4DIXA

Crystal structure of the ig-ph domain of actin-binding protein scab1
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
212
structure length
212
Chain Sequence
LVYEIDGTEALGSCLRVRPCSNDAPDLSKCTIQWYRSSSDGSKKELISGATKSVYAPEPFDVGRVLHADIIYDGHSLSLSTVGKIDPAAGLGSYVEALVRKHDVDFNVVVTQMSGEDHTSESIHLFHVGKMRIKLCKGKTVIAKEYYSSAMQLCGVRGGGNAAAQALYWQAKKGVSFVIAFESERERNAAIMLARRFACDCNVTLAGPEDRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Plectin-related protein
publication title Plant actin-binding protein SCAB1 is dimeric actin cross-linker with atypical pleckstrin homology domain
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 58
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16709 SCAB-Ig Ig domain of plant-specific actin-binding protein
A PF17684 SCAB-PH PH domain of plant-specific actin-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.140 Mainly Beta Roll PH-domain like PH-domain like 4dixA02
2.60.40.2700 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4dixA01
4DIXA
chains in the Genus database with same CATH superfamily
1SXCA 4HETA 4O5LL 2XZAL 4GFXA 3DJZA 4JM2B 4X50A 1A4JB 5KAQG 4JNXA 3MUGB 2WWOA 1HE7A 2DYNA 4FC3E 4HZLB 4NT6A 5DC4B 4AK1A 3VD9A 2Y7QB 1U9KA 5FF6B 1P4UA 2V5TA 2FK9A 1FL6A 3GF8A 2IDUA 3JQOB 5EEYA 3QJOA 4LQFL 5C0CE 2EDKA 1QBML 4J27A 4PB0L 5GS1B 3MRRA 5T3ZL 5DI8B 1ASOA 2ZOWA 4GRMA 4D0CA 1DVQA 1MFAL 2R69A 4P57B 5IEHB 1RULH 1T5XA 4JGUA 4Y9EA 3L7FA 4LXFA 3BKCL 5GJSH 2X1QA 1E4KA 4K7FB 3IS1X 1DCEA 2YC1B 4EOWL 3EGSA 1E6JL 2BWDA 5D96C 5CMAB 4KVGB 2W07A 4F7CB 4AQAA 3TFKD 4X4KA 1BLNB 2MQ3A 4KUCD 3U9PH 1P1ZA 3FU0A 4TUUA 3MXWH 4LIQH 4KRPD 4QXTB 3QUHA 2YEQA 2NTSP 2Z7UA 1YN6B 1AQKH 4CN4A 3CV5A 4IHOA 3LEVH 4MMXA 4TUKL 3T65A 2W1NA 3Q05A 1F42A 4HWEH 3SKMB 4LP8A 2EIBA 3PCYA 2WLHA 5IESL 3RNQA 3OKEB 4XMXA 3SKJH 3K6FA 3T9WA 1YJDC 4AGOA 1MH5A 3GSWA 2XETA 1BF2A 3NT0A 1PLCA 1FPTH 5HE0A 1NAKH 2MH4A 2GCLA 3KPPB 3LXAA 4KXAA 1RPUA 4PJ8B 4B9IA 2H6PB 3P4MB 4Y1AD 1BEXA 2Z31B 5DD0L 4BWUA 1U8CA 3QA3A 4LPWA 4WHDA 2A5UA 3GMQA 3RWCB 4Z7OB 1VGEL 1M6OA 1JJUA 4H1LA 1CICC 1B9ZA 4K5NA 1U58A 4X5XA 2EZ0C 3GK8H 3H6JA 1A6WH 1OSZB 3IT8D 2N01B 3N3EA 4J3OD 2HRPH 2WWMC 1CDBA 3C5ZD 2K45A 3U6RB 5CSGA 4W9DC 5FUCC 3DHJA 3FBKA 3QZWB 4I2XA 5E1HB 5T1KB 3E8UL 4PJHF 4B6ZA 1FOEA 1CD8A 1EDHA 2A2QT 3MRNB 1NQBA 5KJRH 2HUHA 4V1DE 5GJTL 2BVUA 1KTDB 1LWJA 4PMFA 1F13A 4BKSC 3K4AA 1UQSA 3D85D 3GD1C 3MBWB 2QBWA 1HKFA 2VAAB 1T6BX 5B4MD 1NBZA 3KBFA 5H2BB 2VO8A 2R2HA 2OI9C 2H47C 3MYJA 1NMCC 4TULH 4N0UA 5CLYA 4W93A 4GRLA 3QNYA 5F7AA 2BDNL 3IRCA 2ADYA 2KKQA 4LLDA 2FX7L 3ATBA 1J05B 2IH1A 3IM1A 3T3PF 3O2VH 2AK4A 2WO4A 3X1EA 1CYWA 4HUVB 3UP6A 3TA3D 5L4JA 2K2JA 3WUWA 1Z87A 3RUGF 5CZRA 3BQUA 2F19L 4FFYA 4QRRA 4EE2A 1PDKB 3BIBX 5KS9E 5DJ6A 4TVPD 2WLLB 2NZ8B 1MJ8H 2WXMA 4X4ZA 5A6IA 2UZYA 1DL7L 1RI8A 2CAYA 2OTWB 5LBGA 4PRPA 2VN7A 3LKOB 1CLVA 3RDJA 1SUHA 1RSYA 3Q5TA 5TF0A 1F4XL 2OSXA 4F2MA 4ABUA 2WUCH 4F7TB 1M7RA 2CO2A 4DP8X 4G6FD 3HZYB 4U6VL 3TM6A 3AAZA 3VGAC 4IBVA 3VFTA 1H3WM 3Q2CA 4RAVB 4QOKA 2IOIA 4XCCH 5ISZE 1GTNA 