2LG1A

Solution structure of the human akap13 ph domain and stabilizing dh helix
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
185
structure length
185
Chain Sequence
SMTKDNEVEQEDLAQSLSLVKDVIGAVDSKVASYEKKVRLNEIYTKTDSKSIMRMKSGQMFAKEDLKRKKLVRDGSVFLKNAAGRLKEVQAVLLTDILVFLQEKDQKYIFASLDQKSTVISLKKLIVREVAHEEKGLFLISMGMTDPEMVEVHASSKEERNSWIQIIQDTINTLNRDEDEGIPSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords A-kinase anchor protein 13
publication title Structural Insights into the Activation of the RhoA GTPase by the Lbc Oncoprotein.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2lg1A02
2DYQA 4A6KA 3V5WA 1SHCA 1Q67A 1UPQA 1H10A 3DXEA 2COAA 1NU2A 2D11A 2D9YA 2YT0A 2HE7A 2M14A 3QIJA 2R09A 4WVFB 1MPHA 4CYEA 1K5DB 3HW2B 1KI1B 3QBVB 1DYNA 1WJMA 3U8ZA 2FJLA 2DX5A 1TXDA 2NMBA 5D3XA 1MK7B 2GCLA 1FB8A 2DHIA 1E5WA 3SO6A 3QWMA 4L6EA 5D3YA 1FHOA 1U5DA 1FOEA 1ZVRA 4HAUB 2COFA 1ZSQA 2VSZA 3ULCA 3MDBC 2D9VA 5HE3A 1NTYA 2AL6A 4GXBA 3BJIA 1X1FA 2I5CA 3DXDA 3SV1A 2CY5A 1XR0B 2I1JA 1DDVA 2RUKB 2VKIA 1U27A 3X23A 2P8VA 3GYPA 3O96A 3RCPA 2RVBB 2UVMA 1WI1A 2AEHA 2Y8GA 3HK0A 3T06A 3ULBA 4MT7A 2IYBA 3SUZA 4WJ7A 5HE2A 2KUPA 4DXAB 4Y94A 2DN6A 1V5MA 1X86A 2EMSA 4WSFA 5FI0A 5D3WA 1W1GA 3A8PA 3G9WA 1P5TA 2P0FA 2Q13A 2IFSA 2ROZB 4PQ0A 2DFKA 1DROA 5DI9B 2M38A 4HAZB 3ZVRA 1PLSA 4HDQA 1KZGA 1RJ2A 3VOQA 4P7IA 2P0HA 4TKNA 2QKMA 2XQNM 2LKOA 2W2WA 4CHMA 4HAYB 3D8DA 1XD4A 4EMOA 4KVGB 2LULA 2CY4A 2RLOA 1WJ1A 1OY2A 2W2XD 3VIAA 4C0AA 1OQNA 5C6RA 2D9XA 2E2XA 1BAKA 4EJNA 2Y7BA 1FHWA 2YT1A 2J0JA 3KZ1A 1MIXA 5CLLB 2JP2A 2RGNB 4HB2B 1U5GA 2Y8FA 1ZC3B 4MK0A 3HQCA 1FGZA 4HAWB 5C5BB 4DX8A 4KHOA 2DLWA 2QKLA 5DHFB 5L81A 4F7GA 4DX90 1GC7A 4HATB 5DIFB 3BINA 1P6SA 3A98B 3PVLA 5DH9B 1X11A 5LOPB 1WG7A 4Z2NA 1K5GB 1ISNA 3M1IB 3ODWA 1Y5OA 2MFQA 3D8FA 4NY0A 4BBKA 2YS1A 1MK9B 2MDXA 4A6HA 5D3VA 3PG7A 4GPTB 2LG1A 2ADZA 1FAOA 2CAYA 3TFMA 2UZRA 2ZPYA 1IRSA 4EKUA 2J0KA 4CHJA 3CXBB 1UNPA 2MWNB 4F7UP 2Z0QA 1V88A 2EMTA 3PEGA 2R0DA 4GN1A 4PNKA 4IOYX 1X1GA 2ELAA 5FI1A 3WYFB 2YF0A 5JHGA 1WGQA 4KHBB 1W1DA 2KCJA 2Z0OA 3P6AA 1QC6A 2RSGA 1V5PA 4K17A 3SYXA 2GS0A 4HAVB 4Z2MB 1NI2A 3WA0A 4A6FB 1WVHA 5CLQB 1PFJA 3KRXA 4DBBA 3KRWA 1U29A 2LYDA 5HE1A 4ZRIA 5LONB 1GC6A 1W1HA 1M7RA 2CRFA 2I1KA 2EC1A 2DHJA 3MPXA 1QQGA 3A8QA 1BTKA 2DA0A 3KSYA 2YRYA 5J3TA 2N0YA 4H8SA 1WGUA 3FEHA 2MKRA 3PP2A 2RNRB 1U5FA 1LW3A 1DBHA 4KHAA 3IVFA 5DHAB 2J59M 4GMVA 3AU5A 5EFXA 2N23A 4XWXA 2D4QA 1BTNA 4HB3B 3KY9A 1DDMA 4NSWA 2VRWB 2D9ZA 5C5BA 5C16A 1BWNA 2D10A 1X05A 4IAPA 5D27A 1GG3A 4K2PA 4K81A 1FGYA 5GOWB 5KQ4A 1LB1A 1SGHA 2DKQA 2W2XC 5KQ1A 5JLJB 2K00A 1XCGA 2DYNA 2DKPA 1MAIA 1MIZB 3ODXA 1ZM0A 5J3QA 5C79A 4B6HA 1J19A 1U5EA 1EAZA 4HB4B 4YL8A 1V61A 3F0WA 4HHVA 4HAXB 1TJ6A 2OTXA 2L2IA 2Z0PA 1KZ7A 1M7EA 1UNRA 2H7EA 3N7CA 2LOXA 4K2OA 4ZRJA 5JHHA 1XKEA 4HB0B 2DTCA 2YSZA 2YS5A 5KCVA 1FHXA 2X18A 3LJUX 3ZDTA 4MY6A 3DXCA 1B55A 4TYZA 3ML4A 3D8EA 2LOZA 