4DIXA

Crystal structure of the ig-ph domain of actin-binding protein scab1
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
212
structure length
212
Chain Sequence
b'LVYEIDGTEALGSCLRVRPCSNDAPDLSKCTIQWYRSSSDGSKKELISGATKSVYAPEPFDVGRVLHADIIYDGHSLSLSTVGKIDPAAGLGSYVEALVRKHDVDFNVVVTQMSGEDHTSESIHLFHVGKMRIKLCKGKTVIAKEYYSSAMQLCGVRGGGNAAAQALYWQAKKGVSFVIAFESERERNAAIMLARRFACDCNVTLAGPEDRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Plectin-related protein
publication title Plant actin-binding protein SCAB1 is dimeric actin cross-linker with atypical pleckstrin homology domain
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Protein binding
total genus 58
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16709 SCAB-Ig Ig domain of plant-specific actin-binding protein
A PF17684 SCAB-PH PH domain of plant-specific actin-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.140 Mainly Beta Roll PH-domain like PH-domain like 4dixA02
2.60.40.2700 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4dixA01
4DIXA
chains in the Genus database with same CATH superfamily
1ZJAA 3B7TA 3BPLC 4MMXA 3HC3L 4P5MA 4AGPA 1UM4H 3ARED 5TJWK 5CN3A 3WXVL 1UH2A 2YQ2A 2NT1A 3WJMA 1OB0A 2D0GA 5I2SA 5TD4A 5KVMC 5IWLC 1YAZA 2BP8B 1OGAA 2NY0D 3MRNA 3VXRA 4DO4A 3U82B 5DTFB 5FGCB 2LW3A 2OYMA 3MA9H 2P5WD 4NRYB 2XZCH 1YEGH 1IGYA 4KAQH 2FO1A 1FHWA 4HUUA 2NUTA 2EDQA 3ZTDC 3UBXG 5E9DD 2BNRE 4IRJB 4Q56A 1NFDA 1IAKA 4MAYC 3H7BB 3DJSA 1MWAL 5C07D 2CCWA 2J55A 2X4SA 3NFPB 5EDSA 3HR6A 1S7UB 4EZJA 2UV3A 3DTUB 4RMQA 2BERA 1EHNA 3VSQA 2CODA 3FQYA 3AWGA 1Z87A 2YPKB 2CO1A 4PGJA 3E38A 3V6FB 1NEPA 4FFYH 3TIDB 1PZCA 1IBYA 2QGCA 1WUZA 4G7QB 1WWAX 3CHPA 4EPSA 1KCBA 3H7LA 1TENA 1U8HA 5D1QB 4R8WL 3MV11 2JB6B 3NUKA 5FO8B 1KGXA 3SYXA 1F41A 2TSAA 2CY5A 2G75A 2YPLB 3IETB 3MYJA 2WLYA 4UZSA 1U93A 1XEUA 2ATPA 2H26A 1NJ9A 3D18A 2M2DA 4CKVX 4Z76A 5J13C 3H9YA 3BRDA 1FNEA 4GXFA 4JJ5B 4ZOBA 5FLUA 1O75A 1QZ1A 5FIEA 1U29A 2YQBA 4X7DC 2R2HA 3UYRH 2J21A 4RAVA 2BP3A 1QABA 4YL8A 4QXVA 5FLVA 2NBVA 2IMNA 1E8WA 1HQ4B 3FOLB 1J9SA 1MIML 5F2FA 4YXKH 4KDWA 5EBLA 4ZNCD 5LCVL 4CHMA 5J8OA 2O61B 3VXPA 4YDLB 3HW7A 1N5AA 3QIUB 4MAUH 1HSAA 4X8CA 3ZRFC 1WGQA 4NC2B 5KVDL 2E27L 3BW9B 3RJOA 1OGAE 3ULVF 1EIBA 1MWAA 1AVAA 2GABA 4WFED 1DHKA 4G9DA 4FQIL 4QHKJ 1SXSA 3TJHC 2UY6B 1ACCA 4OLXH 3QDME 4HBCH 4S1SH 2Y06L 1LNUA 3WL9B 5KQ4A 3REVA 5JQ6H 3DI2B 4J6RH 2IQAA 2X0WA 4UQ2B 2KQMA 3CDFA 2H2SC 4R90L 1NMAL 1ZT1B 3DOSA 2DB8A 1ZSDA 3NIDF 2PW2A 2FBRA 1MCWM 2BVPB 4L9LC 1SOXA 4IYKA 3QS2A 1CT8A 2LU4A 3NPSB 4G6JH 1GZPA 4BH7B 4JG5A 5DZJA 2DLHA 2BSBA 3RPIB 1E8XA 4QI3A 1YO4A 4JO3L 5GIRB 3THML 1JPFB 4LLYA 4PY7A 5LQBL 2CDFA 3CX5K 1GC1H 3BSZL 3DXCA 2EKJA 2K70A 3PUCA 3Q8AA 4ONGL 1WBXB 3QZNA 4DN3H 4P46A 2QGDA 1MFNA 3HEIB 4H1LA 4OIIH 1L5GB 5BO1L 3WD5H 5EO1A 2X1PA 3FSSA 1HYRC 2X1OA 1AAJA 4GLRH 5DDHA 3S5LG 3U30C 1MHEA 2WINA 2CO3A 1LP9E 1FZOB 1KIRB 5LCVA 4YGVB 2ZUQB 3IBOA 4YDZA 2MCPL 3L95A 1PD0A 5J3QA 1CE1L 3PDGA 1A6TA 5I66B 4WJ7A 5L9DL 2QV2A 4NN5C 3FU5A 3IDNB 5AVTB 3L3GB 4GMTL 4KK9C 1KUMA 2B1AL 2EDFA 2CRMA 5TQ2H 1JGIA 2C9VA 2VDOH 4ALAL 2RCSH 2VRQA 3B9KD 1XD4A 1T5XB 1A6VL 4TQIA 1WFUA 3FT4B 1FLTX 1U8PA 4CDGC 1OQNA 4QF1B 3NACL 5IFAL 4CADA 4DP0X 4XB7A 3WFDL 4PRHD 5J6GB 2NX5B 1M7RA 3WO3B 3S8FB 4J12A 3SDXE 2PTTA 4XC1L 4B95C 3PUUA 1BBDL 4HGKC 2WWKO 4HX1A 1JPGB 3CGTA 4NJAH 3EO1B 4WW2F 5KBMA 4E5XB 1ROWA 4BSWA 4U05A 4LCIL 3BVWA 4GP4B 4TQHA 2AITA 5I23A 4OFIA 1I82A 2BOBB 3WLWD 5LBSL 3AFLA 1JRHL 4DTGL 3N42B 4X5WA 4G8GD 2KL6A 1I4FA 2XT1B 3T3PB 4JFXB 4PTUA 4X6BB 3VFVB 3BSZA 2QSCH 1GPOL 3RGVD 2GQHA 4XNXL 2Z8WC 2XZQH 4KUCF 5DHFB 1T04A 3BKML 4OJYA 4HT1H 1NCCH 2E7MA 1UG9A 2ZSVB 4XVJH 4Z5RA 4M43H 1LEIA 2A2QT 4YDIH 5T33L 4DOHE 1IUZA 2NY2B 5C92A 4L23A 5E1IA 3RWGB 3TBVA 4I2XB 3MJ8A 4HUNB 2R09A 1V5UA 1ZEAH 4DZ8A 5CIPA 3MBED 4ZUVA 1ZLSH 3IFPB 1U8LB 5DWPA 2OXGB 2ZCKH 4LVOC 5HGAB 5F7KC 1W9XA 4MFHA 4F92B 4KQ3L 3ZL2A 2CBOA 4QHNA 4UOW0 4KK5D 3TEWA 1KBGH 3R18A 1RUPH 5F0JB 3X14A 4HAKA 4WGWB 4HCGA 4APQD 4IRJC 1JZIA 3FUKA 3IFLH 2YZ8A 4HZAA 3W9EB 2Z4DA 1EVHA 1OSZB 5EBWB 4F2EA 1F18A 1WGOA 1QUPA 3FU3A 5KVDE 4AH2A 3QUYA 5I5RA 5J1SC 2LGNA 3M46A 5FXCH 2ZWNA 4JAMA 3UG5A 1G7JA 2QHRH 3IXTA 4YHMH 1HU8A 5JYLA 4HG4J 5I1HL 2PCFB 5ACZB 4GLRI 3RX8A 5D1QC 3RG1C 5JUEH 4KMTL 5LBSA 4XXWC 4DQAA 2ZIDA 2ROVA 3RU8L 1T0PB 3PXHA 1MFEL 2J8HA 1DBAL 3D08A 1A7PL 5IM7B 3DGCR 4K81A 3QIBA 4L3EB 5HDBE 1CK0L 4GNKB 2WVTA 3KWWA 3BP7B 3GMRB 3HFFA 5DUML 3B43A 4PRPD 3M88A 2AERT 2X6UA 3S96A 2XTJE 4TSCH 4QJ4B 1AZUA 3WU1A 1T1XA 4A7UA 3DXEA 2OW7A 4OLYH 1E30A 1FZKB 3BO8A 1A6ZB 3HE7A 3VXUA 4YEFA 4PM1A 5E94B 1KPVA 2J43A 5B22A 5GZOA 2O6DA 3AABA 3D1MC 1KCVL 3VI3A 1DJWA 1OTUD 4HGMA 3KXFA 4YDLC 1NU2A 1S6NA 2EYTA 3BMWA 2XY2A 5HHPA 3ZRSA 4LHUD 5T1KA 3U83A 5GGTL 3WGVB 4JDZA 2DWEA 2P3YA 3TVMB 3LPWA 4M6NL 4BHUI 4M3JA 4N2MA 2YVCA 4PBXA 1ZM0A 5D7HA 2E74C 4DK3A 1RULH 5I0XA 5B39A 3T5WA 2VLMD 1RUML 3WGUB 2YS3A 1RPUA 3E0GA 4M4RA 4ZUSB 4UT6L 5SWZB 2ZYHA 1CC3A 4HKBA 4F27A 1H5BA 4HZ1A 2VMFA 4N2DA 3RWJB 1YEIL 3V6ZB 2ICWJ 2W9DH 3GYOA 1NC2A 5DFVD 2ICES 3ROLA 5A2AA 1WEJH 5CZXD 3LKSA 5FYKL 4KZEL 3PJNA 