1FYTB 1HOCA 3OHMB 4BBWA 3V9FA 4LLYA 4W6WB 4XBPB 3P2BA 5GRWA 3KM2A 2PXYC 1NPNA 4G71B 3FQYA 4L4TB 2OK0L 1W8NA 2EO1A 4PH8A 3RE0A 4B5ZA 3QFJD 1HILB 3D3VB 3VXUD 3K4DA 5G2NA 3UTTA 2RACA 2EKSB 2W60A 3VSQA 4OKDA 1OF2A 1GJUA 1FZJB 1IBZA 1KNOB 2WNKA 1TJMA 4GT0A 1HVXA 4JQIL 4BFIB 4NC2B 2AMUA 4MXWH 3VB8A 5FO9B 3E38A 5IGXL 2Y6SC 1UH4A 5D5MF 4L1DA 1RZKC 2NY2C 3MRQA 4GKSB 2HKHL 4FZ8H 4DP9X 1G0YR 1KPUB 5HYSB 1T66D 5HGDB 3ULAB 3VQ2C 2XN1A 5FM5M 1QPPA 3ODWA 1IM9B 3OR6B 1Q9KB 5JOFA 3G5WA 4U6YB 4LKXA 5D7JA 4A6YL 4LDEB 4YHNA 5DRWB 3TN0B 4YNYA 1MCFA 1TDQA 4HJJH 4AYID 1D6VL 1SOKA 4AQZA 3VDCA 1JWMA 1QKZH 2VKWA 4Z7NF 1Z9LA 2ZAGA 4KK5D 4Z2NA 1IV8A 2EC9U 1NDMA 5AKTA 3ZR6A 3V0VB 4MS8D 2J1KA 2KZWA 3H7BB 2R8SL 4PV9A 3ETBJ 1SRDA 1AQDB 3AG4B 1DCLA 3C2AH 5IMLA 1Z2KA 5D7IF 5E4EB 3L5XL 3KW7A 4A38A 1GSKA 1T04B 12E8L 4J3OG 1MQKH 2I5YH 4NC0B 1JHTB 1J9SA 4WSFA 1RIVL 4N2BA 4R97C 3MOBL 4J1UB 4YHZL 3O81A 2ZXQA 3OAWA 1L7IH 3T2PA 3UGEA 5CGYC 3DX7B 2BNRA 1OP4A 2V17H 35C8H 4OZIB 4P2OA 4WW2B 5I6MA 2QJDA 2VLMD 4QHMB 3PHQB 2NNAB 3TBVA 3QCVH 4JPQA 1W15A 1OT4A 3FT4B 1PTZA 5B39A 4LCUB 4QHUA 5LBSH 4GXUM 4M1DL 2NY1C 3ABKB 1JGVL 3S3CB 5F3BA 1XX9C 1OP5H 3O2WH 5I2IB 3BAEL 3CMGA 2W2XD 5AOMA 2IANA 2XXGA 1DUZA 3EF4A 3LQZA 4YDIL 2Z4QA 2P0HA 2ZICA 3IXAA 4JFDD 1UB6B 2CUIA 2BSEA 3S4SB 1I9RH 1PEWA 3BAWA 4IHBA 3THMH 2GIXA 4F3FB 2J5WA 2VLLA 4ZUSB 1AGEB 3M88A 4N0YL 3GGWB 3AADB 1PZDA 3EGXA 5CZXD 4MNGE 4NM4H 3ILPB 5IG7B 2FHBA 5FWRA 1SEBA 3BP6A 3T0AA 5KBLA 1CBVL 4FLSA 1MLBB 4LCVA 4CMHB 1QLRB 5E1AB 3ASNB 1KLUB 3MCYA 1BF5A 4X7DC 3I84A 4I4WA 4NBZB 5FLUA 2QQLL 3OQRA 2V9TA 4IJ3C 2VE6A 3G6AB 2J1YA 1NFDF 2YAQA 2NY5C 5DZLA 3O4OB 3ARVA 1E5UI 5EBMB 1MCRA 5DD6A 4PWEA 3O3UN 2OMUB 1LO0H 3RURA 2JJTA 4X4YB 5BMFL 1U3JA 3TBBA 3RDTA 3BVNA 3KL0A 3ULVD 1H6UA 3QUXC 1JBJA 2MNUA 2YRZA 4NN5B 1UPQA 4J3BA 2EDJA 4Q6KA 1WTGT 2D2CC 4K9EH 4D9RE 4YC2B 3W38A 3MRDA 2WVVB 3AMLA 1S7RA 4RAHA 3KPLB 5T1DL 3ARDD 5IKCB 1DEEA 4YSQA 1IRSA 2H3NA 2FECI 5D7KD 3HNSH 4ZW5A 3KZ1A 4AI7A 5CGBA 1IKNC 4RETB 4NKMA 4Y2DC 5MEQB 5C6PB 4XGZB 1FIEA 1K8DA 4KK8C 5F88A 4GW1B 2Q86B 3IWUA 5AW4B 4HHWA 5HVHC 4MJIB 4PGJA 5FDYA 1QUPA 4XN1A 2FZ3A 1RCYA 5FPIA 4IOFC 1FI8C 3C9NA 3WFEH 2H2SD 4D0NB 5FO8B 4K3GA 3BPOC 1OOAA 1AG0A 1ZYIA 3BDYH 2P5EA 3Q7JA 5HHVL 4QRUA 5LVEA 5CJBA 4P5TB 4FQCH 2ICEB 1MWAB 1G6RL 2MPAH 1C12A 2OCJA 1MAIA 4AL8L 1GGTA 4E41A 4XPAH 5L88H 5DZPA 1IGFH 4FG0A 2BSDA 1J8HE 4L3EB 4MD5B 2ALAA 2IPTH 3BPLC 3GSQB 2FYYB 5HDOA 3CQPA 4FFVC 4BRJA 5FA4A 4Z0XB 4G6JL 1AHWC 1BYNA 1W16A 4JM0A 2IADB 2DIBA 3AJ7A 1ZDQA 2YD3A 1JERA 4A2LA 3W56A 4R4FL 4Q74A 4YHMH 3BZEA 2LYDA 1YNTA 3VDAA 1QO3B 3MLUL 3T0VA 4BHUI 5A2CA 3QWOA 2GFBB 3NTCH 3B2XA 2VABA 3WHE1 4PQ0A 3CJJA 3MV8E 1KN4L 3H9YA 1K5GB 2W59A 5D1QD 2DLGA 3IDUA 5F7FA 4BHUA 2MFNA 1OTTD 3IWVA 2DOCA 3LKSB 4RIRA 3IGKA 2A4CA 3HZMA 4MRCA 5ES4B 3FFCE 3K0YA 1DFBL 3MROA 3V7AE 2WSKA 2EXWD 2DPKA 3RIAF 5ICZB 2OL3B 2Z8WC 5LWYL 3NACH 3QEHB 4A2DA 4M4PA 1PG7X 4HKXA 1EZUA 1FC2D 1PZCA 4I0PB 4OBRA 2CWRA 2D10A 1RK1B 4G5ZH 4TSAH 3ARBD 3L3JB 4ZUTB 4JDTL 3QC5X 1D9KC 1OWWA 5D2LF 3MRIB 4BH7A 