4DIXA

Crystal structure of the ig-ph domain of actin-binding protein scab1
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
212
structure length
212
Chain Sequence
LVYEIDGTEALGSCLRVRPCSNDAPDLSKCTIQWYRSSSDGSKKELISGATKSVYAPEPFDVGRVLHADIIYDGHSLSLSTVGKIDPAAGLGSYVEALVRKHDVDFNVVVTQMSGEDHTSESIHLFHVGKMRIKLCKGKTVIAKEYYSSAMQLCGVRGGGNAAAQALYWQAKKGVSFVIAFESERERNAAIMLARRFACDCNVTLAGPEDRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Plectin-related protein
publication title Plant actin-binding protein SCAB1 is dimeric actin cross-linker with atypical pleckstrin homology domain
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Protein binding
total genus 58
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16709 SCAB-Ig Ig domain of plant-specific actin-binding protein
A PF17684 SCAB-PH PH domain of plant-specific actin-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.140 Mainly Beta Roll PH-domain like PH-domain like 4dixA02
2.60.40.2700 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4dixA01
4DIXA
chains in the Genus database with same CATH superfamily
1TQBC 3UBXG 1AACA 3MPCA 2R7EA 1NGWB 4DAGL 5B1AB 3MYJB 3D3VD 4KHTL 5FA3A 2MWNB 1UD4A 5D70L 3KWUA 1UM6L 2DKUA 3FFDA 2WZ5A 3O8XA 3CFCH 2I7SA 4DTGL 4NO3B 4NQSB 2EICA 3S35H 3NTCL 3L1GA 2ZYRA 3KGSA 3MGOA 3KLKA 1YJDL 3A8QA 1YNKH 4XVSH 5C0NC 4HU8A 3L9RB 4XWGL 3B3IA 3HUJE 4PV8A 4R3SB 2VDKL 2WVSA 2B9BA 1LL1A 2LR4A 1Y18A 5DLML 3D4ZA 2K70A 4KZDH 1UA6H 1CC3A 3NOIA 1JZ4A 1CGXA 1LWRA 5DJ2B 4JO4H 2TRHA 4LVHB 1IIIA 3GSVB 4O02B 1VEOA 3V9CA 2Z7WA 3DO7B 1RZIB 1KTLA 3FRPG 3P4MA 3LB6D 5JW4Q 3DX8A 2FBJL 1PD0A 1K8IA 1BM7A 1NAMB 4XXCA 2FDBP 1YEIL 2FAUA 5ICXA 4DOHB 1MH5B 1KXHA 5IP4A 3LRHA 3RFZC 3Q2NA 4HKJB 4MJID 3CZUB 4C4KT 5BPPA 2L1CA 2PXYC 5L8KB 2QPSA 4KXZI 3ABLB 1R47A 2EABA 3O6FB 4UTBH 2E75C 3LDBC 5ANMB 1R3HA 4HH9A 4YPJA 4DGIL 5DJAB 3GMOA 1XF4B 3GSOB 5EZIH 2VW4A 3IFPA 1AGEA 5CGMA 3WEAA 1JGVL 1X5MA 1JHLH 3C5SB 3KGUA 1J0ZA 2O5ZL 3SKMA 4U7MA 2UUDH 1F8TH 1Z5LA 2LLNA 4YHNA 5AKRA 1T04B 4GRLB 1A5FL 4RMBA 3N9GH 1BZ7B 1M71A 2X1WL 2Z4DA 3RQ3A 3MBWB 3NSCA 1GS6X 3GXDA 2IDUA 4OZHA 1AHWB 5TTRA 2FATL 3L4TA 3CDYA 4B27A 1RPUA 4A6YB 4C47A 2FL5A 3PRZA 4FI7A 3HZMA 4HJUA 4UT7H 2CK0H 4WUUA 3SKJH 4B53A 1MHCA 3RWHB 5BS0B 5AVWB 5HPMB 4A7SA 5JLJB 1U21A 1Z7JA 2FLMA 4CC4A 5EA0L 4OFYD 1NDMA 4JM2D 3QDJB 1OARH 1NUFA 1P7KB 5GZOA 3BZ5A 5LG1A 15C8L 1MIML 1XEDA 2W5PA 2R4RL 3MGTB 4L3EE 4NN6C 3V4PA 5CWSB 1I8KA 1N2RB 3OTTA 3FTSA 3MACH 4MFHA 3LXCA 4AQOA 4JQIA 3TASA 4GSRA 4M7ZB 4ZUWB 2C9VA 1QRKA 1TQWA 2EH7H 2Z93A 5JHDB 4F2MB 2EIMB 2HH0L 4I2XA 2F54B 4LDEB 2BSSA 4FXLA 2DQFA 5KTEH 2AJXH 3FOLA 4UBDC 2GKIA 2NUTB 3D0VA 4M6OH 5A1AA 3LSOA 3MLUH 4LIQH 3ZYZA 3L7FB 2WVUA 1A4JB 4RAHA 2DYPA 4UDUA 3IDNA 3L3HA 5ADOL 1URZA 1PBYA 5LGHL 4GAFB 1GRWA 5D1ZC 4DGYH 5C9JB 4X7SH 3T0EC 4N0CC 4PJ8C 2EJ8A 3VH8A 1SUHA 1WS8A 5T3XD 1H3VA 5AFAA 2DDQL 2W0FB 3EOBB 4G6KL 4QRQA 1ORQA 3MAWA 4YHMH 1QSVA 4RWYL 4JRYE 3CZJA 4GMSH 4OV5B 3CDGB 4YFLF 1LQSR 1MCHA 3VFOB 2ZNWA 2CBOA 1WAPA 4FG6D 3I6SA 1Z87A 4M7LL 4ZZFA 4RFOL 5KJRL 2YD3A 1MJ7H 2H6PA 5IFHL 2NZIA 4KAQH 3NFSH 1D7DA 3DX6B 3GIVA 3L5HA 5CKGA 2K7QA 4FEIA 2E27H 1MSPA 1VA9A 2IGLA 5F2FA 1ZLSL 5KN5A 4PYGA 5DI8A 3Q8CA 3QUMH 4ZZKA 5E8DL 3LNDA 4GRWF 2RR3A 5F9AC 1JFHA 1IKNC 1W72A 1EAZA 2NY1C 3B2UC 5BW7C 3APNA 2LU4A 4FQ1H 3TWCL 4FMVA 1EUTA 2O6CA 3A6BL 1SMDA 2E7BA 4ZPTB 1K5NB 3NSDA 2HG5A 5MENB 3G5XB 1L9MA 5FIEA 5DS8A 5IV2B 2DQTL 4AV0A 1BVNP 4KK6C 2YSTA 3O3BB 3QWRD 4ODTL 4DQOH 2HMIC 5L4FA 3UTSD 3GMQB 5C6WH 4M9PA 1T1WA 1ZTXH 4ZJ9A 4ZW3A 3IMSA 3FTYA 3H9ZA 4GAAA 4LRIA 3S8GB 5KBDA 1ZV5A 5E6RB 1MFUA 1QSFB 2YRPA 4ZOEA 7TAAA 2NY2B 5EBMB 4K7PY 3MSPA 5INDA 3E8VA 1G4RA 4QRPE 4TUOA 4J1UB 1QLFA 1PLSA 4ZRKA 4L9LA 4MQXC 3VMPA 4XPGL 3FSAA 4OLUL 1EHNA 2LOXA 4KWUA 3AAZA 3H55A 2YD2A 3RBSA 1BBDH 1JZFA 3KBFA 4YNYA 3U9WA 4M4RB 2EDQA 2WP3T 2AC0A 5DRXA 4OKDA 4V1DB 5AAMC 7PAZA 2JLPA 4JRXB 1HNGA 1G5AA 4J3WA 3PUUA 4FJ6A 4NQDE 2EO7A 1AQHA 1BECA 5DMGD 4AVJA 1MEXL 4OGAC 1GZPB 3WNOA 2ATPB 3CPLB 1TFHA 2W65B 1GKOA 3MR9B 2APSA 4LVOB 5CGBA 1DJHA 3MRHA 5CUSH 3RTQA 3FU6A 3N0PB 2JKJA 4FQHA 3O45A 2ELBA 4ZAKB 5IHBA 1XH2A 2DN6A 5FUCE 2EIEA 1MFNA 2WNXA 4DZBA 4LSRL 4Q52A 3V6OE 5JORA 3RY4A 1DQDH 1KG0B 4X9GA 2AJZB 3ESNA 2HKFL 3KM1A 2WQUA 4TUKL 3LN4A 4UZGA 3QAZC 2NY6D 2CUIA 5CF3A 1MFEL 3FO2A 1LO0H 3O6LL 1OGPA 2XU9A 4K3JL 3F5WB 4N28A 3REWB 3M6DA 3W9EB 3LPOA 2QGBA 3ZKMC 2J0MA 4WWKB 1HAUA 4CADA 4F1ZA 1N5YL 4GW4A 5KVEH 1S6NA 1MW3A 4H25A 4XPBH 2PUQT 2BFGA 5D1ZI 4P23D 3N2JA 4PB0H 1JK9A 5IJVB 4E0RA 4ZNEA 4D0NB 3HG1E 4NYLB 4UU9B 4MY6A 3UTQA 4HCRL 4Z7WE 3MLXH 3NYKA 1Y6KR 4OLXL 3VD0A 1B9KA 5GSVB 1KTJA 3X14B 1GTNA 3TT1H 2WBKA 3NCYS 3V7MA 4JQXA 1C5BL 2Z59A 5I66B 3QI9A 3WTSA 3K4AA 1CF1A 4PW4A 4ZTEA 3QQDB 1HXYB 4IBQA 5E5MA 5IMOB 3GS0A 1I9EA 4CC0A 2K4AA 1WGOA 7FABH 4XHQA 2AL6A 4QRFA 3ESVF 3VI4E 5I1LB 4GOSA 3WN6A 3NJGA 2EE0A 2LFGA 4O5LH 4PBVC 5DC9B 5SX5H 4XP4L 3M07A 4APQB 1WFNA 2GB2A 2P5EB 4GQ9L 2DLWA 5TDNB 3DMMA 3RVVC 3SOTA 2VLJB 4Z7QB 5LNGA 1AZCA 5CLYA 4HB2B 4LHUD 3R8BB 1E5CA 5IGXH 1PF3A 1T5WA 1EGJL 2WQAA 3A3YB 2EDTA 3D8FA 5KQ1A 5FLVA 2N0MA 4IOFC 