4DIXA

Crystal structure of the ig-ph domain of actin-binding protein scab1
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
212
structure length
212
Chain Sequence
LVYEIDGTEALGSCLRVRPCSNDAPDLSKCTIQWYRSSSDGSKKELISGATKSVYAPEPFDVGRVLHADIIYDGHSLSLSTVGKIDPAAGLGSYVEALVRKHDVDFNVVVTQMSGEDHTSESIHLFHVGKMRIKLCKGKTVIAKEYYSSAMQLCGVRGGGNAAAQALYWQAKKGVSFVIAFESERERNAAIMLARRFACDCNVTLAGPEDRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Plant actin-binding protein SCAB1 is dimeric actin cross-linker with atypical pleckstrin homology domain
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Protein binding
molecule keywords Plectin-related protein
total genus 58
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16709 SCAB-Ig Ig domain of plant-specific actin-binding protein
A PF17684 SCAB-PH PH domain of plant-specific actin-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.140 Mainly Beta Roll PH-domain like PH-domain like 4dixA02
2.60.40.2700 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4dixA01
4DIXA
chains in the Genus database with same CATH superfamily
3QSKB 1CU4L 1JZGA 1ITCA 2GI0A 4AQ1B 4EI5B 4PG2A 1EQWA 2AMGA 4FQXA 4A04A 4XOCA 3V9CA 5C0EA 3PQYD 3MRFB 5MHSE 4NI6A 4JG1L 4ZX6A 1CDJA 1MAJA 2DQUH 3LQAC 2VLJE 4KITB 1IBDA 2DWTA 1I7UA 1OD7A 4RWYH 3MRBA 2Z14A 1MFDL 1T5XA 1XWVA 1A7PH 1YO4A 2HPOA 4XODA 3MMEB 3RTQB 2CO7A 3SE9H 1RZGA 4UU9A 5CIPA 3BSGA 1NBZA 3EYOA 4M56A 4D7PA 2WW8A 3QWRA 2GJJA 3BVVA 3PFQA 2VWEE 2RLOA 1FLRH 1XB8A 3FYIB 4N6QA 4PTTB 1B3IA 3ZN6A 3P02A 4HQQH 1CLZL 4XC1H 3EGDB 1ZT7B 3CVCA 3KLAB 3C5SA 3WFDL 4TF4A 4XAKE 1EO5A 4FNUA 1U2YA 1BF2A 4X99A 5C09B 4HS3B 4F8TA 5I74C 3CZFB 5A2IH 4HEME 2LQRA 3BH9B 2JE8A 2JKWA 1R5IB 2QZ5A 4PRHB 5HVFB 2JFCA 3LN5B 4HKXA 4X5XA 5DGQA 3U4BL 2NY3B 2B39A 4LEOA 1V5PA 3TEZA 2EUVA 1KN2H 2WXIA 3NJFA 3T0EB 1UM5H 1RZQA 2AJYL 3VXUA 2ZNWA 4AL8C 2V5MA 2L7JA 3EJSA 4R5TA 3AAZB 3O2VL 3KPOB 3C6LC 3O0RH 1JK9A 1KIPA 1NEUA 3KJ4B 3KVPA 2YLHA 3MOBH 4ZUTA 2OZNA 1Z32X 3FOLA 3HCVA 3TA3B 1CI5A 3ZYIA 2HWZL 4PY7B 3HBQA 5HDQH 5T3XE 3AG4B 1BAWA 1DVFD 4OJFH 2E3VA 3ALWA 2D0FA 5GRWA 4WV1A 4XNMA 3WDHA 2VZ1A 3S7GA 5J0BA 4R8WH 3GBLA 1D9KC 4K8RH 4MS8D 3KY9A 4KWUA 1U27A 3U0PB 4OV5B 1X7QA 3HPLB 3QUZC 3QDJD 4NKMA 4U0RB 3DURB 4KTGA 5KBMA 3WAKA 4HWBA 3FK3A 5IVXE 4JFDD 3MV8E 3TWYA 1N0LA 2I7OA 3DYMA 2IH9A 2X1QA 2ZWZA 3J7HA 3JV6B 3NWDA 5HPMB 3EXLA 3DHPA 1M57B 4OCSH 3ZSTA 2X1WL 1K4DA 3GEWB 2YD8A 2QQLH 2P8LB 3PABA 4NO3A 4LLWB 1IGIL 1XH2A 3GSOB 1U3HC 3RUGE 2HJKA 3SV1A 1Z87A 3HS8A 4KJYB 4KQ4H 4MCYB 2LG1A 2DQCL 1UT1A 3KGSA 4NM4H 4F7MB 4R4ND 2NY2B 1A3ZA 4JFYB 4POUB 1MFEL 4Y9EA 4Y9CA 1INQA 4FQLL 1P4LA 1EEZB 5I1HL 3UJTH 3DXAD 3L3JA 5F6HI 3D48R 3LB6D 2VLRD 4QWWD 5D70H 3RL1B 4Z78A 2GCYB 1X5KA 2X5PA 3A4FA 3BJLA 3CH1B 4PJGB 2ZUTA 4F93B 3U1SH 3II2A 3B5GA 3VIAA 4JFFB 3M17A 3OGCB 3BQUB 5ENWB 3BYYA 2C9AA 2PCYA 4WK0B 2CG9X 2R23A 2N0MA 3TFKC 3SQBB 2EYTB 4LRIC 4MCZA 5KQ4A 4NKDA 4FG2A 3O41A 1ODAA 4YWGL 3WJMB 1KYOK 2BO0A 4N9GB 2GC7C 1XIWD 4GRLA 2WYZA 5DHVB 1J0WA 1DBML 2AK4B 4YVUA 1BFVH 3R7QA 1TTCA 1VEPA 2HLEB 2AXFA 4PB9H 4JANB 4LEBA 5E7FA 3UFIA 1KDIA 1F41A 1G9ML 4W4OC 4HJIA 2VLRE 3MFFB 5HE1A 3NCJH 3IFLL 4FZ8L 4NQCA 4EKUA 3CHPA 5D7JD 4ZSOE 4M8QA 1ESOA 1JMXA 3AXHA 3G04B 4L48A 2BSSB 2V5SA 1IU1A 5EBLB 3OKOB 3BUYA 4NS0A 3S4SA 1CICA 3VXRE 4MD4B 1Z6JT 3LKOB 1OAKL 4KKQA 5SX5H 3PU7A 1HI6A 2R39A 3BC9A 4FQQB 3QDMB 5EFXA 3S37L 4Q52A 4LKXA 2ZYIA 2Q76B 3CE1A 1FVDA 5C6TH 2W80C 1M3JA 4OJEH 1QFWI 3ZIMA 4X4XA 1GGTA 4BZ1H 3UPAA 3VXQB 3CHRA 1EJOH 1IGMH 2DF3A 2AQ1A 1C1EH 1LO3H 5GSVB 5FDYA 2UUDK 3X11B 4IOYX 4P2OA 5KVGE 3CXHK 5E6YA 5CCKL 2NNAA 1UOLA 2A74C 5H37H 3RWHA 3LQZA 4K7PY 5DWUH 1T7XA 1EO7A 3BSZL 4PP2A 4X0KB 3TJHC 1FHXA 3ZTEA 1GIGL 1Z66A 3RL2B 1WTLA 5I8OL 3ML4A 4WWKC 2VUYA 2XZAL 3Q48A 3L4TA 3WNOA 4WI9A 1WC7B 2ICWB 1EO8H 4C56B 1MHCB 1QSZA 2DBLH 2J21A 1A9VA 1HHJB 3LIZA 5KBPA 3CX2A 1OE3A 4C58B 4MX7A 2XFXB 4KHTH 2DYPD 4M3KB 3HC3L 3OKDB 2LTQC 1S7TB 1B55A 5E4EC 5E9DA 1PZBA 3T0BA 4UOZA 5KN5B 5LGHL 4KROD 4GQ9L 4JPKH 3CDZB 1BF5A 2A83A 3X14B 3SPCA 4MQ7B 1SBSH 2X7LB 3BP6B 5BOJA 3WKML 1CYGA 1YQVH 1CO1A 1PNCA 2F58L 5FUZH 1W0VA 3KGRA 4LP4A 1SYVB 2QZQA 5CLLB 4NJAL 5AAPA 2PXYC 4C57C 1GZQA 2F68X 1BHGA 3KD4A 3D1MC 2XDHA 5KYNA 5M94B 1GGBH 4DGUA 3VWJB 1E5CA 4B9KC 4KROC 1QI4A 5TQ0H 4TVPH 1O75A 3KMDA 3D2UA 5AW3B 4CW1B 5ID0B 4TKWA 1UVQB 3PG2A 3RGVD 1E5AA 3OC5A 5EHFA 5KVMC 3QORD 3OD3A 5DS8A 1CFTB 3BP4B 4RRPM 1AJ7L 2ZICA 5I1IL 2ATPB 1XCQB 1VGKB 1N68A 4U1JB 3K6SB 4NDMA 4G1EB 1M3IA 4DEWA 1J12A 5IEKA 5GS1C 1E0OB 4POZD 3WKNA 2R69A 1XGTB 4PJEA 4DN4H 4AQ1A 3H42H 4G7RB 5D70L 3QUKA 1PAZA 3QI9D 4HIQA 3ML9A 2GSGB 1H9DA 5BW7A 3CNKA 3ZTCC 5K9KB 4IEFB 1TLMA 4U1GC 3S36H 3ULVL 3RG1C 1JYWA 1ZA6B 4BFBD 4GAGH 3HSAA 4MAYA 1N64L 2G5BA 4N0CD 2ZF9A 4MDRA 4J4PA 3ESVF 3H85A 3BO8A 3HBGA 3MRKA 3NVQA 4JM2D 3BVNA 2N01B 5AVXB 3CFIC 1ZLSH 2AEPH 1QKZH 3LKNA 3IETA 3BH9A 3OHMB 4AYID 2X3AA 5EOTB 2PPEA 4ODXB 1UC6A 2C9XA 2LLNA 3NZSA 2NQCA 1Q1JH 2V9QA 3C5SB 4HIJA 2ITCB 5MI0B 2V2WB 4NHCH 4QRUB 3U6RB 2NDGA 2QR0B 1U8NB 1INDH 1NCCL 2CD0A 1CT8B 2MPAH 1R3LA 5AKVA 2WYIA 2N7SA 3STLB 1TENA 4YDIH 