1YEJH 2EDLA 3GMMB 2PPFA 1CFVH 3LRSB 1IEBB 1YEEL 3RA7H 1UACL 3QIUB 4A66A 1IQWH 4X7FC 4LKCB 3VI4A 4I8DA 4CNIB 2YPLA 4HS3B 4UI2A 3WFHA 2Z8SA 4XP9L 4K17A 3SPIA 3EH5B 4NRXA 3CVCA 1U3ZA 1SJHA 5DUJA 1PQZA 4JY5H 5E6IA 5HYJB 1QLEH 1VIWA 1GAFL 3LIZA 1WO2A 7CGTA 3FDWA 1A3LH 1XGQA 1B55A 2WP3T 3QIJA 1MRCH 3IDGB 2LABA 3K74B 1UNPA 5GS0D 1URZA 4JN2B 3LZQA 4BUHA 2IALA 3KL3A 5K9OA 4JVPA 2H7DA 1YCSA 1M53A 4XCFL 4MMYB 3RRQA 1P4BH 3IU4H 3KJ6L 2ADIB 2XUWA 1PBYA 4JAMB 2ZYHA 1M7EA 1WICA 3SZKC 3WLBB 2VDRL 4M8QA 3WIFA 1ACZA 4KJWC 1PZBA 3Q48A 3ROOB 3ZYZA 2BLFA 4ODTH 5FGCE 2BY1A 4GLRH 1GMEA 1XF3B 5AW1B 3T77B 1RPQA 2HJKA 3P0YL 1AGCB 5DR5L 3KCPA 1DFXA 4XX1E 5BQDA 3E2HC 5F89A 4GAJH 1DBKL 2M83A 1PX3A 3DMMB 4J8RB 3Q5YA 5I1HL 2PO6A 5KUKA 2QGBA 1S9YA 3QDMD 4KJQC 1CICD 2J88L 2ALWA 4U1IB 1FNFA 4EUPB 3NZ8A 2EZ0D 4OT1H 2CALA 4FQ1H 4PP2A 2X4PA 3BSZH 2WWMD 3EFDL 4FYSA 5CJ5A 2JKTM 2WWKO 3NJJA 4TUJB 3KRWA 2XA8H 4YSPA 1BD2B 1WZLA 3SO3C 3SOBH 4Z0BH 5E2UH 4N68A 3MHZA 5DFAA 4AX3A 4ATTA 3BCDA 3CMOL 4OIBA 3FKUS 5E8PA 5HGHA 5BOJA 1E3XA 4WWKA 2RA1A 5G4NA 1ISNA 2HVJB 4Y4FA 3ZDZE 4A7GA 5KW9H 4JANB 3UERA 4AV0A 3QPXH 5FWQA 2OX5B 5HI3D 4YXHL 3QIWA 4YBLC 3S37L 2OZ4H 2YD4A 3H9SB 2VMFA 3PXJA 3HUJB 2UX6A 4KMLB 1N5YL 3SE3A 4RESB 2OMWB 2ZOUA 3V5DB 3FU8A 1Y6NR 3U30B 3KPQB 2DJSA 5AG8A 2NUTA 3D18A 1CGSL 1OY2A 1U33A 3TASA 1FF5A 1CGYA 5D3VA 2IXQB 1X9QA 2MQGA 2XX1A 4P5KB 2QPDB 4HYTB 2ZD0A 4PJ7E 4RMQA 2AITA 3BP7A 3QUZB 4YMPA 3OMIB 3JV5A 5GGSY 3P3SA 3M6DA 3KPSE 5KCVA 4JPWL 1I8LA 4LLMA 2DBLL 3H9SE 2UXFA 4PG2C 5K9KB 3L3GA 2CD0A 4EKJA 4RGOL 3CVHL 5HHOD 4GAAA 2AC0A 5T5FL 1G7HB 2P8PA 1VPOL 5I1JH 5BS0A 4MMZB 4N0FA 4HUUB 1KIPB 1NAMH 1GS6X 4U3HA 4X99A 4NPYB 3K7UA 3RZWA 1MY5A 1FFOB 4HAFA 5JUEH 3W3BA 1HAWA 5E56A 3TFMA 4NJ9H 4H0GA 4F7PB 2AMGA 1F4WH 1NIEA 3EO9H 3WHE0 1DBHA 4X6DF 1UXLA 1A9VA 3D48R 3VDBA 3TPKA 4WK2B 1R5IB 3PWLB 2Z93B 5I76A 4W9CC 5I82A 1CDHA 2X88A 1XAUA 3GZOA 1VKXB 1QNZL 3CN1A 1F3DH 4JZNB 4LASL 4RGMB 1BVKA 1TNNA 1KBVA 3WDIA 4LCCC 2D3VA 4XMWA 2CJSA 1Q72L 4Q6IB 4Y4HC 5I19H 1CIUA 2CH8A 4PNKA 2BK8A 1C08A 4EI6A 4NT6B 1TYEB 2LAGB 1E4HA 1DJHA 4AV5A 4Z3FA 1IAIL 2FIKA 1FL6B 2YGVA 1DO6A 4HCRL 1KJ2H 1OARL 2MKLC 4PRBA 4AEHH 3UPRA 1WF5A 4N8CL 5KSBF 4M43H 2WK2A 3FT3A 2GYSA 2HLAA 2ICCA 1AO7B 1QRNE 4HC1A 3B2PA 1I7UA 1FORL 1Z3GH 1UEMA 4GRMB 2K78A 5EUKA 3WE6A 1I7ZB 1NC2D 4D0CB 1BVNT 2P0FA 1T5XB 2D4DA 1XEUA 3ZT6A 4BFKA 4MXVF 4AYFB 4FNRA 3WFBH 3D39E 4G7VL 2YD8A 1YEGH 3PV6A 4JR9H 1QVOA 3MCG1 2I26N 4G1MB 5IJDC 1FH5L 1S3KL 2CSPA 2EE2A 4M7LH 1SXBA 3BVWA 4LVOB 5FYKL 3EGSB 1BTKA 5T33H 1KN2L 4J4PC 1KEGH 1YO4A 2F5BH 2VWEC 3PP2A 2FLMA 4AQAB 1G4MA 2GKIA 1AO7E 2NY3C 2FL5A 3CZFA 1W72L 4YJZL 1HH9A 3CZJA 2XOTA 1QOKA 3Q13A 5FV1L 3T2NH 3UJJL 3DPBA 2G0LA 4H8QA 2NXYB 4HB3B 1K5NA 4XPGL 3BAJA 1UKTA 3UG5A 1A3RH 4X7SH 1XCTA 1ADQL 3PWPA 5T1LA 1DQDL 3T65B 1PIFA 2W38A 4NC1E 2PCXA 4FD0A 5CIPA 4PWHA 3MFGB 3RNQB 2BCJA 2QPSA 1MH5B 3GSWB 4KX9A 3B5TA 4OJYA 4OV6F 5IJCC 2ED6A 1OB0A 3DUUA 4XWGH 4LB8A 4JZJC 1UD8A 1KYOJ 3DRTA 1RJYB 1PZUB 3QA3B 4RRPG 2CO7A 3P4OA 4OVVA 1M6OB 1DSYA 2GJRA 4H1LB 