4ZFOB 1IGTB 3NPSC 3MFGB 4BCZA 5I9QC 1K5GB 3QNYB 4TUKH 5AZEH 4RFOL 5FK9A 5T5NG 2C4FT 3O9WA 4NWTH 3VUAA 3NJHA 2XQBH 2Y4SA 3LQAL 2YAHA 4V2BA 2IANA 4Z7VE 1TJMA 1P5VB 1EAOA 3LPOA 1WBYB 1MJJB 3PJSA 3HB3B 4HJ1A 1R5VA 1S9XB 1MW2A 4KITB 4MA7L 5LB1A 3QBVB 1F8TL 1Z1WA 3BLBA 4BZ1L 2W95A 1I8IB 4J27A 5EFIA 1F4XH 1FO0B 3QNXA 3AU0A 2ZXEB 1DVUA 1LO5A 2D3VA 2Z7UA 3MV9A 4U1JB 4IJ3B 6FABL 2X4PB 2NOYA 2DYPB 1QSFD 2HJLA 3BGMB 3CBKB 4JKLA 5T1LA 5IEHA 4Q7DA 4HWZB 2V0AA 5DJYB 4C56D 3DX2A 4HJ0C 1H6EA 5IUSA 1YEFL 1P2CA 2FHCA 4X7SL 5I19L 3QUGA 1JGVH 1N8ZA 1OLZA 3M7FB 4FZ8H 1RZKL 1B90A 2VDRB 3WS6A 1EZSA 3KWTA 4NO3A 3QO1A 3A21A 1OWWA 2CJTA 1Q9LA 1BVKA 3SD5A 3HW2B 1A1NA 3US9A 1T66D 4LFHG 4UT6A 4ZOEA 2AEOA 3BINA 5KQ1A 3OHXC 4GXVH 4LQ1A 3P0YL 4NIKB 5CGTA 5A2LH 3VI3E 4HOXA 4B7LA 5BNXD 1HL4A 3H3PH 1FIGH 2XRAH 4PRDA 2GJRA 2VSMB 3Q5TA 1NOFA 4EQ2A 4F8PA 2QL1A 3I2CL 4P2QD 4JPKH 5J4MA 1IBGH 5C09E 4QXTA 1IC0A 1Q0XH 1FORH 5TFSL 1HI6B 1JXDA 5K69A 1BD2E 4OZIA 3T4YA 3X3GH 4G70B 2HTLD 1OAQH 2R59A 2OZ4L 4E9QA 4OCWL 1MH5B 2J1WA 4Q2ZA 3JTSB 1FAIL 4I0KA 4KJYB 3PP2A 4F5CE 1EV2E 5E9NA 4BZ1A 1YQVH 4XWGH 2EO9A 5EOTB 1ERNA 1ZVHA 1SMAA 1PTZA 3WN6A 4QO1A 3GXFA 4GSQA 4E42B 4G72B 1ODAA 2DQCH 3I6SA 3T0BA 2J12B 5DD1H 15C8L 2R0ZL 3MREA 1IAIH 5FHBH 5AB9A 1UPRA 1DBMH 1CD8A 4NZUH 2VLJA 5JHBA 2O5YL 2ZE0A 1PJ9A 4FQJH 2OTUB 4KTEH 3VGBA 1NIEA 3JV5A 1HIML 3EYQD 3HRZC 5EMYA 4Q0XH 4ZFFA 4HJGB 2W0PA 2F5AH 2XCMC 2XG4B 5IESH 3HUJF 5T3ZL 3VWKD 1UWXK 3DBXA 4OZHA 3NIFE 2BDNH 3U7DA 2CMRL 3CMGA 4GS7C 1X5ZA 1Q0EA 4M93C 5FFLA 3MCLL 4XE0A 4PGZA 4GOUA 3GGWB 2PYFB 5DK0A 5AW2B 1CFMA 1N7ML 1KN4H 3F7VA 1ZANH 1MFDL 1AY1L 3VIAA 1TU2A 4KMQA 4M9PA 2RIKA 3VFOA 1BLNA 3L7FA 3KPSB 5CP3A 3UZEC 1FGNL 2A4EA 1YG9A 4O2FA 2OZ4A 1QASA 1T22A 1XCQB 2UZIL 3OB0H 4OCYL 3KBEA 3ENEA 4KROC 4ENZA 2V2TB 1RRPB 1RK1A 3BDBA 1Q9WB 2ZUYA 2JB5H 1NCGA 4ZMVA 2XFXB 1XF4A 2VSDA 3KWVA 1G9HA 1XGPA 1IZJA 1ZC3B 4JZNA 5CNHA 5FYKE 1G5GA 1L0PA 3FQNA 1JNNH 1IAIM 1IGCH 1KN2L 1QKZL 4UU9B 1HNGA 1DQDL 2D9YA 4MAYD 4X9HA 1M3IA 2I1JA 1UJTA 4HKJA 3ML8A 1WCQA 2E5EA 2UWEE 4LVHB 1R3HB 5EHFA 5IBLD 1Q9OB 2D2QA 3L6FB 5LNGA 1NCNA 1J5DA 4I7ZC 1C16B 4WEBH 4N0UA 4NB7A 1EGJL 3HPLA 3ZTNL 1JCKA 1AQKL 4M6OL 4AE1A 3WFBL 4J39A 1CTNA 4X7CC 3HE6B 1JVLA 43CAA 2ORBL 2UZXB 1DVSA 4WNQB 1I8LA 3TO4B 2EC9T 1A4KA 4RBPK 2B7DT 2V7NA 1OE2A 5ALCH 1BP3B 4RIRA 4H5SB 3HHRB 4XVUC 3ARQA 2APVA 4U4BA 1KIUB 4BV1A 3D39E 3S88L 1W1DA 3TH2T 3BQUB 4Q6KA 4QXGL 1P3RA 2R29L 4OM1H 4TF4A 3VSTA 4AENB 5LG6A 3BP4A 4FMKA 4JO1L 1BAWA 4M1GH 4WJ5B 3WTSA 4PRAA 2F74B 2ITCB 1DUYA 3TNMB 1IAII 4IW4C 1UQSA 3G08A 4NO5B 4L5FH 3A6CH 2RH0A 4NKDB 1EAPA 5G5DA 1F4HA 3HB3C 3B2UC 3DYPA 2JIXD 3OWEA 3ZR6A 3STBA 2BRQA 1W1GA 4QOKB 3RUGA 5KSVB 2Q13A 2DDQH 3DXAD 3TJHD 4TPRL 3MROA 3DIFA 1XF5B 1H3GA 3GEWB 4IJ3C 4E9YA 2GCLA 5EO9A 2BC4A 2L4OA 3QJTB 3W56A 4I77L 5GGSA 1MUJA 1GSKA 1DQMH 1NDMB 1VESA 4BFIB 3PWVB 1F90H 1SVCP 3IDMB 3MRQB 2H2SD 1H3PH 3MRLA 3QWOA 5SX5H 3MLWL 4GW1B 3HSAA 4IU2B 4Y5YB 2PLTA 4PG2A 3BN3B 1TJIL 3LH8A 4HJSA 5AVRB 4BZYA 3IRZA 3LEYL 1QSEE 1CS6A 1PZ3A 4KKQA 5TF1H 1HILB 4HIIB 1SLWA 1JGUL 5F7EL 4PVBA 4ZMNA 3MLXL 5IB2A 4KDVA 4U2ZA 3AACA 3A8QA 2MPAL 3AMLA 1NFKA 4CDHA 3E6FA 4NYLB 2R29A 4EEEA 3M8OH 1HZHH 4GH7B 4MQ7B 4A2EA 5T3ZE 3NQIA 4NT6B 4GW5B 3ZVRA 1BAKA 2ZKWA 3BFQG 4EI6B 4ZSOA 2WVVA 3MGOA 1MY5A 1P6SA 4GQPH 4S1RL 1Q8MA 3CDGB 2JKWA 3IAPA 4CVXB 3EGSB 4HOWA 1XBRA 3INUH 3QZWB 3TW1A 1JV2A 2B59A 2K7QA 3BMVA 4Z7AA 1PSKL 4Z95L 1NPUA 4KK9D 2OS7A 1H3XA 4JR9H 1I1AB 3RE0A 1LQBC 4DKEL 1L0YA 1XR8B 3NJKA 1T6WA 4L8BA 4LL9A 5L2JA 2Z0OA 3RBSA 5JR1H 1E4WL 2C9AA 1D5IH 4OUUA 4P2OA 4FS0A 3H0TB 1UKSA 1OP9A 5IMOB 3QIWB 2Y1VA 1RZGA 1U5GA 4P7IA 1XH3B 1OB1A 3T8VA 1J9QA 4A2DA 1M71A 4EBQH 1Z3GL 3I75B 4HMEA 4U3SB 3MRFA 4L4VD 4BZ2H 3JWNH 3MO1A 4KUZL 4ONHB 3FMGL 1KG0A 1J1PH 2C4XA 2BCMA 3WTXA 2HG5B 4HWUA 1TYJA 3H6JA 4GAYA 3WYRA 3GUTA 1C5CH 2VLRD 2X4QA 1E6OH 2CBMA 1TQBB 1E5WA 5FOBB 2WPGA 1FHXA 1IL1B 1X5IA 4ONFL 1GS6X 5GS2D 2UZSA 4OCRH 2WIMA 1RZPA 2GJZA 5KZCB 3BEVA 1W8OA 1NZRA 3CDZA 3P3UA 5F71A 1SM3L 4M7LL 5C3TA 4EVNA 4W9KC 1FYTB 2JKIS 3BD4A 4KY2A 1QFPA 3J27A 3IVKB 1MZYA 3OPUA 1JWSA 3FB5A 4L3AA 4OD2B 3FUJA 2V8MA 4Q74A 2PWGA 4WHDA 5A16B 4M1DH 4CMHB 2AVGA 4OB5H 3CFCH 3GM0A 5IJDC 4GEJA 2GSMB 4JO5A 3EFFB 2G2PA 1PIGA 5DQJB 3DJZA 3NH7H 4XNZC 4PRIB 5CMAA 1H8LA 1L4IA 1XSIA 2BVOA 4IMKA 4HAVB 3F00A 4BUGA 2WBJB 3OKKB 4PJ8A 2N59A 4EIBA 2HKAA 3CFEB 4YHZH 4DEPC 1TEYA 4PJGA 4IRJD 5KANI 3O4LB 1I7UA 1F97A 1YEKH 4LP4A 4NNXA 5B8CA 2R1WB 3DMMB 3A4AA 4O9HL 4B5EA 4XPGL 2FGWH 3FQWA 4A5KA 2UX6A 3ZKNC 4OD3L 2AI0L 2F19L 4PLNC 1T0OA 3APNA 4PGDA 1BV8A 5EZOH 1SJHA 5D1QD 1JPSL 2AVFA 4U1SA 4HU8A 1QBMH 3M1OA 2NXZC 3L08A 2XQ0A 3TO4C 2Z1KA 3GMLB 1HDMA 3N5AA 5EV7A 4A6FB 2P28B 2FVNA 3MLTA 5D7IE 1UD3A 1DQLH 5GSVA 5AOLA 1ZAGA 2M38A 2DBLH 1K5NB 5F7FA 1F11A 2A9DA 2X70B 3BQUC 5JPMA 4K7PH 1I3RA 3OKMB 1A1OB 1LO4L 5DZPA 1NGWB 1ZMYA 3VFWA 3MRDB 1W1HA 3U4EB 2WVUA 5CIPH 1XSJA 3KPLA 3SB3A 2Z0UA 3O8XB 4KRLB 1LK2B 4HWBH 5I1CL 4H40A 3WMSA 2VQ1B 4LLUA 1E7VA 5C0RL 4W9HC 5IRSA 5IVZA 2C34A 3ZKMC 1XGZA 2V17L 1HHHB 3OAUL 1JAEA 3MLRH 1I53A 4CNIA 4I89A 1WV7T 4P5TA 1CDBA 1LEGB 1AHMA 3NCWA 