2H7DA 3SNHA 1V89A 1N3HA 3FSSA 4GZUA 1UEFA 4IFSA 3CIKA 2ROVA 2GCJA 4YONA 4GMXB 4F7HA 1I2HA 2COCA 4A6FA 2UZSA 2D2QA 3F5RA 3UZTA 2ELBA 1H4RA 2YS3A 2K2UA 2G35A 3PVWA 1EVHA 1V5UA 2YVCA 3AJ4A 2J0MA 4HDOA 1NTVA 1ZC4B 2CODA 1PMSA 1I7AA 3TVVA 2D9WA 1XODA 2L1CA 3GYOA 2HTHB 4ZRKA 3U7DA 3ODOA 1U2BA 4KAXB 1EGXA 2V76A 3PVUA 1XX0A 4A5KA 3OANA 2OQBA 2BCJA 2KGXB 3TCAA 1AWEA 1UPRA 1P3RA 5HE0A 2K2JA 2EJ8A 1MKEA 3NSUA 2P0DA 1EF1A 2DX1A 2DHKA 3P7ZA 5J3YA 1Y19B 2I5FA 1TQZA 3FM8C 1AQCA 1OMWA 3TO1A 1RRPB 1Z87A 1J0WA 2NZ8B 2GJYA 5JP4A 3TW1A 2PZ1A 3AU4A 3PZDA 1DDWA 4D0NB 3PSCA 1UNQA
chains in the Genus database with same CATH superfamily
2DYQA 4A6KA 3V5WA 1SHCA 1Q67A 1UPQA 1H10A 3DXEA 3DCXA 2COAA 1NU2A 2D11A 2D9YA 2Z14A 3HIEA 2YT0A 2HE7A 2M14A 3QIJA 2R09A 4WVFB 1MPHA 4CYEA 1K5DB 3HW2B 1KI1B 3QBVB 1DYNA 1WJMA 3U8ZA 2FJLA 2DX5A 1TXDA 2NMBA 5D3XA 1MK7B 4QJ3B 2GCLA 2R2YA 5M4YB 1FB8A 2DHIA 4L1RA 3B77A 1E5WA 3SO6A 3QWMA 4L6EA 5D3YA 1FHOA 1U5DA 1FOEA 4CSQA 1ZVRA 4HAUB 2COFA 2RRFA 1ZSQA 2VSZA 3ULCA 3MDBC 2D9VA 5HE3A 1NTYA 2AL6A 4GXBA 3BJIA 1X1FA 2I5CA 3DXDA 3SV1A 2CY5A 1XR0B 2GUMA 2I1JA 1DDVA 2RUKB 2VKIA 1U27A 3X23A 2P8VA 3GYPA 3O96A 3RCPA 2RVBB 2UVMA 1WI1A 2AEHA 4QJ5B 2Y8GA 3HK0A 3T06A 3ULBA 2ZKMX 4MT7A 2IYBA 3SUZA 4WJ7A 5HE2A 2KUPA 4DXAB 4Y94A 2DN6A 1V5MA 1X86A 2EMSA 4WSFA 5FI0A 5D3WA 1W1GA 3A8PA 3G9WA 1P5TA 2P0FA 2Q13A 2IFSA 2ROZB 4PQ0A 2DFKA 1DROA 5DI9B 2M38A 4HAZB 3ZVRA 1PLSA 4HDQA 1KZGA 1RJ2A 3VOQA 4P7IA 2P0HA 4TKNA 2QKMA 2XQNM 2LKOA 2W2WA 4CHMA 4HAYB 3D8DA 1XD4A 4EMOA 4KVGB 2LULA 5I2MA 2CY4A 2KIEA 2RLOA 1WJ1A 1OY2A 2K8EA 2W2XD 3VIAA 4C0AA 1OQNA 5C6RA 2D9XA 2E2XA 1BAKA 4EJNA 2YT2A 2Y7BA 1FHWA 4HSIA 2YT1A 2J0JA 3KZ1A 1MIXA 5CLLB 2JP2A 2RGNB 4HB2B 1U5GA 2Y8FA 1ZC3B 4MK0A 3HQCA 1FGZA 4D6WA 4HAWB 5C5BB 4DX8A 4KHOA 2DLWA 2QKLA 5DHFB 5L81A 4F7GA 4DX90 1GC7A 4HATB 3U12A 5DIFB 3BINA 1P6SA 5IRSA 3A98B 3PVLA 5DH9B 1X11A 5LOPB 1WG7A 4Z2NA 1K5GB 1ISNA 3M1IB 3ODWA 1Y5OA 2MFQA 3D8FA 4NY0A 2KIGA 4BBKA 2YS1A 1MK9B 4QXAB 2MDXA 4A6HA 5D3VA 3PG7A 4GPTB 2LG1A 2ADZA 1FAOA 2CAYA 3TFMA 2UZRA 2ZPYA 1IRSA 4EKUA 2J0KA 4CHJA 3CXBB 1UNPA 3A58A 2MWNB 4F7UP 2Z0QA 1V88A 2EMTA 3PEGA 2R0DA 4GN1A 4PNKA 4OT1A 4IOYX 1X1GA 2ELAA 5FI1A 3WYFB 2YF0A 5JHGA 1WGQA 4KHBB 1W1DA 2KCJA 2Z0OA 3P6AA 3FVCA 1QC6A 2RSGA 1V5PA 4K17A 3SYXA 2GS0A 4HAVB 4Z2MB 1NI2A 3WA0A 4A6FB 1WVHA 2Z59A 3NWFA 5CLQB 1PFJA 3KRXA 4DBBA 3KRWA 1U29A 2LYDA 5HE1A 4ZRIA 5LONB 1GC6A 1W1HA 1M7RA 2CRFA 2I1KA 2EC1A 4OSNA 2DHJA 3MPXA 1QQGA 3A8QA 1BTKA 2DA0A 3KSYA 2K49A 2YRYA 5J3TA 2N0YA 4H8SA 3NWAA 5LG4B 1WGUA 3FEHA 2MKRA 3PP2A 2RNRB 1LW3A 1U5FA 1DBHA 4KHAA 3IVFA 5DHAB 2J59M 4GMVA 3AU5A 5EFXA 2N23A 4XWXA 2D4QA 1BTNA 4HB3B 3KY9A 1DDMA 4NSWA 2VRWB 2D9ZA 5C5BA 5C16A 3NW8A 3HSAA 1BWNA 2D10A 1X05A 4IAPA 5D27A 1GG3A 4K2PA 4K81A 1FGYA 5GOWB 5KQ4A 1LB1A 1SGHA 2DKQA 2W2XC 5KQ1A 5JLJB 2K00A 1XCGA 2DYNA 2DKPA 1MAIA 1MIZB 2KR0A 3ODXA 1ZM0A 5J3QA 5C79A 4B6HA 1J19A 