3OHXB 4NZRL 3S3DB 1ZT4A 1MCLA 4LEOA 4YDIL 4IIQB 3NIGF 1IKFH 4WGVB 2DH3A 1DLHA 3BP7A 3U36B 3ML9A 4DPBX 2VOTA 4P07A 1F3DJ 2WY3B 3L2NA 3OJDB 2N7SA 2ZF8A 4P9HC 4BWWA 1B3JA 3A67H 4U1NB 3AG3B 2XUWA 1QATA 1YEHL 3ZGIA 3HC0A 4LLYA 4YXKH 3VQMA 3B9DA 4P05A 2CAYA 2OJZH 2FYYB 4U1GC 2J57A 4XTRD 2CR3A 1PJ9A 3SE6A 1KMGA 3C08H 1KEML 3TA3C 2C3XA 4AQ1B 1EVTC 1JTOA 3OLDA 3L17A 2NY0B 2CWRA 3AS0A 3FT3A 3NAAH 4HA1A 4Y1AE 2PYEA 4ONGL 3CZFB 4KK5D 1EEQA 2F74A 4K94C 4NERA 5IVZA 4HLZG 4G1EB 4ZFGL 1FFTB 4DKFL 1HSAA 4BUGA 4OTXL 3RZCD 4XP9L 4Z7VE 4ANUA 4KTEL 1M7EA 4POZC 3WO3B 4N20A 1V7MH 1A7RH 1V3KA 1XTLA 2IV8A 4ZX3A 3QWMA 4HUVB 3UL4A 4R4ND 4AQEA 3IDJA 2OCCB 1IGMH 2R1YB 4GQQA 4RSYA 4IRSD 1R24B 6FABH 5GGUA 3MO1A 3MV01 3QUMA 2BNRE 4J4PC 1I7RA 5D7SH 3DDFA 2UZPA 3X12B 4WFFE 5IQ9A 2IO5A 2UWEB 5AUMA 4PBWD 1BQKA 1UATA 1H8NA 4F27A 5IFAH 3Q06A 2D9WA 3DGGB 1SHXA 3EG9B 1RUMH 4H8PA 4M3JA 5I18L 2VM9A 1A6ZA 1W8NA 4LLWB 2CDGA 3SGDH 4YX2L 5DSCA 3Q44A 4E41E 4GXFA 1LO2H 2XBZA 1U8OB 4IOSD 2KQNA 3KCWA 3ULAB 2GJ6A 1RZPA 4LVHC 4P2RA 5ETUA 4BDVA 2FB4H 4OKVA 3KJ6H 2DHIA 1HH6B 1RJZB 1KJ2B 2UZYA 4JKPH 4AGMA 5KSVB 3QUGA 3MXVL 3X23A 3L3KB 5MEPA 3HI6H 4LBEB 4HG4J 1GVIA 4IBYA 4OZIF 1XIWC 3DHJA 4Y4KB 2IMNA 4XPTH 2DL2A 1TTFA 3BKJL 2YRLA 3IJYA 4MZRA 1FNEB 4LPTA 5CCJA 1FC1A 2NY7H 1D9KB 1MHEA 4I5BA 1TTRA 1HSBA 3LKRB 4FNSA 3D33A 4S11A 4HXAL 2KERA 3SPVB 3VDBA 4FQQB 1U8HA 3LH8A 3S48A 5DHVB 1BYPA 4X6DE 3O6FC 1WD9A 4OIAA 3M1BA 3RG1C 5I1HH 3HZKA 1AGDB 2GT9B 4QRSB 1YN6B 2VZUA 2OCFD 4X7CC 3LZRA 5K9KB 1NLDH 4M6NL 1DQIA 3QIBB 3CMOH 1MXGA 1JGDB 4H8WH 1RURL 4IOIA 4RIRA 1WA1X 4XH2A 1UH2A 4G9FB 4HUNB 3SBQA 1L5GB 4HZ1A 5KVGL 1ACYL 1JS4A 3C5ZA 4GQRA 2AI0H 3HNVL 3MA9L 4GRLC 2ZOOA 5GOWB 2WJ5A 3FN9A 3ALPA 2DJMA 1V5UA 1ILUA 1J9CT 5DRWA 4JFEA 1CVRA 3O4LA 4XOEA 5F9DC 3VG9B 4UV7H 3HI5H 4DH2A 5AAWC 3NN8A 1CF8L 5F21B 1AHWC 3LQMA 4OD2A 4FADA 3BSZA 5ID0B 1Q9WB 1TYJA 3WMSA 3BD5A 1IGYB 4XMKL 3ZTNH 3RJQB 4A2GA 4DW2H 4MNHB 1HZKA 3ZK0A 4KKQA 1TQVA 4HS3B 1KJMA 2PW1B 3VYOA 1S46A 3T8XA 3VXRB 1JNLL 4KKAD 1EMTL 5ABDE 3D09A 4G8EB 5ABZA 4I88A 4WIQA 2BDNL 4JUTA 4M7ZC 1KYDA 1BREA 2XA8H 4PGEB 1ID5I 4JJHA 3CH1A 2FX8L 1JZDC 1RK0A 2DM2A 3TEUA 1UD6A 4KNQA 1YYML 3VQ1C 3Q8FA 1QPPA 1P0SE 4RMTA 1OGAB 1OM3H 1ERNA 2N23A 1TZHB 3S98A 1FNSH 2R1WB 4W9DC 4Y5YB 3TP4A 4S1SL 1JZGA 4QOKA 3L4UA 3GWJA 2GUOA 3KPNA 3BPLB 1QUNB 3DSNB 3IFNL 4NO5B 4R9HA 4QCIB 1AR1D 2ED8A 5KQ4A 1ED3B 3A4AA 1AQCA 3F64A 3QDJA 4ABUA 3Q1SH 3T3PE 2DTCA 1F45A 1DQJA 5I6MA 1K5GB 2E7LA 3NFNB 2K9FB 1E4KA 1EFQA 2A9BA 2CJSA 1S8DB 2ELAA 2XN9B 2DWDB 2XQYK 3AXIA 2CUAA 1OKEA 3FM8C 3MLWL 4FD0A 4IK6A 2H0JA 4WFGE 5B1CA 2R0LH 5A2IH 4OLYL 1A9VA 4H8VA 3D0LA 4WHDA 3TCLB 5F6HJ 1W0YT 4D0CA 3MRIB 3DVNA 2VSZA 3S3BB 3F3HA 5GZNA 3ARDD 3LCYA 4KKBD 2W9EL 5LG4B 2V7NA 1QBML 4X6FA 4XPFH 3JWDL 3TFKD 3D25A 3PIQA 2GC7C 3KPOB 4TL5A 4UMSA 3DJRA 4GB9A 3RWJB 3SDDB 1P4BH 1VADB 3TESA 2P8PA 4GH7B 1JV2A 1J48A 5DO2D 5L2KB 2E9WA 1W6WA 3L3JB 4FA8A 1A0QH 2ZXGA 2RLOA 3TONA 5JO5A 1GC1L 3JTTB 1VACA 4LSQL 1R3LB 2WTRA 5CZXD 1KYAA 2EC8A 5JHLH 1RAMA 3X3FH 4CKQA 1HTYA 4NKQB 3HR6A 1MF2H 3ATBA 2A4CA 1X4YA 4RCAA 2G9KA 2X9WA 2XXFA 4NWTH 1SOKA 2VWEC 2KZBA 2VUOA 3GEFA 5IHUL 1I7TA 3JVGA 4TNWF 4OCYL 5CBEB 3SYAA 5GS1A 2KUPA 2FNBA 4CN4A 5GRVL 4FERA 2AMGA 2ZP0T 2AV1A 4FQJH 4OUUA 1G6RB 1TETH 1Z9LA 2H26B 4M9OA 1U5EA 3UG3A 2R9HC 1NKOA 3CCHA 3TO4B 1E9OA 2JKWA 1T2QL 2OP4H 4Y88A 5A2AA 3WFEL 2EDRA 4D6WA 1VZHA 2CBQA 5D7KE 2G2RA 4IU3A 2RACA 1FAIH 1P6SA 3V7AG 4P3DB 4WKXA 5CD5C 1HQ4A 3S3CB 3L08A 1OZUA 2V37A 4YGVA 4M6ML 4HJTA 2DD8L 4WI6A 4FMKA 2W2XC 2AKRB 2DEWX 2FJGA 3DV4A 1PEWA 1RIUL 3BW9B 1GKEA 3VFNB 3MYZA 2CO7B 4IW4C 4BJLA 5KYUA 2ITCA 4LNVA 1QWUA 2OW6A 2B2XL 4HGWA 2X4TB 1BBJA 3B9AA 2BSBA 2O72A 3MUJA 4LVOC 5DRNA 5E9NA 1NC2A 4IJTA 2B3RA 2DLHA 5CEXB 3KGRA 3LKSA 4JHVA 4CHJA 1M53A 2DRUA 4I9WD 5GJTH 4ZDHA 5LUMA 3R19A 4LFHD 5KVFH 1ZGLB 2HFFA 1R9FA 4G7YL 4Z5RA 1II4E 2O30A 3ZOAA 2XCMC 5IQOA 1CFSA 5KSAD 5I71B 3WE6A 4PJXA 1UT1A 3L3GA 5FO9B 4GP4B 4N8VA 3GZQA 4AQZA 1FZKB 4LKCB 4R7DB 2CRIA 1P1VA 4YN3A 1KZQA 2PTVA 2M8XA 3W0WD 3D34A 3JV4A 8FABA 4ORGB 4FXGB 2AEHA 2XX0A 1IZKA 2HRGA 4KFZC 4WHYH 2A5UA 4B9PA 4M3HA 3FB7B 5FYKH 1KYOJ 5FM8A 2YS3A 3ZTJG 1ZY9A 1JMXA 3WNMA 4M8UA 2DQCH 1M6OA 5FUOL 4Y5VA 4EN3A 3S35X 3VA2C 2XWTB 3B9KB 2FSEA 3NH7H 1SOXA 4JZNA 1H0DA 1JXGA 2IALA 3OKKB 1IUZA 4X80L 2X1QA 4XPAL 4S0HA 5IJBC 32C2A 2OZ4A 2XN1A 1NEZA 2XZAL 5F9JA 2H1XA 1UXSB 5HGGS 3V5HB 2A6DB 4LLMA 1EEZA 1JZIA 1P4LA 3WNKA 1IC0A 1DHKA 5F7KC 1DDTA 2ADJB 4QT5A 4XNYH 1IRAY 4UOW1 2ICCA 3BJLA 4HV8A 2COQA 4EO5A 2NQ3A 2O5XH 3P30L 3SE3C 2BVOB 2JJWA 3B43A 1AH1A 5T1MB 2Y06H 3C09B 2BNQA 4ZW6A 3M45A 3A6CL 3RGVB 3P40A 4OZGA 2XWEA 3VI3B 3ZL4H 3QZOA 1AXTL 2UXGA 3MRCB 1TOXA 2IAMC 2I1JA 2N3JA 4LCCB 1DCEA 4OZHE 5CLXA 5EZJB 2WGNB 3D51A 4WI4A 1B0WA 1KYFA 3L4YA 4HWUA 4GIOA 5J11B 3LHPH 4MNGE 4UTAA 2VR8A 5EH1A 2B14A 5CN2A 1YDPB 2PTUA 2F08A 1NCBH 3CFCL 2A77L 2VQUA 2D0HA 4FJZA 3S35L 1R3JA 4NQCB 5CD3B 4AQ1C 2AJ3B 2ZXQA 3VWKB 2BC4B 5E1AA 1YNKL 5BZXA 4XWXA 5TDNA 4JO8A 3DUSB 4XVSL 1P1ZB 5CIPB 1U2HA 5DD0H 2X6VA 1YA5A 4U0QB 4XOCA 4AT6B 4QJ5B 1FNGA 3H9HB 4I2XE 5E6ID 4YSPA 2IWGA 4I4WA 1DBAL 