4PGCA 4URTB 1E42A 2WGNB 1U58B 4MA3A 1CBJA 4TYUA 1THCA 4HW6A 4X5XB 2DMGA 2VZVA 5HHXL 3O6FC 3TONA 1KGXA 3ZE1F 1OAXL 2VMDA 1SM3H 2Y07H 4GRWF 4IS6A 4MYWB 1TQCB 4TLTA 4I2XB 5EBLA 3TH4T 5ALCH 4FULA 1M7UA 3L4VA 3R7QA 3EDDA 3NJXA 2GK2A 3LZLA 3Q8FA 1N6QL 4S1DC 4KAXB 2RD0A 1KZ7A 3BAYA 1TVDA 1UQSB 1QWNA 4S1QH 1MJ7H 4KROB 4LRIC 1RUMH 1TKWA 3B6SA 4QRTA 3UMTA 1NBZB 4UT6L 2R2HB 3R19A 5DTFB 2X18A 1R19A 3MYJB 4XP1H 4N0UB 5DEFA 2PYFA 2Y23A 2A6KA 5C0JB 4X9GA 2CUHA 4QXUH 2VXUH 2IPUK 4LLDB 1PLGH 2IH1B 3P4NA 4ONGL 5AOJA 5D8JH 2AK4B 5H4YA 1HINL 4A2MA 2IOMA 4U3CA 3E80A 1OALA 3GUFA 4GEJA 5GGQH 4N0CD 4MD4B 3UBFA 2Y0SA 1KBGH 3FUKA 3BJLA 3U7AA 1MVUA 4Y1AA 1ROCA 4DFHA 1KTRL 5DQ9A 4OM1L 5CHNB 4K23L 4QRRB 3B7TA 2YIHA 3FT2B 3GS4A 3HRZC 3QZMA 5DJ6B 5JOPE 2X6BA 2UZYB 2YPKA 1EBPA 5EMYA 3BT0A 4NKDA 3CGTA 1A7QH 4K9EC 1V27A 3KH3A 3SYOA 3QS2A 4UILH 1CXEA 4F2MB 4EIGB 1UT1A 2ZX6A 5EUOA 1SHXA 1K85A 4P05A 3V6OA 4PS3A 1T21A 4HQQL 3CHOA 1SVBA 1A6ZA 2WQXA 4XMPH 5HVGB 1VFAA 2QDWA 1AE6L 3HS0C 4OR1A 5I6KA 2FO1A 1L9PA 3VFTB 4PR5B 2YWZA 1SMDA 2XLLA 4ZYKA 2AQRA 4QOKB 5F1KC 3ESPA 4XMUA 1U95A 2VW4A 4QXGH 1T77A 3RKDC 5SWQA 4QIRA 4LLYB 4XNZB 2DMCA 3TVMC 4KQ4L 3D85A 5JNYA 3OGCA 3L95A 4KK8D 4UYPA 2H4EA 4NI3A 2BOCA 2IWGA 2HWZL 3I6LD 3AY2A 1VZGA 5L81A 5CD3A 5DVMA 4WK4B 1S2EA 5LCVH 2CNZA 3LV3A 4Y5VC 4A2EA 1B3IA 4IOFD 3KYKH 2W60B 4R7DB 1NJ9A 1QWUA 4PTTA 1JK9A 1CYGA 4XTRC 5HDQL 1U5EA 4KPHH 1TZGL 3U4KA 1N7ML 1NUDA 3U0WH 1DDHB 4S0TD 4DK3A 2WO3B 2JCCA 1UUSA 4CU8A 4IKIA 5DURD 1R6VA 2C9SA 4GNKB 1RJZA 4JFHE 4ZOCA 2OYPA 5K9QI 3CSTA 1HIML 3MRQB 2J0KA 3KLDA 3V0GA 4NJAL 5AL8A 1OKEA 5CLQB 3DX8A 43CAA 5GHWH 4NZJA 2D9XA 2ZAHA 1CTMA 1A4KA 3QEGL 4KHXH 4O5LH 4IQHA 4PLKD 3TH3T 3IEAA 3VSTA 4N2GA 1AP2A 5JOFB 1FAKT 3CSFA 5D7JB 4L6EA 1IBFA 1TJGL 2QKSA 3G04A 4YHNB 5T1JA 5E9AA 1L0XA 4YNYB 3GI8H 2XWZA 4NZUH 1QBMH 4PB0H 1JWMB 2AJXL 5T3ZH 4HOMA 3T3MB 4RISL 3UBGA 1NDMB 4PWIA 1U5GA 4QHKJ 4MY6A 4PV9B 3QFJA 5DRNB 1BAGA 3ARGD 3VXUA 3BKCH 3QT2A 5I1LA 4BD4A 5I0WA 5IMLB 1IGCL 3L9BA 5DU7A 1QFHA 4ZZKA 5E6ZA 4EOWH 4HALA 3GB7A 4M1CC 3HAEG 1E6JH 2QSVA 1OMWA 3AITA 2AERT 1NCJA 1C1EH 3BSHA 3FPXA 2BNRB 2V2WA 4OV5A 2YXFA 4NCC1 3RVVC 3QR2A 4POUB 4UNIA 1HHIA 3VGHA 2ZWZA 2WOBA 2CLRA 1JNNH 3TBVB 3TNMA 2EH8H 2W65A 3H9ZA 1CLZL 5HE3A 1D9KD 1FIGL 4HCGA 4RFNC 4R7LA 3VTAA 4Z76B 4LAJH 4BINA 5B39B 3NP3A 1VENA 2VDOB 4QHUB 4Z95L 2GSIA 2VAJA 2MTAA 5JW3L 1A21A 2FX8L 4NQSA 5IESH 1ZGLM 1GZPA 5F3BB 1MFDL 1HDMA 4DX90 2DLIA 3KRXA 3CD4A 4RMWA 5D1XE 1JZ4A 1GS8A 3HI5H 3MV7E 1WUNT 5GGRY 5FYJE 2IANB 4Y2OA 5DJ0B 1KCKA 1DDVA 4OGYH 4YSSA 5CN1A 4NM8H 1TU2A 1X5MA 3LQAL 2Z4QB 3WTXA 5AYQA 1AMXA 3ATFA 4GIOA 4H4NA 1L3NA 1I7RA 3MRGA 2VLLB 2OXGB 1XF1A 5AVSB 5DD0H 4NZTL 1PMSA 4JFUA 5EF2A 2VLJD 2AEQL 3EGXB 3IF1A 2JKJA 5FI1A 1LWHA 1R24A 2A9ML 3PXLA 2Q10A 1SEBB 3QAZC 3DI2B 2H0JA 3BP6B 4LCWD 2NY4B 5F7LB 5MEOA 3KSYA 3LNDA 2A74A 4MCZA 3FUMA 4KMTL 2OAAA 1ZEAL 2FCBA 3GLAA 1NCOA 1DQKA 4I4WB 3IS0X 2ZIDA 4MCYB 1RZ7L 4Q9RL 3INUH 1BGXH 3E8UH 4KJWD 1D2OA 1E5BA 1F58L 1M9WA 5ILTH 5DD6B 3NG5A 1ZLEA 5JPMC 1R3KA 2BMKB 1I1YA 4PRHD 