1U5EA 1EAZA 4HB4B 4YL8A 1V61A 3F0WA 4HHVA 4HAXB 1TJ6A 2OTXA 2L2IA 2Z0PA 1KZ7A 1M7EA 1UNRA 2H7EA 2KUQA 2LOXA 3N7CA 4K2OA 4ZRJA 5JHHA 1XKEA 4HB0B 4GNKB 2DTCA 2YSZA 2YS5A 5KCVA 1FHXA 2X18A 3LJUX 3ZDTA 4MY6A 3DXCA 1B55A 4TYZA 3ML4A 3D8EA 2LOZA 4KHBA 2H7DA 3SNHA 1V89A 4QJ4B 1N3HA 3FSSA 4GZUA 1UEFA 4IFSA 3CIKA 2ROVA 2GCJA 4YONA 4GMXB 2Z4DA 4F7HA 1I2HA 2COCA 4GOUA 4A6FA 2UZSA 2D2QA 3F5RA 3UZTA 2ELBA 1H4RA 2YS3A 2K2UA 2G35A 3PVWA 1EVHA 1V5UA 2YVCA 3AJ4A 1MI1A 2J0MA 4HDOA 1NTVA 1ZC4B 2CODA 1PMSA 4DIXA 1I7AA 2NBVA 3TVVA 2D9WA 1XODA 2L1CA 3GYOA 2HTHB 4ZRKA 3U7DA 3ODOA 1U2BA 4KAXB 1EGXA 2V76A 3PVUA 1XX0A 4A5KA 3OANA 2OQBA 2BCJA 2KGXB 3TCAA 1ZYIA 1AWEA 1UPRA 1P3RA 5HE0A 2K2JA 2EJ8A 1MKEA 3NSUA 3OHMB 2P0DA 1EF1A 5I2SA 2DX1A 2DHKA 3P7ZA 2Z13A 5J3YA 1Y19B 2I5FA 1TQZA 3FM8C 1AQCA 1OMWA 3TO1A 1RRPB 1Z87A 1T77A 1J0WA 2NZ8B 2GJYA 5JP4A 2FJUB 3TW1A 2PZ1A 3AU4A 3PZDA 3NWDA 1DDWA 4D0NB 3PSCA 1UNQA
chains in the Genus database with same CATH topology
2DYQA 4A6KA 3V5WA 1SHCA 1Q67A 1UPQA 1H10A 3DXEA 2COAA 1NU2A 2D11A 2D9YA 2YT0A 2HE7A 2M14A 3QIJA 2R09A 4WVFB 1MPHA 4CYEA 1K5DB 3HW2B 1KI1B 3QBVB 1DYNA 1WJMA 3U8ZA 2FJLA 2DX5A 1TXDA 2NMBA 5D3XA 1MK7B 2GCLA 1FB8A 2DHIA 1E5WA 3SO6A 3QWMA 4L6EA 5D3YA 1FHOA 1U5DA 1FOEA 1ZVRA 4HAUB 2COFA 1ZSQA 2VSZA 3ULCA 3MDBC 2D9VA 5HE3A 1NTYA 2AL6A 4GXBA 3BJIA 1X1FA 2I5CA 3DXDA 3SV1A 2CY5A 1XR0B 2I1JA 1DDVA 2RUKB 2VKIA 1U27A 3X23A 2P8VA 3GYPA 3O96A 3RCPA 2RVBB 2UVMA 1WI1A 2AEHA 2Y8GA 3HK0A 3T06A 3ULBA 4MT7A 2IYBA 3SUZA 4WJ7A 5HE2A 2KUPA 4DXAB 4Y94A 2DN6A 1V5MA 1X86A 2EMSA 4WSFA 5FI0A 5D3WA 1W1GA 3A8PA 3G9WA 1P5TA 2P0FA 2Q13A 2IFSA 2ROZB 4PQ0A 2DFKA 1DROA 5DI9B 2M38A 4HAZB 3ZVRA 1PLSA 4HDQA 1KZGA 1RJ2A 3VOQA 4P7IA 2P0HA 4TKNA 2QKMA 2XQNM 2LKOA 2W2WA 4CHMA 4HAYB 3D8DA 1XD4A 4EMOA 4KVGB 2LULA 2CY4A 2RLOA 1WJ1A 1OY2A 2W2XD 3VIAA 4C0AA 1OQNA 5C6RA 2D9XA 2E2XA 1BAKA 4EJNA 2Y7BA 1FHWA 2YT1A 2J0JA 3KZ1A 1MIXA 5CLLB 2JP2A 2RGNB 4HB2B 1U5GA 2Y8FA 1ZC3B 4MK0A 3HQCA 1FGZA 4HAWB 5C5BB 4DX8A 4KHOA 2DLWA 2QKLA 5DHFB 5L81A 4F7GA 4DX90 1GC7A 4HATB 5DIFB 3BINA 1P6SA 3A98B 3PVLA 5DH9B 1X11A 5LOPB 1WG7A 4Z2NA 1K5GB 1ISNA 3M1IB 3ODWA 1Y5OA 2MFQA 3D8FA 4NY0A 4BBKA 2YS1A 1MK9B 2MDXA 4A6HA 5D3VA 3PG7A 4GPTB 2LG1A 2ADZA 1FAOA 2CAYA 3TFMA 2UZRA 2ZPYA 1IRSA 4EKUA 2J0KA 4CHJA 3CXBB 1UNPA 2MWNB 4F7UP 2Z0QA 1V88A 2EMTA 3PEGA 2R0DA 4GN1A 4PNKA 4IOYX 1X1GA 2ELAA 5FI1A 3WYFB 2YF0A 5JHGA 1WGQA 4KHBB 1W1DA 2KCJA 2Z0OA 3P6AA 1QC6A 2RSGA 1V5PA 4K17A 3SYXA 2GS0A 4HAVB 4Z2MB 1NI2A 3WA0A 4A6FB 1WVHA 5CLQB 1PFJA 3KRXA 4DBBA 3KRWA 1U29A 2LYDA 5HE1A 4ZRIA 5LONB 1GC6A 1W1HA 1M7RA 2CRFA 2I1KA 2EC1A 2DHJA 3MPXA 1QQGA 3A8QA 1BTKA 2DA0A 3KSYA 2YRYA 5J3TA 2N0YA 4H8SA 1WGUA 3FEHA 2MKRA 3PP2A 2RNRB 1U5FA 1LW3A 1DBHA 4KHAA 3IVFA 5DHAB 2J59M 4GMVA 3AU5A 5EFXA 2N23A 4XWXA 2D4QA 1BTNA 4HB3B 3KY9A 1DDMA 4NSWA 2VRWB 2D9ZA 5C5BA 5C16A 1BWNA 2D10A 1X05A 4IAPA 5D27A 1GG3A 4K2PA 4K81A 1FGYA 5GOWB 