3K2IA 4DGUA 4PJDA 3IMTA 1JHKL 5DWUH 2BIQA 2VCOA 3S36X 3RX9A 3UPCA 3CBJB 2VZ1A 4XO8A 2J88L 1HL5A 3D0LB 1DZBA 5HDRA 3F6LA 2OYPA 1J8HA 5E2UL 5GISH 2B4CH 1S3KL 4Y5YC 4R6UA 4MJ6A 2GITA 1QA9B 1GC1C 3O6ML 1JGLH 1M7XA 3QWRD 5GZND 2NCMA 4LLWB 1MCBA 1TZOA 2E56A 3NJIA 4HHAA 3FTZA 5DJ2A 2IALB 2FRGP 4F93B 1DL7H 1HXMA 4PJ5B 1NSNL 3QYMA 1MDTA 4U1NB 4OCNC 2IFFH 3MA7B 5EN2B 1ZSHA 3I6KB 5AW9B 1KEGL 4QYOB 1O6TA 5I17B 5FUCC 3IKKA 1Q9KA 2J2ZB 4CGUB 3ML4A 1OARH 1UUNA 1X7QA 2OJZH 3CFJB 4UOQA 5DD6A 1T4KA 3K6IA 4HJ0D 3SBPA 4Z8FL 2NY3B 4PJAE 1D5BB 4L8DA 4MJIE 2AEHA 4OTXL 5EU7E 5EU5A 4OCXH 1DE4A 1I1AC 3VE0B 3W39B 5J5EA 2G9KA 4EKJA 4HU2A 1DBBH 1E4XL 2ZAGA 2ZCLL 3O11A 3FO2B 4FHKA 1P84K 5LG1A 3BZ5A 1T2QL 1PX8A 3UJIL 2WUCL 2IG2H 3GTTA 5KVEH 1ES0B 1XAKA 1IB5A 2CA4A 4AEHH 2QPEB 5I0YA 3BVVA 1DDHB 4L48A 4RGOH 4ILDA 2HRGA 5F7YC 5CS7A 3HNSL 5D1XB 3W11C 2NX5D 4AV5A 5HY9B 3K71B 4L2YA 3WIHH 5DQDH 1I7RB 4ORGA 5EF1A 2NYZA 5IW6B 4JPIB 5AG8A 1UZ6E 3QAZC 4RMBA 4OFQA 3LSOA 1SEBB 1MPAH 4P3DB 5F6IB 3UXFA 1EXUA 3GJEB 3D4GA 4QTFA 3GF8A 4WGVB 1YY9C 2GAZA 1JZ8A 3SE9L 2B3IA 5DRNA 1UGNA 2FZ3B 1E5CA 4MVBD 2WVSA 4TULL 4GKZA 1ZTXH 3C6LB 4JY6B 2Y5TA 2G0KA 4FYTA 1J8HE 4NO2A 4NKOB 1AGEA 3LRHA 4PJBB 4R7VA 4TM9A 5CD5C 1FNAA 2EIKB 5D7KE 3IE4A 1TZIB 2NY2D 1NPNA 3ES6B 1OPOA 4D8OA 3B8YA 2FL5B 1DROA 4A2HA 4LRNH 2RFXB 2ZPKH 5F9AC 3WNKA 2NRDA 4O5LH 1U91A 3KLAA 1C1EH 3ROOA 5GRVK 4JPQA 2H7WA 2YWYA 4N2HA 4NGHH 2WBJC 5I8KL 4B50A 2KERA 3B2VL 2OQJB 4QR7A 2EVFA 4ELMA 2VUYA 3QPKA 5FW6A 3UZVB 2EKSA 1MCHA 5DEZA 3DUUA 3FFCB 1E4HA 4ZQKB 5CZKA 2AFNA 4ZMQA 3DMMC 1XODA 1CTOA 1KJMB 1OAKH 4BRVA 4EN3C 4CHJA 4I1NB 4Z7WE 2XA8H 1T21B 2UXGA 3ULVH 2CIIA 4Z1PA 5IG7A 1ZA3A 3L4WA 1QRNB 2YGNA 3RB7A 3SDCB 3ABGA 2P1YA 4UT9L 2A73B 3H9HB 1EBPA 1UB5B 2NYKA 1NGYA 4AI7A 4L3FA 2VR8A 4FRWA 4H7VA 2VL5B 3QK0A 4D0BA 2YGOA 4XVTH 5D7JA 5J7CC 4CMMB 4N8UA 2H3NA 4G8EB 3KPPB 5T8IA 3TTSA 3UROR 2NY5H 2B2XL 2LQRA 4YPGA 2HFTA 4PJEB 4RZCB 2A3TA 3PP4L 2XN1A 3STZB 2WLIB 3GRWA 3KR3H 4XN5A 2XWEA 5SWSB 4Z7OE 3W37A 5D70H 3ZW3A 4X7TB 5LAPA 3D06A 5BJTB 1H10A 2FWOB 3UTTA 2DTML 2ODIA 3PNWA 4NQCE 3L3DB 3AU1B 1KV7A 4K5PA 2WTRB 5H2BB 2MWCA 5CBEA 4PCSA 1M2VA 3FBKA 3RNKB 3O8XC 4JO4L 2Y2YA 3WUWG 5F97E 4JM2B 2XOTA 2KCJA 1I75A 2QSTA 3MXVH 4X9YA 5HI3C 2IOIA 1G84A 1I7ZB 4QGYA 3VA2C 3OF6D 2MQ3A 1XWVA 3HZYA 1BXXA 2E7BA 5D4HA 1UNRA 2FQFA 1G7HB 3VGHA 4NAJA 1DFXA 1FZJA 5IY5B 4P9MH 1NUGA 4U6VH 2IV9A 1QSZA 4YSCA 3RWCA 2X6BA 5SWZD 3DI3B 2IH9A 4LU5H 4X42A 4UT9A 4Y89A 4XVUD 3V8OA 3HS0B 3VTTA 2DQHL 1BVNP 5EZJA 5DF0A 2XWJB 4ZUWA 3CH1A 5TDOA 2OMUA 3FU7B 1IGYB 3F83A 1GRWA 4HUUB 3V0VB 1ZT7B 4XWOC 2Y0SA 3VXSB 2ROYA 4LEOA 2CR3A 3APDA 3JBG7 1IQDB 3CVBA 3ZL4H 5IUCA 3B3BA 1IAKB 1X5KA 3T4AA 2P49B 3HB3D 4Y5VA 1FZMA 3GTNA 1WZKA 3B2UD 3OJMB 3NWAA 1BIHA 5F7MC 2ENSA 4MY6A 3SJVB 4GT7A 1T7YA 2O30A 1WWWX 2CO7B 4AE0A 5DU7A 4GAFB 2DYPD 4XN2A 5ISZE 2Y3AA 2L0DA 3CVIL 2NTFB 2R8SH 5JLJB 1AHKA 1QLRA 5DSCA 3LV3A 3GZQA 1S2EA 4UB0H 2NY3C 3L16A 2G75B 2X89A 1ILSA 2H1PH 3MYJB 3UTTE 5A1AA 1AE6H 2DQDH 4FJ6A 1AHWC 2CM5A 1G9EA 2HKHH 3C08L 4UV7L 4CILA 3EGXA 4AJYV 4OT1A 4WI5A 4F9LC 2R2HB 4GSDL 4JFHE 4OLEA 1TYEB 1MCFA 5L8KB 1W0VB 5J57B 3T6QC 3LNFA 2VJ0A 5LGKA 4X80H 4JN2A 5IQOA 5DLMH 3X1BA 5KBNC 1UCBH 3VSVA 5EBLB 3QUML 3DRTB 1LP9F 4JHUA 3NEEA 3T2NL 3MRIA 4PJ9A 4Q9RL 2D73A 4FQXC 1YEDA 3DO4A 1HSAB 1LDSA 2ZKHH 4ZDHB 4YXLH 4G11A 2V33A 4BYHA 4BFJA 1UATA 4L4TA 3K0WA 5I8EB 1AD9A 1NAML 3EBIA 2WUBH 4AQ8C 2BPBA 2F54E 3BAEH 4KKRA 5JDSB 1UEYA 2CBPA 2QPSA 3MRRA 4U1LB 1BREA 3C6LC 5HI4C 3VWJC 1BFOB 1FG2A 3FC8A 3O6FA 1XAUA 3IFNL 1I7TA 2NSQA 3QUXB 4JFEE 1RLWA 4AEIH 1WTGT 1J8KA 3BT2H 1LNUB 4Y5XC 5E24E 5IJKC 2I69A 4QXAB 4LCCA 2CPCA 5HYIA 3SYQA 1NGPL 5F7HA 4KKBC 5K9KA 5KYYB 4I9XA 1WAAE 3HAEA 2WHVA 3QXDA 1PD1A 3TJEL 4ZXBB 4YWGH 3G5VA 4EUPG 5B1AB 4Y4FA 4OFDA 4K8RL 3SDXF 4HS8L 1CT8B 1T20B 4FKEA 5HGBB 1QTSA 4WLCA 4Z9KB 2WAHA 2AJ3B 3H9SA 5INCA 3VXNB 3BLPX 4FLSA 2BH0A 4HUWB 4AXWA 2CDFB 3PL6B 4RNRA 2A6DA 3LH9A 3ZDXB 4TTDC 5MHSE 2FWSA 2PKDA 1DLFL 3WSQH 5JPNC 3V95A 3MLUL 5B21A 1L9OA 1PL3A 1N64H 3GMPB 5DT1H 2WINB 4N2IA 3QUMA 1OD9A 2RBLA 1YNKH 5E5LA 1CLVA 4M7JH 1Q0YL 5TQ0H 2VXTL 1A9EB 2VUOA 2VKIA 1RJLB 2DQIH 5EDXA 3MDJA 1C7SA 3EYOA 3WFCL 2WYTA 2YK1L 2P0FA 4Y4HC 2YEZA 3GIVB 3KPSD 1BQUA 1AIFA 3IDJB 4KVGB 3DC0A 2VYRE 4ECNA 4P07A 3HIZA 4A1RA 3FO1A 1NEUA 1ZA6A 3FTUA 4HK3N 3VA6A 3QDJB 3DKHA 4KJWC 4UYQA 4ZAKB 3QULB 2NZ9C 2OTXA 1U8PB 1F4YH 4F91B 2QVKA 4FQHA 1M7DB 3CLEH 3X11B 3LPFA 3EYVB 1J0KA 4K5OA 1J0IA 2PTTB 4HIQA 3ELQA 4RISL 3ESOA 5KSUB 1RUKL 4B9KC 5JXEA 2HH0L 1RIUL 5BO0D 2HLAA 4X4ME 3L17A 3ZKND 3V7MA 1V61A 4ZW3A 2QQKH 3WAJA 2GJ6E 1MNNA 4D94A 5CO1A 5C97A 2XN9A 2JH2A 1WFMA 3FUIA 3W5NA 4XCCL 4M62L 2C3VA 4D9RD 2XBTA 1T03L 4NC0B 2NXZD 1BVLB 5E08L 4LF3A 5GS1B 5CZVH 5DUBA 3TO4D 3KLHD 3VFGL 5HDBF 2NQDA 3IU3B 5KYWA 1KCUH 4JFOA 3DECA 3WG7B 4N9GB 4S1QH 2WKGA 5F3BA 4Z7QE 1KC5L 2HFEB 3CHRA 1B3JA 2GCYA 3HS0C 1ITCA 3MJ8B 2OM5A 4JGJA 4JCLA 1F1AA 4IKJA 5CIPB 4ZUVB 3BQUD 4FNLH 3O45B 1FDLL 4G71B 4YHIB 5DJ8A 1J0HA 4ZNEE 3M07A 3CVHL 4V1DB 1VEPA 1WVHA 4XHJC 5K39A 3VNYA 1HOCA 4KOBA 5C08D 5LJYH 4XO9A 5HHVH 3RKDC 2MFQA 1BXVA 1RUQH 2CBQA 