4H26B 4IU2B 4PCYA 1IILE 4X5RA 4OLZH 1CUOA 4OGXH 1BQUA 3E3QE 2B59B 1TKWB 4V2BA 5BVJA 4HKBB 3QG7H 5GGQH 2ZF8A 1XTMA 1WI1A 5D7KD 5DJ2B 5FA3A 5HVGB 2W81C 3DTXA 2L7UA 1JD7A 1CDUA 5DMIL 1NA8A 4F2MA 2WLJA 4R3SA 5B39A 1PZ2A 4N3UA 4HP5A 1MFVA 4X6DA 4R7XA 4UM9D 1F8TL 4NY0A 1CD8A 1HAWA 2OXGB 4A7SA 4CDGC 3C60B 4YONA 4E5XG 5A7BA 4G6MH 4ONHA 5H4YA 5EU5A 4P4KB 2YOAA 1XT5A 2P8LA 4WGWB 1A3QA 1QO3A 1FB8A 1FVEB 4I0KA 1IEBA 2HJFA 1N12A 4I88A 3WIFA 5JPMA 3ZR6A 5B8CB 4EUPB 1HL5A 1DJYA 1FNSH 5KZCB 4DGWC 1EHLL 3U9PH 4XHJC 4Q9QL 4X9BA 1IQDA 1W1HA 2AP2A 3UAJD 1UQSB 2EINB 2H2PC 4AITA 4JKMA 2DWEB 5HYSG 1F5WA 3ZT5A 1X3DA 1OCRB 1UCTA 2EDXA 3HKZA 4GMVA 4NQVA 5AD0B 3K5RA 4FADA 3QFGA 5DJDA 4HJEA 3SO3B 1NAMH 2AF2A 4KI5D 4ZK8A 1FG2A 4U3CA 2ZD0A 1AD0B 1FZKB 3WJMA 2VNCA 4WVRA 2ODIA 1HL9A 5CD3B 4XBPB 2J59M 2VJ0A 4MT7A 1IGIH 2CUIA 2IOMA 2F1EA 3BN3B 3P2BA 1W8OA 2VDQB 1GGCL 2ZSWA 3CZGA 5JP4A 1RMFH 3RWJA 5CNHA 3U4AA 4XBMA 3MGOA 4J12A 5EZOL 5I71C 4BYHA 3MPXA 1KXTA 3WHE1 2CCWA 2OFQA 4OIBA 3QDJA 3REWB 1HKLH 3TXAA 3ZMEA 1UNPA 4YBLC 2HP4A 3K91A 4GFTB 4LCWB 4XN1A 4ZTPH 3KAAA 2H7WA 1CICB 1UKTA 2VR7A 4JREB 1H3PL 1NCDL 1A1MB 3K2MC 2BNRB 3RWEB 3EO9L 4MBRA 5EA0L 1EJ8A 1DVZA 2Q86B 4AEFA 4M4RB 2Z91A 2JVUA 1MOEA 4U1HA 2CAKA 2WTOA 3WNKA 3HTLX 2JKXA 3OKOA 4HH8A 3S4SB 1G7IA 4XMXA 3TYGH 1OWRM 2EC1A 3CGTA 4K3JH 3DI2B 1YNKL 3NFPA 1V61A 2AJYH 3MR9B 3OKNB 2DQFB 4RMWA 4KVCL 4PJDE 4X4XB 3TEUA 5A2FA 2X2YA 4JRXD 2EIZB 2W07A 2I26N 3QHFL 1OW0C 2R0KL 2WWOA 2K1MA 3HG3A 3QH3B 5EZPA 4J3OG 2HT3C 3NJHA 1IO4C 5H35A 4BFOA 1N3NB 1AI1L 1WT5A 4NQTA 2DQTL 3TVMD 3HE7D 5I5RA 3RVXD 4PJBF 1NGWB 1AR2A 4M7JL 4KBPA 2VYRE 3TA3D 1MQKL 2MCPL 5BS0B 4JO3H 1JI2A 2Y2WA 3VG9B 1RHHA 3SDYH 2YC1B 4PGJA 5JIMA 5CSZB 1F13A 3NIGF 3MCKA 4ZYKA 5IQ7H 4XOAA 4PJ8D 3NBNA 1FHWA 4TUKL 4WJG3 2JMRA 2XG5B 4YHIB 1WA2X 3CC5A 2I5FA 4FI8A 2NMSA 5CEYA 4EN2A 4R2GB 1RK0A 2ZWLT 1A4KA 4MVBC 5A3IC 2F58H 5FUZL 4LLQB 2I9LA 2X6VA 8PAZA 5FK9B 3VFGL 1E6OH 1BZEA 1VF5C 3KPQA 2BSCA 4H20L 1U8IA 3TCLB 2APBA 5EU4A 5F7MC 5GJSH 4KKLC 3CXHJ 5FUCC 5CU9A 4IFSA 3BKJH 5FI1A 1QLRA 3GJFB 4PRHA 2FJUB 4N2NA 3NJVA 4YDJA 5F1SA 3OSKA 3V52H 3B34A 4Y2NA 5ISZB 4HWBH 5DJ6A 3BAEH 5MEQB 2PP9A 5ID1B 4H2CA 4KKLD 1RUAL 5FV1L 1KZQA 1RJZA 1V7ML 1YDPB 1RJYB 3EOTH 1TNMA 4OCYH 2WN2A 1ADQA 3BAEL 4F3FA 5KS9B 3VH8G 1R3IL 3GUFA 2Y07H 4L1BA 5GRZA 4JFOA 4LBAA 3IVKB 4JCMA 5HI4D 3A67L 3BUPA 3H3PH 5CLXA 1DVTA 2NUTA 2KYIA 4DK3A 5E8PB 2HMIC 3HE6C 4Z7WB 1GH7A 1D5BB 2Y4SA 3MGTA 5IMKB 5A16A 4Y5YC 3VJ6A 3US1A 1LP9A 1Z3GL 4X50A 1K3IA 2IDFA 2P0HA 4JM2F 2ZOTA 4FZ8H 4IBQA 4OKVA 1EJ6A 3IXTB 3LKRA 6CGTA 4KQ4L 4K9JA 1A7PL 2P24B 3PHQB 2PUQT 5IIEA 4IMKC 4PJXB 1QQDB 4NC1C 3MSPA 4FYSA 5TDNB 1L0XA 3RZWA 2XV6B 2Z4TA 5GGSA 2EIKB 3WO3B 3IAGC 3FB8B 1JNNL 3MNDA 1IGYA 1XR8B 3TA4D 1EHNA 2UYLB 4G9FD 1P4LB 2K4WA 2H8PA 4XPGL 5HJ3A 2E9WA 4PQ0A 4EDXA 5I66B 4MAUH 3EW3B 4P4RB 3QJXA 3QP3A 4HIJB 4EEEA 1FH5H 4DQOL 3HBZA 4OT1L 3VXMB 3QEGL 3ME0B 3SOBL 3GUTA 3CK0H 1N8ZA 3LKNB 1R3LB 5T3XH 4OFYD 1J0YA 1XF3B 5FUOL 2COVD 2X6MA 4KU1A 3WEMA 4YWGH 4HG4J 4MMXC 3R0MA 1IZJA 5C08D 1PFOA 2NX5B 2W0FA 5GPRA 5FECB 3UJTL 1AGDB 3IXAA 2UX6A 2IMNA 2WZ5A 3QIUC 4XPBH 5EU3A 1PS3A 2TSBA 3JVGC 4P23C 3O2VH 3STLA 3UC0L 5B3JF 3SNHA 2IG2L 1YRKA 2C9RA 2HXAA 3LQAL 5HHNB 4ELDA 3RVTD 1PKQE 5B39B 3BISA 2OW6A 3GF8A 5MENA 3O11B 5E2WL 4U49A 1XFPA 1QBLH 3JWDH 4AMKL 5J06A 2E4FA 1P5VA 1WIUA 3OX8B 3CLFH 2W60A 4OD3L 3VRJB 2LAAA 4AY0A 5D1ZC 2D9WA 5KQ1A 3GHBL 3MBEC 2QVIA 4QMEA 5DS1A 5D72L 1PFJA 3WLWD 4BZ2L 1MCSA 3BGMA 5BQ7A 4EZMA 3WIFB 2Y69B 4AV0A 1MCLA 3SPVA 1Z2KA 4QKTA 1SJEB 2VDMH 5INCB 5KW9H 3FN9A 4P4KA 5KVDH 3MZTA 3O8XC 1KBKA 4W9FC 4RZKA 1DTUA 5FM5M 5GRUH 1JGLH 4AVIA 3NCJL 1A7OL 4PJCB 4OD1H 4JJHA 4MA8H 4PJEF 1AVAA 2TRYA 2QFRA 3X13B 5DFWH 1MCBA 1HX0A 4AYDC 2R51A 3AT0A 3QCVL 1ZLUK 3G3LA 3LRSA 2EJ1A 1I1AC 1ZGLP 2G35A 3GYRA 3IJEA 3U7YL 4I7ZC 3BPNB 2P80D 1CURA 1NSNL 4UUJA 1BJ1H 3GS7A 4JQIA 3GIZL 4LVNB 1JZ3A 4OLUH 3TVMA 1RIUL 4R4NC 2O5XH 1HYSD 2YMTA 2X88A 4K9EH 1MJJB 4FFVD 1MHEA 4I77L 3VFWB 4MA3B 1GPOL 3O96A 1XF4B 3HMWH 4GSQA 4HOZA 3CIKA 4L2LA 3VXRD 1FIGH 1G9MC 5DFTA 5DEGB 1DN0B 1WZKA 3ZO9A 3U6XA 2GS0A 5IR1A 2C3HA 4KXCA 1AHMA 4CC4C 3P3YA 4K3HA 1UWXK 2X2UA 4EI5D 2FVNA 3S3DB 4JFEB 4XBGA 4KI5E 3PWPD 4BH8B 3VMOA 3UTZB 2ZWKA 4XC3H 4Y5XA 3FQ1A 1A0QL 3WY2A 4QHNA 4XCEA 5EEUA 2O26U 1LB1A 5B1KA 2IH8A 1QASA 3NK3A 4N0UB 5B39G 5DVLA 1CLVA 1XR9A 1SXAA 2FZ3B 2FSEB 3FT3A 3NA9H 4HMCA 4PY8I 4NX0A 1NBVH 2HRLA 3MLZL 3VFMA 4LL9A 1E2VA 5TF1L 3LTVA 3HAEA 4PRPD 2OTPA 4Y19E 1J10A 4YE4L 3G9AB 1JPFA 3UBXG 4XNZB 1PNDA 2OL3A 2QGEA 4PBXA 1IM3B 1QRND 4X6CE 1LD9A 1M6OB 2VO5A 4JHAH 4CVWA 2P49B 4OCMC 1C5DB 4MJIA 1BP3B 2Z91B 4GP4B 4PS3A 4U1HB 4QGTA 2P52A 1A4JB 2C7UB 4NZUH 2DWYA 3P73A 4P46D 3LH2L 5E0FA 5EU7E 2X3CA 1AO7D 5BMFL 4F2EA 4DX90 4YHOL 3INUL 4N1EA 4NDMB 2I24N 4P3CH 2I7SA 1HZHH 1SY6A 3KYNB 4YGAB 1KB5H 2L0DA 2CM5A 2DZEA 3LEVL 4MRCA 3NEOA 3SPHA 3E6FB 3ZDYB 4BSJA 1NDMB 1BM3L 2W94A 4U1IA 5KBLA 2G3MA 2NY7H 4XN5A 4O4YH 3PIQA 4R7LA 2VB5A 2V7HB 3C6LD 3V7AE 5E6IC 1WGUA 3NZ8B 4ZUVB 2X0VA 4UWQB 5FKAA 4TQPA 1UWYA 5KJRH 4LSQH 1V7NH 5BS0A 4PJHA 4BK8A 3HUJE 1TCMA 3GGWA 3FH5A 3RNKA 3QUGA 