1O6TA 4IRSC 3CX2A 4ZXBD 3SDDC 4DKEH 5KTEL 3SDAB 3RDTB 3CIAA 3NAAL 3BVNB 3VJ6B 2A73A 5LGKA 2DQEL 1KPRB 4KJQD 1X6NA 2FGWL 2WXOA 2RTTA 4OLVL 2BDNH 3C2SA 3U1SL 2CM5A 2FX7H 1DVXA 5FM4A 4HAKA 1DEEB 5DMYA 4LLUB 2H3NB 4N2CA 5F7NC 1MKFA 3FM8C 4D6WA 3A58A 3RVWC 3S8FB 4JFDA 3TCXA 1CCZA 5B1JA 4WW1A 3QJXA 5I9QC 4NKMB 3WEXA 4U4IA 1K8DB 5F88B 3VXSD 4C58B 4DEPC 1JNLL 1JMXA 1U5DA 2AEPL 1UOVA 4AJWA 4Y1TA 3GXUB 5J13B 3PZDA 3WTSA 2FZ3B 4OJCA 3TIDA 1JPGA 4DP4X 4UNVA 4ICXA 2FHFA 1JFHA 2H2PD 3REWA 1F4XH 3HB3B 1FQ9C 3PDOB 1U8IB 4DO5A 2RCSL 3FXIC 1ETJA 4U6VH 3ZKXC 2P5EB 3L48A 1DVUA 3SODB 2RR3A 3NQIA 4KKAC 2EE0A 2CAKA 3MV9B 3NIGB 4HFUH 5SWZE 2ZWYA 3T6WA 1U3NA 1FSKC 3TWCL 4F20A 4NQCD 1PAMA 4NUGL 3N1QC 1TJ6A 1U41A 3L3OC 3UAJD 4UOQA 4NHCH 2VC2B 3FT1A 4RWHA 5DXWA 3CFJA 5FA4B 2NCMA 4FOMA 2FD6H 4MLIA 4PJDB 2A83B 3WNOA 3MJ9A 3P73A 3HK0A 1UB5A 2G4GA 1DE4B 3ARDA 2Z0QA 1BEYH 3MV9E 3SDXF 2BFVH 1YNTB 4F9PA 2XZZA 1X4YA 5JPNA 3QWOB 3QQ4A 5FHAL 3UJTL 3HJ0A 4JO1L 3VXRD 2VABB 4ZOAA 1WZ1L 4F8NA 2QFRA 1KJMB 2A6IA 4PI2A 3GWJA 3T0BA 4RIRB 2F7IA 1ECZA 2Z0PA 3V10A 4DPRA 5IGXH 5ECGA 2L7UA 3IRZA 4PCYA 3GUTA 1TQSA 2VXVL 3ECBA 5FECA 2XRAH 3F7YA 4RGNC 1OT2A 1YECH 4MKMA 4YHKL 4P04A 5BO1H 1NEPA 5J6GA 4LK4A 3L3HA 4Y4HD 4AZ8A 3SJVD 2RVBB 5GOWB 2YD6A 1JI2A 1YLBB 1YYML 3FBQA 3PG7A 3QWMA 2DEYX 4BQ6A 1CDGA 3WFDH 1JYXA 2MQ0A 2WN3A 3HNTH 1A7NH 4HKXB 4K3EL 4UZSA 4APQC 1PD0A 1A6VH 4D2NA 1JZDC 4K3HA 2VSKB 1D6VH 4N25A 2ZUWA 2DFKA 4BH7B 3VXME 5AKVA 4Y16D 3CSBA 3GQFA 4AGLA 1ED3A 3LVTA 3VI4B 3N04A 2YPLB 4AIEA 2BNQB 1UNRA 4NRXB 3L5XH 1SJHB 2KR0A 1PQZB 5E6IB 1PG7H 4J4PD 3NBNA 2FWSA 1B4TA 3ZYOA 1XT5A 2OJ1A 2DWSA 4KNQA 2NY3D 3H42L 2VRQA 3BZ5A 4JFYA 4WUUB 1XGQB 2UY6A 5GPRA 5DJ8A 5D2NE 4F2FA 1ZSHA 5KOMC 2IALB 5D1QA 4NAQA 5K9OB 1BTNA 1WDAA 3SEPA 2QEJA 2YUXA 3TBWB 2BW5A 2BNQE 3OHXC 4P4RB 2QGEA 2R15A 4M1DH 2XWDA 1JGVH 3C6LA 2VUKA 1P7HL 1WTLA 3WIFB 3BAEH 2CRIA 4PWKA 5KZCD 4P3DA 3L4UA 2DQCL 4WUUE 2WLIA 2BHUA 4X4MA 1GS7A 1P5UC 2HJKB 4YDIH 2P24A 1U4EA 3C8KA 3KCPB 4HWUA 4J3VA 2M26A 4YOKA 3LZOA 1WG7A 1ZVSA 1ZHLA 3SE8L 4ANUA 2ZOKA 3ARBA 1OVZA 3LCYA 5I1DA 1FDLL 1SY6H 1CGWA 3DRQA 3OZLA 2P52A 2PO6B 4JFTA 5KVDE 2JMRA 3D09A 3VI3F 3V6BR 1ECYA 3CC1A 3MBXH 4QHLB 3O6FD 4PP2B 2X4PB 5HXMA 1AIZA 3EH1A 2VXSL 4M02A 3NEXA 2O6PA 1KB5L 1MZYA 4W6YB 1OPGH 4P46C 1LP9F 3BT2L 1N68A 4IMKA 5D6DC 1KGCD 4NSWA 1UT2A 3V6FA 1KOAA 5GRXG 4S1DD 5HGHB 2BVYA 1OM9A 1DQJA 1AHMA 4WHTA 1WLHA 4FS0A 1KBWA 4WFGD 4GAGL 4Y4FB 1INDL 2WXRA 5DC2A 4XAKD 1DHKA 3KLQA 1S9XB 3QIWB 3ZHFA 5HPOA 3BKYL 1I85C 2A7BA 1OQOA 1XH1A 3FUFA 3QDGE 3CPLA 4X7TB 4EXKA 4DKFL 5J3QA 2AJSL 1V3JA 2D03L 4DFIA 1TLMA 1I1AC 4YPGA 4ISVB 5T1DH 1YY9D 3X23A 4B6HA 2ZF8A 4IDJL 2M14A 2D0GA 4PJBF 4K8RL 5C09E 3OJDA 2BM3A 3DGGB 1SDYA 1ORSB 5T5NF 4LLMB 2L0DA 1MFVA 2D7OA 2XKNA 4FYQA 1OHQA 2XSKA 3L3GB 3QDMA 3DDGA 2ZYSA 1OGAD 1CICA 1X5ZA 1LDPH 3WYRA 4U4BA 1KLFA 2XQYK 1R3LA 5BS0B 2XWTA 5T3XE 4N0FB 1OCZB 1NEUA 2X4TA 4IU2A 1L9SA 4LEBA 5EO0A 1KT2B 3CDGA 3RWGB 5BZZA 4OGAD 3PV7A 2BRRL 4L4JA 2Y5EA 3EJYC 5HHVH 1HHKB 1CXIA 4RRPA 1VEMA 2Y22A 2J71A 4PJHB 