1XFPA 4GT0A 2TAAA 4BCXA 1R1CA 4I9WD 1ZDQA 1B2YA 3VD4A 3ZKMD 4N0CC 4NCDA 2NSMA 1KCRH 3EYUL 1H6UA 7TAAA 2OSLB 4W9GC 2F7QA 4QOKD 3MXWL 4F8NA 2VLKA 5DO2C 4EKXA 4D9LL 1SVBA 2J71A 1BDYA 1Y6NR 2V6HA 1WI1A 3EOBA 3DV4A 3NA9L 1RVFH 3GMMB 1W72L 2PWFA 2GSIA 4LLMA 1HXKA 2FD6L 1HYSC 1WGVA 1U8NA 2C7UB 3WN5A 3IJYB 4X8XA 4G82A 5I71B 4HH9B 2VQTA 1SXZA 3WUWA 1OP4A 4V2CB 1JSYA 3QIBB 3QJFA 3TT1H 4AYFB 5C5BB 4LSPH 4NJ9L 3ULAB 4OZFH 4ANWA 4C57C 4XH2B 4NUQA 4HPYH 1QWNA 2KZWA 4FGMA 3RGHA 3KAAA 4FERA 4X5QA 4Z7VF 2VSCA 5HHXL 3GDBA 1JZ5A 1QLEH 1G0YR 3PHOA 1FG9C 4NY0A 2PYEA 3P4NA 5C0DA 4GI6A 1EO7A 4RWYL 1E27A 3CVHA 2OXHA 5H8DA 4A2LA 1KY6A 1D5ZB 4O2CB 1WUNT 2D9WA 4M5YL 2FATL 1YNLL 4JDZB 3MCKA 3ZKSD 4RA0C 4MDIB 4PV8A 1MAMH 4N5EC 1A6WL 5IBTH 4F9PA 2OJEA 1OAYL 5HGDA 5JQIB 1I1AD 3VTAA 1N6QL 3G6DH 4AL8C 3QUXC 4HUCA 3L48A 5AW1B 4XOBA 4DK5A 1H5BB 4Z0BL 2NY7L 5IW1A 1GYVA 3Q44A 1GIGH 1XGQA 4XPFL 5D2NB 5IQ9A 1P9MC 4E68A 3JWNC 4ZXBC 5FHAL 2K6YA 3GB7B 1BYPA 2IDQA 3SDYL 2XA3A 3MGAA 1LGVA 3W11D 1Q67A 3LN4A 4D8PA 4G3YH 4B6ZA 4Y2DC 1RZJH 3BVUA 1WAPA 4HJJH 4H13C 3H3KA 2ATKB 3DX9A 3OSVA 5FK9B 1D5MB 5LWYH 1FJ1B 4PGCB 2P8MB 1DVFB 4N87A 3Q2CA 4G6KL 3T8XB 4E41A 1N6VA 1EZUA 4M48H 5B38A 3PL6C 3PJSB 3ERXA 2EH8H 5E8OA 5FO9A 1GMEA 2YGPA 4UTAA 2KIEA 1AR1B 1YY9D 2KYIA 2WBWB 3N9GL 3QBTB 2FR4B 3MRGB 2W91A 1SMDA 4LPUA 3MV9B 2EDJA 3ZKQD 5IQ7H 1MHCB 4AUUA 2HJLB 2G5RA 5E6IB 2VXQH 4K3JH 5E4IA 1M1XA 1ZLEA 3KCPB 1IKFH 3J8F7 3CXFA 1AGBA 2ZOKB 3G6JA 1NMCC 4YVNA 3EIFA 1BXUA 3VGEA 3QO1B 4OLUH 2G2RB 5E1AA 4PRID 1Q9LB 4MD4A 1AR2A 3K2KA 4OJFH 5I5IA 1IGFL 3VRIA 2EH7L 3QR0A 1HL8A 2PO6A 2WBJD 2DM3A 1L7IL 5JHDE 3MRBB 3NAAL 1MQKL 3KLLA 4XPTL 2CLRA 1S7QA 4WI4A 3E1ZA 3L3IB 3ZYZA 1U3JA 2EVIA 3VD7A 4AGMA 1GGIL 4ZZKA 5GS0L 5KSBE 3O4LD 3NIFF 5F7LB 1ZYIA 2YAMA 3L1GA 4FYQA 3EBHA 4K5LA 1ZVNA 1JNHA 3RBGA 4WRLA 5BMFL 1WJMA 3DMMD 2I07B 4EN3D 1SRDA 1R33A 3CJJA 4X5XA 3PV6B 3Q9PA 4YZFE 3ARBA 3RWIB 5L88H 3FONB 4MDRA 1FIEA 4ICXA 3D0VB 4WU7A 4JJHA 4HCRL 5AVWB 4K2UL 2WBXA 4YDKH 3ZUNC 1X05A 1UA7A 1E6JH 1XL4A 2Q0ZX 2AQQA 4EI5B 3QUZC 3NIDB 4MD5B 3V5KB 1OF2B 5GS1C 2NNFA 5C0AE 2Z13A 2MQGA 4NXKA 1PG7W 3CD4A 3GQFA 2PCPA 4QO1B 2VC2H 3KGUA 3Q1EA 2E9JA 1LO0L 2X4RA 3TBWA 2GK0A 4I48B 4TYZA 3OKOA 4OFKA 1RJCA 3MLVH 4WCYL 4J2QA 1JVOA 5CILH 5IV2B 3O3BA 1KIPA 2ED9A 2J1XA 3F62A 1GZHC 1A3RH 5BRPA 1CF8H 1B6UA 4TNVK 1KIQA 2UWEF 3TONA 1IEBA 5AOIA 4JFDE 3H42H 3I02A 1JIBA 1ITBB 4L37A 3O8XD 5DVOA 3EO0A 4BD4A 1SBSL 4BKLB 4JPVL 5HI3D 1FHNA 2XKUA 2FWUA 3DBXB 1G7PA 2Q86B 4IIQA 3R1GH 5HHQA 2XKNA 3G6JE 2J4WL 4KHTL 2WJ5A 4URKA 2VM3A 3VOQA 1EO8H 1Q1JL 3LQZB 2YC1B 3WIAA 1E28A 1PQZA 5EC2A 3C5ZB 4Y9CA 5E0QA 3LKOA 3REWA 3DGDA 4G2AA 3OG6B 1FNHA 4LQFH 2GJJA 4ONOA 3VFOB 5EIIB 2ZXQA 1UPQA 3WDIA 5IROA 4G1MA 3RNQB 3WEXA 5F3HA 3ZHDA 1MFBL 2M83A 1MJ7H 3S4SA 1XZWA 2X42A 4KAXB 4K7PY 4R97B 1J0WA 5I71C 2LT9A 3QJZA 5I8CA 4ODWA 1D5XB 2UY7A 1B4LA 3AUVA 4XWOD 4WW2B 2IPUG 3EJZC 2OX5B 4HHGA 3BRGC 3BSHA 1FB8A 2GTZA 4HSAC 4NQEE 3GBML 2WLLA 4G59C 5FUZH 5DD3H 1ZOXA 2B15A 5CEYA 2E8ZA 2XV6B 4ZOCA 5T1JA 3GRWH 4HKJB 3HRPA 1Q72H 5CAYB 4LASH 3F7KA 4QRAA 1CI5A 4RQQA 2DIJA 3LIZH 3WJJA 5I8OH 1TQCB 1YUKB 5HYFA 2IJ0C 4PJ5D 3MUGB 1GW6A 2BY3A 4HPOL 3IDIA 5E2WL 4WI2A 1VFAA 3H56A 3ULUE 1OSPL 1M7IA 3VD2A 4JFYA 5JOEA 2VM4A 1NFAA 5BVPH 43CAB 2AF2A 2FB4L 2NY3D 4BQCA 2BNQA 4TSBL 2M14A 1AFVL 1IAMA 1KGWA 2CLVA 4I3SL 4GEIA 4R7DA 3DUSA 4R7LA 4F7TB 4HJUA 2VWEC 1KZQA 1AH1A 4FTVA 3O6KH 4LAQL 4AKQA 3UTQB 4FFWC 4FXKA 5D2NC 1HSBA 5JW3L 1V3MA 3K5SA 4YDNA 5C6WH 3QPXH 3SYPA 4JDTL 3T2OA 4XBMA 1AS8A 4PRAB 4F7MA 4J1UA 1OD7A 5AD0A 4L3CA 1URZA 3RWHB 3QQ4A 1AO7E 1DVFC 1YYLL 2XWTA 4IOSD 5AW3B 4Z78B 5I1JL 4PLJD 5C7XL 2TRYA 4ODVH 2I5YL 4GIOA 4J6IA 4K5NA 1AR1C 1U92A 2OK0H 3LNGA 4PS8A 2BM3A 2H47C 4H8PA 4MXWL 5HI4D 3HNVL 1DUZB 3C6LD 4XCYA 1IRAY 3GMQB 2ITDA 5EOCJ 4FL4B 4F1ZA 1IJ9A 1U5EA 3T77A 1XH2A 2AJVH 4M61A 4LNRA 4N3UA 2ESVD 2VMCA 5E6IC 5C0BA 4XMUA 5GGSB 1VFOA 4LCWE 3BE1L 2P5EE 3D8FA 1VF5C 4KKBD 1OPGH 3PGDA 3QZPA 3AGWA 1L6PA 4IDLA 3MRLB 4DP4X 1UURA 3NZHH 2BHYA 2LOXA 5DUPL 1NLBL 3AWFA 2HT2C 1AXTL 3JV4A 4XMPL 2DZEA 4YBLC 4H25A 4NQDE 2P4AB 2HPOA 4RGNC 3UERA 3LB6C 3VXME 1ZK9A 2W2XC 3TBBA 4GY4A 4HXAH 3ULVC 5GGVL 3EW3B 1OAZL 3ARWA 4TTDD 3RA7H 2YEQA 3FFCD 3QFJA 3L5IA 4LL4A 1CFQA 1EX0A 2Y3NA 1CDIA 1QRND 1OQOA 3LRSB 4G7VL 4N90E 5E5RB 3SDCD 4AUYA 4GW4B 3CZGA 4DCQA 2VITA 2ICEA 1LK3H 3O0LA 3UOAB 4KH9A 4NM4L 4R0LB 3HBGA 2NY5C 2B59B 2EYRA 4X4ZA 3GK8H 4Y4HD 5FKAA 5EUOE 4ZFGH 2F2HA 2AEWA 4OLWH 2GBUA 1ONQA 3C2AL 3MFFB 4P99A 6PAZA 5FM8A 5TH2A 1VACB 2VQUA 5JMOC 5L2JB 3V55A 4U3XA 3AAZA 4OUUB 4DK6A 1ORQB 4G7RB 2WOYA 4KJWD 1RZFH 2A6JA 1L9NA 2NZ9D 1XCTB 3KPOA 5HHME 5HP5A 3K6OA 1YPZA 4BFEA 3DROA 1OB1B 5T3XH 4F7PA 5I1EH 1E4KA 1G6RH 4RDQG 5BVJB 1J86A 3HAEH 3MRFB 3MO1B 1TITA 3HMWL 1XQ4A 1AXSA 2IYBA 4XTRD 5T5NF 1WISA 1ECYA 3SE3A 3U9PH 1GXEA 2FIKB 1XX9C 1NUFA 3QDGA 2D7QA 3AUWB 5J1AB 1YEJL 4JM2D 4GAYB 3RURA 3V52H 2FE0A 5JXAH 1ZY9A 1OSYA 3SNHA 4WV1A 4GUOA 3IDXL 3L2NA 1NEZB 4U7SA 4JHAL 2B0SH 3MNMA 1C08A 5D7LE 1CDGA 5IHWA 1CZ8H 1EEYA 3AREA 4JJOA 1D9KB 3C5ZC 2V2WA 3FT3B 4ZYKB 5D7IF 4QT5A 1EAZA 4DGIL 4WSKA 1JWSB 1RHHA 2NYYC 