1K8IB 4PIBA 1NLDH 2X44D 5EN2B 4LLQA 4MZRA 5KYWA 4EPSA 1MN4A 4OGAD 5KTEH 4MS8C 2Y7OA 1U8IB 4FZEH 4AENB 4JM4H 4WJ7A 2DKSA 4ZOEA 2G30A 2FLMA 1NANH 3F7RA 1EV2E 4UTBH 4XB8A 1T80A 5IJVB 3RTQA 2IVFC 1JXGA 4WI5A 1WE5A 1DQLH 4BFFA 1LVEA 3ZTDC 3MLZH 1JPEA 4XCNB 1ZLEA 2VLJB 4BA0A 1MNUH 2DI9A 2NY5L 2BIQA 1G9MH 3S9DB 1YMME 4NYLA 1X5IA 3CUPB 3KCWA 3QO0A 3HHSB 4FG0A 4HHWA 5ISZA 4X9YA 2XZQL 1KWGA 4ZS7H 3CZFA 4F7TB 1L9PA 4Z7VB 1P84J 5FV2A 1HIML 2VLRB 1JV2B 4XO8A 2XWRA 1WZ1L 3C5ZA 4S0SD 1M71A 3ULUD 3QHTC 1ZT1B 2Z34A 3QJVB 3UBXB 4PYGA 3ZE1B 5IF0B 1CFMA 3CVDA 4PJBA 3QCTH 1WAAA 5ESVB 3QIUA 4G80A 3GZKA 5FF6B 5E8PA 2XKSA 1OAUL 4F15B 4XMPL 4UQIM 2OZ4H 3PJNA 4JKPL 4JVUA 5CLZA 4F33B 2VKXA 4PN6A 2G0KA 2SEBB 2VUKA 3L95B 3MJGX 3S3BB 1YEGH 2DDQH 5CM1A 5I30H 5E08H 3HZMA 4MVBD 3DX7B 1CJYA 4OKVB 4AH2A 1TJGH 4PI0A 5FHBL 4EN3B 1JGDA 1IC7L 4OQ1A 5LGYA 5JYLA 6TAAA 1MKEA 3NUKA 4OZHB 3VNZA 3MRGB 3EHBD 2A5UA 4BWUA 4A2DA 5AWNH 4QHMB 4OZGB 5T1KB 5IHUL 4JFPA 3T2NL 1IBGL 5F3HB 4DP4X 5E4IA 3CMGA 1UADC 1PKQA 2UXFA 3FJTA 2DW5A 3G6AA 1NGZB 3HLAA 5AOJA 3TH3T 4AGPA 3GSXB 4HK0B 1KPVB 4B6ZA 3GSOA 4OVVA 4Y7MA 4YUEH 3SE4C 2KERA 4YLCA 5JLJB 3VGGA 3DOSA 3HR5A 3TTSA 1S7VB 2EDEA 4JFYA 5HPOA 1J8SA 5FPIA 3DK0A 2X9XA 3LSOB 3QIWD 1M2VB 4KFZC 3K71A 4XB3A 1KTRL 3HBPA 5DD1L 7FABL 2MPAL 2H45A 4KKNA 2G2RB 5KVGL 5F8QC 4ZPVB 2PXYA 4KKAC 1M7IA 1OM3H 5I9QC 2HB0A 4NENA 5BXFA 3B9EA 4BHUI 2WXPA 3L4YA 4N90D 1RZ7L 1J0KA 3LNDA 4KC3B 2HVJB 3SGDI 1DVSA 3ZE2E 1E5BA 4HSIA 4RGNC 3VXSE 3QIWC 4YVNA 2OMZA 3F7PC 3ZBMA 1O9WA 1C9SA 2E7LC 1AXTH 2Q5BA 4NUQA 4YSSA 4I4WA 5IESH 5B4MC 1HHKA 2IGFL 3ZMNA 4PJGE 3BFOA 4KRMB 4YMPA 1XB3A 2C7FA 3RPKA 2A9NH 2UWEA 4OLWH 4Z3JA 4UU9B 5CIPB 2WXMA 4D6WA 7PCYA 3VRIA 2Z31D 4XC1L 2B15A 1B4TA 5LG6A 1E2WA 4G8GD 1ZJAA 5IVNA 2NBVA 3DPDA 1LXMA 1SQMA 1NPNA 2E8ZA 2FHBA 2EVIA 5DUMH 5KUMA 3UMTA 1YEDA 4P2OC 1TJMA 4HLJA 5D2NE 2YBGA 4G1MB 2APWA 2FCBA 4M1DL 3WEXB 3D4CA 4NKIH 2R29A 1OCWL 1Q0XL 2AJSL 3LS5L 3SDAD 4UAOB 2Y3NA 3V8CA 5F0JB 3OHXA 4UF7C 3N43F 4RZCB 1URLA 2K2JA 1W15A 1ZT4A 1KYUA 3ZUCA 1MHEB 4MQSB 1CE1L 1DBKH 2IIJA 1PZDA 5FW8A 2QQQA 2E74C 4QRBA 4P2OD 1MREH 1RHHB 1GGBL 4NZJA 2H6PA 4ZUSB 3ZL4H 2O61A 1LK2B 4X6CB 1G6RB 1OM3L 1E27B 2DQDH 3X3FL 4QR7A 4XAKD 5KAQG 3ESOA 4BH8A 4WV1B 4GAYA 2GT9B 4KKPA 5IR1B 1NCCH 4JAMB 4FQCH 5I6XC 3WUWG 2C5DC 5GS3A 4FF9A 1MCEA 4LVOC 4UMGA 5TF1H 3S97C 2YMXH 3SJVA 1DLFH 2IADB 4POZC 4ALAL 4Y5XC 3WLWC 4DK6A 3K8LA 2IYBA 2EACA 2QJDA 4MQXC 1JVLA 4J27A 1KMGA 3P9MA 4JR9H 4O02B 3M8OL 5E6RB 3K2UL 5MP6H 2GKIA 4QUOA 2Z3FA 1SY6L 4U1LB 1WC7A 4QT5A 4C56A 4DKTA 5LXGL 2F53A 2YPKB 3MLPA 1EBPA 1JRHL 1M7DB 1PLGL 3MNMA 5F89A 4HX1A 5GGRA 4MCYA 1QSVA 1V05A 1YEIL 2OULB 4M61A 3VFMB 2R1WA 3BSZH 5DJ8A 2PW2A 1C5DA 4WENB 5D2LE 3KNBA 2WBXA 1L9SA 3G5ZB 5BS0E 4L4TB 4DEUA 5K33A 3BP6A 4BINA 1C8QA 1GCFA 1NUNB 5DZVA 3CMOH 1THAA 2IALA 3TL5A 5I1JH 2K00A 1SHXA 2FD6L 3WAJA 3MI6A 2HRPH 2QQNH 4HAFA 2QVMA 3CH1A 3MLWL 1GJIA 1V7NL 3HN3A 4HWUA 3IDYB 3ASWA 4O02L 4BJLA 1ZM0A 1T1ZB 2AI0L 3SZ6A 3FSAA 1MLCA 3UEZA 3QCUL 3L48A 5BZXA 2QDVA 1ES0B 3PWPE 2DYSB 1NWPA 4BK5A 4MCZB 5FX3A 1CLYH 3FCUB 2XZCH 4LDEB 4LLDA 4P3DB 2JI1A 2ATPA 1YQVL 4AT6A 4GAAA 1MLBA 2YPLA 5F7AA 1J9SA 2D4QA 3FO0L 3FEHA 1ONQB 3L2MA 1BZ7A 3P2DA 4NNYB 1DVQA 3SB3A 5I1EL 1FZMB 3WKQA 1F11B 4AIEA 5C0AE 1OF0A 5FYJD 2XQYK 3Q6GL 2HZHA 1RZKL 4C4UA 4XMLH 2FGZA 4MMYA 3V2AR 1VKXA 1SXZA 4M43H 1SMOA 1S9VA 2XOTA 5TJWK 3BHBB 1WAAE 4ZRIA 2X10A 2GJPA 5HYSA 4C59B 4FXGA 3GMMB 3SE8L 1M7RA 3QUZA 1KACB 1YA5A 3QQ3B 5JIHA 4UI2A 4MXWL 4NZFA 4FCHA 3QIWA 4D0DB 1T0OA 1SLUA 5E6UB 4JKLA 2W0FB 5LG1A 3RPIA 2G0LA 4L1HA 1KJ2L 1DE4A 1S7RA 1NTYA 1NIDA 1PF3A 3KM1A 1RUAH 2ZG1A 3BYTA 1TQTA 2Y06H 4MJ6B 4Q9BA 5GZNC 3KCPB 5D1QB 4YSQA 6FABL 3RY6C 1RUKL 4GXFA 3H6AA 1X5LA 3NMEA 3LQZB 2XRAH 3FU5A 1O7SA 2XWZA 4AJ0A 3O3DA 2PP8A 4D7BA 3OX8A 1CXIA 3MPCA 3P77B 5DHMC 1OB1A 3L9EA 4P2YA 4PCSA 2XKNB 3MYZA 4DW2L 1LGVA 2W2XD 3K8KA 3C60C 3RJDA 1CTNA 4Z0XA 3V10A 4R3SB 5IUCA 1GC1H 4D9QE 3ILDA 3GJEB 5LN8A 3DHMA 2VL5B 3T1FB 4G8GA 2V33A 3K80A 4L3EE 1P5UB 3NDZE 2ADIB 1S7TA 5E9DB 3JYBA 1N6UA 3KE0A 4IHOB 1IB5A 1XGRA 3FTYA 3HW2B 2O6FA 2OXHB 2J6EA 2QQLL 4BZYA 4BWWA 4MZ2A 5C0FA 2AABH 4MAYC 1G1YA 2CSPA 1MWAA 3OR7B 2YSSA 5JNYA 4L3AA 3LKSB 3UTQB 3MJ9L 3UXFA 3KZ8A 2KUTA 4OIIL 4DP5X 5IK3A 4I2XE 1IIKA 2B1OA 3VW3H 2J8OA 1F58L 1QLEH 1NCNA 1EFXA 4I0PB 1IFRA 4R5VA 1QBML 1CBVH 2VM9A 4PJGA 4LEXH 5KBNC 2ZUXA 5E94A 4V1DA 2BY2A 4RFNB 1IAKB 4FRWA 1E6JH 1UYWL 3M1IB 4QGYA 1IAIM 2FE0A 1DN0A 4JFXB 4MMZC 3NJJA 4GUOA 2IGLA 1MCQA 5I8EB 1IC5L 1H6TA 4DO6A 4QRPB 1BXXA 1F1DA 3C5ZD 3EYFA 5F6HJ 3SSGA 4OZIE 4LRNL 5GZNA 2NZ1A 3ARDD 1WZLA 2WBJB 4NENB 5IBLD 1OALA 3REVA 5DJZA 5D2NA 5TE6H 2WZPD 5GQBA 1KB9J 3QUKB 3A6BL 5C0IB 2DX1A 2ZKHL 4GZUA 2X09A 3HN8A 1NOLA 1N4XL 3F12A 1IKOP 4HCRH 2E27L 4S2SB 4WEBH 3TVVA 1H19A 1LO0H 3PLYA 4CSZA 4I4WB 1S5IH 3LIZH 4V11A 2BSSA 1EIBA 5FI0A 3RVVD 2UXTA 4PI2A 4XO3A 3HPJA 3DETD 4M6OH 4QRPE 4NJ9L 1ZHLB 5FYKE 5ABDE 1A7BA 3HUJF 5DFVD 1DDWA 5D1ZD 3IU4H 3P3SA 1T5WB 5D9SB 3FRUA 3UYPB 1Z3GH 2EABA 1FRGL 3AU4A 1G7HA 4JFTA 1PZ5A 2GUYA 1CG9B 1HSAB 4K3DL 4UZSA 5LONB 1SN5A 5TE4H 2XI9A 5K69A 4S1DC 5DZOA 3H9SB 