4RESB 4WFHD 4BK5A 4KZDL 1UA6L 4PJ7F 1M6UA 2ZUQB 1FYTD 4EOWH 4JO4L 3ZRCC 4Z76B 3MNZB 1VCAA 3QFJE 3FFCB 3SV1A 1IGIH 1B4RA 3GXMA 3ISRA 4NRZA 2V9TA 3Q43A 3VFMB 2A0LD 5I15H 1A4KA 1QNIA 1JHTB 3J7HA 1DBBH 3MRMB 3H2PA 4GRMA 5A2CA 5A7EA 2WCGA 5HGHA 4JFPB 1UA7A 1U8NB 1I9JH 5HHNB 5LOPB 4PLOB 3TJPA 4DVRL 4WUUD 1NCWH 3QEQE 2VJ0A 2MKRA 4GZUA 3PVUA 1NGQL 4UTBL 3OB0K 4ODUB 2XT1B 1MVUA 1A6TA 1IEAA 3FN0H 4Y4FB 1PLBA 2QPDB 5CLTA 5GZOD 2C9RA 1Y19B 4Q6KA 4NLHA 3S2CA 2XJKA 2Z13A 4URKA 2PTTA 4BQ6A 1WJ1A 4ZRIA 5EIIA 1F8TL 1DUYB 2C9XA 4RFNC 4Q6YA 1GPOL 2X9ZA 1FVDA 3N50A 2R0DA 4LHUG 4NRXB 3KJ4B 2CY5A 2HT3C 4OCLC 4BSWB 2CCWA 3CTTA 4AVIA 3PZDA 1WFTA 2D4DA 1JRHH 5T1DH 3N9GL 2L04A 4KXDA 4YLCA 2DTSA 2C3VA 3BAJA 3C6SB 5IHHA 3VFPA 2WLYA 3LQAH 1OP9A 3MRBA 3AU4A 1D9KC 1T20B 3G6JB 2HTKD 1TXKA 2I9LB 4UT7L 5AW9B 3SKJL 2CK0L 1WC7B 1FDLH 3GINA 1SXCA 4LLWA 3ZN6A 4QXTB 5CAYB 5C79A 2JELH 3T1FA 4JY4B 5F7YC 5F7UA 4JNXA 1GS7A 1OARL 3EXJA 1L0PA 2IFFL 1E5AA 3CFIC 3SJVA 4H0LC 4U1KB 3RWDB 1ND0B 4UQIM 4XN4A 1FVEA 2ATKA 1MQ8A 1R6VA 1NU2A 1RSYA 4U4BA 4X4YB 4WSGA 2EDHA 4WEUD 4UAHA 1J0YA 5D5MA 5CJXC 2RCSH 5F8RC 1MI5B 4N2EA 4JL1A 4KMLB 1A9EA 4HK3N 1NEPA 3ZTDC 4UQCA 2HCZX 4GO6B 2AJXL 1HINL 1EGXA 4W4OA 5ACLA 4M6OL 3MRKB 3VG9C 3VU1A 3MLUL 4LIQL 1FFQA 4DO5A 5GGQH 1FYHB 1D5RA 3HMXA 1I82A 3TBVA 1FWXA 4H8HA 3HHSA 5K1JA 4M8QA 4DGYL 4X7SL 2V9QA 1MWAH 1JV5A 1DJYA 4U1IB 3ES6A 1QO3A 5K9JH 3LYRA 4D94A 1E27B 2HX8A 4JANA 5GHWH 3RKDD 4WI2A 1Z3GH 3ZT7A 5L81A 1GJWA 4YHML 1HHHB 4LF3B 3L2MA 3WLWC 4KY2A 3BH8A 2W38A 5B39B 4ZX4A 4P2OB 3ARVA 3DJSA 4JN1L 4LMQE 1UTDA 1KBVA 2Q86B 4MNQA 4HAYB 4ZSOE 1MJ7L 2ADIB 2XZQH 3JV6B 3AS2A 3NFSL 3CDFA 3LIZA 3VXQB 1VF5C 3F04A 5BVJA 4F9LC 2WANA 4PCTA 2CJTA 3QCUL 1SVZA 1WBXA 2J72A 2VGLM 2E27L 4OSUH 1QRNA 2OI9C 2BS9A 4Y5YC 1PLAA 3B5HA 5HHOB 1XCTB 1IFHH 4MS8C 4NZTH 3IMTA 3EJCA 2QQNH 1D2PA 2YLKA 4KK9D 5E9DA 5C0EB 5MEQA 2QKSA 3MC0A 4MX7B 4ZNEE 2EAEA 5C0CD 3NJNA 5EU7C 4X7DC 4FQ1L 4HK3J 2WWKO 4HCFA 2VDQB 5E51A 2J8UA 3T4YA 3T0BA 1FI8C 4CMHC 1JXFA 1HE8A 4G6AD 1PZSA 4NFDA 5A3IC 1YVLA 2QDWA 5LONB 2H2SC 3ZDZF 3ATFA 1VZGA 3NK3A 4LSVH 5J1SC 1ZTXL 3P0GB 3BUTA 4MMZB 2XTJD 4NIKB 1ZHBB 2VKIA 4R5XA 5BV7H 1PSKH 1E5UI 2SEBB 1JUFB 1KIRA 2OL3H 4H13C 3GRWL 2GFBB 2KBGA 2AK1H 3PHQA 5DRZA 5HYEA 5JOPE 1LEIB 1KCBA 5BQDA 3OKMA 4Q4IA 2VSCA 3SDDC 4JPQA 5DJDB 1D7FA 4X0KB 3NCEB 1J11A 4N4YB 5HP5A 1JNNH 1NFDE 4XZ4A 43CAB 2OR9H 5LN4A 1U3HA 2Y1YA 1RZKC 2ZCLH 1M1XA 3I6GB 2BY3A 1F00I 3QDMB 4LOEA 1TJMA 5FA4B 3TBBA 2ADYA 5EEUA 1X11A 2CG9X 4AWJC 1IU1A 1M05B 3ZHNA 2QJDA 3P3UA 5TJWK 3DI3B 2V33A 2NRDA 1L6ZA 1HXKA 2N4IA 2R23B 4X8CA 1YMMA 1E4WL 1LDPH 3FEHA 1VFOA 3FO9B 2HJLB 4QHPA 2WBXA 4WVRA 5CUSL 3ZE2B 4PGZA 3GSWA 1CLVA 3U9UB 1U8MA 4RGNB 1G9EA 3FUHA 4N5ED 3QI9D 4UOW0 4JM4H 3MV8A 1EVUA 1TUPA 2PYEE 1XKEA 2WXJA 1DQDL 1T1XB 5I24A 4TSBL 3UPRB 3TO4C 1NGZB 3HLAB 5SWSA 2VQ1A 5F9OL 2V3FA 2FQEA 2MHAB 1CE6A 1LO0L 3GC3A 3JTTA 2ZX9A 2K00A 4YL9A 4ENED 1AKJA 2X88A 2D9YA 3DMMD 2ZKXA 4XPBL 1AJ7H 4X9FA 1P4IL 4AMKL 2C8NA 4PB0L 5E2VH 5F3FA 4LK4A 3LNHA 2NSMA 2I85A 2Y5TB 5C07E 5F1IB 4PJCA 1KENH 3QYNA 1Z2KA 4KXZH 2Y6SC 3OKEA 5FUZL 3TT1L 2FJLA 2VXVH 5DEFA 2V2XA 5HD8D 1INEH 2ZKMX 4HAFA 4YSTA 3WJLA 1KTKE 4KZEL 1AGCA 2NY4B 3GSUB 3FKUS 4KHXH 5I71C 4WWNA 1O7SA 3CFKA 4MA3A 5IOKA 4IKJA 4IS6B 1RHHB 2Y7QA 3AGWA 1WQVT 4A7TA 1KLUA 2XPYA 2JCCF 4O5LL 2NYYC 3MA7A 1J18A 2YR3A 4P2RE 4FXGC 4N3TA 3V8CA 1G7MA 3WTYA 4ACPA 4KK8C 3IJ8A 3HBGA 4P9MH 5IB4A 5TK4A 3PV7A 3Q6GH 1T1ZA 5KOVC 2P4AB 1WFIA 3N1PC 5D2LF 4V11A 4ERSH 4OVUA 5DVMA 3NW8A 4PJAB 4IBWA 1KB5L 3TWYA 3B9KC 1IKFL 1XQ4A 3BZ4A 5E1HB 2JWYA 4ZUSB 3PGDB 1NGXB 5J6GB 1KEGL 4EUPH 1NGPH 3T1WA 3A67L 3IVKA 1JHKL 1N18A 1BZDA 5GISH 4F37K 4CVXB 3DETD 1OANA 2C3HA 1U41A 2YEZB 2HLFC 3VXUB 5IB1B 1JBJA 3C08L 1MWAA 1I1YA 3ARGC 5E0FA 1OE3A 2XPGB 2ZSWB 4WJ5B 5CCKH 3NAAL 3VGGA 4MRBA 5IM7A 1TITA 2E76C 3TNNA 1P2CB 2K6WA 3ZMNA 3PWNB 5CXPA 3C09C 5C3IA 2W88A 3PWVB 4X6DF 1SN0A 3RGVC 3TT3H 4OJCA 1K4DA 2O5YH 4IFSA 4RLDA 2YAOA 3SO3B 1RLBA 1HL8A 1IC5L 5DA0B 1F6AB 2Y4SA 5ICUA 4TNVK 3CFTA 5I6XB 2GJ6D 3ODOA 4HUUB 1V7ML 1A7RL 1N70A 3DRTA 5J11C 1JNHB 2X9YA 4RQQB 2ATAA 4WNJA 1IGML 5C3LD 4K73A 3ASWA 4OU3A 1FB8A 1VFBA 3OKYA 2EIZA 3N1FC 1WVHA 5D7SL 1N10A 2EE9A 3LQZB 3INOA 3Q6FA 5BZWA 3CHPA 3KY9A 4F7KA 3AQYA 4H8UA 2WMPA 3IBEA 4YVUA 3WKYA 1YEWA 3VWKC 2LYDA 1V55B 3HTLX 4K5OA 4LFHG 4PJDA 3T6VA 3HAEB 1OF0A 2ZUXA 3BIAX 1QI4A 2ARWA 4HLJA 2QPEB 3II3A 5DH9B 3U7WH 4EI5B 3LD8B 4L8SB 1SDDB 3KYOA 1LO2L 3ECBB 4BBKA 4KX9A 2ZUQC 1A21A 3JUYA 1OWRM 2OQBA 4ORZC 3PG2A 1V5MA 2FB4L 4WY7H 3KJ6L 2H2PC 1TIUA 4FKHA 3U0TA 4XVOA 1I9IH 3HI6L 4GUOA 4EZLA 1XSIA 3QAQA 1FG2B 3DARA 4WJG3 2OL3A 2W1NA 2BSTA 2CRZA 2JKXA 3DTDA 3IRCA 3QDJE 4GKNA 3O4LD 4HQQL 4JFED 4NKDA 4IEFB 3P3YA 1NL0H 3B7SA 2LAGB 5GRUH 5C09D 3SYPA 1KIQB 1PX4A 4AGPA 1MREH 2EDFA 1FA4A 5I1HL 1ES0A 4PJBB 1WVZA 3CN1A 5DJ6A 1ETB1 5JHDE 4Y4FC 3VRLE 4F2ME 1NLDL 5DA4A 1I7UA 5GXBB 4EKXA 4AH2A 3CMOL 4Z7OE 4L1RA 1K8DA 4H8WL 2UY6A 3C5JA 5EFIB 2BXZA 4FG2A 1AY1H 2W07A 3ZUNC 1BOGA 3MNZA 5C71A 1EDYA 1OP4A 3SBWC 2P43B 1TT6A 2K49A 4WWPA 2XXGA 1S9WA 5D3VA 2AI0L 4AXWA 2OMXB 5HE3A 2IQAA 4YHZH 4ODVH 4UV7L 