5KQ4A 1LB1A 1SGHA 2DKQA 2W2XC 5KQ1A 5JLJB 2K00A 1XCGA 2DYNA 2DKPA 1MAIA 1MIZB 3ODXA 1ZM0A 5J3QA 5C79A 4B6HA 1J19A 1U5EA 1EAZA 4HB4B 4YL8A 1V61A 3F0WA 4HHVA 4HAXB 1TJ6A 2OTXA 2L2IA 2Z0PA 1KZ7A 1M7EA 1UNRA 2H7EA 3N7CA 2LOXA 4K2OA 4ZRJA 5JHHA 1XKEA 4HB0B 2DTCA 2YSZA 2YS5A 5KCVA 1FHXA 2X18A 3LJUX 3ZDTA 4MY6A 3DXCA 1B55A 4TYZA 3ML4A 3D8EA 2LOZA 2H7DA 3SNHA 1V89A 1N3HA 3FSSA 4GZUA 1UEFA 4IFSA 3CIKA 2ROVA 2GCJA 4YONA 4GMXB 4F7HA 1I2HA 2COCA 4A6FA 2UZSA 2D2QA 3F5RA 3UZTA 2ELBA 1H4RA 2YS3A 2K2UA 2G35A 3PVWA 1EVHA 1V5UA 2YVCA 3AJ4A 2J0MA 4HDOA 1NTVA 1ZC4B 2CODA 1PMSA 1I7AA 3TVVA 2D9WA 1XODA 2L1CA 3GYOA 2HTHB 4ZRKA 3U7DA 3ODOA 1U2BA 4KAXB 1EGXA 2V76A 3PVUA 1XX0A 4A5KA 3OANA 2OQBA 2BCJA 2KGXB 3TCAA 1AWEA 1UPRA 1P3RA 5HE0A 2K2JA 2EJ8A 1MKEA 3NSUA 2P0DA 1EF1A 2DX1A 2DHKA 3P7ZA 5J3YA 1Y19B 2I5FA 1TQZA 3FM8C 1AQCA 1OMWA 3TO1A 1RRPB 1Z87A 1J0WA 2NZ8B 2GJYA 5JP4A 3TW1A 2PZ1A 3AU4A 3PZDA 1DDWA 4D0NB 3PSCA 1UNQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYQ A;  4A6K A;  3V5W A;  1SHC A;  1Q67 A;  1UPQ A;  1H10 A;  3DXE A;  2COA A;  1NU2 A;  2D11 A;  2D9Y A;  2YT0 A;  2HE7 A;  2M14 A;  3QIJ A;  2R09 A;  4WVF B;  1MPH A;  4CYE A;  1K5D B;  3HW2 B;  1KI1 B;  3QBV B;  1DYN A;  1WJM A;  3U8Z A;  2FJL A;  2DX5 A;  1TXD A;  2NMB A;  5D3X A;  1MK7 B;  2GCL A;  1FB8 A;  2DHI A;  1E5W A;  3SO6 A;  3QWM A;  4L6E A;  5D3Y A;  1FHO A;  1U5D A;  1FOE A;  1ZVR A;  4HAU B;  2COF A;  1ZSQ A;  2VSZ A;  3ULC A;  3MDB C;  2D9V A;  5HE3 A;  1NTY A;  2AL6 A;  4GXB A;  3BJI A;  1X1F A;  2I5C A;  3DXD A;  3SV1 A;  2CY5 A;  1XR0 B;  2I1J A;  1DDV A;  2RUK B;  2VKI A;  1U27 A;  3X23 A;  2P8V A;  3GYP A;  3O96 A;  3RCP A;  2RVB B;  2UVM A;  1WI1 A;  2AEH A;  2Y8G A;  3HK0 A;  3T06 A;  3ULB A;  4MT7 A;  2IYB A;  3SUZ A;  4WJ7 A;  5HE2 A;  2KUP A;  4DXA B;  4Y94 A;  2DN6 A;  1V5M A;  1X86 A;  2EMS A;  4WSF A;  5FI0 A;  5D3W A;  1W1G A;  3A8P A;  3G9W A;  1P5T A;  2P0F A;  2Q13 A;  2IFS A;  2ROZ B;  4PQ0 A;  2DFK A;  1DRO A;  5DI9 B;  2M38 A;  4HAZ B;  3ZVR A;  1PLS A;  4HDQ A;  1KZG A;  1RJ2 A;  3VOQ A;  4P7I A;  2P0H A;  4TKN A;  2QKM A;  2XQN M;  2LKO A;  2W2W A;  4CHM A;  4HAY B;  3D8D A;  1XD4 A;  4EMO A;  4KVG B;  2LUL A;  2CY4 A;  2RLO A;  1WJ1 A;  1OY2 A;  2W2X D;  3VIA A;  4C0A A;  1OQN A;  5C6R A;  2D9X A;  2E2X A;  1BAK A;  4EJN A;  2Y7B A;  1FHW A;  2YT1 A;  2J0J A;  3KZ1 A;  1MIX A;  5CLL B;  2JP2 A;  2RGN B;  4HB2 B;  1U5G A;  2Y8F A;  1ZC3 B;  4MK0 A;  3HQC A;  1FGZ A;  4HAW B;  5C5B B;  4DX8 A;  4KHO A;  2DLW A;  2QKL A;  5DHF B;  5L81 A;  4F7G A;  4DX9 0;  1GC7 A;  4HAT B;  5DIF B;  3BIN A;  1P6S A;  3A98 B;  3PVL A;  5DH9 B;  1X11 A;  5LOP B;  1WG7 A;  4Z2N A;  1K5G B;  1ISN A;  3M1I B;  3ODW A;  1Y5O A;  2MFQ A;  3D8F A;  4NY0 A;  4BBK A;  2YS1 A;  1MK9 B;  2MDX A;  4A6H A;  5D3V A;  3PG7 A;  4GPT B;  2LG1 A;  2ADZ A;  1FAO A;  2CAY A;  3TFM A;  2UZR A;  2ZPY A;  1IRS