5CJ5A 4I85A 3OHXB 3AS1A 2AAVA 4YPJA 2H1LM 1D5XA 3GHEH 4P9HL 3T8MA 3KYNA 2B8OT 3WEXA 2NLJA 3L4ZA 3EJYD 5LCVL 4ZMPA 3E6FA 4HKJB 3KPRB 4N0FA 4HG4K 1UXSB 2Q8BL 2ZOLB 4IGBB 5E4AA 3GSNA 3QUML 2K70A 1YN7A 2NSMA 3ATFA 1AG6A 4HU8A 5J1TC 1JJUA 2BWDA 1WAPA 1XMWA 4GUQA 5CCKH 2B4CC 3HFMH 2FBJH 4KKZA 5G4NA 1EGXA 4EAEA 3V9FA 4MXWH 4BZ2A 2XJKA 1QRNE 3UCRA 4R0LA 3JWDC 5DUML 5E1AA 4LPTA 5KSBE 3DCXA 3S5YA 3T4YA 1ZTMA 4H40A 2UZIH 4ZD3H 3T0XA 1U6AH 2YRLA 1IJNA 5IW1B 4GP8B 3VXUE 4Z7NB 3V52L 1I7TB 4YL9A 1OIOA 3NTCL 3HNTL 3PZDA 5GS0D 1G5GA 1FYTA 1L3WA 2A4EA 2W9LA 3GPSA 2NY5H 3LN9A 5EUOA 3QI9A 1A4KB 4G5ZH 4P06A 3ILEA 4NQUA 1KF9B 2CPCA 4DKAA 2JB6B 1I8UA 3V4LA 2MHAB 3T4AC 5C7XL 3MRQB 5E23A 1KIUB 1G6RH 1HINL 2KR0A 2X2JA 3WFCL 1J5DA 3O9WA 5J3QA 1HXKA 1E7VA 2MOGA 1USQA 3NG5A 4JDVB 4TXVB 5I9QB 3BGFC 2XV3A 3WFHB 2COAA 3A0OA 1OGAE 2B4CL 2WVTA 1NC4A 3DX4A 3GI8H 1VAHA 1BQKA 2APFA 4OZIF 3HI1B 3KNBB 4HYTB 3VXNA 2YT1A 3FQWB 1L4IA 1QSFB 1PYWA 1RJLA 2IPKB 4KKCD 4XPAL 1GS8A 1AKJB 1VFAB 5IB5A 4AOFA 1CFTA 4M62L 5D1XA 1KTLB 5ANMA 5FYJH 1MLCB 1IJ9A 1JZIA 1X5XA 3TONA 4JDZA 5ID1A 5LQBH 2VL4A 1EERB 1OSZB 1ZS8A 3Q44A 3ZLQC 2O61B 4X5WB 4MYWB 4ZRKA 3KPSE 5E8EA 1OZTG 1L0QA 1GOFA 2ZPKH 2R4RH 3B7UX 4XWOC 3L6FA 3P2TA 4JW3A 4PREA 4WKXA 1V10A 1N18A 4KUZL 4ZO7A 1L5GA 2X40A 2X1OA 3GS0A 4PJAA 4ZG1A 3FOMB 3NSJA 4WI2A 2WY3B 1T0MB 4OM0L 4K23L 4P23D 2I5YH 1CC3A 5D8JL 4JFOB 1HOCB 4BK4A 1ZPUA 3Q9QA 5B3NA 1YYML 2FL5A 3BH8B 1T2QL 3WD5H 3I6KA 2NY0D 4XZUA 1Y0LA 2EDLA 1MLBB 2YPLB 3FZUC 3AM8C 1KC5H 1ZLDA 3GB7A 4HOXA 1A6ZB 1QWUA 2DV6A 3S36L 1ETB1 2YD7A 1FZMA 2Q3XA 3G5XA 4XPHL 2V3FA 1HXMA 1ZWIA 2X6BA 3EGXB 3Q6FA 4NNPL 3N1GC 3K4DA 4E68A 2BZ7A 3IK2A 2EC8A 4UANA 2NY6D 1J18A 2VLKE 3GSXA 1ZIBA 3MMEA 4WO4B 3QQXA 3DGGB 5A6LA 1I9IL 1FE8L 4KHAA 1EFXD 2Y2TA 1S7VA 3JVGA 1D7DA 1KYFA 1WZAA 4BUGA 5JUEL 12E8L 2APXA 2GYSA 4NOFA 2W2WA 4YEEA 5DUBA 4P2QE 3MRNA 1WDAA 2YIHA 1SF3A 3N5AA 4XWGH 4YAQA 5I18H 1J48A 1G4RA 3M7OA 4K7PL 2NY6C 4L23A 1ZSDB 2FO8A 2G60H 4OI9A 5C0BD 4ENED 4WV1C 4NQCE 5K9JL 4L9LA 3U4EA 4HS3A 1BZQK 5DK0B 5ESQA 4N0CC 4I9XA 4GSUA 4GRWE 9CGTA 2J1XA 4HXAL 3W56A 1ASOA 1WFTA 2DQDL 3G6DL 3TNMB 5KANG 4G7VH 3SO5A 3B9KB 1VEOA 2RAMA 1NMAL 4NBYB 1IQWH 1GC7A 5MEND 4FFVC 2NZ8B 1CFQA 1H3TA 2W92A 2XKUA 3KPOA 3R4DA 4OJAA 5E1HB 2VDPL 1PGRB 3IAPA 4NO0D 4U4IA 4KHXH 4HOMA 4PWFA 3BW9A 3ULVD 3ARGB 4KVPA 4QRQA 4A7VA 1CCZA 4DETA 1RUPH 3X1FA 3BP5A 1KENH 2WIIA 4ORGB 4WTZA 5HHVH 3DVGB 1RUMH 5T3XL 3S48A 1YMMD 4ZMNA 4YBQC 5BVPH 1U8JB 3SJVD 1W6LA 3ZZ1A 1TXKA 3L9RA 3U36B 1DBJL 4F5CA 4Y8DC 3QJHB 1SXBA 4OZFG 4X4MA 5HHVL 1NQBA 4NLAA 3QE5A 1AXSB 2PCXA 3EHBC 2BHYA 3N41F 1W72L 2HTKC 1UWEL 3ZTJG 1P7QD 3TBVA 2I9TA 1W91A 3WSQH 4M6OL 3B7SA 3VFUA 1AC0A 3HZ3A 5JXEC 3IPBA 1KZ7A 4KAQH 2HJKB 4KJYA 5IK3B 3RX9A 3FU8A 5JW4R 3UTTA 4OD2B 2YPVH 5B1CA 1KPUA 2HRGA 5DRWA 5L0QC 4MWFA 3R8BB 1K3ZA 3RZCC 2DQUL 4AIOA 1INQB 3W0WB 1G6RA 4OIFA 4E9SA 2I07B 3OQRA 4IRZA 3WS3B 2DA0A 2YQ3A 2CDGB 3TM6A 4MTMA 3ZU8A 1JV5A 1PSKH 5E5LA 1T66D 3HRZC 2V9TA 4GEJA 4UQAA 4JG0H 3CZKA 4YN3A 2IADA 2EDHA 2NRDA 1AI1H 2K3HA 3GHPA 4A7GF 3UTOA 4K7FA 3OPZH 3VE0B 2WBWB 3DSFH 3ZDYF 3GRGA 1CGSH 3MYJA 4I3GA 4UQ9A 1T0NB 4TUJB 4LBEB 4TQEL 1G7PA 3GTVA 2DHJA 4G6KL 3H2QA 1AGBB 3D3VB 5CF3A 1I8LA 3US9A 1E3XA 2WXOA 2ROVA 1A8ZA 2HG5A 5JA8B 4JPSA 5EDSA 4NPYA 4DIXA 1AMXA 2XXFA 5DZ9A 5FXCH 4DH2A 5F7HA 5FLVA 5DZJA 2DQJH 3CVIL 1M53A 2VQTA 2UYLA 4PJEE 1ZHLA 5HYQB 5E08L 4JGJA 1OCOB 1U8MB 1KI1B 1QRNA 1T2QH 1UASA 3WD5L 2JJSC 4IAPA 2DWXA 2OMVB 1SGHA 2BW4A 3GINA 1ZC4B 1NLBH 4JMXA 3OBAA 4JKKA 5F0LB 5F7EL 4BDVB 5IJKC 2BVPA 3GXFA 5D7KE 1CG9A 5JHLL 1GKOA 2EYSA 1A1OA 4O4YL 2J0JA 2V5TA 5C09D 2W07B 3HFML 4MD4A 3PRZA 4M48L 1J05A 4IMKA 4WUUA 5EZIL 3QH3A 4ANVA 4X5XB 4PRHD 1I8MB 5M7QA 1R3JB 2I5CA 3BVWA 4H8WH 5K1VA 1F18A 2VR4A 4F92B 3VI3B 1MQ8A 4Y16B 3CSFA 3OJDA 4XTRD 3RJOA 5IB1A 1T83C 4A2EA 3SDAC 2VXTH 3LY6A 4L6EA 1JK9B 4ES8A 3UCQA 4FXTA 2F7RA 1NH6A 5I73B 5E2JA 1A6UL 1YNLH 1HOEA 1OGAB 2YGQA 3WNMA 5GGSY 1P1ZB 4NN5B 1BQRA 1II4E 1ORQB 3ARSA 3DIVA 3L3IA 1Y18B 3TO2B 4XNMB 5C0JB 1KJMB 3BDYH 1EEQA 4WJKB 2W60B 4OU3A 1DANT 3UTSB 4PP2B 5IV2A 1RCYA 4UIMA 4AZ8A 4ZMLA 5FK9A 5KVFL 2I69A 1KG0B 2ZQKA 5AKSA 1FIEA 5K59F 4BSVB 1JYXA 2MNJB 3CH8A 5CJ8A 2QELA 3SPVB 2ZYHA 4RESB 3VYPA 5INCA 3UBXI 1ETA1 5E2VL 3WXWL 1VADB 1IC7H 4YBLB 1NMBL 2EXSA 1EMTL 3PWVB 1B4LA 1IC4L 2BVUA 5DJ6B 3MCLL 4AQEB 1DQJB 4F9LC 4XO9A 3FU7A 4TS6A 3H7LA 1D5RA 1ZV9A 3B43A 3PYCA 5ACZB 2QSVA 1A6TA 1U8QA 4HJSA 2ZUSA 3VQLA 4B27A 2JIXB 1O9ZA 3KJ4C 4ZTOL 4P57B 2HA1A 2FJSA 4PJ9D 2J88L 3T3MF 4LQ1A 2WGXA 1HCFX 1UM5L 4ZMQA 5KG9A 2DRUA 1YEGL 3UJJH 1E4XL 3GXIA 2GFBB 2ESVA 1OK0A 3DV4B 3T0ED 4AMXA 3DXEA 1TO5A 2V0AA 1EVHA 1QFWM 3OGCA 5LGKA 4OFYA 1TETL 2Y7LA 4LARH 2QTVA 1R24B 2NTSP 4WNSA 4PJGF 1P5TA 4OT1A 1ZS8B 3O6KL 3V4UL 1U5FA 2VDQL 4UT9A 2VITB 1T5KA 1K8DB 3TO4A 2PZ1A 1JNLL 3FCTB 2VRQA 2NR6D 3EOAA 3VXUD 3UJIH 1BVNP 1MZZA 1VGKA 4U1JA 4DCQA 3K6SA 1ZJBA 3QAQA 2DEWX 2ZAIA 3RIAF 2EILB 3EBGA 3QXTA 5G4MA 3GSNH 2JP2A 1MF2L 2ADIA 3VD7A 5LDUA 2KQNA 5KSAB 1OARH 3NABH 3FT0A 2NXZD 2R69L 4P04A 3C5JB 2FT6A 4Z9KB 5IBTL 3X2QB 4L0YA 4IKNA 3FSOA 5IHHA 1I1RA 2VH5L 3CJJA 1AFVH 