2B1HL 3HI5L 5F1OB 5C0AA 4XNMB 1ZJBA 2Y69B 3HC2A 5IB3A 4QOKD 4F8OA 3ATAA 3GMNB 2KLTA 4XNZB 5AYQA 5KZCD 2Q1EA 4XRCB 5EU6D 1DQQB 2ZUUA 4WSFA 3PU7A 1FZJA 3MXWH 3PXLA 3PNWB 5ESQB 4HAZB 4WW2B 1WE5A 4MVBC 3HOGA 4N9GA 1OAZH 3MCG1 1TTCA 4YJZL 1V5PA 2DJ4A 5EU3B 5C2BL 2VMDA 1LEKA 3US1A 4FX5A 3L1EA 2WIMA 5CILH 2YKLH 3LMJH 2BP8B 5L8LB 1S3KH 3F8UB 2WAHA 4PS4L 5L6YH 1JPGA 2GABA 3AM8A 2PR4H 2D3LA 3KBPA 3QZWA 4JO3H 2EADA 2Y36H 4FI6A 5LG6A 2FUQA 1FVCA 3NA9H 5KSUB 4JPIA 4XP1H 4FXKB 4FNTA 1ILSA 1DVUA 4AEHH 1NPUA 2ZOLA 4P46D 5DQ9A 1CFBA 1T0NB 5EDSA 5D4QA 1OM3L 2UYLA 1JPFB 3ESMA 4ANXA 3AUVA 1JD7A 3O41B 1G7PB 5JDJA 1MCDA 4JW3A 2FTAA 2JLLA 4ALAC 2DJSA 2RGNB 5HI5C 1QR1A 1LEGA 5E5UB 3KR3L 4NUMA 1UEYA 5D4IA 1MIZB 3CK0H 1QBAA 4FZ8H 1XCWA 2JIXA 1IM9D 1KCSH 3KPSB 3V79C 1UXWA 3TZVB 2E86A 2CNZA 5FX3A 4G71B 3Q1SL 2I27N 1DP0A 3OXSA 2V7HB 1BD2A 3TO2B 1S4IA 5ID1B 4B95C 5KS9A 1SXAA 4PJ5B 5KS9F 3KWWA 4ATWA 1I1FA 1OTSD 4P2OC 4CDGC 2R0LL 3V5DB 1JAEA 3QO0B 3VFVB 4KKCD 3VDCA 2XWBB 3N44F 1HH9B 4C83A 4KO6A 4PJXE 2JKNA 5MP6H 4EUPA 1I75A 5KANI 4JRXE 4PJHA 2Y2YA 1CLOH 2YGPA 3BPNB 5D4JA 1JIBA 4KRPD 1D6VH 3ULVC 1A22B 1P4BL 1E0OB 1UEFA 4MXWH 3BD3A 2XJLA 3BI9X 3C6LB 5FI0A 1A0QL 1JE6A 1EH9A 2YPLA 4NZFA 5C0IA 4TLTA 4L4VB 3LRLA 2MFNA 4P57B 1IGTA 2HYMA 4PLJD 5JHLL 4U3SB 1MF2L 4H5SA 3HPLB 4TKWA 3TNMA 1FHOA 3Q8AA 3T06A 1KF9B 4Z9KB 1JZ5A 4IM8A 4L8BB 1JF1B 4NWTL 4HC1A 4I1RA 2Z65C 4F92B 4X6CA 2LLLA 2N1TE 4DP4X 2OMBA 4MMZC 5HDQH 2DQGH 5DC2A 3DX9A 4N22A 2VABA 2BP0B 4FQXB 1NIDA 4Y16B 4HAKA 4F7MB 3AREB 3QNFA 3OG6B 4FQJL 1TG8A 4G8FB 3MRRA 1TETL 3JYCA 3UCQA 3GDCA 1BM3H 3BVUA 3KXFB 4HMCA 1JCKA 3TBWB 5C0EA 2BNQE 2OP4L 2AABH 2QSCH 2VISB 4DGWC 3PAYA 4DFIA 4GLRI 5FO2A 4OZGE 4IBTA 3D5OF 4Z7NB 4LLDB 4FOMA 5IBLD 4BFJA 4A7UA 4L1BA 4NNYA 1MLBB 3OAYK 4OGZA 4JFFB 2VC2H 1YEFL 5CINH 5DDHB 4F7PA 3QUYA 2QFPA 3RWFA 4L4TA 2FH8A 2A9CA 4KDTC 2Y72A 2G3XA 3O11A 4EN3D 3UDWA 3VRJB 1NC4D 2Z92A 4RGNC 1MCWW 1JUFA 3BAEL 2P5EE 4LPVA 5IMKA 3QH3A 1GTFA 4Z7QE 5KVFL 2H7EA 5DJDA 2PXYA 5CU5A 3IM1A 2CIIB 4PP1D 5ENWB 1TCRA 1Q9KA 2GTZA 3VD1A 1E5WA 5FA4A 5DGRA 3ZE0B 1DQMH 2WXPA 2UVFA 3WGUB 2EXTA 3PHAA 2YEVB 3TPUB 2PPDA 3FCSB 4A55A 4D9RD 3PJSB 3QISA 3GSNB 2V8LA 1BZOA 4N5UA 1J5CA 1DO6A 5FYKL 4NZJA 1J9TA 1IEHA 4PWEA 4MQ7A 1M3IA 2JVUA 4JZOB 1MCQA 2XRAL 4TUJA 1AQMA 1ASQA 1YCSA 5SWQA 2WCPA 3NH7L 5ESAB 1BXAA 2QELA 1UC6A 3V9FA 2C9SA 2X2JA 1A6VH 4GXUN 1CICB 1NCNA 2X1OA 4WWID 1L3WA 1TYEB 3FT2B 1FL6B 3KW8A 1YAZA 5D2NB 1GCFA 2JMRA 3HG3A 3VB9A 3CC5B 1JK8A 3FO0H 4X8JB 4DPCX 2MOVA 4PRPA 4KHOA 3OZKA 3R4RA 1UB6B 4XNYL 5IWLC 5HHVH 4H8QA 2R2YA 4WO4C 2I26N 3TEYA 2O5XL 1FO0A 1RU9L 3DECA 2Y06L 4UV4L 5DZPA 5DVLA 3D2TA 4GXUM 3LEVH 2RD0A 2YRYA 3OAZK 4QHUA 5F1IA 3BAXA 5ITFB 1WBZA 1OQNA 4XMPH 4J3XA 1XGPB 4G7SB 1E5YA 1XCQB 2PYFB 3BMVA 4S1QH 2MH4A 3SE4A 5KYXA 1EBAA 1KCUL 4YHOH 1WJMA 2D3JA 3BVXA 2NXZD 1BG1A 4BWTA 3BUYA 4DGVL 4RH4A 3FH8A 1MLCB 5F7HA 2WB1A 3QJHA 5C0FA 5JLZB 4PS3A 2E47A 2OV0A 3QNYB 1JPST 4PRBA 2UZXA 1YHPA 4K94H 3NIDE 3Q8EA 1UWFA 1SY6H 4PS8A 5D5ME 3VFSB 5MHSD 1PIGA 3DVFA 3ZO0A 2OMVA 4MHHI 1ZA6A 4XNQA 4XCEB 1MCCA 4EOWL 3EYFB 3RVTC 2DX5A 2X05A 1V88A 4NC0B 4RRPM 1HYSC 4UIKH 4FRWA 4CJ1A 2PCFB 1YN7B 2RAMA 1IGIL 3QZMA 4BBWA 5KVDE 3Q05A 2SODB 3N7CA 4CKVX 2NY3D 3KPMB 4GMTH 1GZQB 5AENA 2DF3A 4YE4H 4R96A 1DBBL 3ETBJ 4QHLB 2XV6B 1WV7T 3IK2A 2GUYA 3KNBA 3SDCB 4PWIA 5I2IA 3A0OA 2WZPA 1XSJA 5EC2B 4AW7A 4ZFOA 5AVTB 4X7TA 2QPFA 3FTGA 4HWZB 1I9JL 1OP3K 4AYBA 1JZHA 3I50H 3S36H 1KULA 4KTGA 2EUVA 1NCWL 1XSKA 2IH1B 1FFPB 2NX5D 1G7JA 2JJUA 3T77A 1THAA 1WHPA 3EJYD 2HAZA 4HJSA 4MLSA 3FN0L 4PRNB 3W1ZA 1PAZA 2F6AA 4XMLH 4EI5C 3LD8C 5DFAA 4O02H 4L8SC 3SJVD 3TGXA 1H9DA 2BRRH 1CS6A 2HUHA 3CGTA 1SXBA 1HX0A 1QRNE 4R0LB 1USQA 3KPRB 5AKVA 4UM9A 1S7QA 3CSGA 5GRVK 3BGFB 3VXPA 4EMOA 3PWJB 4BZ2H 4HKXA 5E9DE 2DKSA 4FTVD 1JRHL 5T1DL 3GDBA 3DXAB 1ZKAA 3P0VH 4XCNB 3X13A 5C9KA 3P9MB 5IVXA 2J8UE 1IT9H 4B9IA 1X7SA 3KPPB 1NWPA 3NT0A 5HI4D 4NNXA 3ATDA 1NBQA 2NPLX 1U2BA 3O3DA 1MW0A 1J0HA 1FDLL 2NBVA 3LRGA 1BGXH 4LARL 3JV5A 3VGAB 4KXCA 4L8DA 4QTHA 5ICZB 5K9QI 3HVDA 2QHRH 5F7AA 3UABA 5E7BA 1OGAE 3CAFA 4HBQA 4Q58C 1XGQB 2FEEI 2DYQA 5FYKD 3U2JA 4EZJA 2EACA 4XNXH 2XIDA 4YQXH 3PWLB 4NNPL 5F97E 1J8HD 3WL9A 5FECA 4MNQD 4OBRA 2G4GA 1JWUA 2EZ0D 2AITA 2RCSL 3DVIA 2XWRA 4DN3H 4KH9A 1HWWA 1WWWX 3VMOA 4WV1A 3ILEA 2I9TA 4HAUB 2RIKA 2EYSB 5GGQL 5BMFH 4AL8C 4QO1B 2XVLA 4XNZC 1TR7A 4LCYA 4AY0A 3UMNA 1KV7A 1HL4A 1JYXA 1ETZB 3OKOA 2AJVH 5IFJA 2I32A 2XG5A 5C5BB 2WXHA 4JHWH 5B1BB 1QTPA 4WHCA 1AGFA 5K9JL 2DX1A 4IRJC 4IKLA 5GHWL 1TU2B 2F18A 1NFDF 5TE4H 3PP4L 1IC1A 1KCLA 1Z3GL 5C7XH 3LS4H 3L6FB 4C58B 1F4XL 4QYAA 4ZUTB 1SYVA 5CM1A 4NUGL 3OJ2C 3MV8E 5A7BA 1VGKA 1ZANL 3MTXA 4EZMA 4OM0H 1RJ2A 2ZKHH 4BCZA 2VQTA 1LK2B 2XZQL 5HYJA 4MB1A 5L2KE 5SWSE 3LKNB 2OX5B 4FXKC 1ANUA 4N2NA 5DJYB 2P8MA 4Y8AA 5KYYB 4L29B 5DJZB 3EYQD 3U4AA 4AEFA 5A2KH 3DSFL 4NHCH 1F4AA 4OSUL 4Q0XH 3LZOA 2NQDA 4C4BA 1TQUA 3FO1A 4GUCA 3GJEA 1IFHL 2Z31B 3EJPA 4NZTL 1N68A 5DVKA 5LO7A 3UZEC 5FB8B 5JW5B 2QQNL 3KYNA 5H37A 2NLJB 1KSRA 1UD5A 2YMXH 4FABL 3TZVC 2ESVA 3OMIB 1U3HD 4U31A 4C56A 4I3SH 5C0GB 2P9RA 4HFUL 3UBXB 1XGRB 4QRRD 