A;  4EKU A;  2J0K A;  4CHJ A;  3CXB B;  1UNP A;  2MWN B;  4F7U P;  2Z0Q A;  1V88 A;  2EMT A;  3PEG A;  2R0D A;  4GN1 A;  4PNK A;  4IOY X;  1X1G A;  2ELA A;  5FI1 A;  3WYF B;  2YF0 A;  5JHG A;  1WGQ A;  4KHB B;  1W1D A;  2KCJ A;  2Z0O A;  3P6A A;  1QC6 A;  2RSG A;  1V5P A;  4K17 A;  3SYX A;  2GS0 A;  4HAV B;  4Z2M B;  1NI2 A;  3WA0 A;  4A6F B;  1WVH A;  5CLQ B;  1PFJ A;  3KRX A;  4DBB A;  3KRW A;  1U29 A;  2LYD A;  5HE1 A;  4ZRI A;  5LON B;  1GC6 A;  1W1H A;  1M7R A;  2CRF A;  2I1K A;  2EC1 A;  2DHJ A;  3MPX A;  1QQG A;  3A8Q A;  1BTK A;  2DA0 A;  3KSY A;  2YRY A;  5J3T A;  2N0Y A;  4H8S A;  1WGU A;  3FEH A;  2MKR A;  3PP2 A;  2RNR B;  1U5F A;  1LW3 A;  1DBH A;  4KHA A;  3IVF A;  5DHA B;  2J59 M;  4GMV A;  3AU5 A;  5EFX A;  2N23 A;  4XWX A;  2D4Q A;  1BTN A;  4HB3 B;  3KY9 A;  1DDM A;  4NSW A;  2VRW B;  2D9Z A;  5C5B A;  5C16 A;  1BWN A;  2D10 A;  1X05 A;  4IAP A;  5D27 A;  1GG3 A;  4K2P A;  4K81 A;  1FGY A;  5GOW B;  5KQ4 A;  1LB1 A;  1SGH A;  2DKQ A;  2W2X C;  5KQ1 A;  5JLJ B;  2K00 A;  1XCG A;  2DYN A;  2DKP A;  1MAI A;  1MIZ B;  3ODX A;  1ZM0 A;  5J3Q A;  5C79 A;  4B6H A;  1J19 A;  1U5E A;  1EAZ A;  4HB4 B;  4YL8 A;  1V61 A;  3F0W A;  4HHV A;  4HAX B;  1TJ6 A;  2OTX A;  2L2I A;  2Z0P A;  1KZ7 A;  1M7E A;  1UNR A;  2H7E A;  3N7C A;  2LOX A;  4K2O A;  4ZRJ A;  5JHH A;  1XKE A;  4HB0 B;  2DTC A;  2YSZ A;  2YS5 A;  5KCV A;  1FHX A;  2X18 A;  3LJU X;  3ZDT A;  4MY6 A;  3DXC A;  1B55 A;  4TYZ A;  3ML4 A;  3D8E A;  2LOZ A;  2H7D A;  3SNH A;  1V89 A;  1N3H A;  3FSS A;  4GZU A;  1UEF A;  4IFS A;  3CIK A;  2ROV A;  2GCJ A;  4YON A;  4GMX B;  4F7H A;  1I2H A;  2COC A;  4A6F A;  2UZS A;  2D2Q A;  3F5R A;  3UZT A;  2ELB A;  1H4R A;  2YS3 A;  2K2U A;  2G35 A;  3PVW A;  1EVH A;  1V5U A;  2YVC A;  3AJ4 A;  2J0M A;  4HDO A;  1NTV A;  1ZC4 B;  2COD A;  1PMS A;  1I7A A;  3TVV A;  2D9W A;  1XOD A;  2L1C A;  3GYO A;  2HTH B;  4ZRK A;  3U7D A;  3ODO A;  1U2B A;  4KAX B;  1EGX A;  2V76 A;  3PVU A;  1XX0 A;  4A5K A;  3OAN A;  2OQB A;  2BCJ A;  2KGX B;  3TCA A;  1AWE A;  1UPR A;  1P3R A;  5HE0 A;  2K2J A;  2EJ8 A;  1MKE A;  3NSU A;  2P0D A;  1EF1 A;  2DX1 A;  2DHK A;  3P7Z A;  5J3Y A;  1Y19 B;  2I5F A;  1TQZ A;  3FM8 C;  1AQC A;  1OMW A;  3TO1 A;  1RRP B;  1Z87 A;  1J0W A;  2NZ8 B;  2GJY A;  5JP4 A;  3TW1 A;  2PZ1 A;  3AU4 A;  3PZD A;  1DDW A;  4D0N B;  3PSC A;  1UNQ A; 
#chains in the Genus database with same CATH topology
 2DYQ A;  4A6K A;  3V5W A;  1SHC A;  1Q67 A;  1UPQ A;  1H10 A;  3DXE A;  3DCX A;  2COA A;  1NU2 A;  2D11 A;  2D9Y A;  2Z14 A;  3HIE A;  2YT0 A;  2HE7 A;  2M14 A;  3QIJ A;  2R09 A;  4WVF B;  1MPH A;  4CYE A;  1K5D B;  3HW2 B;  1KI1 B;  3QBV B;  1DYN A;  1WJM A;  3U8Z A;  2FJL A;  2DX5 A;  1TXD A;  2NMB A;  5D3X A;  1MK7 B;  4QJ3 B;  2GCL A;  2R2Y A;  5M4Y B;  1FB8 A;  2DHI A;  4L1R A;  3B77 A;  1E5W A;  3SO6 A;  3QWM A;  4L6E A;  5D3Y A;  1FHO