1YEKL 2ZCLL 4L37A 2YARA 4YE4H 1NU2A 3GHBH 5I1KH 1NDTA 1NINA 4L8DB 5K9KA 1WP6A 5LBSA 3BWAA 3HG0A 1NPUA 2Y7NA 1S5HB 1ROWA 1H0DA 4CU6A 4K3EL 3GUTB 4RVBA 2CY5A 2WO4A 5D1ZA 4OTXH 1BGXL 1DBJH 1FGYA 2E47A 1A2YB 3IKCA 2PTTA 3LRGA 3WHXB 5IB3B 2OSLB 4ZFOA 4TOYL 3DUSB 1VCAA 1QUNA 3O6FB 4G7QB 3B7TA 1MRFH 3MRNB 4K4KA 1PEZA 4WU5B 4QY8A 3A5VA 1PL3A 3P4OA 2ITCA 4XWOD 4XE0A 4A7GA 4Q9CA 4LCUB 1YJDH 5A6IA 5HI5D 3RUGF 3WTSA 2EXWD 1JHTA 1PBYA 3UTSE 3LZFH 1MRFL 5KCVA 1J9QA 4YL8A 1Q1PA 1C1EL 1LO3L 1CD0A 2A77H 4Z2NA 2BNRE 3CN0A 4C54A 5H8DA 5CEXA 1IKFL 1NKGA 3ARGA 1EZUA 4N87A 3VRJA 5JW4M 4NO5B 1CB4A 3EAKA 4CMMB 2NY4C 5DMKB 3MRBB 1XIWB 4EOWH 5EPMA 2D2OA 2DFKA 3CHSA 3MV7D 2ZXGA 3O2DA 3VGAB 3EFOB 3ELAT 3QZBA 4ETQB 5D3YA 3FUDA 4N3TA 2Z93B 4XVUD 3AU5A 3CVHH 1ZLSL 3WN5C 3WTTA 3ULVE 5CP3H 1MNUL 3OAYH 5D7JB 4AW4A 1UHVA 1FO0L 3CDZA 4ORZC 4QXVA 5CLWA 3E1F1 5KVDL 4NRZB 5EU5B 4HIPA 1F4AA 1WIOA 4HC1H 2VR8A 2VLJA 3BDYL 1D5XB 3CXBB 3CN1A 5HHOA 2DYNA 4RGMB 4RISH 3QGVA 1MQKH 4XVUC 1U58A 3OKYA 1YC8A 4FKEA 5ICZB 4WRLA 3ARFD 1WG7A 5FYLD 2HX9A 3W39B 3WDJA 5KAQF 3FL7A 1QPPA 4D9LL 4F8QA 4I13B 4QOKD 3AQDA 3DIFA 2XN2A 2YRPA 2K6WA 1MJUH 2W9DL 3GYPA 2BJMH 4X7FC 2X4OA 4G8FB 2EE0A 2F0CA 2CR6A 2AVFA 3ABLB 4K23H 1IAII 3FNKA 1M9SA 3LZRA 4GLRI 5C07A 5KSVA 5DVKA 3NSCA 3DYOA 5EIIG 1FIGL 4PCTA 1ICTA 2ZXQA 2H9GB 2YGVA 4QYAA 5I1IH 4HEMA 2XACC 1J8RA 1YEWA 3IMRA 3LEVH 2H6PB 1G1CA 1SFDA 3N06B 3GMLA 3GXNA 2W95A 3V0VA 4P0DA 4LHQB 1QFHA 2VDPB 2UY7A 3Q8EA 1BZ8A 2NY0B 3FULA 1BYNA 2ICEB 2I1KA 3DRTA 2P5WE 4EO5A 1DQDL 2JK5B 4I5BA 1F86A 2P5PA 4N90E 2H0JA 4IBSA 4LOFA 4ZZFA 3TFBA 4FOMA 1ZA3B 1DQQB 4L8SC 4KRPC 4CU8A 3OZKA 3BQUC 2VDRL 2E6QA 3BP7B 4NQQA 4WO4D 2QKMA 1FV1B 2GSIB 3EUUA 4ACPA 4D2NA 2HTKD 2FQGA 3IU4L 1FO0H 1RERA 3HI1A 1FL3B 3GSNL 2LYDA 4JM2B 1OAJA 4M6AA 5FM5O 1L7IH 4PJFF 1AZBA 1TTAA 1W72B 3FN0L 1OO2A 1CLYL 4EUPH 1I8MA 3WMSA 5DJ8B 1C5BH 1VFOA 4GEIA 2DIEA 4QRUA 3B2XA 4ABUA 1M2VA 2ESVD 4OF6A 3UAAA 3WIHA 4BXVA 4IKKA 3VTMA 1MCIA 3M17B 5ENWA 2EUXA 2RGNB 3AXIA 3FQRA 1QR4A 1T89C 1TLKA 2M83A 1URZA 3FT4B 4Z18A 2DDQL 4IQHA 5I30L 1HNGA 2APSA 1KCWA 4ZXBD 5D1ZI 5KANI 1F3RB 3L17A 3QIBD 2B59A 3QZWG 3ZKXB 2C9SA 3CHOA 2EDFA 4LIQE 3MV11 2NY7L 3T06A 2BXZA 4RFOH 1LEGB 4KPHH 4FI7A 1SDAB 3QRGH 1E6JL 1UYWH 4Q6KA 3ZT6A 3OSVA 3LRKA 3DNKA 1PD1A 3Q5YA 5E00B 4YDKH 2N7AA 1YG9A 1FN4B 2PW1A 3SKJH 1UEYA 2Q3AA 4HPOH 5IVZA 1XF2A 3CC5B 2EJ8A 2YS4A 3D0VB 2UZYB 4IBTA 2BLFA 4HGWA 3F84A 5E4OA 3SGJA 2O93L 3PVUA 2HN7A 3HS0B 3FT1A 3A22A 2EDDA 1FNGA 1PQZA 3HMXA 3S35H 3OG4B 4KGLA 4MJJA 4EQ3A 5C7XH 3MO1B 2OR9L 2LE9A 3WN5A 1FNFA 4YPGB 2MFQA 1KT2B 3RI5K 3MU3A 2R1YA 5L8KB 2H26B 1N59A 4NQSA 3SYAA 1OANA 2EC9U 2VLRA 2OBGA 2A0LC 1JV2A 1OAYL 1OCZB 1XZWA 2CUAA 3WNIA 3X12A 4BH7B 4GKOA 4JRFA 1Q9KB 3SGKC 4B6HA 4PMFA 2ODHA 4AVHA 3HZVA 3W0WD 2HKHL 3SGDH 5G55A 2ITFA 1UOWA 3RWCA 2DKUA 1B4JL 4HIXH 3VXRA 1D6VL 5I1DB 2CIKA 2O5NA 1LK2A 4F33A 1HE8A 3MACL 3ZYJA 3DV4A 3GKZA 5D1QA 3I02A 3QQ4B 2A0LD 4LSRH 4OLYL 1BLNB 2ORBH 4BK5C 1BREA 3DV6A 2LKOA 1BQHB 2WBJD 1FORL 4KXAA 2XBDA 3BAYA 1G1OA 1TQVA 1MCWM 3B2VL 3ECUA 1Q72L 1MVYA 1JZJA 4MNHA 5D6CB 2Q8BH 2CGRL 1SBBA 2N0YA 4QJ4B 1MHCA 3P77A 1G94A 4E41E 4EIBA 1WD8A 2OMUA 1O6VA 1E42A 2BIHA 3P69A 2ITEA 2J56A 3KSYA 2VAJA 1ZDQA 4XVSL 3PDOB 1RAMA 2Q7YB 3QDJB 4WF7A 3DROB 1RZJC 5FB8B 3NIFE 4GRWB 4I9WD 1RUML 1AO7E 2XICA 1CICD 3HLAB 4OCRL 1A1MA 2K2UA 5FW7A 3NDYE 5JIDA 5DD6A 5EO1A 2NW3A 5JORB 4MD0B 4FXGC 1G7JA 2H5UA 5IB2A 2HX8A 3G08A 3RU8L 3CZNA 5IHZB 4RMUA 1KEGH 1DO6A 4FQJL 5A2KH 3B8SA 2R29L 5B1AB 3RGHA 4NJ9H 2AXHA 4L5FL 1OGPA 4YDLC 2WB1A 2YO3A 3H2WA 3QHZH 1N6QL 1WJMA 2NY3C 1U21A 2H4EA 4NN5C 2UVMA 4DP1X 3LDBC 5IT2L 2ZXEB 1LJMA 3NIGB 1BV8A 4XGZA 1I4FB 1YVLA 1T1ZA 4DP9X 3DXAB 3DX2A 1ACYH 3QEUA 4HLZH 4EOWL 5AVVB 3THML 3NSXA 3DSNA 3BE1H 4XO4A 1W1DA 3EJYC 4IGBD 3EH2A 4PUBH 4ZNEA 2BK8A 2LFGA 4ZOAA 3AB0B 1ML0A 5IJKA 1MPHA 1TXDA 2N59A 5GZOA 5EPMB 3WKMH 1YCSA 2ALAA 2KLRA 4YSPA 1BZ7B 4FEMA 4JZJC 4B0MM 4ETQA 2DQIL 3REVB 3CFDA 4X8JB 4ADIA 1P4BL 4NI3A 1QBBA 1MCOH 3TBBA 4N22A 4Y1TA 4YXKL 2F8XC 5KEZA 2FWLB 4R2GD 5EU6E 1KPRA 2XQ0A 1DLHB 1WBYB 4XT1C 1E5UI 3V4VH 3MGAA 5F6IB 1Q9LA 3PWNB 3L1FA 1KB5B 3GJFH 3MHZA 4LDLB 4D0CB 5ITBL 2YEZA 1WA1X 2LV4A 3QFDB 3UAEA 1X4XA 4IBYA 3AACA 3BPOB 2EO7A 1KGJA 3ZTNL 1QP1A 1CXKA 3T3PF 5FYKD 4ZODA 3J27A 4WY7H 4IDJH 4F8PA 2AMUA 3ET9F 2HVBA 1RZJL 2D8KA 4JPIB 5KBDA 1YNLL 1IM9A 3VG9C 1UH3A 2PABA 2WLZA 1Z0MA 4WEBL 5I76A 5HI5C 4EZLA 1RJZB 1E8YA 1NCJA 4OF8A 4WWPA 3FO0H 3O2DL 5FUCE 3QRFM 5IROC 1YECL 2MIZA 1TTGA 2P5ED 2VABB 3DIFB 1INDL 3MLSH 5E2WH 4YEFA 5I8KH 4W9EC 2X38A 3TVMB 3ECBA 2X4OB 4G8FA 3H7BA 4FLQA 3ZZLA 3WU1A 2YA2A 4G6AC 2Y1VA 4JFZH 4QTHA 2G5UA 3TNNB 2Y07L 2UY7B 4NJAH 3FUHA 1BBJA 1A5FH 1NCOA 1NZRA 4Y4KC 5BRZE 3MLSL 3UGEA 1BDYA 3N9GH 3OR6A 5DD1H 3HK0A 1JD9A 1TIUA 3IRCA 4CMHC 5ABZA 5C3LD 3R7RA 2F7IA 3FOLB 4TNEA 3TA3A 1QNZH 1YN6A 2PCPB 3ZQWA 3DA0A 2NXZB 2R09A 3C6SB 4YHYB 2FNWA 4IIQC 5F1OB 1I1AA 5AG9A 4PJBE 4OLXH 3GRWL 3FB6A 3M86A 1MAKA 1IKNC 3NCBB 4A1RA 1FV1A 2GSIA 4S1QL 1FWXA 2X4UA 2JLPA 2CUHA 1CDHA 4G6FD 2H32A 3QUYC 3AG3B 3FB7A 3MREB 2WB7A 4HQQL 3DMMC 4OQTH 5CBEB 1KTKE 1KFAL 1RFDL 1T7VA 