3QORC 1VLXA 5FWQA 3CVHH 3CSPA 3S97C 2X09A 4JPWH 1XGTA 2Y07H 4CMMB 4ZI8A 3F7VA 2VITB 1L0XA 1F41A 1QFWL 2WXNA 4L0ZA 3MLTA 3BHBB 2H32B 1YMMD 1FPTL 4ELMB 3VX1A 2RUKB 1WT5A 3GPSA 3MV9B 4IQHA 4FFWC 3AB0B 4BZ1H 1SJMA 4U0RB 4Y9FA 5FGCB 4F8PA 5BV7L 2K6ZA 1PSKL 1G7PA 2IANA 2VKXA 1D5BB 4HUWB 1LJMA 1TTBA 3BPNC 3QBVB 3Q2CA 2AK1L 1HILB 2P3YA 4QGYA 3TA3A 3WNLA 1A47A 5I75B 2Y24A 3TN0A 1GYAA 1CFNA 1JF6A 3LN5B 4BSJA 2DM7A 4E5XG 3OMNB 4F33B 1HI6A 1JNNL 3QUXA 5AD0A 2OR9L 4OCWH 4PMFA 5GS2H 5ECGA 2FWOA 1SY6A 3SE9H 1V54B 4UNUA 3BGMA 4N2OA 1KGXA 5T5FH 3GZOA 3S5ZA 1N0XH 4HSQA 3U25A 2B4CC 4JQVA 1MAKA 2P49B 4AK1A 2D2QA 1E40A 4ZW7A 3ULUC 1YNLL 3MROB 3QDGA 3L5WA 1FBIL 1LDPL 2CLZB 3SPCA 4HT1L 4U1LA 5B1JC 1BFOB 1GZHC 2C1OB 3K72B 1L9QA 3OR7A 1CXIA 4HIHA 4F7EB 4OVVA 4OIFA 5EDXA 4AVHA 1A1MA 2IBZX 5D7EA 5J4MA 4Y16C 1QSEB 2HUEA 3FUIA 3AREC 1TFPA 1AKPA 1XTMA 5CJ8A 1HHGA 1K72A 2LVEA 2G9HA 4MD4A 1T77A 3WIIH 3DVGB 3C2SA 2VXUH 3HPJB 2AQTA 3BKYH 4XXDA 1SJXA 3VFWA 2RSGA 3FQNB 3SKNA 2B08A 1KB3A 2L4OA 2CSPA 3HN8A 3QWOA 2CIKB 3MHZA 1AJ7L 1AO7A 1HS6A 1O0VA 3QT2A 3VFTB 1Q0XL 2Y8FA 35C8H 5E2VL 1RK1B 1YNTA 1MW1A 3D30A 1BQUA 1ORSA 4R4FH 5D1QD 1XIWA 1KENL 4P4KD 1JYNA 3ARWA 1SOSA 1I31A 2UZIH 2DQJL 3SDAB 5SWZA 3ZQWA 3ASNB 2VDPB 2VXVL 1INEL 1OTTD 5C70A 3F6JA 5FW7A 1H4RA 2A83A 3U2SA 5JDSA 4QF1A 4MMYA 1T4KB 2EO9A 4Z3TA 1CYXA 1XBDA 4NCC2 3BQUB 3VI3E 1ET8A 1A14H 2V17L 1RH8A 3GMMB 4N1CA 4JHBA 2VZ3A 4E9VA 3MLSH 5EPMB 1ZD6A 3VXMB 4HJGB 4M7LT 5T1LA 4OF0A 3WJMB 1N12A 4P9ML 3FRUA 1FGVL 1MELA 3BP4A 1HL5A 3Q6GL 4B9ZA 4KUZH 1NOFA 1UWXH 1XGYH 1ZS8A 4QIRA 5DK2B 5C0BA 4TV3A 3RWGA 1BA9A 4FXTA 3QZPA 5I0DA 2JJVA 1VENA 2VDLB 5EOTA 4Y19A 1AD9A 4PCSA 4J12A 5EEWA 2YPKB 3KL3A 3REVB 1HEZA 1CICC 4X4MA 3PDOB 1NGPL 2DI8A 2F1BA 2LT9A 1MCBA 5GISL 3AU1B 1E6OL 1CK0H 3S3JA 3T65B 5D2NC 1PFJA 5DUPL 2GSGB 3BWAA 1U8JA 2LG1A 1NBCA 1E9QB 2YXFA 1LE5A 2VCOA 2ZYIA 2D9QB 3QO1B 5IOPA 4LCWB 2BK8A 3ARYA 4IYKA 4Y2DA 1QQDB 2WLIA 2MRYA 1EBPA 3IT8D 4JY5H 3PP2A 5BZDA 1FJ1A 4X6BB 1RUAH 2KDYA 4UT9L 2YQ2A 1JZ6A 3HJEA 3EDEA 3CBRA 1VEMA 2O5YL 4GUPB 4N8VG 4UZUA 5I17A 5C0AE 5LNEA 1VKXB 3B2VH 2GIMA 5EBLA 5IJKC 3BAIA 1RPQA 2A74C 2VLRA 3BUBA 3JVFC 4JHAH 4PQXA 4CU6A 2PPEA 2QKIC 1CFVH 2WWMC 1J9SA 4PJFB 3IKCB 4XP6H 4RGOH 3ALXA 1JG9A 4A37A 2EO1A 2WQRA 4NQEB 4YMPA 4W9KC 2PP7A 3FU3A 4XNBA 4FYSA 2AXFA 3QFGA 4WHTB 1OCWH 1W1DA 3MUHL 3ZSSA 3WKQA 2X4SB 3K1DA 1PPIA 1U36A 4YPGA 1DLFH 1S7XB 2Q7AA 4PJ6A 4WVFB 1G7HB 2HT2C 4HF5H 4IMKC 3SPHA 4NPYB 2COFA 1LVEA 3B5GA 5TDOB 5ICYA 3M17B 3CVHA 2WZ6A 3FHQA 3FTVA 4Q56A 4XODA 5B3JF 4PUBH 1INQB 3FYEB 1XCQA 2RHEA 4B9FA 2HLAB 3H54A 3MRQA 3G6JE 5TE7H 4F7GA 4OAWB 3R06B 4GBXB 4YXHH 5CEZH 2WLLB 3UADA 2VLKA 4B7IA 1UCBH 4J3BA 5DZOA 1S7VB 2PF6A 1A3LL 2JKRM 2F68X 1JFQL 4YK4B 5JTWA 5JHAA 43C9B 1IM3A 3HN5A 1BD2E 1LGVA 5E8NA 1NL0L 1C08B 1OD9A 2CO2A 1YC8A 4WNSA 5GRUL 3LKOA 2KT6A 4DP5X 1OLZA 3F85A 4JLRA 1PKOA 1GA2A 3HE6D 3EHBD 4FAAB 4NT6B 5F1NB 2ICWB 2R0WH 4HAWB 4F8QA 2EYTB 2J4WH 3LPPA 1TJGL 2C1PA 3QHZL 5T5FA 3C12A 25C8H 1BSIA 1DFBH 3HZ3A 1QEXA 4YWGH 1ECYA 4HP5A 3GI8H 2LAAA 4FA6A 2XWXA 3FH5A 2BLFA 4PJHE 1KJ2H 1WG3A 3BVNB 3BZFB 5E7FA 5F88B 4CVZA 2KUTA 5HDLA 1JMZA 3FL7A 1SLUA 4IAPA 2H7WA 3BGFC 3L95A 4BELD 1N5AA 2NXYB 2XN2A 2R56H 2BW4A 5BRZB 3KPQB 1GZQA 1JSYA 5D93B 2W0KA 4TVPH 4G8GB 1KBPA 3WEXB 3SDCA 1SLXA 3VXOA 1E67A 2DS4A 3Q2LA 4ODVL 5DHVH 3D39A 3BE1H 4YHKH 3WFCL 4QRAA 5E4OA 2L0DA 2TSBA 1G7LA 3L7EB 3IN2A 5LBSH 3LPWA 1VDGA 2BCMA 1EHAA 2GBAA 3QEUA 3QIWC 1SLWA 3JZYA 3S5YA 4WO0A 4BFIA 1E42A 1LO3H 2O4EA 4XN2A 2GK2A 2PNDA 4Z78A 5EC1B 4A6HA 4X6CE 2BOBB 1OAZL 5DJXA 3VGEA 1BF5A 4YLQT 4P2QA 4E9WA 2YKLL 3LMJL 3PDGA 5J5EA 3KPRA 5L6YL 2NDGA 5HHOE 1GYWA 1ZLDA 4DK6A 1U30A 3ULVE 1OT2A 1F5WA 2HN7A 2YT2A 3OQRA 2Y36L 4GW1B 3O9WA 3RL1A 5I0XA 4EI6B 1IAKA 4U1JA 2DJUA 1HIML 3NA9L 4L0PB 5HYSG 2E7MA 2AK4B 4WZ9A 1IGCH 3QA3A 4CAGA 5D1XB 2NCMA 3MLYL 4ZS6D 3UTPD 2J5LB 1BVNT 1G0XA 5EIIG 4ZXBB 5SX5K 4DP6X 5LDSA 4V2BA 5C86A 3MKGA 1S7SA 3CK0L 4HFWA 1MJUH 2XBDA 4FZ8L 4S2SA 1FAKT 3F7KA 3KDPB 5ISZB 1EAQA 5I2MA 3SDYH 1TJXA 2AERT 2FQFA 2VMCA 4L4TE 5D7IB 2YPLD 5E94A 3G5VA 4TF4A 3NPSC 4LOUD 2Z34A 2YT1A 2JQZA 2CKNA 1I1AD 1WZKA 1YEEL 4G7VL 4PTUA 2PLTA 5DHYA 3U4EB 3UJIL 1J87A 3KPLB 3ZDXB 4QHMA 2APTA 5IF0B 1DVFB 4AMXA 2ZWLT 4L23A 3KBEA 1ZT1A 2E9JA 1HVXA 4PJIB 4OW6A 3LZPA 2OTUB 4Y1TA 3QR1A 5MP6L 4Z7UB 1DVSA 3DYMA 2EKSB 4FQCH 5E2JA 4XE0A 4PR5A 3M8OH 1VFAA 1CLOL 2P5WA 3SD2A 1U8LA 4EXKA 4C0AA 4NENA 2RQ8A 1QZNA 2Z31C 4JFOA 4OFKA 3FQWB 3BZEB 4YE0A 3CSFA 3SE3A 1R1CA 5GPRA 3OX8A 4FHBD 2WN3A 1EAPA 4Z7QF 1BF8A 1SOQA 4X5XB 1EZSA 1I8UA 3FQYA 1Z9OA 3ZE2E 3QK0A 3SN6N 4HB4B 1IAII 1TU2A 3RB5A 3N85L 1MAJA 5HHQB 1HHIA 4ZUTA 2EDDA 2QKMA 2IAMA 2X1XR 3C2AL 4HIEA 1XD4A 4TNWK 4M5ZH 1WWBX 1W9XA 2CMRH 4WW1B 2E7HA 2XFXB 4BCYA 1LD9B 2XYCA 3MRLA 3KW7A 2WIIB 3AB0C 5HDQL 2DQGL 4U0RC 4WHYG 4M61B 5HE1A 1DJGA 1OF2A 4PRPE 2GBUA 4MDIA 4G11A 5I75C 1UADC 3H7BB 4OH2A 1FLTX 1CWVA 1DN0A 3FUNA 1K4CA 4KY1H 2PXYD 4WTZA 4NUJA 1RZKH 4YHIB 3S4SG 3IJHA 3UZTA 3B56A 3KSYA 4AUUA 1UB5A 2XKSA 4HS6B 3AROA 4U3XA 3X11B 1MIXA 2LGNA 3BIKA 5AWNH 3SBPA 1XHHA 4AQ8A 3MREA 1FGZA 4HCGA 4PYHA 2UY7B 1IEBB 