A;  1U5D A;  1FOE A;  4CSQ A;  1ZVR A;  4HAU B;  2COF A;  2RRF A;  1ZSQ A;  2VSZ A;  3ULC A;  3MDB C;  2D9V A;  5HE3 A;  1NTY A;  2AL6 A;  4GXB A;  3BJI A;  1X1F A;  2I5C A;  3DXD A;  3SV1 A;  2CY5 A;  1XR0 B;  2GUM A;  2I1J A;  1DDV A;  2RUK B;  2VKI A;  1U27 A;  3X23 A;  2P8V A;  3GYP A;  3O96 A;  3RCP A;  2RVB B;  2UVM A;  1WI1 A;  2AEH A;  4QJ5 B;  2Y8G A;  3HK0 A;  3T06 A;  3ULB A;  2ZKM X;  4MT7 A;  2IYB A;  3SUZ A;  4WJ7 A;  5HE2 A;  2KUP A;  4DXA B;  4Y94 A;  2DN6 A;  1V5M A;  1X86 A;  2EMS A;  4WSF A;  5FI0 A;  5D3W A;  1W1G A;  3A8P A;  3G9W A;  1P5T A;  2P0F A;  2Q13 A;  2IFS A;  2ROZ B;  4PQ0 A;  2DFK A;  1DRO A;  5DI9 B;  2M38 A;  4HAZ B;  3ZVR A;  1PLS A;  4HDQ A;  1KZG A;  1RJ2 A;  3VOQ A;  4P7I A;  2P0H A;  4TKN A;  2QKM A;  2XQN M;  2LKO A;  2W2W A;  4CHM A;  4HAY B;  3D8D A;  1XD4 A;  4EMO A;  4KVG B;  2LUL A;  5I2M A;  2CY4 A;  2KIE A;  2RLO A;  1WJ1 A;  1OY2 A;  2K8E A;  2W2X D;  3VIA A;  4C0A A;  1OQN A;  5C6R A;  2D9X A;  2E2X A;  1BAK A;  4EJN A;  2YT2 A;  2Y7B A;  1FHW A;  4HSI A;  2YT1 A;  2J0J A;  3KZ1 A;  1MIX A;  5CLL B;  2JP2 A;  2RGN B;  4HB2 B;  1U5G A;  2Y8F A;  1ZC3 B;  4MK0 A;  3HQC A;  1FGZ A;  4D6W A;  4HAW B;  5C5B B;  4DX8 A;  4KHO A;  2DLW A;  2QKL A;  5DHF B;  5L81 A;  4F7G A;  4DX9 0;  1GC7 A;  4HAT B;  3U12 A;  5DIF B;  3BIN A;  1P6S A;  5IRS A;  3A98 B;  3PVL A;  5DH9 B;  1X11 A;  5LOP B;  1WG7 A;  4Z2N A;  1K5G B;  1ISN A;  3M1I B;  3ODW A;  1Y5O A;  2MFQ A;  3D8F A;  4NY0 A;  2KIG A;  4BBK A;  2YS1 A;  1MK9 B;  4QXA B;  2MDX A;  4A6H A;  5D3V A;  3PG7 A;  4GPT B;  2LG1 A;  2ADZ A;  1FAO A;  2CAY A;  3TFM A;  2UZR A;  2ZPY A;  1IRS A;  4EKU A;  2J0K A;  4CHJ A;  3CXB B;  1UNP A;  3A58 A;  2MWN B;  4F7U P;  2Z0Q A;  1V88 A;  2EMT A;  3PEG A;  2R0D A;  4GN1 A;  4PNK A;  4OT1 A;  4IOY X;  1X1G A;  2ELA A;  5FI1 A;  3WYF B;  2YF0 A;  5JHG A;  1WGQ A;  4KHB B;  1W1D A;  2KCJ A;  2Z0O A;  3P6A A;  3FVC A;  1QC6 A;  2RSG A;  1V5P A;  4K17 A;  3SYX A;  2GS0 A;  4HAV B;  4Z2M B;  1NI2 A;  3WA0 A;  4A6F B;  1WVH A;  2Z59 A;  3NWF A;  5CLQ B;  1PFJ A;  3KRX A;  4DBB A;  3KRW A;  1U29 A;  2LYD A;  5HE1 A;  4ZRI A;  5LON B;  1GC6 A;  1W1H A;  1M7R A;  2CRF A;  2I1K A;  2EC1 A;  4OSN A;  2DHJ A;  3MPX A;  1QQG A;  3A8Q A;  1BTK A;  2DA0 A;  3KSY A;  2K49 A;  2YRY A;  5J3T A;  2N0Y A;  4H8S A;  3NWA A;  5LG4 B;  1WGU A;  3FEH A;  2MKR A;  3PP2 A;  2RNR B;  1LW3 A;  1U5F A;  1DBH A;  4KHA A;  3IVF A;  5DHA B;  2J59 M;  4GMV A;  3AU5 A;  5EFX A;  2N23 A;  4XWX A;  2D4Q A;  1BTN A;  4HB3 B;  3KY9 A;  1DDM A;  4NSW A;  2VRW B;  2D9Z A;  5C5B A;  5C16 A;  3NW8 A;  3HSA A;  1BWN A;  2D10 A;  1X05 A;  4IAP A;  5D27 A;  1GG3 A;  4K2P A;  4K81 A;  1FGY A;  5GOW B;  5KQ4 A;  1LB1 A;  1SGH A;  2DKQ A;  2W2X C;  5KQ1 A;  5JLJ B;  2K00 A;  1XCG A;  2DYN A;  2DKP A;  1MAI A;  1MIZ B;  2KR0 A;  3ODX A;  1ZM0 A;  5J3Q A;  5C79 A;  