2E75C 3FB5B 2AEQH 4N0RA 4WEMB 2CUMA 2R39A 3DTXB 2WP3T 5C0CA 1NBZB 3FB7B 4JHWL 4GQ9H 2WTPA 4R4NC 4A7VA 1HH9A 2IVFC 5EU6E 4IBTA 2P5WA 1X7SA 3HQCA 1V5JA 3G9VA 4R97C 2WW8A 3MBWB 4HFUH 3VXSD 4K7FA 4WW2C 1OP5K 2MIZA 4PS4H 1KCWA 1OP3K 3M1BA 5E9DA 4NKIH 4PJGB 3RKDD 2ICCA 4DJMA 1G9MH 3IJ7A 2WZ0A 2LLLA 5C07A 4D0DA 1JZEA 1KSRA 4AW4A 4HUVB 3U79A 2Z0BA 4N0CD 1E5YA 1UFGA 4WI0B 5C71A 1ZE3H 4I87A 3SJVD 1JYVA 4F7KA 3N04A 3PFUA 5DO2D 4EOWH 2VDKH 5D2LE 4NQTA 4XOEA 5BZXA 1TJGL 1CGUA 3VXTB 3ZHNA 2OL3H 5KTEH 3RIAF 1CN4A 2EIJB 3MR9A 4OZFB 5JIPA 1HYSD 4M7KH 4M6MH 4S0TD 2VXSH 4OIFA 3CXHJ 4ABUA 1FCCA 1JMXA 5C0IA 2VMEA 3EYFB 5DVLA 3TPUB 3HK0A 4NQQA 4FFVC 1Z7JA 2HSIA 1QLEB 2ZSWB 1KF9B 4ORZC 1XGUA 3HUJB 5IHHA 3QXWA 5JYMA 1HZLA 2P24B 3VRJB 4JFZL 3C8DA 1IQWH 3FT1A 2COAA 5ITBH 1A3LH 2O6PA 2R0KH 4U3CA 1E9OA 4D0CB 5HYSB 1UXWA 3FPYA 3O3EB 1N5YH 3BJIA 4F2MA 2IAMC 4DPBX 2XV3A 1AP2B 1HCFX 2F53B 3KVDD 4LLUB 4WNJA 5GGUA 4Z3JA 1N8OE 5IIEB 5AAWC 2ZCHL 1ETZA 5L8JB 5ENWA 3LQMA 1CFNA 2GT9B 4PJAF 5C0CE 5BW7C 3L2MA 1G7MB 2WNWA 4ZS7L 5K9JH 2ARWA 1MRCH 1S7TA 3FTWA 2CRIA 3CLWA 3KBFA 4YHOH 3QUXD 1F00I 2IWKA 3ZHLA 2JTDA 4LPYA 4PIRF 2Q8BL 2BNUB 1QWUA 4S0HA 4L4JA 2BCJA 4PBDA 1XF3A 4MA3A 4LOVA 4ZXBD 4S0SD 5ELIA 1MNUH 3QEUA 4UIMB 3UC0H 4WVFB 3G6AB 1ACXA 4HUMB 4MJ6B 2D2CC 2BWQA 4Y2DD 3S8GB 2DMKA 1VJSA 5GRJL 4Y9EA 4KJQC 3N2JA 3ARYA 3QJHA 3TZVC 4F7UP 1K6QH 1W0WA 4ZFZA 5CUSL 3RDTB 3UP6A 1UXSB 4F24A 1E90A 3PL6D 1CICB 1HTYA 1M7UA 1OW0C 3TWCL 2YT1A 1RD6A 1OE1A 3OVUB 3WKML 2EVGA 4U1MB 5DHMC 2WIIA 4YEEA 1ZXKA 2W1NA 3WI9A 2O5ZL 4Q58C 1MHHA 2J73A 3IWVA 2A9NH 5I18H 2EO7A 1Q9KB 3X1NA 4MD0B 1MRDH 4R0LC 4IFSA 4FKHA 4ODSL 1KELH 4AK2A 3IJEA 4N1EA 2K45A 3BUBA 3DDGA 3OKLB 4KZDL 3F5RA 2YMTA 2EJ8A 1ORSB 2XZAL 3O11B 4UQ3B 1YJDC 1O9ZA 4KKCC 2MQ0A 1MJUH 3ZQXA 1C5DA 2N7AA 3QDJD 2K4AA 3GDCA 3B9KA 4OIAA 2BRRL 4R5VA 2NW2B 5EC1A 1FRGH 4K15A 3FCTB 1OGSA 5ADPL 2A1WL 2Q20A 3NSFA 5AKTA 4PRHA 3A47A 1W6LA 1RERA 4WZ9A 4ORGB 1FWXA 3LEVL 4LP5A 3X17A 1CBVL 2JF1A 1S7XB 2DAVA 3JT2A 4Z7WF 3FU6A 3RWFA 5I76B 5L0QB 1K3IA 1I8MB 5LNEA 1J1OL 1HEZA 8FABA 3HZMA 4WHCA 5T5FL 3C5XA 1VLXA 4G42A 1HHKA 2YRZA 3L5JA 4F3FB 2YFOA 4LVEA 3IFOA 4G8GA 3WHE1 5C9JA 1YEEH 2QKIC 2W65B 3I9PA 1BQSA 4URTB 2VC2B 3AU5A 3RGVA 4PJCA 3HBPA 3CFQA 4KFMA 1D9KC 1TFPA 1BM7A 2IF7A 3IRCA 5DJZA 3LKQB 4XMWA 2E7DA 5HVFB 2C9QA 4F8QA 4HIXH 4Z7OF 1MF2L 4ERSH 4GP5B 1FC1A 4LVNC 4BWUA 1X7TA 4P49A 1GZQB 2VIRA 1EFXB 3TWYA 3FCSA 4FQ1H 4M29A 3DV6B 3MBEA 5KAQG 5MENE 2WMPA 1VEOA 5JW4Q 3U7YH 2IBZY 1BQ5A 2DW5A 4HLZH 4NKQB 4V1DD 4B9CA 3QEQE 2F5BL 2FYYA 2WWKT 3AWEA 1ZLWH 2Z92B 2AJUH 4JREC 1ADQH 1ET5A 4XI5C 5C3LD 1MIZB 3GSRB 4APQA 1KYUA 4RSYA 1JF1A 1YC8A 4JFQB 2EKSB 1PLGH 4HS6A 5AVQB 2CO4A 1XR9A 4AV4A 3VAEA 4IBYA 1JTPA 1MLBB 1HN1A 3R4RA 3SYCA 4FLRA 4W4NA 5EG6C 1T5WB 5DC9B 4WWPA 4XN1A 5TE4L 5CCKH 3MLZL 5GRXG 1JJUA 2FECI 3DX4A 4JDEA 2VDLL 2J1KA 3QO0A 3CN1A 3S34H 5T5FA 3HMXA 1SQ2N 2RQ8A 3C60B 2MKRA 1MHPL 4PD4K 1MWOA 3NJJA 5DMIL 3TA3C 5D8JL 4CVUA 1P53A 1UYWL 4MDJB 4Y19B 3LVEA 4Z7UE 4AZ8A 2GYSA 3P4MA 3MJWA 1MJ8L 5CLQB 4NQVA 4I4WA 1RFDH 3WNIA 1P6FA 1UVQA 2AJZA 1KTDA 2D7OA 3EJZD 5EF0A 5J06A 4BBKA 5C0FB 4PRPA 1PNCA 4MMYA 5ADOL 2QQNH 4DKAA 1JF5A 4EDXB 2CCLA 2J1ZA 3FN9A 3LZFH 1JFQL 4J3VA 1G4RA 5HVGB 3U7WL 1FFTB 3KHQA 3LN5A 3FQTB 2KLTA 4L8SB 2DM2A 5BZDA 4PJCE 3HZKB 1T1ZA 5KVGH 2QADB 3UMTA 4ZPTA 4A7GF 2O5XH 1NGXB 2E0PA 1CURA 4MZ3A 4LHUA 2R7EA 4Q6IC 5FI1A 4X0KB 3LXBA 3R19A 3C9NB 1XGTB 1CLYL 5CLLB 3IB4A 2E6JA 2I9TB 2DYNA 4RGMB 3OZ9L 4AT6B 3ZIMA 2Z59A 3J7HA 4CSSA 1UD8A 1SOQA 5CSZA 3NSUA 1AWEA 2NZIA 1AGFB 5ACLA 2GC4C 1RZJC 4FFWD 2DY2A 5CGBA 2DHJA 3D34A 5DJ6B 4AQEB 1KFAL 3QWQB 1FHGA 2EUXA 5D7SL 3WTYA 3WE1A 4AQZA 4UT7L 3IT8D 3OAZK 1P4LB 1RHFA 1T7ZA 2ZYRA 4IU3B 1DVFD 4C58B 2FBJL 1HEHC 5JORB 2JJSA 3QJVB 3T4AB 1XXFC 2ENPA 2VAJA 2ZAIA 1RIHH 4Y5VB 1DSFH 4FQIH 3R0NA 1OP5H 2HT3D 1AR1D 4PV9B 4R5XA 3DX8B 3A67H 4MTMA 1Z9SB 2PP7A 1T89C 2CGRH 2FJGA 4PW3A 1OHQA 5CD3A 5IF0A 1RKRA 3RRQA 3MBXH 1DYNA 2X0VA 1QSFA 1G4MA 5E6ID 3MNVB 4R90H 3K46A 5CR1A 2AQTA 4HGWB 1WAAF 2ADJB 5K93A 4C56A 2X9ZA 1P4BH 5IR1A 3WEAA 3F64A 2MNUA 4KQ4L 3IXAA 2HP4A 3GPSA 1V10A 1X6NA 4S1DC 3U6RA 3VXQB 2BO0A 2HT2D 3GNMH 3BN9D 4P3CL 4ONGH 3DRQB 3HG2A 1TCRB 4KFZC 4KDTA 3LB6D 4Y7OC 3GZOA 3RDJA 2H9GA 2W2XD 4R2GC 1THCA 3U2JA 1YRKA 3VD1A 3ULVD 4XX1G 3QI9C 1WZ1L 4MNHB 1CYWA 2FJFA 2EECA 1YY8B 4P2QA 3TIEB 1KXVA 1YECL 2LAGB 3BZ4B 4FQLL 3RVTC 3PSCA 4TNGA 3EXJA 3MC0A 1K4CB 3TFBA 1YN6A 3KWUA 1KZGA 4EO5A 3E3QC 2P8VA 4L4TB 1FV1B 2IC2A 2NUPB 4ALAH 3P02A 1BTNA 1Y1UA 3GLDA 3GMOB 5H35B 2GUMA 1YLBB 4HS3B 4EI5D 1U2BA 4ZX6A 4LCYA 3ZTCC 4KVNL 3ECBA 3MJ9L 3PDOB 1ZRUA 4HD5A 4U4IA 3VGAB 3JYBA 5EU3A 2VR9A 1JXFA 3NACH 1ZLDA 4LCCB 4YE0A 3HLAA 5EO0A 1G6RB 3TOPA 2NQ3A 3HAEB 3QXDB 4NHUB 5DZNA 4XN7A 4HWNA 4XC1H 2WZ6A 2EUVA 4O2EA 4K55A 4OF7A 1NCOA 3ATBA 3F58H 1MI5A 3TBTB 3VXOA 1ID2A 2B39A 3KYKL 3D4ZA 4GG6A 4DUVA 1RK0B 1QACA 4JHBA 1JHLL 4RVBA 5INCB 1SDYA 5DRXA 2H6PA 4AWJC 3CFKB 1M6OA 1T83C 3KL5A 2PP9A 5ID1B 4XNXH 3FKUS 2H8PB 1U3NA 3VWKA 3BVNA 1P69B 3GO1L 2VABA 3N1PC 4AC2A 4PLOB 1G43A 4OAWA 4PN6A 4IM8A 3KNBA 3VFTA 3C5ZD 4CN6A 4NP4L 5FECB 4Z7QF 5DEFA 