3FQ4A 2A4CA 2ED9A 3KVDD 3HMXH 2XJLA 4KHOA 1BD2A 2VDMB 4LSQL 2MHAA 3E0GA 3L1EA 4FULA 4J4PC 5BUPA 1I3GH 1AS8A 2E9BA 4UQ3B 1JPST 4XMZA 5DK3A 4D94A 4LLYB 5TFSL 3C87A 1EXUB 1PW3A 5C0BB 3NP4A 3OAUH 1TEFA 4DZ8B 5EORH 5IFAH 2TSAA 4KNSA 2GHWB 4M9OA 3HG5A 4PW4A 3B77A 4JO2H 3D4YA 5EOCJ 3UIYA 3RDTB 4KX9A 2VXQA 2Z7ZA 4UTAA 4Q9RH 3FH7A 4K5MA 2RUKB 5FKPB 2F54B 4I3SL 1B0RB 3BOVA 5E8EB 4EBQL 3PY9A 3AGVA 1QPKA 1KJVB 5MENB 4E2OA 4MHHG 2I85A 4NCC2 3L2NA 1N67A 1BOGB 1L7IL 1A3LH 4RA3A 1TVHB 3QPXH 3H0TB 1P5VB 1FE8H 2O6EA 2BC4A 3PGDB 4J3BA 3S36X 3IBOA 3SDDB 3V4PA 4N0YH 1PX4A 3I6KB 1I7ZA 2D7TH 3W3BA 3IVFA 5IG7A 4WO4C 4P2RA 3GNMH 1IL1A 5D72H 3GBNL 1GC1L 2EQDA 1TZIB 1BXAA 1KJ2B 2VM3A 3IB4A 5HJDA 2J6EH 3T6VA 1P9MA 1B9ZA 2DL9A 2E7CA 3FUMA 1HXMB 4XP9L 3EGXA 3VXSA 4HZLA 2CLRB 1A2YA 3IKCB 2PTTB 3WHXA 4JB9H 5CEZH 4HCGA 3QJFA 1NMBH 4GMSH 1MHPL 5F7NC 3H55A 3N55A 4HJGA 2J2ZB 3KLHD 5F9WC 4M5TA 5B3SB 1QBAA 4ELKB 3ARFB 1G43A 2Y23A 1P7QB 1LTXA 2XN1A 3QDJE 4OLYH 1F00I 1ZV2A 4A6FB 2LGNA 1JZDC 2WQSA 4X6DF 4HB4B 2XY1A 2RCSH 3PGFH 3VVWA 4DN4L 1FSKC 3LPFA 3EYVB 2PTVA 4HC1A 3NSYA 3HE6A 1ND0A 4TSCH 3OF6A 1IAMA 1RV6X 1AS6A 2DKQA 3R06B 5GZOD 2GJRA 3LNIA 4O9HL 2OSWA 4RLDA 2VC2B 1J1OL 2OMBA 3JVFC 5G4OA 3MCKB 3SKMB 1FFRA 4JO1L 5IMOA 3C08H 4MD5B 4XXWA 1Q94B 4L4VA 3JV4B 2W9EL 4XPTL 4Q89A 4U6VH 2JJTC 4W1TA 5D96B 3Q13A 4JMNA 1AXIB 3BE1L 2BOCA 5IVXB 5I2IA 1Z9SB 4AYSA 1TQCC 2VW4A 2I9LB 2ZG3A 2G60L 1L9RA 1G4MA 1ZHKB 2ZCHL 2OTXA 3PDDA 4YBHA 4K2OA 2GPZA 2V76A 5E2TH 3DBXA 3MA9H 4UM9B 1JZ8A 3TCLA 2Y5QA 4DK5A 4NCDA 4APQA 1TZAA 4UNUA 4W9IC 4AVKA 1CL7L 4HV8B 5DD5L 4YSTA 4TNWK 2PPFA 2V2XA 1SJHB 3L9RB 1KIUA 3ZZSA 2JJVA 5EU6D 1LO4L 1OD9A 1NCBL 2CJ3A 2GJ6B 2GUOB 3MA7A 3M88A 4IS6B 4DAGL 3SJVE 3Q7JA 3CLEH 4GMTL 5EWIH 3H1ZA 3FU9A 4A7QA 5IB2B 2X70A 4R6UA 1UWXH 5AENA 2PO6C 1FORH 5ADOL 4ZMOA 5EZLA 4J6RL 4OLXL 3HIZA 3P73B 2VQ4A 1T6WA 4IRJD 1EK3A 5E8NA 4K2UH 4N1HB 3QNXA 2JQMA 2CKBB 4A6KA 1GJUA 1RVFL 3Q8AA 1GYWA 2R0LH 4KK8D 3DXAA 2P80A 3CK0L 3C8HA 1QD0A 3ARED 4JY5H 1LWJA 1UWFA 3NZ8A 1G7LA 3N41B 1SHCA 4N6RA 4XMKL 1GY2A 2EEDA 1XQ4A 4IJ3B 1YEIH 3BMVA 4Z0BH 2NT0A 4NUJB 3ULUE 2JJSA 3MDJA 1Y0LB 1T5XB 1P6AB 3K2IA 2XC8A 1G6RL 1HINH 2FEEI 1WVZA 1MHHB 3NCEB 3ILPB 1J0JA 3NCCB 1TTUA 3LS4L 1M6UA 5C0RH 4P4KC 1RZGB 4PWGA 2VN4A 4W9CC 5IQMA 5HD8C 2ZUVA 3ZE1E 1A6PA 3F62A 1T5WA 5D9SA 4LDOB 3MBWA 4L9DA 4GBXA 2AANA 1HQ4B 4M7LL 5HJ3B 1UB6A 1P5UC 4X6EA 2D73A 2LU7A 2ENQA 4OD3H 1UD2A 1IGCH 1ED3B 2YPLE 4JG1H 2KCJA 4U6XB 2CRYA 2VAAB 4PJXE 2BNRD 2GY7B 5L9DL 2WJ7A 1U8MA 2WQAA 1IM3D 1QRNB 4G7YL 4WLCA 2YZ8A 3BT2H 4IOIB 4N0FB 2Q3ZA 3SZKC 3VNYA 1XODA 4JPVH 3PL6D 4XI5C 1EHAA 4J3TA 5E6IB 4Z7VA 4YXKH 3VI3F 2DBJA 4ODXA 5H2BB 3DX0A 1AGFB 1EWHA 3QRGL 1MUJB 4K3GA 3LEYL 1JF5A 1VENA 3T6QC 3PHAA 4UZGA 2J88H 4Y16A 2VR6A 3B83A 4QRSA 2RH0A 4PRBB 4CC1A 3K1KC 5J4MA 3HE7B 2LAGB 1M1SA 4LF3A 1JOIA 5SWSB 4M4PA 2ZPKL 2AW2A 3HZYA 3CFUA 2D31B 3GSWA 4LVHB 2NX5E 3L95A 3LEYH 4K9EL 5E1GA 4AMWA 1NCTA 5L81A 1X7QB 3IJYA 5BVJB 3ESUF 3RBSA 1QABA 1I1AB 1XV8A 5JIPA 4KJPC 1T22B 3NWFA 4DX8A 3ZE2F 1OP3H 4F58L 3C09C 4TTGA 1K6QL 5FGRA 3L2LA 3OWEA 2FYVA 3G9WA 1DUZB 4OCLC 2AEWA 4DXAB 4LE8A 5MI0C 4NP9A 4H5SB 3KR3L 3DMMA 5MENE 1D3CA 1GYCA 2Q7AA 3OZLA 3C60A 3KZ1A 4WKZB 3FF8A 3QUYA 4E41B 5JHAA 3PG7A 3GSQB 4XCCH 3KPSB 2R56H 2E27H 2BZDA 2ZOWA 2C1PB 2FEDD 3JZYA 3TBVB 3MUGA 2QSCH 3HA0A 3PUUA 5JOPD 4HAUB 1IEAB 3E3QC 4HX1B 1BJMA 3IJEB 1INEH 3FBQA 4NERA 5HVHC 2VE6A 2EYRA 2KPWA 3KPNA 1QEWA 4QF1A 4GAFB 4G8GE 4L3EA 1TQBB 3ARBA 1E28A 4QCIB 2BM3A 5IKCA 3OAWA 1GHFH 5ABAA 2P42B 1QSEA 4JFFA 5C9KA 3ZMRA 4P2RE 5T33L 1DL7L 1TZGH 1I8AA 2V3EA 3CAFA 3BXNA 1JHLL 4PJAB 1Q9WB 4KMLB 5C0BA 4CADB 4M5ZL 3S5ZA 2CHWA 3VGEA 4I2XA 3BH8A 3FC8A 3O41B 4J8QA 3PPEA 5DLML 2OMUB 3DARA 3MYJB 1FG2B 2FQEA 5FKPA 2CWRA 4QHKI 5I1GH 5K9OB 2OJ1A 2WVVA 5EA0H 3EKCA 3VAEA 4G3YH 2LVCA 3QQ9C 3D3VA 5B8CC 1T04B 3KWUA 1OHQA 3U48A 1S3RA 4XBPA 4XMWA 2LW3A 4EN3D 5CSGA 3RZCD 3K0WA 2DQJL 2WSKA 2YK1L 5AWNL 3DKHA 1CDGA 3UG3A 2ZUYA 4JFSA 4OZIA 4RMBA 1JFQH 3C5JA 3IRPX 3NJNA 3MDBC 1F6AB 1CN4A 5MHSD 5DRZB 5GISL 3A47A 4HIHB 4CHJA 4H44C 5IEHB 2AV1A 5EO0B 3SBWA 4EIUA 2VZSA 2GB2A 1M4KA 1IAOB 4B3VA 5A2LH 2W0PA 4I1RA 4F7UP 2VR3A 4NM8L 1V5JA 1ZK9A 3DJTA 3TV8A 4ZW5A 3T1WA 2A9ML 2YXWA 3QDMA 5FFGA 5GJTL 4L0ZA 1CL7H 2IAAC 4MXQC 5EG6C 1I4FA 3GMMA 1UKSA 4M02A 3QJUB 2J0MA 4JG0L 3ALXA 4LCVA 1U93B 3KS0J 1YZZA 1GS6X 1MPAL 1OARL 3GI9H 3QDGA 2YHGA 3KM2A 4HUKB 3RY5A 3ZKMC 1T2XA 1B88A 1FVCB 3TJHD 5CLYA 2R0KH 2OQJB 4PGCB 4F8OA 1TJIH 2MJWA 1JGUL 3JZ7A 3PGCB 3L3DB 3BN9C 4X6CA 3C2SA 1OPGH 1WCQA 3A6CH 3D39E 1Z0NA 3IWUA 1HH9B 4PR5B 1CFVL 1FAIL 4HZAA 4MJIE 3CDFA 5DD0H 1UD3A 1MK7B 4HB0B 5CP3A 5DXWA 1MRDH 2IV8A 1W0YT 1CDYA 3BPLC 3L5WB 3QDHA 1NCAL 4LHUB 4ZMVA 1KLFB 4HUWB 4MMZB 3T65B 1BGXH 3N0PB 3RBGA 3TESA 2HLFC 3IF1A 1I31A 2ENYA 2GTWB 1BAGA 1I3UA 4Z7OF 4K15A 3EBAA 5DMKA 3V5KB 3X1GA 3IT8D 3RQ3A 4GRLC 4D0CA 1HFUA 1MFEH 1EEYB 1VFUA 1VDGA 2GITB 2XTSA 4FCAA 4Y9GA 5ESAA 1T2JA 1Q4NX 5AVRB 3QNZB 3DXAE 1NOFA 4OVUA 2VL5A 1RK0B 3I2CH 1UD4A 4G8GB 3WE6B 4PJHE 1ZKAA 1BBDH 3EO1A 2X4PB 2BNQB 2G5RA 3QULB 4CVXA 1A4AA 2YMOA 4DGIL 4KXZI 4QRRD 5KBKA 1EHKB 4M7KL 