4B6H A;  1J19 A;  1U5E A;  1EAZ A;  4HB4 B;  4YL8 A;  1V61 A;  3F0W A;  4HHV A;  4HAX B;  1TJ6 A;  2OTX A;  2L2I A;  2Z0P A;  1KZ7 A;  1M7E A;  1UNR A;  2H7E A;  2KUQ A;  2LOX A;  3N7C A;  4K2O A;  4ZRJ A;  5JHH A;  1XKE A;  4HB0 B;  4GNK B;  2DTC A;  2YSZ A;  2YS5 A;  5KCV A;  1FHX A;  2X18 A;  3LJU X;  3ZDT A;  4MY6 A;  3DXC A;  1B55 A;  4TYZ A;  3ML4 A;  3D8E A;  2LOZ A;  4KHB A;  2H7D A;  3SNH A;  1V89 A;  4QJ4 B;  1N3H A;  3FSS A;  4GZU A;  1UEF A;  4IFS A;  3CIK A;  2ROV A;  2GCJ A;  4YON A;  4GMX B;  2Z4D A;  4F7H A;  1I2H A;  2COC A;  4GOU A;  4A6F A;  2UZS A;  2D2Q A;  3F5R A;  3UZT A;  2ELB A;  1H4R A;  2YS3 A;  2K2U A;  2G35 A;  3PVW A;  1EVH A;  1V5U A;  2YVC A;  3AJ4 A;  1MI1 A;  2J0M A;  4HDO A;  1NTV A;  1ZC4 B;  2COD A;  1PMS A;  4DIX A;  1I7A A;  2NBV A;  3TVV A;  2D9W A;  1XOD A;  2L1C A;  3GYO A;  2HTH B;  4ZRK A;  3U7D A;  3ODO A;  1U2B A;  4KAX B;  1EGX A;  2V76 A;  3PVU A;  1XX0 A;  4A5K A;  3OAN A;  2OQB A;  2BCJ A;  2KGX B;  3TCA A;  1ZYI A;  1AWE A;  1UPR A;  1P3R A;  5HE0 A;  2K2J A;  2EJ8 A;  1MKE A;  3NSU A;  3OHM B;  2P0D A;  1EF1 A;  5I2S A;  2DX1 A;  2DHK A;  3P7Z A;  2Z13 A;  5J3Y A;  1Y19 B;  2I5F A;  1TQZ A;  3FM8 C;  1AQC A;  1OMW A;  3TO1 A;  1RRP B;  1Z87 A;  1T77 A;  1J0W A;  2NZ8 B;  2GJY A;  5JP4 A;  2FJU B;  3TW1 A;  2PZ1 A;  3AU4 A;  3PZD A;  3NWD A;  1DDW A;  4D0N B;  3PSC A;  1UNQ A; 
#chains in the Genus database with same CATH homology
 2DYQ A;  4A6K A;  3V5W A;  1SHC A;  1Q67 A;  1UPQ A;  1H10 A;  3DXE A;  2COA A;  1NU2 A;  2D11 A;  2D9Y A;  2YT0 A;  2HE7 A;  2M14 A;  3QIJ A;  2R09 A;  4WVF B;  1MPH A;  4CYE A;  1K5D B;  3HW2 B;  1KI1 B;  3QBV B;  1DYN A;  1WJM A;  3U8Z A;  2FJL A;  2DX5 A;  1TXD A;  2NMB A;  5D3X A;  1MK7 B;  2GCL A;  1FB8 A;  2DHI A;  1E5W A;  3SO6 A;  3QWM A;  4L6E A;  5D3Y A;  1FHO A;  1U5D A;  1FOE A;  1ZVR A;  4HAU B;  2COF A;  1ZSQ A;  2VSZ A;  3ULC A;  3MDB C;  2D9V A;  5HE3 A;  1NTY A;  2AL6 A;  4GXB A;  3BJI A;  1X1F A;  2I5C A;  3DXD A;  3SV1 A;  2CY5 A;  1XR0 B;  2I1J A;  1DDV A;  2RUK B;  2VKI A;  1U27 A;  3X23 A;  2P8V A;  3GYP A;  3O96 A;  3RCP A;  2RVB B;  2UVM A;  1WI1 A;  2AEH A;  2Y8G A;  3HK0 A;  3T06 A;  3ULB A;  4MT7 A;  2IYB A;  3SUZ A;  4WJ7 A;  5HE2 A;  2KUP A;  4DXA B;  4Y94 A;  2DN6 A;  1V5M A;  1X86 A;  2EMS A;  4WSF A;  5FI0 A;  5D3W A;  1W1G A;  3A8P A;  3G9W A;  1P5T A;  2P0F A;  2Q13 A;  2IFS A;  2ROZ B;  4PQ0 A;  2DFK A;  1DRO A;  5DI9 B;  2M38 A;  4HAZ B;  3ZVR A;  1PLS A;  4HDQ A;  1KZG A;  1RJ2 A;  3VOQ A;  4P7I A;  2P0H A;  4TKN A;  2QKM A;  2XQN M;  2LKO A;  2W2W A;  4CHM A;  4HAY B;  3D8D A;  1XD4 A;  4EMO A;  4KVG B;  2LUL A;  2CY4 A;  2RLO A;  1WJ1 A;  1OY2 A;  2W2X D;  3VIA A;  4C0A A;  1OQN A;  5C6R A;  2D9X A;  2E2X A;  1BAK A;  4EJN A;  2Y7B A;  1FHW A;  2YT1 A;  2J0J A;  3KZ1 A;  1MIX A;  5CLL B;  2JP2 A;  2RGN B;  4HB2 B;  1U5G A;  2Y8F