5AVXB 4FXGC 1UWXK 2VZTA 2CBQA 3LRLA 4FNQA 3RKDD 4Y4KC 4KVNL 4AL8H 4GBXC 5I76B 5IB3B 3ZDXF 4WWNA 4Q0XH 3OAZK 1HT6A 1J7VR 1CN4A 2R4SL 1PAZA 1BVKB 2VT0A 3BEWA 1GL4B 1CDYA 2B9AA 4PTUA 4ZX3A 1XGRB 2M8XA 3BGAA 4P99A 5FYJU 5LDUA 3OXSB 4EI6B 1C08B 4ZFOA 1X5JA 5HGGS 4XNMA 1NCBH 5D7LE 4G6JH 1EERB 3S9DB 1PZ3A 5J89A 2FIKB 3UPRB 4PRBB 1N67A 4YUEL 3EAKA 3BUPA 4PJHE 1Q0XL 4R4FH 4TS6A 5LLIC 3B8SA 2ZP8A 2HLAB 1ZTMA 2DQIL 5FV2A 2BOBA 5EUKB 1EHKB 5F6HJ 3UTSE 2ODIA 4NZRL 4B9ZA 1JXGA 2AEWA 5IHZA 1QVOB 5HHOA 2Y8GA 4C8XA 4W9IC 3DOIA 5J56B 2XYBA 1P69B 3PLYA 3O0RH 5IQ9A 3D1MC 5HHNA 2AJVL 3T3PE 4YDNA 3PRZA 4L1LA 2FL5B 2DYPD 2XXFA 3CZFB 1EGJA 2YXMA 5LWYH 1HH9B 1AOZA 4K2PA 2CR6A 3DPBB 3S0PA 2J6EL 3QRGL 1I8KA 4AJ0A 4ZRJA 1K5NB 1IRAY 1QW8A 3OBAA 4HZ1A 4KKRA 5TE7L 3RUGE 2C1PA 2QLYA 5DC9B 9PCYA 4PJIF 1XCTB 2MOQA 3PWPB 5T1LB 1G5AA 5CLLB 1Y0LA 1E4WL 5CIPB 4QRPB 3KYMA 3UO1H 2HFFA 1UACH 25C8L 4WUKL 4YQXH 3W0WE 4G82A 5E4AA 4XP9H 2BSRA 5EORL 1IJ9A 4D9QD 4UUJA 4XHJD 1ZT1A 2AAVA 3GFUA 1TPXC 1Y07A 3VFVA 1TITA 3DRTB 2E7CA 4CADA 4XOEA 5D7EA 5IB4A 5B8CA 1ZA3A 4EDWH 4RQQB 3FO0H 5HDRA 4K7PX 4OCNC 1XTMA 1LK3L 4FJYA 1YUHA 2CO7B 4JMXA 3P4OB 5EBWB 3RVVD 1NC2A 3I02A 4QRPE 1PIGA 4PGCB 3UJIL 4TLKA 1YEDA 4MA3B 4XCFH 2VN5A 3BIAX 3G9AB 4OLEA 2X41A 4N6QA 3B34A 5BVJA 3KJ6H 2R8SH 1EANA 5DWUH 3MLSL 1MOEA 5CUSH 3IVKA 5ACMA 2DQDH 1QMUA 1FCCA 2DWYA 4HKBB 1OF0A 3QZLA 4HKJB 1WT5C 2VDRH 2OQJB 2ZT9C 4YHYB 1ES0A 1T6VN 4E42A 1HS6A 3WDJA 2E75C 2X6VA 3JUZA 2BS9A 3HC3H 5AB2A 3AABA 5DR5H 4KRPB 1AG6A 4LSSH 4K2OA 4DT2A 3BP4A 3ARFD 3BZFA 3S5LG 3ATAA 3B6SB 4QRTB 1DBKH 1WEJH 3O4LD 4M7LT 3KD4A 4L0PB 3SKOA 5KBKA 5I1HH 4UANA 4I3SL 5D5ME 2PYFB 4Z7NB 2J88H 2A6KB 2D4QA 1FFTB 4JFED 2VZ1A 2P45B 3FYEB 2PPAA 5C9JA 3P4NB 4OCMC 4GMXB 4KZ0A 5DMGC 4XXWC 2BOLA 5E2WH 3ZK0A 4N2KA 4NWUL 3LPWA 2NY0D 2VM9A 1ANUA 3K6OA 4BFBD 3RL1B 1MVUB 4P3CH 4Y1AB 5BRPA 4Q8BA 5EWIL 2W0FB 3CMOH 3P4LA 4IM8A 2FH6A 2YPKB 2VM4A 4BZYA 4Z7NE 4IRSD 3D8FA 4NKDB 5F44A 2AK1L 3TBTA 5L8JB 2VNCA 3LRMA 1UG9A 3CQFA 4OJFH 5I5JA 3C5ZB 3HAEA 2ESVD 4PJ9D 5SV3A 1Y19B 3FTUA 4OD1L 5GISH 1A6ZB 1NIAA 2ROXA 5D7IE 1VFAB 4DZ8A 4NFBA 4XPBL 4A55A 1ZT7A 3TIEA 2NX5E 4ZPVA 4Z9KB 1GYCA 1H5BA 1NBVH 4ZYKB 3G5ZA 1U95B 4TNVK 1CGSH 4AKQA 4PG9A 1E4XL 1J9RA 5SWQB 5IEKB 1UVQA 1CG9B 2GIMA 3D85B 3C09B 5FLVA 1G0DA 5JNYB 1J11A 3OGCB 3L95B 1TCRA 1B9KA 2BOCB 4MJ2A 1EMTL 1P7KA 4BKTC 4JPWH 2DQJH 3BYTA 5CD3B 3ZGHA 4WEBL 3QARA 3U7DA 4H25A 1BPLB 1NMBL 3CVHH 4RGOH 1NJ9B 3A3YB 5T5FH 3WAJA 2H8PB 1DANU 4PTTB 1JK9B 2DS4A 1X86A 3QZPA 4HA1A 4YO0A 4M6NL 1FNLA 5LGHH 3VFPA 2XN2A 1HU8A 1T2QL 3TA3B 1R47A 2JKNA 1PZ5A 3ARSA 2Q7YB 5DS1A 1LO5A 4CW1A 4KKAD 5KYUB 5I15L 2HAZA 4AT6A 2JCCB 4TNEA 1RJZB 2WP3O 2P5WE 4QRBA 1U6AL 4JFWA 5D7SL 2FJSA 2J2ZB 4LSTL 2FBOJ 3DKHA 2P4AB 5KVMC 1JPSL 5CF3A 4AQ8C 4RSYA 3GXMA 3DX8B 43CAB 4KVPA 3MNDA 2D7NA 4PJEF 4YBHA 4G6FB 4JG0L 2NTFB 3D4ZA 4WTXA 4F80A 3BESR 4DWHA 1IT9H 4Z3HA 5JW4M 1ZANL 1JZ3A 1GSMA 1V54B 1AP2B 4ANVA 1XCXA 2WM0A 4KKLC 4F1ZA 1A3ZA 5H35A 3D05A 1S7TA 2R0ZH 4HCRH 3G04B 1PPIA 5BRZE 2PP9A 3N40P 4N8CH 1NFDE 1UUNA 