4F7H A;  5JHH A;  2DYN A;  3N7C A;  1GC7 A;  5J3Y A;  3G9W A;  1ZC3 B;  2DX1 A;  4F7G A;  3KRX A;  2KUP A;  2P0H A;  5DIF B;  5HE3 A;  3TW1 A;  2YF0 A;  4ZRI A;  2AL6 A;  5FI1 A;  3TO1 A;  1MKE A;  2D9Y A;  2Q13 A;  4KHB B;  2NMB A;  1AQC A;  2I1J A;  4HAV B;  2YSZ A;  4MK0 A;  1FAO A;  2L2I A;  2ROZ B;  3OAN A;  5KQ1 A;  2CY4 A;  5FI0 A;  1QC6 A;  1M7R A;  1Z87 A;  1FB8 A;  2ADZ A;  2KGX B;  5GOW B;  4IFS A;  3KSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...