A;  1ZC3 B;  4MK0 A;  3HQC A;  1FGZ A;  4HAW B;  5C5B B;  4DX8 A;  4KHO A;  2DLW A;  2QKL A;  5DHF B;  5L81 A;  4F7G A;  4DX9 0;  1GC7 A;  4HAT B;  5DIF B;  3BIN A;  1P6S A;  3A98 B;  3PVL A;  5DH9 B;  1X11 A;  5LOP B;  1WG7 A;  4Z2N A;  1K5G B;  1ISN A;  3M1I B;  3ODW A;  1Y5O A;  2MFQ A;  3D8F A;  4NY0 A;  4BBK A;  2YS1 A;  1MK9 B;  2MDX A;  4A6H A;  5D3V A;  3PG7 A;  4GPT B;  2LG1 A;  2ADZ A;  1FAO A;  2CAY A;  3TFM A;  2UZR A;  2ZPY A;  1IRS A;  4EKU A;  2J0K A;  4CHJ A;  3CXB B;  1UNP A;  2MWN B;  4F7U P;  2Z0Q A;  1V88 A;  2EMT A;  3PEG A;  2R0D A;  4GN1 A;  4PNK A;  4IOY X;  1X1G A;  2ELA A;  5FI1 A;  3WYF B;  2YF0 A;  5JHG A;  1WGQ A;  4KHB B;  1W1D A;  2KCJ A;  2Z0O A;  3P6A A;  1QC6 A;  2RSG A;  1V5P A;  4K17 A;  3SYX A;  2GS0 A;  4HAV B;  4Z2M B;  1NI2 A;  3WA0 A;  4A6F B;  1WVH A;  5CLQ B;  1PFJ A;  3KRX A;  4DBB A;  3KRW A;  1U29 A;  2LYD A;  5HE1 A;  4ZRI A;  5LON B;  1GC6 A;  1W1H A;  1M7R A;  2CRF A;  2I1K A;  2EC1 A;  2DHJ A;  3MPX A;  1QQG A;  3A8Q A;  1BTK A;  2DA0 A;  3KSY A;  2YRY A;  5J3T A;  2N0Y A;  4H8S A;  1WGU A;  3FEH A;  2MKR A;  3PP2 A;  2RNR B;  1U5F A;  1LW3 A;  1DBH A;  4KHA A;  3IVF A;  5DHA B;  2J59 M;  4GMV A;  3AU5 A;  5EFX A;  2N23 A;  4XWX A;  2D4Q A;  1BTN A;  4HB3 B;  3KY9 A;  1DDM A;  4NSW A;  2VRW B;  2D9Z A;  5C5B A;  5C16 A;  1BWN A;  2D10 A;  1X05 A;  4IAP A;  5D27 A;  1GG3 A;  4K2P A;  4K81 A;  1FGY A;  5GOW B;  5KQ4 A;  1LB1 A;  1SGH A;  2DKQ A;  2W2X C;  5KQ1 A;  5JLJ B;  2K00 A;  1XCG A;  2DYN A;  2DKP A;  1MAI A;  1MIZ B;  3ODX A;  1ZM0 A;  5J3Q A;  5C79 A;  4B6H A;  1J19 A;  1U5E A;  1EAZ A;  4HB4 B;  4YL8 A;  1V61 A;  3F0W A;  4HHV A;  4HAX B;  1TJ6 A;  2OTX A;  2L2I A;  2Z0P A;  1KZ7 A;  1M7E A;  1UNR A;  2H7E A;  3N7C A;  2LOX A;  4K2O A;  4ZRJ A;  5JHH A;  1XKE A;  4HB0 B;  2DTC A;  2YSZ A;  2YS5 A;  5KCV A;  1FHX A;  2X18 A;  3LJU X;  3ZDT A;  4MY6 A;  3DXC A;  1B55 A;  4TYZ A;  3ML4 A;  3D8E A;  2LOZ A;  2H7D A;  3SNH A;  1V89 A;  1N3H A;  3FSS A;  4GZU A;  1UEF A;  4IFS A;  3CIK A;  2ROV A;  2GCJ A;  4YON A;  4GMX B;  4F7H A;  1I2H A;  2COC A;  4A6F A;  2UZS A;  2D2Q A;  3F5R A;  3UZT A;  2ELB A;  1H4R A;  2YS3 A;  2K2U A;  2G35 A;  3PVW A;  1EVH A;  1V5U A;  2YVC A;  3AJ4 A;  2J0M A;  4HDO A;  1NTV A;  1ZC4 B;  2COD A;  1PMS A;  1I7A A;  3TVV A;  2D9W A;  1XOD A;  2L1C A;  3GYO A;  2HTH B;  4ZRK A;  3U7D A;  3ODO A;  1U2B A;  4KAX B;  1EGX A;  2V76 A;  3PVU A;  1XX0 A;  4A5K A;  3OAN A;  2OQB A;  2BCJ A;  2KGX B;  3TCA A;  1AWE A;  1UPR A;  1P3R A;  5HE0 A;  2K2J A;  2EJ8 A;  1MKE A;  3NSU A;  2P0D A;  1EF1 A;  2DX1 A;  2DHK A;  3P7Z A;  5J3Y A;  1Y19 B;  2I5F A;  1TQZ A;  3FM8 C;  1AQC A;  1OMW A;  3TO1 A;  1RRP B;  1Z87 A;  1J0W A;  2NZ8 B;  2GJY A;  5JP4 A;  3TW1 A;  2PZ1 A;  3AU4 A;  3PZD A;  1DDW A;  4D0N B;  3PSC A;  1UNQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...