4N6QA 5HTSA 4BKSC 4XN8A 4OJEH 1WGQA 5KSBB 3EYOA 3WDIA 1NA8A 2DQIH 2VC2L 1P5UC 5CINL 4JAMB 4GG8A 2XVBA 1AS8A 3ML4A 3EFOA 3S0PA 1WTLA 3FB5B 3UGXA 5JIQA 1R19A 1Q8MA 3CDZA 3MV9A 4HUXB 1UYWH 3MFFB 4LL4A 4FKKA 2ZJSL 3E3QC 3PDDA 1JWMB 1ZLUH 4GXBA 2WBJB 3SZ6A 1Y0LA 1NMAH 2ZP8A 3F7PC 4AC2A 4M62H 2R2HA 5G5DB 4XT1C 3FH7A 5B7MA 3ARBC 2UWEF 3TJHC 4RDQF 1D5ZB 4BSVB 3CXHJ 4XNAA 4PWJA 4HEMA 3X2QB 3FQTA 3VTTA 5I8KH 1AGBA 1CT8B 4KRNA 1IBZA 3NCFB 4FNLH 3LS5L 2YPVH 4QD2E 2R59A 5EMYA 3FRPA 2DHKA 4JJ5B 3CZNA 3M86A 1OK8A 2A4EA 3TVMB 3AY4C 4UQ2B 5LXVA 1KPVA 2MKLC 3IU4H 2ADFL 3G08A 2YT0A 4CN6A 2P24B 1FCCA 4CC1A 4TQEL 3LNIA 3BINA 3F7RA 1ODUA 3C60B 4N2BA 1IZJA 3VXTA 1PEZA 2D7PA 4UBDD 1SNRA 5J6SA 2V76A 2C7UA 4IMLB 3SGKC 2GK0B 2WINB 1A6VL 2IEPA 3JTBA 1TSHA 2DLEA 4HK0A 3VXNB 4DKEH 5D1ZD 2EIBA 3ZKQD 1AP2A 2CKBH 3AWFA 1U2YA 3T0ED 4N0CD 4PJ8D 5D7LA 4X9HA 5HY9A 2VZTA 1N6UA 3FO0L 3MOQA 1TLKA 1FNHA 3D0AA 1QG3A 4TS6A 4W9FC 5HDBB 2G3NA 4LVEA 5HHVL 1GGIL 4YR6A 3GMRA 2FSDA 3H2WA 4TNEA 4K23H 1HHKA 3RUGB 5FCUH 2Q13A 4KFMA 1F58L 1NBVH 3ECWA 4IGBB 4AJ0A 1QLEB 1BVKA 4UTCA 3L4XA 5AALA 4JFHD 4XMPL 4Y5XB 4NQVA 3RTLA 5IVXE 3UBXI 3OZLA 4NC1E 4P9HL 4XXWA 3TO1A 4S1QL 2XOTA 3PWPA 4JFDA 3WS3B 4RMQA 3UPCA 1F4YH 3EJZD 3MVSA 3QVAA 4YHOL 5JHHA 1SN5A 3SB3A 2GJJA 4YBHA 4PD4K 4ONHA 3B2UD 1EEYB 1GC7A 2NY1D 3KWVA 1XF2A 3SQBB 4PV9A 2WZPD 2K1MA 1SN2A 4B41A 1SF5A 4OIBA 2A9DA 4TYZA 2GSIB 3FUFA 2VRKA 4R2GB 5JHMA 4Y4HC 4K94L 4HUMB 3KLSA 4RSVA 4DEWA 5ABAA 3ARFA 4A1RA 4OGQC 2WWOA 1RFDH 4KK6D 3WJMA 3JWNC 1ZSDA 5F7EH 3F58L 3DXCA 4PRID 2HMID 1TCMA 1ZSHA 2ZP9A 1T21A 4MA7H 1JVOA 4A6FB 1HOCB 2FRGP 1ZVNA 3FB8A 3HUJB 1T83C 1OL0A 2XKNB 4NLAA 3HBZA 4OGYH 3VWJC 2C34A 3IYLW 4UIKL 3HEIB 3TBYB 1W0WB 3DX4A 1BLIA 5EHFA 5AVXB 5LJYH 2Q2LA 3GGWB 5CBAA 4OCSH 3GPEA 4MQXD 3UC2A 4GMTL 2F0CA 4HETA 4PJBE 4YE4L 2V3EA 3ZL2A 1E9PB 2KYIA 4MJ5B 4OI9A 5H35A 2A6JB 3IJEB 4XCFL 4HALA 3GLZA 2W60B 2ZX5A 4HWBA 3Q2VA 2YWZA 2FECI 2BS8A 3F01A 5CIPH 2KLRA 5I1IH 1OT4A 3HBQA 4JM2B 1BWNA 4EIGB 3TU6A 1OAYH 4UQ9A 1TTUA 2V2WB 3L4CA 1NUGA 5CN1A 4OGAD 1BIHA 1F6FB 3ZSTA 5T1JA 1CFMA 5K59F 2JB6B 3VDAA 2VLLA 4GUPA 4OJFH 3I2CH 4O02L 2PO6B 5D55A 2BRRL 4NO0D 4E9YA 2HJKA 4UT6L 3SGJA 1QUPA 4YONA 1PGRB 1T7XA 3ARTA 1KCWA 4MB3A 1U4FA 4J6IA 4GKLA 2BM3A 3MMEB 3STLB 2BP3A 4BZ2L 3K5SA 4NBYB 4PGDA 4GEJA 2YGVA 3P0VL 4K4KA 3MRFA 5IMLB 1UZ8B 1WWCA 5D6CA 1IT9L 1OSZB 2IMMA 4ZQKA 1CGWA 2CR6A 4JEGB 3ZKMD 2BCKA 3AC0A 3RKPA 1HCFX 2C4FT 4PI2A 3ILPB 1BGXL 4G1MB 2KHAA 4PJGB 3VJ6A 1TJIH 3FTWA 4QRTA 3EH2A 4OZ4A 3UZQB 2E3VA 3TYGH 3ZKNC 1U92A 2X3AA 1N59B 2A6KB 2QHRL 4QXWA 2P28B 4K81A 5DEGA 4KROB 4YHYB 2I24N 5IHZB 2HLAA 2N01B 1KLFB 1G9NC 5I6KA 1WP6A 4XNXL 4YQXL 1KZGA 3I02A 4GBXA 3NRQA 4GLRH 4TSCH 1J1OH 2GBVA 2NXYC 2PWDA 3T0WA 3GB7A 4JO2L 4L3EB 1FLRH 3KPSE 5HYJD 4DN3L 5D93C 2DWEB 2AJUH 4Y7MA 4P99A 2BOCB 4LLQB 5T3ZH 1CZ8H 4TSAH 4A6YL 1RL1A 1ZC3B 4N6RB 4LBAA 1P5VB 4M5YH 2W91A 5HYIA 3CFJA 4PJ5E 4MK0A 4L6EA 1UZ6E 2YPVA 1BFVL 3RIFK 1Z5HA 3RVVD 3S6CA 4N8UA 3R7QA 3HE7C 3PS6A 3QDGE 2ESVD 4JHWL 4Q89A 4C56D 3QUZA 1SEBB 2FJFA 3MV11 1O7DC 2YWYA 2IXQB 5TE4L 1EXUA 4IOFD 4CGUB 1OM9A 1SHWA 3FONB 4HJ0C 3OGOE 1FC2D 2OBGA 1CD9B 1YG9A 1LW3A 3BPCB 4D3CH 2ZKHL 4JRYB 3IJSB 2JP2A 4PHZA 4Y2NA 4ALAH 3EO9H 2F7RA 3MOBH 3IU3A 1OXYA 4L5FE 5GSRA 5FOBB 1M7DB 1PQZA 1NH6A 2J0KA 4L4VE 1Z9MA 2CKBA 2IAND 4NHCL 3D18B 4Q0XL 3K0WA 2J5LC 3TA3D 1LM8V 1YY9C 1O75A 3TN0D 1IAOB 2EEBA 1CDUA 3VQLA 2YMXL 2B59A 3TTSA 1QACA 2CDFA 4HAGA 2DWXA 3S8WA 4I3SL 2OMWA 3L3OB 2FT7A 3HS9A 2H1LM 2L8AA 4N2LA 5FM5M 3APCA 5SWZE 3TCXA 4NN5B 1LNUB 4POZD 2Z0OA 4JPWL 2LKOA 1L9TA 1H9VA 3NIFB 3PABA 3L3IA 4DXAB 1DVFC 1RJLB 1RZ7L 5J6HB 3MFGB 4OJYA 3T6ZA 3KXFE 4QY8A 1PCXA 1OAUH 4CW1A 1TZGL 1YEGL 2WO3B 1MCWM 2N1KA 2BVQA 4Z7NE 4BZ1L 4J4PD 1NCIA 3DIFB 4XC1L 1FZOB 3CUPA 4AYID 3ARGA 2NY6B 4DGUA 2EDNA 5TD4A 1G1CA 3QZWG 2YAQA 4Z77A 1KT2A 2WLNA 1XXDC 5KWYC 3HI1B 4NRYA 4FG0A 4QRPB 2QV2A 5DGQA 5EO1B 4OCWL 5A2FA 1FV1B 4P23B 1B4JH 3U83A 1ASOA 2E6PA 3ULBA 4CU7A 5EOCJ 4XZUA 4ZK8A 4L3CB 5I16A 4QR7A 4GT0A 5T5FL 3VI3F 2Z0QA 1N0XL 4Y19E 2QGDA 1A9BB 4OT1A 1U95A 4GG6A 1AO7D 4C54A 3WUWG 4GG6F 4OCRL 4A2EA 2ICWI 1S5HB 4DCQA 4KNTA 5AKTA 3CU7A 4XMZA 2OMTB 1K2DA 2D0FA 3EBHA 4DHLA 1X4XA 2E9IA 4HISA 3WS6C 4F7CA 1CL7I 1XIWD 3TM6A 3MZGB 3T6QC 3TX4A 4FLRA 4GFXA 4HHAB 2IAAC 1PY4A 2DQMA 1A3RH 3IDGA 3U4KA 3ELQA 2F19L 3K2IA 1XR9B 3O6FD 3TBTB 1MHHA 1I85C 1NIBA 4XCCH 2YF0A 3WIIL 1IQWH 5B8CB 1U2CA 2VSDA 5JQ6L 5SV3A 2GSMB 4B0MM 8CGTA 2VXUL 3BKYL 3DX7B 2M14A 5LXGH 1XSOA 4FYRA 2ITDA 3NPZB 3IXTB 2TRYA 2VLRE 1AWEA 5I8CA 2HG0A 3AXLA 3H0TA 4J8QA 3SCMA 4K9JA 3CSYB 3ESOA 4JDZB 35C8L 1DFXA 4KUCD 4RETB 5DYOB 5LKNA 4R4FL 5C0BD 4I3GA 3IS0X 3SQOH 2R0KH 4XVUD 1MFBL 1S9KC 3HG1B 5C0RH 2HRPH 4A67A 3RDTC 4L2LA 2GTWB 1BWMA 1EQWA 3PV6A 4FHJA 5DZVA 2FHCA 1KPUA 5BS0D 1HNYA 3B2XA 4YSEA 4JN2B 2G3ZA 5T3XH 3ARQA 4GW5A 2XV3A 4APXA 2A6IA 4WUKH 1A14L 4MAYB 3FU8A 5GRXG 3WFHA 3TVMC 2CLRB 4Y2DD 3MRGB 2X4PA 2AXJA 2VN7A 3KYMA 2OQJB 4U6YA 5JPMC 1UQSB 2VLKE 3MJ6A 3BFWA 3SBWA 3HS0B 4N26A 4KV5E 2PPFA 4IHOB 4UM8B 3TIDA 2EIDA 4KUZL 4PREA 2Y2TA 4G5ZL 4J3OH 3C60C 3SKUD 2J20A 2F54D 1EUUA 4U6XB 1NDTA 