3ZO9A 4FDWA 2AP2A 5LGJA 2IH3A 3KNBA 1M71B 1CR9L 1FORH 2N7SA 2Q7NA 3V4VL 3K3QA 2CG9X 3K2MC 2ZXDA 1RAMA 3OWEA 3QFJB 3WIHA 3VXUB 5I1LB 1WBYA 2IC2A 1Y1UA 3BH9A 1QATA 3R8QA 3ZT7A 3PP4L 2E7HA 2NQDA 1S3KH 1XQ4A 3S35L 3B2DC 3D8MA 3GO1H 2GI0A 2EE3A 1A7OL 1KN2H 3SBPA 1D5ZA 1MPAL 4IIQC 1HKLH 1YMMD 3DETD 2V2WB 5I8EA 5IHUL 1NKOA 2DJMA 1W72H 4OV5B 1MHPL 2X7LA 2IGLA 1B4JH 1A4CA 4P5RA 3UJJH 2G5RA 2HFEB 1QHOA 1HHIB 1TSHA 5CR8A 5BVPL 2CLRB 4XPGH 5EO1A 3BISA 2D9YA 4WFFD 2W65B 5IB2B 3SCMC 4BZ1L 1ADQH 1N8ZA 3DXAE 2WUBH 3BUDA 3FCBA 4UU9A 5LGYA 3ZDYF 3D25B 1A22B 5I0YA 5H37H 2WSPA 1GZPB 3F6JA 1HDMB 1L9MA 2DLFL 4LEEA 2JTYA 3MRFA 1LWRA 5IM7B 5LG1A 3EHBC 1KYOK 2P1YA 2P5PA 1TU2B 1WIPA 3GINA 2O6DA 4LVEA 4OZHF 4YDZA 1A2YA 2RJMA 3IJ8A 4UWQB 5E1IA 1F45A 4FFZA 3RY5A 2EIZB 1I7RB 3MRGB 1TENA 2D7TL 1AZUA 1E40A 2AQPA 3FT0A 1KC5H 4ONHA 1R24B 4O02H 1MW3A 4P4KD 4G8GD 3PVWA 4S10A 1I3GH 5I1EL 1ILSA 4HWBL 4O2CB 4Z7UF 4L1RA 2ICES 3ARGA 5HY9B 2A74B 3ZKMC 3WNPA 5HHXH 4LGRB 5JQHC 3PGFL 1ML0A 1OAXH 4M5YL 5EIQA 4XN5A 1RZ8A 2EILB 1YUKB 2ZZUT 2GBTA 1RUQL 2ZX9A 4MAUH 3W2DL 4YSAA 4Q4EA 1MFMA 1JGUL 1SN2A 4DSYA 1ULVA 1R3KB 3GSNB 3TA4D 3Q6FA 1EJOH 1I1YB 5HD8C 3H2QA 3BWAA 4WJ5B 2D9VA 1P53A 5EZPA 2VN3A 3D0VA 4NGHL 4BFEA 3CZGA 1LMIA 1NANH 1CT8B 1G7PA 2AFNA 5FDWB 3W37A 5C0DA 1G1YA 4LEOB 3DUSB 4NQUA 2C7FA 4ONGH 2CGYA 3KLHC 1HINH 4JFDB 1NBYB 5SV4A 2OSLA 1RV6X 2CGZA 2ADFL 4L48A 4KKNA 2VLJA 4K23H 4NHUA 2UUDH 3LKRA 1FWXA 3KR3H 5D2LE 1U8MA 3TBCA 4Z77B 1AOHA 4LCWA 3TIDB 2DWEB 3G6JF 3HNVL 2VITA 2GCYA 3VX0A 2WKLA 4GSUA 1N4XL 1TTAA 3GYOA 3IK2A 3EUDA 5JXAL 3ZHNA 4AE1A 2JQMA 1MW2A 5C0EA 2WQAA 4YDJA 4Z3TA 1I1AD 5AZUA 2D73A 4Y9CA 3QEQE 1WZAA 1P84J 5E9NA 3CAFA 1TYRA 4KQ4H 4PRHA 2NSMA 3ZZLA 1E8WA 4ZXBA 3MLPA 4LHUD 4GSQA 1WSST 2CJUL 5KBDA 1AHKA 1QW9A 2V37A 2UVFA 3UTZA 3KYNB 5J1TC 5EU4A 3ZRSA 2CBOA 3CFJB 3ML8A 3IDIA 5SX4H 5B38G 1EXGA 4A6HA 3ARDB 4LZKA 3FB6A 1NUNB 4U0RC 3EOYG 5HDQH 2UZRA 2J43A 3DVGA 4WWPA 1TZGH 1AMYA 2V2XA 2QLVB 3EJYD 4ODBD 5F9JA 4AL8C 5JPNB 3E3QE 4QDGA 3VXSA 4F7KA 2RSGA 2FDBP 3HC4H 1Q90A 4Y4KD 2A6IB 2W88A 5IFAL 4GBXD 3ZVVA 3VG9C 2R2EA 1UOKA 3GUTB 1FHGA 2G2PA 3ECBB 3FO1A 2JELH 4ELMF 5FECB 1CPUA 3SGJA 4B3EA 2VGLM 4QLWA 2L8AA 3F7YB 4OZFG 2BERA 5J6GB 3L45A 2XT1B 1OGSA 1N26A 3ESNA 1B88A 4HLJA 5AKSA 4Z3IA 1E6OL 3QQ9D 4FFTA 4G42A 3RILA 4PREA 5C8JB 1EJ6A 4I9XA 1TJGH 2XVKA 4U1HA 2PYED 1V10A 2VR4A 3TJHC 5EF0A 2AJXH 1CFMA 1DBAL 1S7UA 4NQCA 2VDML 3OGOE 1ZLVK 1ED3B 3REVA 1JV2A 4PG2A 3UAJA 4PJAA 5TPWL 3GEWB 4G9FE 2E0PA 1IZKA 1CVRA 3MLYL 1RY7B 2PCFA 2V5RA 3GS7A 3GRWH 4R2GC 1H6TA 4TSBH 4QNPE 1L5GA 3CK0H 4X83A 5KSAD 3OV6A 3HE7D 4BJLA 2XKUA 3QQXA 4HUNB 1ZVRA 5HP5A 4LBEA 2YAMA 2G4EA 2DDQH 3BCFA 3G5YA 4JFYB 3TPUA 3P3YA 2UY6B 3DLQR 3PJNA 5DJ8B 3T2QA 3VXRA 5AW9B 5T3ZD 3QHZL 5D1QB 1ZLSL 4BFOA 1YY8A 4U1LA 1MDTA 1CLZH 1WQVT 3J27A 5B3NA 3GXPA 4YAQA 4ZTEA 2BS8A 4FN0A 4IRJC 1U92A 2ZG2A 2XG4B 3X1BA 5FCUL 1RZJL 4MDJA 2W95A 1HZHL 4GO9A 3AREC 4P2QD 2ZUYA 4Y4HA 3SJVA 2E56A 1YN7A 4KH9A 3TO4C 2F8IA 4P3DB 4YFDB 1WCBA 2XPGA 1EHXA 3T0EE 3S3SA 2XFXA 3LQAH 2P24B 2F2HA 