1CXFA 1OT4A 32C2A 1A14L 2K7PA 4UM8B 5I76B 4Z76A 1YPZA 4P57A 4QXGL 2DTML 3Q1SH 4U6VL 3UBFA 1NGPL 4JDTH 2CK0H 2LU3A 5KG9B 3D2UB 4HUXA 4UILH 5EUOE 4KZEH 5GGTA 2KZBA 1UNQA 1T3FA 3C2AL 3O6KH 4P5TC 3N04A 3WY4A 2ZYRA 4PWHA 1BFVL 1QX1A 4OQTA 5ELIA 5GZOC 1ACYL 3PXHA 5J9PA 4RX4D 5E8NB 1NCWL 1TQZA 2DICA 4YOKA 5T1LA 5EEXA 4L8CA 3ILQD 5C0GB 3TO4B 1M7XA 1WGVA 3Q3GB 5DI8A 3NCYS 4NRXB 2P26A 1BQLL 4XN7A 1ZVYA 4CVUA 1U3HA 2HG5B 3OL2A 2GSGA 3BRDA 3OB0H 4WIQA 1OTTD 2NSQA 2PWEA 5D2NB 1TTBA 4XP1L 5EF3A 5EV7A 3MXVH 1NFAA 1Z9NA 2ATAA 1JDDA 5FWQA 1IVLA 1D5BA 2IXQB 2MPVA 3RIKA 2HSIA 1FJ1B 2J5LC 4XP9H 2C1OB 5LXGH 1NCIA 5I6OA 3IKKA 4BKLB 4PD4J 4JPVL 4YLQT 1LL1A 5C5BA 3C12A 4ZUUA 1F58H 4LHUG 1B6UA 5D7LE 4UT9L 2V6HA 3BKJL 2D9VA 3NEEA 4PJFE 3S88L 5D7EA 3IDYC 1T7YA 4GUPB 5IB4A 3E1ZA 3NW8A 1H5BC 1FAKT 4AVJA 5K59E 5I1CL 3VSTA 3QXWA 4B5EA 1DR9A 1R34A 4XXCA 2OMXB 1F8TH 4QXUL 1P4IL 3MV8B 5AW0B 1A7NL 1E4WL 1DJZA 1JXDA 2MWCA 2ZKYA 4B95C 4HD5A 4ZMYA 3CLFL 2VLKA 4OGQC 1AGEA 2VDRB 4Y5YB 3FUNA 4P46B 4CA4A 4OFPA 5BXFB 1J5OH 4QPEA 3N85L 4WJ5A 3F3HA 5HDQL 1AGFA 4XPTH 2COQA 2BIMA 1BZ9B 4OGZA 1F4YH 1UM4H 4PVBA 4JO5A 2NYYD 2F08A 2HJLB 1IBYA 3OKKA 3AREA 3LNEA 3TX4A 3I50L 3QJZA 3W1ZA 4BQ9A 3QFJA 1WS7A 3BVTA 3N2JA 3DIDA 3D09A 3GBEA 4G8IB 5D2LB 5D1QC 2PWGA 2R56L 1OP9A 4RMVA 4U3HA 4HCFA 4DGYL 1I3RA 1VZIA 2K3TA 3DO3A 1SOXA 3QJFB 4TULH 5HYEA 5DYOB 5JPMB 3MRDB 4S1QH 3HC0B 3S8GB 5LBSH 5IVZB 2A9NL 3QK0A 1L3NA 5BVPL 3A58A 3TN0D 3MV9B 4HMEA 4N8CL 4FQHA 1HEJC 3GYOA 1IC4H 1SVBA 3FQXB 4WWKB 3VI4A 4X6BB 1KFAH 1RFDH 4LPWA 4IKJA 2NY4D 4XNUL 3WN6A 4GOSA 1S7SA 3PP3H 2BX5A 4JE0A 5LBSL 1JNJA 3ARBB 2YFNA 3KPMA 2VDPH 3X1BA 1TJXA 3CFBA 4H1LG 2F5BH 3NZHH 4BUQA 2UZXA 2ZSVA 5ICYA 2G2NA 2HAZA 4YHZL 2B9BA 3QRLA 1DSWA 2BP8B 4IRJB 4NT6B 5E70A 3WCYA 2GCLA 3EH4B 5HE0A 3CU7A 4HAZB 2NY3D 3H42L 1GRWA 3UMNA 3W5MA 4YL4A 2VZUA 1Q9KA 2O5XL 1QSFA 1KYOJ 1K8DA 1Q94A 3GLDA 5KSVB 2CE6A 3OLGA 2E6JA 5DD3L 2WUBL 3LJUX 3O4LD 2NCMA 4GFXA 4I0PC 3CFEB 2GCYA 4L3CB 1MPAH 2WBJA 3QAZB 3NCXA 1H4RA 2K6YA 4LLAA 3O45A 1VGEL 4JFWA 4X5WA 5LNDA 1CFSB 2H47C 3X1NA 3ABGA 4XP4H 5DUPL 3M1OA 4LSDA 3VUAA 5BJTA 3DX3A 4HT1H 4C4KT 1OQOA 2HFGH 2VR9A 1W72H 3O2DH 4HC1L 2ITDB 3O8XB 4G42A 5C1MB 3RP1A 3FO2A 5HHMD 1LMIA 2PWFA 1JZEA 2X89D 1ZCRA 1Q0EA 1UATA 3CIQA 3OKMA 4Y1AB 5AG8A 4QJ3B 1XD4A 1U3JA 1J8HA 3KH4A 4ZFGH 3IMUA 3D39A 3IJ8A 2UZSA 2L4OA 4L4TA 4POYA 4NPJA 2PETA 4JB9L 4FQIL 4WSKA 2Q6WA 2V17H 4XN2A 1OXYA 3HJ0A 3HI5H 4XNQB 3Q8FA 4Y0GA 1G7JB 3M45A 2NOYA 3D9AH 1KCRH 5JPNC 2X4SA 5HGHA 2VQUA 1ZC3B 1H6EA 1SUJA 2VZTA 4KTYA 5HGDA 3RVXC 1U8KB 2IANE 2BS8A 1SOSA 3NJIA 1EUTA 1GMEA 3ZKND 1KCVL 1FHGA 3APDA 3Q5TA 4YAQB 3B2MA 1KN2L 3D18B 3NRPA 1BZOA 1A4JA 1A6AA 1GG3A 1E65A 4FTVB 3SIKA 4F15C 1JVKA 2N56A 4UOW1 1UM6H 3B3BA 3U12A 3AU1B 2JXMB 4BQ8A 4FQPA 5ECGA 5EBGA 3CSPA 4H1LB 2B2XL 3FUKA 3UYRL 1P3RA 4HUWA 4GQQA 3P9WB 2AEHA 4DBBA 1FHOA 1D2PA 5I6MA 1BWWA 1C12B 1X5FA 2D3VA 4FA7B 1P7BA 5J6HA 3UO1H 1HEHC 3IDNA 4G43B 2NXYC 3JYCA 2IV9A 1U91B 4HS6B 4Q2ZA 1UD5A 2V7HA 4PV1C 1M2OA 4GG6F 3ARXA 5EORL 4X5QA 4CVZA 2GI7A 4IMLA 1P2CA 2VLLA 5J13B 1H5BA 5AVUB 4ODTH 2EIEA 2K78A 3VFPB 1LM8V 2CBOA 3LZPA 3KXFE 4XHQA 4JM4L 1AY1L 1CTMA 3TIEB 3WO4C 1AR1D 5IROA 3JXAA 3PWJA 4E41D 3U7WH 4ZW3A 1U58B 5JYMA 1MF2H 4X4KA 4XNYL 1H8OA 3H4FA 3V9EA 3WE6A 3DMMD 5HGBB 3GXDA 1N26A 1MG3C 2P8VA 2E7MA 4I9WE 3LN5A 3S35X 3F58L 2Z0QA 4OM0H 3GWJA 2DM4A 5EBWA 3QDMD 3S96A 3RI5F 4APXB 1VFAA 3U2SB 1UXWA 3AS3A 3RHWF 4JGNA 3VFUB 5IUSA 3ULCA 4XMTA 3Q2VA 43C9B 5D93B 5J9PB 2WYTA 4WHTA 3LIUA 4GG6A 3BWSA 4GH7B 3RX8A 3RVWD 1UZ6E 3I6LE 2WIMA 4ZUTB 5LQBL 4GKNB 4HDOA 3L6FB 4ETYA 1F3JB 5CJQL 5TTRA 3WS3A 1S3KH 15C8L 1OAUH 5IOPA 3T77A 1AG0A 4G71B 1NC2A 1MCCA 3ARWA 4OV5A 2QKIC 3EJRA 3FO9B 4M6ML 5KS9E 2Y5TB 4B5ZA 5HJBA 5CCJA 2ENSA 3BCFA 4N0UE 2FYYB 4PRAB 3HG4A 3WI9A 2C1OA 2FECI 3HG1D 3FUIA 3QUYB 2YRZA 4OCWH 1PMSA 2J8UF 3DO7B 4X7SL 1BQ5A 4J7RA 3QS3A 4BZ2H 1CS6A 3SDXF 5JNYB 1JYVA 1MCNA 1S8DA 1SXCA 2A9MH 4WEMB 1W72A 4AJVA 4K8RL 5T1KA 3NSDA 5SWZD 3NA9L 3IFNL 2YXVA 3QFJE 4MJ2A 4LMQI 4G6JL 1MVUB 2ATKB 1IFHL 4U3SB 4MNGE 4TPRH 4EBQH 1IAKA 4CSPA 1BVOA 4Z78B 1RU9H 1WH0A 4NRYA 4KNQA 3G6AB 4W4OA 3QYNA 3G6JA 1N0XH 5KWYC 3BPCB 4NAJA 4UB0L 2OYKA 3MV9E 1A47A 2CGRH 4JFQA 4PS7A 3I9AA 2R23B 3P30H 2V2WA 4K94C 3JTBA 4ZX5A 3NH7L 5DMIH 2WD0A 4JUTA 4WHYH 4NXKA 3KBEA 1N0XL 2WWMD 3OKKB 3ARUA 4R96B 3T6XA 4FXKC 3I85A 4Q6IA 3MX0B 4LHUD 3HC4L 5LGJA 4FKHA 4ZZKA 5AB0A 1WEJH 4HJTA 1I8KB 2KZWA 1FQ9C 4GMSL 3C8KB 3WS6C 4PIRF 3QXVA 3TO2A 4MXVE 5G5DA 3H8NA 4O51A 4FAAB 4K5PA 3FB5B 4WEEA 1PU0A 1QFUL 1YUHB 2WXKA 4HH9A 4L4JA 5CS7A 3NZUA 4J3WA 3FN3A 5TE7H 2NY6B 3FT9A 4BSVA 3BUYB 1RPUA 1TYEB 1FZOB 5E2TL 2XETA 2YUZA 5DYOA 2BNQD 5D5MF 1FLTX 2GVYA 3I84A 5EU6B 1JYNA 4GI6A 4WUKL 4DVRL 2LULA 1N64H 2I9TB 3CX5K 1IBFA 4ICXA 3SDYL 2BP0A 2ALWA 2NNFA 4G5ZL 5ICYB 3F8UB 1BTKA 4AQEA 1CMOA 1J9TA 3OB0K 4B3EA 4MWFB 4C8XA 1F1AA 2E4TA 1NAML 4QXTA 2VMEA 4ANKA 3DPBA 4ZMXA 5KVGH 3GBMH 3VOQA 1Y1UA 2A38A 5GSVA 2J1ZA 1UOVA 2FIKA 4Z7UE 3H7BB 1JV5B 1I1FA 2XN9D 1PLSA 2GFBA 1I53A 3GDBA 1CFSA 3B9KD 3FQNA 5A6MA 4S1SH 3DX6A 3D4ZA 3ERXA 4F8NA 1BM3H 1TYRA 3LB6C 4ODWB 1QBMH 4K0OA 