4O2EA 3WXWL 3SGEI 3SQRA 4FL4B 3Q3GB 4X7EC 1YUHB 4K9EC 2FIRT 4KHTH 4K07A 5IEHA 1OT1A 5D70H 1TQTA 1UM6H 1SZNA 1IC7L 3IKKA 1UOWA 3H6JA 4JKKA 3VSVA 4DTGH 3WKPA 1AMXA 4JCMA 4BSVA 1G7QB 1YPZA 2BVTA 4IU2A 1CK0L 5DEZA 4LCIH 1YPZF 1GGUA 4ENZA 2E6QA 1GYVA 4XWGH 4S0TD 4BINA 2W92A 2WKOA 3RVXC 2CM5A 2JI2A 1UD3A 1NCHA 5HGAA 4WLCA 5F1KC 3C8HA 5DLMH 3A47A 3W56A 2NTFB 4GP5B 4I18A 5EO0B 4XBGA 3IDXH 5FGSA 3HMWH 3QCTH 5I1DB 4IGBC 5IBUB 5FDWA 1PZ2A 2DQEL 1CGSH 2OSLA 5JMRA 3E9UA 2A9NH 3V4VB 4R8WL 4IDJH 1NWOA 2FBJH 1XH3A 3B2VL 1UJ3C 4F3FA 1KUMA 1V7NL 3EO0B 4JHAL 4XAWH 2GK0A 4PJ9B 3D3VA 4Y8DC 2P8LB 2WINA 2Z4TA 3D85B 3ROOA 1CFVL 1LMKA 4NUPA 1XAUA 2ZXEB 4LPWA 2R1XB 4Z7VB 1TYRA 5AW8B 2RNRB 4RGOL 3RL2A 1KPRA 1B0RA 1KOAA 2GJZA 3MRJA 5CMAB 4DERA 4A7GF 3BISA 3EDKA 5C97A 1XD0A 1OCWL 5E6SB 4I0KA 4JPVH 3WY4A 1CE1L 3OZ9H 4P2QE 1DLFL 4R2GC 1DZ0A 1K6QH 2Q20A 3KPRE 1B55A 1ZPUA 5MEND 4HF5L 5GS2D 5BJTA 1PZCA 1WA2X 3SDXB 4N2MA 2H5UA 1CIUA 3Q2WA 4N2GA 2O5ZH 4J5VA 1TJ6A 2IWEA 1U8IA 3EW3B 3RY6A 3IDIA 3TFBA 2OLDA 3U6RA 4OLZH 2X18A 4PUBL 4F15B 4YGAB 1A5FH 1QSFD 4NQXB 3UERA 1BZ9B 2HVKB 5JPNC 1AMYA 2CGYA 4YXHL 4G9DA 5TE7L 1UM5H 5CEZL 3DPBB 4PLKC 1MCPH 2QV4A 1UCBL 1F11B 1TDQA 2YQ3A 2FATH 2R9HD 5EU5B 3LY6A 1PZ3A 2BY2A 3ULVF 2I60H 1AQDA 4MJIA 2VMFA 1DBHA 2YSSA 3OC8A 4H2CA 4JFVA 1OVZA 5IY5B 3BEVB 3IGAB 1ZLVK 3D39D 3VU2A 3EBGA 1NFIB 4V1DD 5CD5D 4KVGB 1T22A 4N1EA 1X5LA 2YGQA 2JI1A 1JXJA 1LP9A 4E42A 3AGVA 2AQSA 5TE6H 4H1LH 3O3EA 1LP9F 2R4RH 4KU1A 2Z1KA 4PRDA 2J4WL 1UD2A 2CHDA 3FBQA 25C8L 5E6UB 1DFBL 4B7LA 4U1MA 4YWGL 1ZXQA 3P4NB 2DQHH 2CJ3A 2PO6C 2BMKA 2BWDA 3VNYA 1KJ2L 2P5WE 3UJTH 3WXVH 5FYKU 2R29L 3K71B 1YEKH 1Q9LB 5DWUL 3GGWA 3OKLA 5I1KH 2R56L 5F3BA 5ADOH 1QOKA 1U8CB 5LGHH 3MV7A 4KX7A 4TVPL 3IJEA 2ERJB 4GOUA 4HB3B 5FAAA 4BH7B 2DBJA 4ETQA 3DJTA 5TH2B 3MQIA 2B15A 1FRGL 3PL6C 3BE1L 5KVDL 4Z3GA 2HX7A 2DDQH 5LBSL 2FLBT 3A98B 1SJHA 2DTMH 5CSBA 2Q7YB 3DBXB 3VVVA 2X44D 1WGVA 5C1MB 2E9GA 4C8XA 3V4UL 1LO3L 2X7LB 5C08A 3GSRB 3MJ7A 4M7LH 4YHYC 4RFOH 4KDTA 4KROC 5KJRH 3MRDA 2MKWA 2C4XA 3AADB 3ZE2F 3GO1H 2GCYA 1T7WA 2H8PA 1E28B 1RJYB 5ITBL 3ECUA 3ARDB 3E9TA 3FU7A 1DUZB 3ALWA 4MBRA 4MSWA 4XO4A 5DS1A 2YC1B 4L37A 1L9PA 4H0IA 3NSXA 4RVBA 2DQUH 4UYQA 1C12A 3U0PA 4BHUI 5EWIL 1PTZA 3N1MC 3A6BH 3V5KB 2VLJD 2VR7A 4NKOB 3U2IA 4OR1A 1A1OA 5EULV 1N0LA 2EINB 2GAZB 1XF5A 3SDYL 4ELME 3BO8B 4HIXH 4ZMZA 3K8LA 3O6ML 3MV9E 1H15B 1RQ5A 1W1HA 1E3ZA 3UZQA 1A2YB 4ODTH 2IBZY 2WW8A 3FPYA 3R1GH 1KIUB 1M7RA 5AOIA 2IAMD 1YY8B 3T3PB 2C5DC 3MJGX 2IH3A 3VGDA 5CS7A 4LSUH 2WK2A 4PG9A 1IE5A 2ZSVB 3MCKA 4PJEB 3RIAK 1U29A 1SYSA 4HEME 5HHMD 1QA9A 5HYQB 2BSRB 4MGXA 3MBXL 1RHFA 3C6EA 4JFXB 2Y7MA 2DBLH 3AVEA 4HZLA 4OLUH 4FQCL 4XPGH 1CN4A 2WQ8A 3SKOA 4QHNA 2LU3A 3M8OL 3LN9A 5KCVA 3IXAA 3OSKA 4Q9RL 4G6MH 2HVJA 4WO4A 3LV3B 1JZJA 5JXEC 3GYRA 1FOEA 3FSOA 2X4OB 1MFAL 3KBHE 3LKQB 2MCG1 4J6RH 1A6PA 1MEXH 5DMGC 4AQAB 4DP1X 3QWRA 2EDOA 3L3OC 2ZWZA 1U58B 4XVJL 4JRLA 5H4YA 3N42B 4FFZH 3UTSA 4PJAF 3QGVA 4QJ4B 1Y6NR 4J23A 2XNAA 4LKXA 1DSFH 5DQJB 1X7QB 1AI1H 1MFDL 1EO8L 3GSQB 1CGUA 3OR6A 4KMQA 1MUJB 5D7LE 1R5WA 1IQDB 2I07A 2CMRL 2MNJB 2ZXAA 3IJSA 5IK3A 4LSRH 5CEZD 4BQCA 1XT5A 5JIKA 1AZRA 4X6EA 2W8CA 3EOAA 4E9LA 1DYNA 1J0IA 4DNLA 4ZRJA 4YDJA 5KBPA 5AZEH 4J39A 2G0LA 5DTFB 5KSAB 1Q0EA 2NCEA 3O2WL 4F9PC 3H4FA 2LOZA 1T1YA 2NY6C 1BAWA 1TKWB 1DROA 3O6LH 4KY1L 5KG9B 1SRDA 1S9XA 1HQRB 1RZKL 1MCEA 2JQMA 2NUPB 3HR5B 1JTPA 1U42A 1S9YA 4M1CC 2OJEB 1N5YH 4CYEA 3PAUA 3RPKA 2JFCA 2YS5A 1C5DB 3TYFA 1LE9B 1CFTB 2B4CH 4W9CC 5AWNL 4P23C 1TVHB 1UVQB 5E8PB 1HN1A 3WUZA 3TF4A 3DC0A 3OJVC 3ULUH 3G04A 4ISVA 3PWPE 2MDXA 5I5JA 2BSCA 3D2UA 2CDEA 1S7TA 3BKML 3K3QA 2HT3D 3BJ91 1AIFB 4WRLA 5CN3A 3RI5F 1UYWL 2FJHB 1H5BA 3QEHB 4UOJA 1Q38A 2C3WA 4U05A 4BK8A 1PFOA 2R7EB 1G6RL 1P9MC 1DDVA 4WAFA 4RAVA 3P77A 3G6DH 2K3TA 1KLGA 1NMAL 5FA3B 4TVPD 3FFDB 2CHXA 4M62L 3VXME 3O8XB 1SBSH 4RA0C 3QNZA 3V6FA 6PCYA 3VRIA 3R0MA 4XP4H 4L8CA 4ILDA 1NCTA 2W9LA 2X4UA 3MGOB 5B8CC 4FNLL 2BHZA 3V6OC 3B3IB 4PV8B 3VFRA 2FCBA 2OK0H 3M1IB 1OW0C 4XCYA 1EGJH 5DK0A 1Y18B 2V6HA 4CSQA 3QQ3A 3CQQA 4N90D 2YD0A 4W6WB 4NZRH 4HGMA 5K9OA 4G9FD 3B3BA 4UOQA 4LPCA 4YDIH 1MRFL 2WQWA 4OIIH 5K39A 1X7TA 5DMKA 2FT6A 2OTPA 2ADGA 3WIHH 4BE6A 4K2PA 4KI5D 1KTLB 2HX9A 2XQ0A 1B4TA 3P4MB 2YGOA 1J8RA 3DX8B 3H85A 4UB0H 4Q74A 5GGRY 5JZ7C 4EJNA 1YEHH 1KNOA 1K8IB 1CURA 4JFDD 4LCWE 5HVWA 2F2HA 2XVGA 3K2UL 1CXHA 1E5ZA 4W4NA 3KLAA 5ICXB 4PFEA 1OE2A 2O6FA 4DKEL 3GKWH 4K5MA 3VXSA 3V0FA 1QW8A 2C3GA 1BV8A 4ONGH 2AANA 4PJBF 4PN6A 4LHUA 4MAYC 4H20H 1R3HB 4HH9B 1KTCA 3VXRD 5HE2A 4ZMXA 4Q2ZA 3ZXAC 3GSNH 3IXTA 4PTTA 3GMOB 4F57H 4PW3A 3ARFD 3ZKSD 3WLWD 1QFWM 3IFPB 1AGEB 1VPOH 3EH4B 3PUCA 4K23L 3EGSA 5FCUL 3S96A 4KTEH 4M5SA 3VFUB 1NBVL 2VXSH 3SKMB 5CSZA 3DK2A 4HPHA 1I9RL 2EVHA 1Z5LB 1I3RA 4MZ2A 4YHNB 1SDAB 4FL4C 2VO8A 1IJ9A 1GOFA 4Y89A 5I8EA 4P4RA 1CU4H 1M71B 4FZEH 4TXVB 4I85A 4E9QA 4F2FA 4JGUA 4F8LA 3D4GA 4XN9A 5F7MC 3ZZLA 4MS8D 1F4YL 4OZHB 5F0MB 3Q7JA 2O61A 5DU7A 2YD7A 2WTPA 2FL5B 3HZMB 1IBGH 4WUUB 1MXDA 1MHCB 4OCXH 1L4IA 2Z4QA 3DURA 4IRJA 3N91A 4AYFA 1J5OH 1R3IH 1EEUA 1TZIA 2VXTH 2B39A 2CLRA 5TGBA 1NDMB 2QVMA 2RFXA 