3KYNB 2C8NA 2NYYD 5IWLA 1XF2A 4Z7NE 2DWXA 4LP8A 4MCZA 3C60C 4PTTA 4RETB 2P8PA 4WHTA 1TZHB 4R4ND 1BIIA 2ADIA 2NMBA 5FV2A 5JW4M 2UZYB 4HSCX 4HAFA 1F42A 1EANA 3KLDA 3MJ9A 2I60L 3UACA 3WIFB 2C9XA 4WFFD 5D96C 2XWCA 2ZG3A 3GKZA 2ARJA 2KPWA 3TFMA 3R7QA 4FQHB 1WFNA 2O6EA 2V7HB 1RMFH 3FB8B 3D25B 4MAYA 4X6DF 4ZO8A 1KTRL 4XOCA 3SKNA 1DTUA 1CWVA 2DEWX 2J5WA 1JK8A 2VDKB 4KUCD 2B9BA 4K3HA 5I1HH 5F89B 1NDTA 3SHSA 3ULSA 2QTEA 2GIXA 2OL3B 2G3XA 3Q0HA 4MHHI 1LTXA 4KMTH 3RU8H 2V8LA 3EUDA 2EC9U 3BJ91 2VW6A 2ZWZA 2FQDA 2MHAA 2B1HH 4IDJL 1ICTA 3ZT6A 4UINH 3ALXA 4TLSA 3HI1B 1U8IA 2JXMA 2CDGB 3V0HA 4LF3B 5DUMH 2MDXA 3GHEL 3S0PA 2Y8GA 1BWWA 1MI5E 3TN0B 2AKRB 5DHVA 4BEIA 5C0JA 5KVFH 1QHPA 3QORB 4N8VA 3S3PA 4FFVD 4PJHA 4I88A 3A22A 3WFHA 1MCKA 3KZ8A 2P80D 4FHBD 1ZS8A 2FT8A 3ZKXB 5DJ8B 5I6PA 4NRZA 2VXUL 4H0HB 5K39B 4WTZG 2Y2TA 1R5WB 1AS7A 2HN7A 1UD4A 1KFGA 5GGTH 3CFNA 4W6WB 3O2WH 1JPTL 1T6VN 3S37L 3U9UB 2JJVA 3LKRB 4MASA 1UHVA 3SD2A 1K8DA 4PG9A 2JIXA 1EJ8A 3BIKB 2F0CA 2QGEA 2EDHA 4QTIL 1ND0A 1KXQE 2BVTA 3DXAA 3SY0A 1WA1X 4FKKA 4A6YL 4BM7A 4JANB 3EG9B 3NZ8B 5FM5M 5ICZA 3GSWB 3T06A 3F7QA 3GMNB 3D85B 2RA1A 5FGSA 1ZK5A 4W1TA 1TNNA 2X41A 3MUUA 1MFVA 3GXPA 3Q7JA 5FYKH 1U8NB 2VKWA 3WN5B 1KEMH 4E5XG 2DTCA 4TOYL 1M1SA 2X05A 2Z8VC 1J7VR 4GSUA 1DQKA 2QDVA 1S7WB 2AXJA 2YHGA 4L9LA 3AQYA 4P2YA 9CGTA 4WTWA 4BGLA 3TZVD 3WE6A 2MTAA 3IBEA 2N56A 4N2BA 4XRCA 5K9OA 1IC4L 1U3HB 1SN2A 2WXQA 5TPWL 5LHDA 2C1OA 1Q1PA 5TGBB 3N1FC 4GAJL 5TE6L 3D69B 1HH6A 3UBXI 1N3NB 5C0DB 4CN4A 6FABH 3GHPA 1Q90A 3BDXA 2IWGA 3I85A 1M7EA 1JTOA 1MFMA 2DQEH 3OR6A 4PWJA 1FSKC 5HSFA 1I9JL 5KYXA 3NP3A 3MGTA 1I9EA 3F0WA 3SKOA 5HGDB 1Y0LA 5IVNA 1REIA 4N2NA 4G5ZL 3MNZB 4FQ2L 4DKFH 2J1YA 4KKCD 4A6YA 1KGJA 1TJHL 3MRJA 5LGHL 4R26L 1DEDA 4JQXC 2BIHA 3PVLA 5MP6H 3HI5L 5KSBF 3I2CH 1E7UA 4AYSA 4YX2L 2ZOLB 1RZ8B 5IB4A 4D8PB 5EEXA 4LSQH 3GSUA 5TFSH 1NPJA 4L4VA 4YZFF 3ULBA 4OLZL 3V5DA 3QDMB 2F1AA 4JHVA 5EN3A 3U6XS 1Z32X 1I1CA 2K4WA 3RY4A 2CRZA 3LNEA 4OCWH 3ZR5A 5B38B 5F1SA 4M5SA 3FB6A 1FAIH 2WTOA 4JHZA 1HHJB 4KGJA 4Y16B 3HIEA 4JZJB 4Y9BA 4YL4A 2FLRT 1RU9L 3OXRB 1KB9J 1JD9A 2VLRA 2QPUA 3OAZH 4MYWB 2OMVB 4ESKA 3NSCA 2EVHA 1OCZB 1XGYL 2YEVB 4IBSA 2L2IA 1D9KD 1S8DB 3U2SB 5JOFB 2Q7YB 1ISNA 4XMXA 3W82A 3BAYA 2YD2A 2MTPA 2OR9L 3CN4A 4FI6A 3L1OH 1DFBH 2PP8A 1SY6L 5FYJU 3HA0A 3D51A 5DTFA 5I2IA 2Z3FA 2X4NB 4NRYA 1QVOB 1DO5A 1OEZW 2APBA 1HIMH 1X5LA 3PPEA 5KOVC 2FYVA 3OGOE 3VMOA 3ARRA 3DHPA 1INDH 1CR9L 2EDNA 5T3ZH 1JYXA 4GB9A 4XI5D 2ZG2A 3FTSA 4S10A 4EXPX 4FA6A 2ZP0T 4IRJA 5BQDA 2F1BA 2X40A 4KVCL 3H7BA 5GPRA 1XBDA 3BD5A 4TVPL 3NFPA 4IRZH 2QDWA 1G5AA 2XACC 1LM8V 4LPCA 3TESA 2EDMA 4ANVA 4GINA 2YPKA 4LDEB 2RALA 3ETBF 4MNGB 7FABL 3TIDA 1LO3H 1TZGL 2QFRA 3AG3B 5SX4H 1MEXH 2J6EL 3CHXA 2UZIH 3CAFA 4N0YL 4XGZA 5D1QA 5GRUL 3T6VA 4J28A 2WZPD 4HEMA 4YSUA 3D48R 4TVSa 3SDXB 3TA3D 2L1CA 2OP4H 3IETA 2EC8A 2PCPB 3TN0C 4XB3A 4DAGL 1N26A 3GBNL 1B9KA 3QORC 2PWEA 4N8CL 1CFVL 3WFEL 3UDWC 2UZRA 1H19A 3BUTA 3EAKA 1J5OL 3MJ6A 1KENL 3PWNB 3MOAH 1SY6A 4W9IC 4XCNB 1K5DB 5D71L 4ZUTB 1JK9B 2BHUA 3WTWA 2OTPA 3S36L 1U8OA 1HQ4A 1NL0L 3T0AA 1OCWH 4UM9B 1EGJH 3FOLA 3SKJL 3ZTNH 3EGDB 5CJ8A 1GJIA 5JDJA 1AQKH 4M6OH 5CEZD 3ULUF 2O61A 3VNZA 5E6ZA 2F53D 4XB8A 3QIUA 5GGRB 4XX1E 5HYJE 4IIQB 3LMJL 5DD0L 3BW9A 2YT2A 2XKNB 1TCMA 2IADA 4JFPA 2J56A 3C5JA 1Y6KR 3U1SL 1KBBA 1PQZB 5FV1L 4LDCA 2W92A 2UY6A 3B56A 3S88H 4QXGH 4XP1L 3AXLB 3DX7B 4OQTL 1G9NL 3NFSH 4N22A 5E4EB 3VU1A 3L4ZA 2J6EA 3UC2A 4MSWB 4A7SA 1JNLL 1NCAL 5IT2L 2W5PA 3LNIA 2VN3A 4EDWL 1QSVA 3S4SB 3WNPA 5BRZD 1ZT1A 5I8CB 2SEBB 1HX0A 1D6EB 2BVPA 3M86A 1EGXA 5GJSH 3ZLQC 3CU7A 2GTZB 4BH7A 3UH8A 2J8UB 3L4CA 3QWRA 4YC2B 5IQMA 1A7OH 3RPIA 5GZNA 5CEYB 4J4PC 5FYLD 1U3HC 5AW4B 4O02L 3RDTD 5GIRA 2MJWA 1JPFA 4Y0GA 1CICD 1WBXA 4TPRH 3U4BL 4KZCA 5KS9B 1L5GA 1TTFA 3N43B 4G6MH 2XXMB 2YXWA 2V3FA 5D3WA 5ABZA 2OMBA 2AK4E 2Z0PA 2DI9A 2APWA 3L3JB 1W16A 4OJDH 5ICYB 2YPLE 2JLLA 2X3CA 3P2DA 5MERB 2WXRA 2R69L 4L0PB 4MNQE 4YGVA 2Q9OA 2WLHA 1DQIA 3O3UN 2XTJB 4QY8B 4AGNA 4F80A 3WY4A 1GVIA 1UD5A 2H32H 5I66A 3MLWH 2CXGA 2BNQB 3LEYH 3L3GA 3VG9C 1UM5L 4EN2A 3DUSB 1FQ9C 1MW0A 1F6LL 2F58L 1RP8A 2ZP9A 4S1DD 3N50A 4XBPB 2W8CA 1T5XA 2X3BA 1UEFA 3OHXA 3FT4A 3O6LH 4JQIL 4OQTA 4GPTB 1DSYA 4JB9L 4NN7B 5HDQL 5GGQH 4R2GD 3LS4L 3G9AB 2YPVA 3QI9D 2UYLB 1NBQA 3BWUF 2NX5A 5J6GA 2F7OA 3H85A 3ZHFA 4TVPE 3BVXA 3L5HA 4TMPA 4W6YB 3RVTD 3JVFC 2HX8A 3VM7A 4BWTA 4E9XA 4QNPE 5KYNA 3EO1A 1UT9A 1LYQA 4NOBA 5E23A 4D3CH 4N6RB 1PSKH 1UNQA 4Z95H 4QXUL 2ZOOA 2BOBA 4IBQA 1MAIA 4KKLC 4JZJC 4Y16C 4DKEH 1GOHA 4HMCA 4MA8H 5EUOF 5K5YA 1VDGA 4JDVA 4JFXA 2CNYA 3VFVA 4NI3A 4FLQA 4OD1L 5EZPA 4P5RA 4JW3A 4XCYB 2DI7A 3CHQA 2ITDB 3CTTA 2E9IA 1AMYA 1ASOA 4U0RC 4OIBA 1YSOA 2ZSVA 4HLJA 1TMCB 5IGXL 2R69A 1MRFH 5M4YB 1EVTC 1Z3GH 1MCNA 4RRPA 5B1JC 3RWGA 4I2XA 5IBUB 2X5PA 3U9WA 3OKNB 1P5UB 2Z9TA 3W2DL 4AG4H 3FMGH 1U8LA 2OXGA 4PGEA 5HGAA 3FUDA 1RUAH 5B7FA 5I6KA 2IO5A 4LKXA 1MZZA 4HCFA 2W2WA 2MCG1 4YMPA 3B1UA 3MV8E 4RMVA 5CINL 3Q13A 2LTQC 3QRGL 3S2AA 1Y18B 4KU1A 3UG4A 3A0OA 3ZMEA 5AOMA 1PGRB 2LLNA 3EOYG 3MTXA 4F7EB 3UFIA 3QFJB 1PLBA 1CLOL 4M7LH 3TXAA 2X4UA 4LL1A 1OSZA 