1Q90A 1QI5A 2CO3A 3UTZA 3WFDH 4DUVA 1H8NA 3KYAA 1C16A 1XCWA 1UUSA 1OP5H 4BZ1L 3I9GL 4ODVL 1RIUH 5B7FA 3LPGA 5C2UB 4GMTH 2G2PA 3TJEH 5CP7B 1MWOA 4F9PA 4ZTPL 4DERA 2XFXA 1B2YA 1XR9B 3CBRA 4EQ2A 4PTUA 2DWDA 5IROD 2X4UB 4OT1H 3ULVH 2A73A 4Q97A 2J6WA 1OQNA 3BJ91 3NYKA 1MFBH 5FO8B 1SLXA 4H8SA 5L0QB 1TZHA 5KSBA 4HGKC 1YPZB 2ZKMX 1OZUA 4PS4L 4P46C 2DEXX 3P3UA 1TUPA 2OMVA 5T8IA 1MNNA 1X5HA 3ETSA 4BUHA 4UBDC 4DFHA 2X4SB 5HGHB 1S5HA 3UEQA 2GUOA 3MA7B 4IS6A 4M7LH 1FYTE 3RURA 4KH9A 2IOIA 5IY5B 4DO5A 3G5VB 2R7EA 1S5IL 1X7SA 2GAZB 5DGRA 2X70B 1KNOB 3VFSB 5FO2A 2PPAA 4C47A 1UKQA 2ZCHH 4CL7A 4OSUH 4PJ6A 5EC1B 4ZFOB 3RKDD 3BFWA 1PG7H 3ODXA 2JXMA 4ANWA 4JQXC 4FLHA 4JL1A 5EIQA 5I26A 4DW2H 5J11C 4EZKA 3PIQB 1MWAL 3L5HA 2HT2C 4UYQA 3MV01 1OGAA 2NMBA 3W81A 1A7QL 4A6YA 5J6HB 4PJHB 1LNUB 4BE6A 2D4DA 2K8EA 1JF6A 1QKZL 3MUHL 3O4LA 4NHUB 1ZIAA 1OSYA 1W2KT 2X9WA 5HI3D 5I5IA 1KXQA 1ZEAL 3L1OL 3BUBA 1QTPA 1P2CB 2VLLB 5EOCH 2WPGA 3TZVC 4BKSC 4DP7X 1UACL 4AT6B 3HHMA 4FFYA 3WA0A 2Q2EB 2XWTB 4O00A 1KJ3H 4TL5A 4GG6E 3TBYA 2RTTA 4PJAE 5IJVA 2AJXL 3DGGA 3F58H 2J12B 2H32H 5JHBA 4F8LA 5A2AA 4CNIB 3JTSB 3H53A 3PV6A 2IH3B 1KENL 3US0A 4YHMH 4JEGB 3BVNB 1XZ0B 1OGTB 4X98B 4D3CH 1PZAA 3TGXA 3BHBA 4NRZA 5T1MB 5D8JH 4AE0A 2FJGB 1KIQA 2XN0A 5F3BA 3S5LB 2OPCA 2W91A 3UJIL 4ODSH 4H0HB 5GHWH 1OOWA 4IDLA 4WJ5B 2X53A 2J71A 2VABA 2ZUQC 3LZNA 3PJSB 4H7VA 5DZLA 5J5EA 1XEUA 3SBRA 5C0RL 3TNMA 1IUZA 4CKQA 3S96B 1EZVX 3Q2LA 2YGNA 3QPXL 3QO1B 3LHAA 4Y16D 1CR9H 5I8KL 2LLGA 1RLWA 3BZEB 5KSBF 3QBVB 1Z5YD 3RFZA 1LE9A 1CZ8L 4MD5A 1TMCB 1S9WB 1T21A 2OLDA 4B9IA 4NN7C 4P5TD 4PSPA 4MZ3A 3BQUD 3V6OC 4QRQB 5BS0D 1YN6B 2PCPA 2GEQA 3LKPB 1MREL 5F7LB 1QTSA 4KKBD 1LYQA 5IGXH 2WIIB 4M29A 4ORGA 2AAAA 4RMTA 4L29B 4M8UA 2OXGA 5FYLH 1R3KA 3UTSD 4AXWB 3VWKA 1MHPH 5T5FA 3U36A 2YEQA 1CGYA 1S7UB 4UV4L 1Y07A 2XKNA 3F01A 4LCWE 2Y6SD 3MRMA 4OCNC 1VIWA 3MV9A 3NSFA 4LQFH 3F5RA 4TOYH 2JK5A 5FO9B 2DQHL 1RU9L 4KXBA 1YLBB 2CBPA 3VRLF 1TO4A 1BCIA 1ROCA 4PRPA 4X5LA 5DRNA 2YK1H 3MCLH 3SUZA 3V0IA 3MJ9A 1H0DB 1MCOL 1S8DB 3SDXE 1DP0A 1UQSA 5C8JA 4ODVH 5AAWA 3JWNE 2WXJA 3QJRB 4HAWB 4MJID 5IJCC 2ZCKH 3I74A 3ULUL 1JZHA 2EKSB 3FPYA 4MA7H 3LSOA 1J1PH 2FBJL 3UIZA 5L4MA 4LNVA 4X4ME 1WAAF 5FGCE 1FC1A 4FNSA 1X9UA 3DHJA 1QEWB 4QF1B 5CZXC 2EVHA 4AJWA 4P99A 3LMJH 3RHWK 2FR4B 1HHGA 1WJ1A 2D2CC 2RSGA 4X80L 2HFGL 2BH0A 1CE1H 1DBKL 2CBQA 1L9TA 1XF3A 2CRIA 5BJTB 3APCA 1MJ7L 4JFQB 5AKRA 2Z0UA 1A6WH 4OUUB 2CXKA 4AIZB 4M7JH 3NJKA 3FO1A 4Z7IA 3Q9PA 3HE6D 1OP4A 2PO6D 5AVQB 3SYPA 3T0VA 4CN4A 1HHKB 2BVQA 3T0WA 3CFTA 2DOCA 5HHNA 3CZSA 5IJBC 4HJ0D 5FGCB 5A2CA 5GS1B 4EI6A 5JO5B 3IGAA 4FP8L 3I75A 1KJ2A 2FDBP 5KW9L 2Z93A 2VZVA 3C8KA 1FZJB 5C0IA 1UWGL 5F70A 1P84K 4PV9A 5GRVK 3I3BA 4GW1B 4QO1B 1ET8A 2IWGA 5D71L 4ZFOL 5FCUL 4UDUB 1CLOL 3S6CA 5J56B 1HL4A 2DHIA 4OM1H 4YC2B 1T1XA 4K3EH 4UT6A 4WW2C 1L6XA 5CJOH 3ZDZE 3GSVB 2VAAA 4G1MA 1ZS2A 4ZFFA 2AV1B 4E9YA 3MXVL 4G9FB 1FFTB 4R97B 1TEGA 1G9NH 2IO5A 4X9HA 4ZFGL 5KJRL 4U3XA 3O6ML 5IREA 2VW6A 3HC4H 4K07A 3WN5B 4OLWL 4YXHL 1LO5A 4YJZL 2WBJC 2NZ9D 3PV7A 3M1BB 4I77H 1UJ3B 3B7YA 3FDWA 4APQC 4FJYA 3JT0A 2EECA 3OANA 3QDGB 5DDHB 1R5WB 4N2HA 2W9DH 3DX6B 5FUOH 4A2HA 1DUYB 1TPXC 4F1ZA 2OX5B 3B9VA 3LPPA 3L3IB 4PLKC 5M4YB 4UINL 1BWMA 1MFCH 4Q6YA 5DMGC 2D31A 3GSWB 3PP3K 1HEZB 3DOHA 2F1AA 4QXUH 3FQNB 4XXDA 3T09A 3LHPH 4K71C 2FIRT 3TF7C 3QQ4A 1SDDB 4D0BB 5GJTH 3WELA 4LPXA 4LARL 1HCVA 1T22A 3BAWA 3MQIA 4N8VG 4UAHA 3WFCH 4CBPA 3CD4A 1BQHA 5HE2A 4KI5C 1V3LA 2L04A 5FDWB 3ARGD 3OJ2C 2YSZA 3PHOA 1NBVL 1AZZC 1K5NB 2XT1B 4M7ZB 4PM1A 3MODL 2OYMA 3FTGA 3AJ4A 2QV4A 2ZUWA 5AALA 1AE6H 4YUEL 2CK0L 4PJHF 4RRPA 4GQRA 5IQOA 2LLLA 2A9BA 3BZFA 4WKZA 4XWXA 4NKOB 1NAMB 4TSAL 2Q7YA 2WCGA 5BRZA 3VTAA 1NEZB 1DQLL 4KNUA 1E8ZA 1PJ9A 2XV2A 4N28A 5D7IB 1U8QB 4LSTH 2EIJB 4X8CA 2FSEA 5DR5H 1U5EA 2X4PA 2ROZB 3B8YA 3IMTA 4BSWB 1R3HB 2CU9A 5CGMA 5IKCB 1H6FA 3FTUA 5ECJE 5I24A 1T1WA 2Y9RT 3CBKB 1YDPA 2EMTA 2ESVB 1CI3M 2DJSA 2Z92B 4KX8A 1WT5C 1TQUA 4RX4A 1M9WA 1S2EA 4BKTC 2FTAA 4HJJL 4XNAA 2GAZA 3HNVL 3VFSA 1SOKA 4Q74A 4XP1H 4O5LH 2ZCZA 2BWQA 3GSUA 1RJLB 3B2VH 1DQKA 4I2XB 4GOUA 2VSKB 2WXQA 3FCTA 1BD2E 3KYKL 4NZRH 1IC0A 1AAJA 1U42A 2WO2B 5ACMA 4BBKA 4RGNB 5JW4Q 1NOAA 3R4RA 1XR0B 1YY9D 2X4RB 1LEGA 5B38A 4P9HC 4P05A 2VQ1B 3BUDA 3ILPA 4KJWD 1EDQA 4PREB 4I48A 2AQTA 4QXGH 4NFDA 2ESVE 12E8H 1T4KA 4KDTC 3PWPB 5TPWL 3CFMA 2WZ0A 2UXVA 3U1QA 4KK8C 2XQYG 2JJUA 2X18A 4U1SA 3C2AH 2UZYA 3SCMA 1KN4L 1OAYH 2EVGA 3GGWB 5TFSH 2VDRH 1SXSA 1ED3A 3TASA 5I1LA 2E76C 2I27N 2XWTA 1KPRB 2V9RA 2AEPL 3JWOH 1FJ1A 3DXCA 3ZKQD 1B0GA 3CSYB 4WZ9A 5JZ7C 4ES9A 4N8VB 1JRHI 3HR6A 3AY4C 3EGDA 1ZT7A 4J3XA 4XCFH 3GC3A 4YPGA 1DBMH 2X9YA 1RURL 3TN0C 2XUWA 4ZSOA 2NY4B 2MCPH 4HDIB 3KPRE 1FNLA 4BH7A 2IQ9L 4ERSH 2DD8L 2RHEA 4OGYL 2YGPA 5BCAA 2FJGA 1PX3A 3HZVB 1NBQA 5CCGE 1NEZG 1ID5I 5AYUH 5EULV 3DTDA 2VDLL 1JHTB 1VPOH 4ZO6A 2J1YA 4YZWA 3D25A 3KLAA 4YDVA 4PRBA 4IBVA 3VGFA 5I1DA 3L3DA 3WLBB 2P8PA 5JOEA 2W2XC 3HNVH 1B4JH 2VRKA 1SMDA 4H0IA 4A7UA 4PB0H 4RIRB 5JLZA 5LCVH 3V6ZB 5HYIA 1R5IA 1ERNA 1AACA 3PL6C 1A4BA 1C7TA 5DRXA 4M6NL 5TDPA 3H9ZA 5G5DB 1D7FA 4X6FB 3QIBA 4K8RD 3B9KA 4HB3B