4WNQA 2XN9D 3D7PA 4FLHA 1ONQA 1M7XA 3IDYB 3RZCA 2AV7A 1RFDL 3UO1H 2H3XC 2X38A 4NDMA 5F7EL 3V4PB 4M3KB 1I8KB 2MTPA 4HD5A 4MA7L 2H2SD 3CZLA 4DZ8A 3WHXA 2Z93B 4DN4L 4OGYL 2YAFA 4I2XB 4IRSA 4PJ9C 2DQFB 3FOLB 3D0VB 3ZVVA 4HOZA 3LSOB 2QZ5A 2JK5A 3KS0H 3T6WA 2NR6C 3IETA 3MCYA 4UWQB 2DYPB 3LOWA 1I7AA 4OCSL 4UDUB 3IDNB 3L3HB 3SDDD 4ELKA 2VDOH 4HXAH 4GAYA 4NJAH 1CDBA 3BH9A 3QZBA 1BZQK 5E1QA 2CUMA 3POHA 5HBBA 4PJEE 3BX7C 3QXUA 4DETA 4U1HA 5I1IL 3D1MC 2FLRT 3MNWA 3QORA 4ZRGA 2YEQA 3BEWA 3VH8B 3P11H 3Q13A 1OAYL 3T4AA 1C7TA 1F4HA 1QLRA 4QRQB 4CVWA 1ORQB 4KITB 5GRWA 2R2EA 1WIUA 4I8DA 4UQ3A 2J7LA 4JPSA 1GCYA 4IOSA 4W9HC 3E8UL 3SHSA 3B8SA 5I6NA 3OLIA 4G8GE 5KVGH 5LWYH 2Q3XA 4OJFL 2WD0A 3HNVH 4MCZA 2H6PB 4F15C 1LQBC 3GIVB 4RRPA 1E2ZA 4MYPA 3GMPA 1WAAE 4R7NA 5KN5B 1CF8H 1QABA 2RMNA 2Z3FA 5DI8B 4JGNA 2KR0A 4XMKH 3TO4D 4D7BA 1RZQA 3ARPA 1KGCE 5IZ7A 1UKTA 3FZUC 4FFYH 1KFGA 5PAZA 3PQYA 1W72B 1FL5B 3CSBA 5BOZG 3AACA 1PG7H 3BUPA 1JNLH 1Y1DA 3K6FA 2HG5B 1HXMA 4PG2A 3MUGA 3L1FA 3OKDA 4RGMC 5DS8B 1TJIL 1X9QA 3U6XA 3ULUF 3QUZD 4HCRA 1GMIA 4ESKA 4N85A 3TYGL 2Y7OA 5D1XE 4E68A 4PY8I 1TTGA 4KGJA 1IB5A 1T1WB 3D8MA 2GITA 2HRLA 3EBIA 4FLSA 3PWUA 4TSCL 4W9IC 1V27A 4RMVA 3UAJC 4Z3HA 1FLRL 3QIUA 2DLIA 3HLKA 5D7IE 5INDB 4TL4A 2AJUL 4TUOB 1QLFB 1KJVA 4XHJC 5T3ZL 1CZ8L 4L9LB 3GLAA 4FFTA 1BFTA 4TSAL 3F83A 4FA7B 2HJFA 4PS7A 4M5YL 3DV6A 2MPAH 3AAZB 3KMDA 1SHSA 2NYYD 3CDCA 4G72B 4YNYB 4HBCL 1I3UA 3BXNA 2KL6A 4KK8D 3WG7B 4RZKA 1EGJA 3FTZA 1E50A 5F3HA 2QADB 4Z7UE 1P7HL 5B7FA 1WCBA 3SPIA 2D4FA 1QYGH 4ZMYA 2VDRB 3NVQA 4ZS7H 2EC1A 2BHYA 3B9KD 1AAJA 4PRHA 5FCSH 3K71A 3MRHB 3RTQB 1T0OA 3GBEA 3FTUA 2XTJB 4FQHB 4D3CL 3O45B 4KKBC 2M1KA 1EO7A 1QBMH 3G9VA 3RA7H 1X5IA 5ESVA 1U8CA 2Z35A 4DZBB 1TO5A 3EO9L 5JORB 2P0HA 2NNCA 4G70B 2F1AA 3CFBB 2WPGA 2HLFD 1GGTA 4C55A 3LN4B 3W5NA 3ARGD 1BJ1H 4U49A 3IDMA 4P5MA 1Z9NA 3ZE0F 3FO2B 3U30C 5L0QB 3NSFA 3KRWA 3LH2H 1KELL 2B7DT 4LSQH 4HDIA 5HVHB 1MG3C 4CADB 4J3SA 1OWWA 3W38A 4GW4B 4HDQA 4XAKD 4WI0A 4H25B 1ET5A 2F53A 2L7EA 3RGVD 7PCYA 2BXYA 1ZWIA 2QFRA 4KI1A 2R39A 4KQ3H 1JK9B 2Y25A 4PBXA 4E0RB 5BOJA 3Q48A 4WI8A 3UTQB 4Q14A 5IHUH 1WUZA 1Z3RA 1JF5A 2FZ3A 3MLPA 3ARDA 4WFED 3MDJA 4NFBA 4EQ2A 5FFLA 1OAUL 2Q0ZX 4MCYA 3N40P 2WSPA 3O0RL 4IBVA 3QI9B 4IRZH 3IMVA 3ZT5A 4W68A 5AVYB 3KCPA 3NDZE 3HRZC 1EJFA 3HHMA 1TQCB 5E5MB 3ULVL 1T2QH 4U6VH 1PKQA 4NQCD 2WLJA 3VWKD 1IV8A 2VDQL 1CD1A 2AAVA 4P5TC 2DD8H 3LNFA 4WI9A 5C7ZA 2KCJA 1DEEA 3QS2A 3I6KA 3DMMB 3UBGA 4WI7A 4G7QB 1B4JL 3ZPDA 1T5WB 4M48H 2WSKA 2B2XH 1TO4A 2APXA 2H32H 4GKZA 4NC2B 3VGHA 1VIWA 1OCZB 4GO9A 1ZT4B 4K8RC 1XX0A 3FFCD 5ELIA 4LEOB 4IBUA 2QKIA 4UDTA 4V2CB 2H2PD 5D6DC 2CQVA 1I8IA 2MCAA 4AOFA 3BP7B 1UNPA 1DLHB 4JZJA 3PCYA 3H42H 2P7TA 3SYCA 5FF6A 4KV5F 1P7BA 5E00A 2VR3A 3QUKA 5FGBC 3HC0B 4LLYB 4D9QE 4HMDA 3X1EA 4DIXA 3UZVA 4AZ8A 4MDJA 1F18A 1KTRL 4P8QA 4K5LA 2D31A 1HC1A 4I0PC 4IMKA 5I76A 5FYLE 4GMXB 4NAMA 3FVCA 1V10A 4XCCL 4ZW5A 1NTYA 1IQWL 3FT3B 2Z6FA 3RVWD 4Y4FD 1H8LA 2PYEB 3PF2A 4PY7A 2F74B 5LXGL 5IVZB 2EDWA 2ETWA 3D3VE 1THCA 4OF6A 3UIZA 1HSAB 1P84J 4B5EA 1JERA 3GS4A 3UTTA 1CBJA 2DL9A 5D7JC 4XPAH 5IW1A 4JVUA 2ZCHH 3UP6A 3UACA 4AQEB 3ESPA 3IDJB 3SQOL 2N7AA 2Y1AA 1GHFH 2EVJA 3PVLA 3Q0HA 5HDBE 5GGUB 3MO1B 3QUMB 4M29A 1AC6A 1I7RB 2R09A 2AXHA 2DW5A 3L45A 3O8XC 2VSMB 4GRWH 4HULB 2EEXA 1P7QA 5T3ZD 5IQLA 5IQ9B 3D8DA 5KAQF 1NBYA 2D0GA 5AUMB 3W0WA 3RWIA 4YUEL 4WUKL 4MVBD 4FQ2H 3OLGA 4GQPH 4TUUA 4X98A 1J1PL 1XO8A 1GH7A 1A6ZB 4NBXB 1IVTA 2CDGB 2DIEA 5DD6A 5A2LH 3SOBH 5DSCB 1ASPA 2EVIA 3LRSA 3S5LA 1FIEA 1MK7B 3HJ0A 1UFGA 2Z9TA 1MI5D 2GJ6B 1J0KA 4P2RB 5ETUB 4MJIE 4YXLH 4FKEA 4BDVB 2GI0A 4OKVB 2UZYB 1ZEAL 5EV7A 4BUQA 1QNZH 3FOMA 5TDPA 5MEPB 1F86A 2GJYA 2AEWA 1W1GA 4XXCC 4WEEA 1U5DA 5LCVH 4NXKA 3IJYB 5CLWA 5LQBH 2DAVA 4KTDL 5HI5D 2V8MA 4A39A 4LP8A 1T03L 2A77H 3AMLA 4Z3FA 1MHEB 1MCJA 5J3HC 4I5BB 1HSBB 1A7NH 3NZ8A 5I26A 4YSQA 4AKOA 1JWSA 3CMGA 4DUXA 3QIWA 1U8HB 2FEEL 3GBLA 4LCIL 5HGDA 4NCC1 3M1BB 3HZKB 2DEXX 2F8IA 4JDEA 5KOMC 3P4OA 2ED7A 1H6FA 3K5RA 3E6HA 3EH3B 1DBAH 3OSVA 4NOBA 5I1GL 4RDQG 3G5YA 2E46A 4P2OD 3IDXL 2Q87A 1KJ3L 4IOIB 1WZAA 4RIRB 3HMWL 1XBRA 4XH2B 1T2XA 5L9DH 2FH6A 3QCTL 4TRPH 5EIQA 1CGSL 2G60H 4W1TA 2A9NL 3C5ZB 3HN3A 3V5WA 4IDJL 2HFTA 4JX0A 5J13B 2KZKA 4XAWL 4GIAA 4OLEA 4QLRA 2ENQA 2O5NA 5DRWB 4FNUA 3O4LB 4JFEB 5E08H 3FT4A 2QVIA 2VT0A 1WBYA 1BEXA 3CHSA 3NN8B 4OD2B 4HATB 4DVRH 1OSPH 2OSYA 3TS8A 3QG6A 1NGQH 4JPVL 1AOZA 2WKGA 2XZCH 2YD5A 4RISH 3EOTL 4XO3A 2B5IB 1KJMB 2Y5EA 3OZ9L 3JWNH 1E8WA 4JKMA 5E6IA 1K6QL 3CPUA 4YEFA 1TZ8A 3FFOA 4ODSL 3T8XB 4PWGA 2ODIA 4OCMC 1CLZH 2CE6A 3GNMH 3V7AE 4N2IA 3FC8A 1FYTA 1IVLA 4ZYKA 3VFUA 2DI9A 1N8ZA 3H7LA 1G6VK 1GPOH 4ZW8A 4EIUA 4OLZL 3CH1B 4O2FA 1RK0B 2VNCA 4X5QA 1GJIA 2IF7A 2H1PH 3C87A 3BOVA 3C9NA 4ACTA 1E4XI 5T3XE 3AG2B 1UM5L 2WYIA 5FW8A 2HA1A 3LPGA 3D69A 4HG4K 1MCPL 1KTDA 2E59A 4OUOA 4PJGE 4N2KA 2Z7UA 2I60L 2EDMA 3LRKA 3MV7D 4QOKB 2HTKC 3MU3A 2EE3A 2GUOB 3KPNB 3NJIA 3RWCA 2VE6A 3QDMD 1CTOA 1ETA1 2V3DA 3F6IA 1INDL 3ZTCC 3U12A 4XMXA 1DQJB 2IFFH 5JOFA 4Z2MB 3PY9A 4TVUA 4ZOCA 1WO2A 1AG0A 5TE6L 4CU8A 1U93A 3ASOB 5HJDA 2IPUG 5JYLA 1QZ1A 3RDJA 4GSUA