5EBWA 3NCEB 3W9EA 3HG0A 2R4SH 1FHOA 1N67A 1WFTA 4X50A 3CNKA 4Q8BA 2B14A 1IC1A 2C26A 4DERA 1UKQA 4K3DL 2ICEB 3VG0L 2PCFA 3OTTA 5ACZA 2A9AA 5JIIA 4HAZB 1HWHB 3C60D 3L5WB 3KJ6L 2R1YB 1ONQB 3IDUA 3UZEA 5GHWL 1J88A 3UBXB 3UTSB 1X9LA 2HT4D 4Y19D 2A83B 3GS4A 5C09B 5IM7A 3LXUX 1BD2B 3KPOB 4N2FA 5FO7A 3BP7A 2Y7BA 3GMRA 1WH0A 1IGJB 3HG5A 3IWUA 3DDFA 1A5FH 3ARTA 4QRRE 2PCXA 4XPGH 1C5BH 2EE2A 4X6CB 1FZKA 2AI0H 3KVQA 4YUEH 3T3PE 2DF3A 3VX0A 1TJXA 5E94A 4HUKB 2YSSA 1Q4NX 3NJMA 1JPSH 3QDGB 3NTCH 5D2LF 2QADD 1GYAA 1KZYA 1KJ2H 5JNYB 2JI1A 3T0EB 3OF6A 5D1ZC 3CHSA 3SQBB 5J56B 4LO9A 2A74B 4YAQB 3FN0L 4P46C 1EA9C 3CFBB 3EOAB 1S9KC 5TTRA 4GAGL 3HS8A 4MBOA 4ZUSA 2COFA 4WF7A 5SWZA 1JPEA 4JL2A 1UENA 1D2OA 1IT9H 1YVLA 3BIAX 2CUIA 2HJFB 2WB7A 3BKYL 4MRBA 4KI5E 5AYQA 1QBBA 4UMSA 3V6ZA 3NIFB 1KWKA 3SOTA 5JW5B 4DETA 3QJRB 3E7JA 3MV7E 2P5WB 3I50L 2NMSA 2A9MH 4KVPA 5AENA 2AQPA 5I1CH 4XCFL 5EWIH 3RY6C 7PAZA 1AI1L 3D3VE 5E70A 1PVHA 3K72A 3MZTA 4ZS6C 3U2IA 1IGTA 4Y2OB 3VFMB 4ZFOA 1B2WL 1NCBH 5E9DB 3QNYA 1YN7B 4PS3A 4G9FE 4YC2C 2BP0B 2XJKA 2V17H 1KOAA 4HXBH 3PYCA 4N3TA 1FLRH 4LSUH 4PI0A 4D0DB 1SNRA 1P5VA 1WBYA 1MJJA 1QZNA 5C9KA 1GCYA 2AV7B 3BQVA 3RQ3A 4WENB 4ZTOL 1I8IA 2IGTA 3FUHA 1LEKA 1OKEA 1TVHB 1FO0A 3JVGC 4PSPA 2HMIC 4U1JA 5FF6B 3PWPE 1TQZA 2X4PA 4L3EE 1TXKA 2DYPA 2XTJC 3BGMA 2YD9A 4HWZA 3MR9B 1S3KH 3NP4A 2OJ1A 3PGFL 1GC6A 3PG7A 3QNZB 4NSWA 2UWEB 3A4DA 4WFGE 4Z7IA 3VGGA 3QW9A 4RSVA 2Z7YA 4UUJA 5C0IB 3T3MB 3IGLA 5CCGE 2HWZL 4R7XA 3E2HB 4QLWA 1IGIL 5DHVH 5DMJB 3ZIYA 2DQJH 4NN7C 1JGEB 1NSNH 4UTBL 3LKNB 4LPXA 4B7IA 2OI9B 3NJNA 3S5LB 2N4IA 1KEGH 3NESA 3F7PC 3ATAA 4R5TA 5AW6B 4F2MB 4B60A 4LEBA 4ALAC 2FQGA 1NM4A 4NN6C 5GGUB 3FT2B 3MA9L 1HI6A 4Z8FH 4JNXA 1YEGL 3FULA 4AQAB 1X86A 3D39B 4KAQL 4QRSA 5ENWB 5SWZE 2E7LC 2DWSA 1E4XH 2ZCLH 1MH5A 1S7TB 1ACYL 5CJXC 5CHNB 1T2QH 3LPPA 4KJYA 3RPKA 2WUCH 4D9QD 2ROZB 4JKPH 4X4XB 4YSTA 1AJ7H 5EIQA 1N0XL 5EOTA 1SOSA 5AYTA 2JLPA 3X12B 3FFDB 5T3XD 4E9TA 4E42A 5F72S 1XF3B 2R2BB 4MA3B 1BBJB 1X9UA 1P5UC 4D6WA 3QEUB 2XYCA 1FFRA 1MKFA 1VEMA 3C6SB 3R8QA 1GCFA 5F9WB 1QI4A 2O1AA 4UNUA 2OMXB 3QXTA 4AEEA 1L7TH 4ZMYA 1JN6B 2FX8H 3L1FA 2WKOA 2IXQB 3EADA 2OTUA 5HGHB 4LBEB 5H37A 2YAQA 4QRPE 2PR4H 2PXYB 3U4KA 2FWLB 4HJGA 5IFJB 4M3HA 4NFBA 3NN8A 2XG4A 2Q76B 5FR3A 3QEGH 4P4KB 5F96H 1EDHA 3D2TA 3LRMA 3QYCA 1GGCH 1S7SB 2JJTC 2X7LA 3HE7C 2BIMA 4XHQA 4KX7A 1QSEB 2FX9H 1BJMA 1U0QA 2PYFA 1GAFH 4YQXH 2BSTB 4YDVB 2W81C 3IGAB 1BJ1J 2JQZA 3Q8FA 5DQ9B 5EZLB 1JF6A 4MYPA 4JRYE 4YXKL 3BPOC 5J12B 4OGAD 3KPSA 4OKVB 2MWNB 4LESA 3F6JA 5I8KH 3BRFA 2N0YA 4GI8A 4OZGE 4DGYH 4MAUL 1XCQA 3V6OE 4XP5L 5TE7H 2KKQA 3VQLA 2GSGB 3NJXA 2V2TA 1C5DB 1Q9WA 3OKEB 4WUUE 3B9KB 2DWDB 2XFXA 4FLOA 4G5AA 5AVYB 4QHLB 5IHLB 2BVQB 4UU9A 1SHXA 2CJUH 2YOCA 4PGBA 5AKRA 3QYNA 1YYCA 4FFYA 3Q9QA 4HBCL 3NSXA 2ZUXA 1R6VA 1R3HA 2E76C 4ZMAT 4XNYH 1A66A 1Q9OA 3L6FA 3EOTL 5AVSB 1C16A 2R4RH 4G42B 3W0WE 3ABZA 3QA3B 1DN0B 2E7CA 2IWFA 4G6JL 3HE6A 1XTLA 3CBRA 1FGZA 1OTTD 2UZXA 3B5GA 4WNQA 4Z7UF 4XPAH 2R0DA 3DJ9A 3TO4A 4CGTA 5I1KL 1A9VA 3R4DA 4HB0B 3P0VH 3TN0D 2P43B 4PJXE 5DZVA 3QORD 4H5SA 3WD5L 4IBLT 2GUOB 4KXBA 4XNBA 4ATWA 2VIRB 4RLDA 1KIUA 2DX5A 1L0QA 2K8QA 3BQUA 2H4EA 2WMPB 4AENA 3II1A 1T77A 4FN0A 5T1DH 3DHJA 2F74A 5JA9A 3EUUA 3TNMA 4CW1B 1S9VB 4HFWA 3MHZA 4HAXB 4K3EH 5KG9B 4NO5A 4BH8B 4DNLA 2X4OB 2FAUA 2RCSL 4Y8DC 3KM1A 2GY5A 3GLAA 3QPQD 4UWQB 2ILLA 4QJ5B 5DC2A 2BHFA 4HALA 4M8VA 4X98A 2ADFH 2EVJA 3WEOA 3RHWF 5BOJA 3P30H 4X7FC 4QOKA 5KSVA 2X10A 2F7IA 3SZKC 4APXB 1MQ8A 3QO0B 4YSOA 1XF5A 2DQHH 2YFNA 3TT3L 2QLYA 1D7BA 2BNRD 4LB8A 3D85D 4B27A 1NDMA 4BFIA 1TEGA 3ILDA 3PWVA 4EZMA 1CQYA 3IDMA 3MRQA 3H53A 3M1CA 5I0WA 4GW1A 4IU2A 4U6YB 4JG0H 4NQVB 4Y5YA 5DH9B 2YN3A 3FXIC 3SDAB 2OMZB 5C8JB 5L2KA 4XAWH 3RVWC 3QEHB 3D2UD 5D3VA 2QSCL 3E2HC 4OM0L 4PRPB 3SKMA 3GI8H 2XZQL 1EZLA 2YQ3A 1HILA 4HIIA 4J4PD 1U3HD 4FA7B 4RDQF 5F7UA 1CF1A 4QAWA 2VN6A 4CBZA 4M43L 1OT1A 4NYLA 4CVZB 1O7VA 3LDBC 4WTQA 5G4OA 4YHNB 1NGZB 3UBGA 1ET8A 1RZKC 3P2TA 4OV5B 4NERA 2H32B 5D7IB 4NT6A 4GW5A 4GOSA 2DPKA 3FBQA 4M8RA 4EI6A 4HISA 2EJ1A 2ZCKL 1IV8A 3ZZSA 4GYBA 5D4JA 4BINA 2Y1YA 1XIWC 3CDGA 4LHUB 1TETH 2K3HA 4K73A 3RIFK 3ARFC 3EGSA 1QYGH 4GRLB 1F6FB 3B3IB 1KBGL 3CSTA 3QZWA 1RUPL 1ZT4B 3VW3H 4NZRH 2D10A 4UV7H 1I1AA 3O3AB 4ETQB 1KJ3H 1XR8A 1YMME 2W88A 3IFLL 3MTRA 1BEXA 4IOIB 4ZD3H 1GGUA 2Q7AA 3CFIC 3H0TA 3MRCA 4WO4B 2QHRL 3QIWA 4J3OG 3V5HB 4YHML 1XH3A 3T2NH 5ABDE 2XXFA 4HIJA 4Q9RH 1NKRA 2ENQA 3I75A 3KW8A 4Y1AE 4BHUA 1THAA 5HD8C 4U3SA 5JUEL 4PU2A 2LFGA 1VSCA 4ONHA 3QDMD 4KY1H 3VD3A 3WLBA 4EE2A 1NAMH 1RZ7L 3WNNA 2PXYC 4FEMA 2HG5A 3IN2A 4KKLD 4Y16D 3OAWA 1MLCB 4ISVB 4BUHA 1G1OA 2C9PA 1SZNA 4L1LA 4P4KC 3DYOA 2N1TE 4UDUB 4Y2NA 1F3DH 5FOBA 1IL1A 3PAUA 1DR9A 4HK0B 1QHOA 4TSCL 1R0AL 1BVNT 1NGPH 1X3DA 1XB8A 2PPCA 2VR6A 3UP1A 4MBRA 3TJEH 4OF3A 4OLYL 5CJOL 5L2KE 3IVKA 3HG3A 3QS3A 1INEL 5A16A 4IHOA 1A8ZA 1BQHG 5J12C 4HS8H 3WTVA 4M5TA 1VZGA 3P4OB 1YMHB 5H94B 2BCKB 5I1IH 2YS5A 5D4IA 1T80A 5DQJA 5JOPE 4R4FL 4PRIA 2AHIA 1DANU 2QZ5A 1CB4A 3E6HB 4J5VA 2WBJA 1LILA 3QQ9C 3BHBB 4JG1L 3CFEA 1U33A 1DLFH 1JUFA 3VB9A 3MLUH 1D6VL 1QPXA 4MJIB 3O4LA 4CSQA 2LU5A 1Q0YH 2E9WA 2R1WA 3CK0L 3DMMA 3DO3A 3DSNA 3HG1E 1NOAA 4KWUA 3ISWA 4EN3A 5IKCB 1AIZA 1GHFL 2JJWA 1HHIA 2W9DL 5FWQA 2YK1H 5LAXB 2XQYA 3AG2B 4U0QB 4NZJA 4PRBB 1A0QH 1NI2A 4XCEB 3PQYE 2WXIA 4Z7NF 1F5WA 1KDJA 5D6CB 5D5ME 1O6SB 1XH0A 4YVUA 5IB3A 4PW9A 4CC4C 5AOZA 1IFRA 2XQBL 2EEFA 3GMLA 3GXIA 4NZFA 3U48A 2DHIA 4A6FA 2PWDA 1MELA 1HOEA 2B5IB 5EORH 1F4XL 3O2VH 1CDHA 1K5NA 4RISH 4GKNB 5CLYA 2WQWA 4DZBB 2JJUA 2X70A 1RUKH 3SGKC 1SDDA 4XNMB 1RIUH 4XOAA 4XPHL 4KV5E 4AK1A 1ROCA 1KJ2B 4U1IB 2XJLA 4UM9D 1PFJA 3MRDA 3VD0A 4MCMA 3U4EA 1CD0A 4PG2C 4AQOA 3O8XA 5F93C 5IVOA 1M6OB 1LK2A 2ZNWA 3GSOB 1T3FB 4FZ8L 5DVMA 5FOJA 2VQ1A 5LXGH 4R96B 3GSQB 3M45A 2AMUA 1FYTE 5AWNL 2HPTA 3Q3GB 2RTTA 3BVNB 3VFGH 5D1ZD 2R9HC 2CUHA 4GXVL 4P46D 1KC5H 1A9BB 2FEEI 1LEGA 1J18A 1B88A 2BS9A 2L7UA 3FAWA 4OF8A 1I1FB 1UT2A 1WITA 3H3PL 1FIGL 2XRAL 1DQVA 1TSRA 4HLEA 2DV6A 4N1CA 4JKMA 4NENB 2BY1A 4MCYB 2IBBA 4ZMXA 4JPKL 1U8KB 2FHFA 4GUPB 5JHLL 1IBGL 3U1QA 4B0MB 3D0LA 1FORL 4H0GA 3SODB 1Q94B 2X2HA 2ZXBA 5FFOA 4Z7WB 3O4LE 2WQVA 4FD0A 4DEUA 3ARDB 1NC4B 3MRPB 3SDAC 1I8AA 1ED3B 2WY3B 4HV8B 4ZS6D 1WZMA 1IX2A 4TL4A 1FPTL 1U36A 2NZ8B 4UOW1 5B1KA 3VSUA 1OT2A 3F6IA 4K4KA 43C9A 3KPTA 3VTMA 4LLWA 2CNZA 2Y25A 4PQXA 4XWGL 1BVOA 1KBKA 2IALA 4OKDA 3MX0A 2PW1B 4D9LH 4PWIA 1IM9B 4PJ5A 3ULSB 2IOMA 1F0LA 2DQCL 4U1NA 3C8KB 2J0JA 3MA7A 4ZW6A 4Z7OB 5DD1L 5EN2A 3I6KA 2HMID 1IAIL 5FHBL 5E5UB 1CGSH 2MHAB 2XTJD 2GTQA 2QTVA 1SLXA 5I17A 2J2ZA 1U42A 4OSUL 5DD5H 2RGSA 4GRLC 1DEEB 1U8IB 2Q5BA 3CFJA 4FQJL 4NQCB 4KTEL 5HHOE 3Q01A 4NJ9H 2MOGA 1D5BA 1UASA 1AGCA 4Q0XL 4LHJB 4TL5A 5F1NB 2F5AL 5DHVB 5IESL 5KBDA 4K94H 3FSWA 4ZO9A 3TASA 2DN6A 3BFWA 3FO2A 3MI6A 4H1LG 2BDNL 4W70A 2X6CA 4F9LA 1CGTA 2Y36L 5KAQF 1FFPB 4RWYH 1DDHA 5AW7B 4WO4C 2YUZA 2C3GA 4NRZB 1KN4L 1ZANL 4POZC 5D1XA 1BZ9B 5HY9A 1I7RA 2DM4A 3PHAA 1FGYA 3CCHA 5E7BA 5ID0B 3PHSA 2Q8AH 3DPBB 5I24A 5EU4B 5IW6A 4I5BB 3FUEA 4IOSA 1FBIH 1A6WH 3E8UH 1Z3RA 1QEWB 4MJHA 1OAYH 4RZKA 4WDIB 1DJYA 4P3DA 2ZX9A 2EMSA 2Y7SA 3GJEA 3P40A 4PG9B 1N6QH 3K8LA 3BEWB 3RX7A 1CMOA 2ZF9A 2FZ3A 2BXYA 2Y7QB 4RFNB 4HIHB 3ZBMA 5B8CC 1IC5H 1JNNL 1IGCL 3C6LA 2CHWA 3CE1A 3DXAB 4FI7A 4JY6A 4F33B 5C0NC 4NQSB 1E9PB 3UJTH 1ZVYA 2Y72A 3H2PA 3N44F 4NKOA 4XPFH 1A6PA 1H3TA 4PJBA 1JDAA 2ESVA 4QAMB 1JG9A 5IJKA 3CIAA 3SDYH 3SPJA 1TZIA 3ES6A 3NABH 4HPHA 4AUJA 1NBYA 5FM4A 2FL5A 3HC0A 3ME0B 4WEBL 1U8MB 4FG0A 3LJUX 3SYOA 4EUPH 3JTTB 3OMIB 3SGJC 5E8DH 4G6KH 2NY1B 1SXAA 1ZSQA 3FYIB 5ISZB 1W6WA 4MT7A 4KXAA 4EMOA 2EDBA 2C1OB 2UX7A 3HCVB 3ULUH 3UZVA 2ZXAA 4FF9A 5ALCL 5EU7C 3FFCA 5JPMC 1IVLA 4ZQKA 5JPNA 4JY5L 1KJMA 1IM3B 3ETTA 1T21A 3G5YB 4PJFE 4WWID 5J3YA 1QRNA 4OM1L 4ZFQA 3SDCA 5HHNB 2KI6A 2A73A 3H9HA 1UB5A 3UEQA 3Q43A 3EYSL 2QQLL 2VL5A 2AXWA 3N1GC 3SKOB 2IPUK 2A6IB 4MJ5B 4QKXB 4TVUA 4CMMA 1L7IH 4L5FL 3RWDB 5ALBL 1HZKA 4G8EA 3KPPA 1MQKH 3UTSD 4XPTH 5D1XE 5C09D 2Q3ZA 1RCYA 4PJEA 2BSCA 2AEPH 4RZCA 5J3HC 4BK5C 2B5IC 1GGIH 3STZA 1BD2D 2WLIA 4JFFE 4NEHB 2QGBA 5F44A 5BMFH 4GRWF 4WIQA 4PI2A 4WSGA 2XTLA 3ZDTA 4KHAA 2DDQL 2F54B 4ODBD 4X7TA 4LSVH 4HHVA 4XP6H 5BJTA 2FWOA 1IE5A 2ROXA 3U36A 2G35A 5IEKB 5K9QG 4L4VB 1H9DA 1KGCE 2WTRA 5H2BA 1UKTA 3V5DB 3T6WA 2DD8L 4K2UH 1ZLVK 4YZWA 1F90L 3RNKA 4D7PA 1AYOA 3WENA 2CE6A 4RAHA 4JM2A 1NIAA 4N24A 3HN3A 3LKPB 2WLJA 4FP8H 4HQQH 1I7ZA 3T0ED 1GL4B 1PJWA 4JN1L 2VLRB 2I32A 3B9DA 5IMMA 2W07B 3EHBB 4UILL 1G7HA 3ZGIA 1CYGA 3VH8A 1UOVA 1NUNB 3LPGA 5E1HB 1OM3H 3IRPX 1SGHA 5LG4B 3PAVA 3OLEA 4LOFA 1HZHL 1SXBA 3WNLA 1NCHA 1NBCA 3QJUB 3HS0A 3MJGX 1ZLUK 2OSYA 3L45A 3F3HA 2OMTB 4XO3A 5I2IB 4N68A 5HDLA 4NLAA 2XWJA 4LVOB 3FU7A 1PZ5B 3DVIA 3ARDC 2Z4TA 1SBSH 1ZT7A 3V0VA 4JPVH 4NOFA 3VXSA 4OGQC 3INUL 3NMEA 3IJSB 4N2LA 2XX0A 3RFZB 1FNGA 1IQDA 5B39G 1BOYA 4AV0A 3JWOL 1QRNE 2J4WH 3GS0A 4BFKA 3IF1B 1WSST 2YKLL 3V10A 5B3SB 2BSRA 3V5WA 1CXKA 1AZRA 2F1EA 4UM8B 2YMXL 2XVLA 4JVPA 2ZXWB 4ZW5A 5I16B 1GTFA 1BF5A 3SJVA 5IMLB 3F7YB 1GKEA 2JK5A 2WYIA 3EJTA 2WQSA 4PV1C 5E51A 4NBXB 5FYKD 2CO7A 1MFBH 2CA3A 1DYZA 4XGZB 4AYMC 2VDPL 5CP7B 1HC1A 3ESNA 2NTFA 5SWSE 4OI9A 1XO8A 5DIFB 2MRYA 3SY6A 3V0IA 2EIZB 2JKTM 2AJYL 2FX7H 1JZHA 1TSHA 2WLZA 4UZUA 3CZEA 1QAWA 3KPNB 4Q6YA 4JFUA 3ILQC 1C5CL 3A8PA 5K1JA 1E6OL 3RVWD 1WS7A 2KS0A 4YHLH 3L3HB 4H44C 1ZHLB 4IHBA 4CAGA 1W0VA 1HL9A 1LVEA 4KX9A 4W9ZA 2YSZA 1DBJL 5GJTL 3RHWK 5KYUA 1OQXA 2R23B 3F2LA 1U8OB 1SHWA 5IVXE 1KLFB 2CK2A 2D11A 1OSPH 3DRTA 4M1DL 5DJDB 2QPFA 1R3IL 4EAEA 3P73B 5ERWB 1WTLA 4Z7QB 4P05A 2I1KA 3NH7L 3QZOA 4YHPB 5A3IC 4ZDHA 3GSVB 1OHZA 4WGKA 3RAJH 3D39D 4NRXB 1XIWD 1BAGA 1AFVH 2I27N 5J1TC 1OAXL 3ARFD 2YXFA 3BAIA 4O58H 2IADB 4JFPB 5I8EA 3VXRE 1SHMA 1GGBL 1IILE 5JDSA 4YHZL 4RFNC 3C5JB 2XSKA 5HPOA 4U1LA 3FQUB 3S5YA 1BFOA 3B8SA 1WE5A 4UQIM 3QUXA 5JW3H 1PCSA 4ZBJA 1YEKL 4ZX3A 1PF3A 3ILPB 4JDTH 4MJJA 4X6DB 2FGWL 5KYYA 2DMHA 3UGEA 4Y4KB 3P3TA 1NFDE 1P9MA 4BZ2A 4ZXBA 5D7JC 5B1CA 3FU0A 3EBGA 5EZOL 1B4JL 1G1KA 3BP6B 1IZKA 4Y2DA 1T20A 5A2CA 5HGBA 5HD8D 5I9QB 2NY1C 4QNPF 2ALWA 3RTQB 3T09A 3SJVE 3WV0A 2AJ3A 3VXNA 2DLEA 4LXFA 1UM6L 2CIKB 3A4FA 1CG9B 2PXYD 4HUWA 1JI1A 4XPBH 3HNVH 3PL6A 4P04A 1NGQL 5A2KH 4F7HA 4RFEB 5DJ0B 2J72A 5DJXB 3JSSA 4P4KD