3C8KB 2WBJC 1YC8A 2HPOA 2BNUB 1HL4A 1ZVSB 4X6DE 1ZHLB 5KVFL 3ARBB 1MCQA 1GYVA 1T2XA 3BXNA 3DRQB 3FCGA 5I1DB 1JZJA 4YE4L 2L7JA 8FABB 1F8TH 4WSKA 5CJQL 3QFGA 4Y16A 1ZLDA 4JFZL 1ESOA 2J8UF 4G7YH 4UINH 5E4IA 1NOAA 4AIZA 3F58L 4W68A 1WHPA 2NDGA 3CVIL 3UZEC 4ZDHA 1WAAA 2ZUUA 4KMTH 5AL0A 3AB0B 2BSSA 3MUY1 3NSYA 4QLRA 3UP1A 5J3TA 5D96B 2JKIS 2AVFA 2NW2B 1MFNA 2AQQA 3BP5A 4P07A 3V6FB 5KSBE 1F58H 3LKPA 4C54A 3GSOA 1DQJB 4BXVA 3B2VL 1V5PA 4WHTB 1AFVL 4JK0D 3BSGA 1RUAL 3P1VA 3QO0A 4PU2A 3QR1A 2JIXB 2BVQA 3D87B 4UV7L 4MXVE 4F2EA 1T3FA 3CPLB 4OJAA 3FRPG 3VTMA 4LHUG 5HGBA 2Z6FA 3IPFA 2FGWH 2CKBA 2B77A 3QJTB 2V3FA 3KDMB 3U1SH 1UM6L 5AYUL 4R5TA 5JHGA 4FFWC 3D07A 4OF3A 5DMGD 3HHRB 3S5ZA 3EFOA 2Y6TE 3D0LA 3TBSB 4ZOEA 5KSVA 5FYLL 5JHLL 4YWGL 1M57B 3NGBC 5C0AE 3V8OA 3OJDB 1FGZA 1CXFA 4NX0A 4JY6A 3C60C 3NJLA 2NQCA 2AEPH 1DYNA 3O6ML 1ZJBA 3H9HA 3VD5A 3ESMA 3QDMB 3QXUA 4XI5D 4BE6A 3QJSB 1CICB 3WNLA 3R8BB 1KLFB 2K9UA 1X5YA 4NI6A 4L23A 3BPNC 4YHPB 3WIIL 4KI1A 2XWTB 4JW3A 4LLQA 3O6FA 5A2JH 5HGAB 3OSVA 1CVSC 2X4TB 4IU2B 4MVBD 5EO0B 3WJJA 4X0NA 3CDGB 3PHOA 3KLAB 1A8JH 2FJFA 2YQ2A 4JRYD 3BD5A 4N2MA 1NU2A 2X1WL 4G80A 5IIEA 1CJYA 4ZOBA 2YQ3A 1JXDA 4JO3L 5LDSA 3HIEA 4RMVA 5I1CH 5CILL 4EKUA 5J8OA 2AV7B 2Z3FA 5K1NA 2F08A 4PP1D 4AKOA 5CFHA 1S3RA 2IYBA 3HMXA 4NQEE 3TWCH 2HT3D 4P59H 1NCUA 3CFEA 2Q13A 2XV2A 4NUGH 3RX7A 1JVOA 1A9EA 2OI9B 2WNWA 2VZSA 1DDTA 4YIQB 1NMCB 5F7YC 1I3UA 5D70H 1CO1A 4A7QA 5E8NA 3ZE1E 1NLDH 4ZFOB 3KWTA 1XO8A 4GRWE 4XNMB 3ILQC 3VO0A 4JDZA 5E6UB 2VMJA 3W9EB 3GXFA 4KY1L 3S5LA 4ELKA 3CU7A 3I50L 4F8OA 4FNLL 3VGEA 1NI2A 1R3HA 5DQDL 2K3HA 1LE9B 1HXMB 2BOBB 4P5MA 3UJTH 3IN0A 3H53A 1WZ1H 4NO0D 1NLBL 3AXLA 2FEEL 5JDJA 1QSEB 5EIIG 2YUVA 7FABL 5DHVH 3L4XA 5HHOB 7PCYA 3VGDA 2QSCL 2W8CA 1AD9A 4BUGA 2DV6A 1MWAL 4YHKH 1NFIA 3QUYC 1VZIA 3ZDWA 2WV3A 5F9DC 4ZAKC 3VGAB 1DSFH 2WLMA 1IB5A 2D7QA 1S78C 2X3AA 1O7VA 4K3EH 1A14H 3K80A 2MCPL 1UWXH 3RPBA 3OG4B 1I8KB 1ICTA 2W94A 4S2SA 2C1PB 1QSEE 3QUMA 2PXYB 5DMKA 3RWJA 2GIYA 3OAZH 4AG4L 4OUUA 4Y5YC 3KYMB 4ZSOE 4BSVA 1T83A 2HFFB 4IRZL 4TPRL 3L1OL 4S1RL 5KYYB 5BV7L 2DX5A 1GY2A 2VQTA 1G94A 1IGJB 4OCSH 1KTCA 2BSRB 3KEDA 5C0CD 4JFSA 4UUJB 1GG3A 2DTCA 2EC1A 3QJQB 5DRXA 1ZT1B 4DW2L 4EPSA 3VFVB 1T03H 4J2XA 1DZ0A 3GTTA 2WBXA 5HJ3A 5EEUA 5IB4B 4K5PA 3RQ3A 3V0WL 1J1XH 3SY0A 2O61A 4F27A 1YUHB 2DLWA 1NC2B 3I02B 1XEDA 3ZTNL 5MI0B 4X42A 1IBDA 3KBPA 1YEDB 3ZTCC 3B8YA 1C9SA 2PW2A 4C4KT 3SCMD 3N41B 3ULUF 2XTJE 4KTYA 4FL4C 1HCFX 5DS8A 3TESA 4P8QA 5FYJH 3RIAK 3IVKB 2GUOB 3EG9A 3EBHA 5HDWA 2X6UA 2YA2A 5C6TL 1ODAA 2CDGA 2ZSVA 4JKPH 3NCFB 2A9NL 3T2LA 2VOTA 4HFWB 2Z59A 4QAMB 4K7PH 4ODSL 4E42B 1H19A 2DYPA 5IVXF 1H15A 1AQCA 4FMVA 2DQCH 4FQ2H 3SKNA 2K4AA 4N2LA 2YSTA 4XBEH 4U1NA 3BP4B 3DIVA 1MUJA 3OF6D 3BZFB 1BLIA 2HT2D 4K7PY 3FAXA 5JIMA 1SXSA 4DH2A 1OXYA 2ARWA 3U2SB 1JPEA 2IWKA 3SKOB 2HFGL 4PJGF 4UQDA 3HIZA 4DPCX 2X42A 2G60H 3FQWA 4TUOA 5I1KL 5FUZL 3P9MA 4HXBH 5E6YA 3K2IA 1FO0B 4UTBH 5LN4A 4YS4A 5C9JB 3LZPA 3LB6C 2VXSH 5L9DL 5I8KL 1HHHB 2GG1A 2BSBA 3B7RL 4PJFA 2EDMA 2V2TA 3ZBMA 3CXDH 2JQZA 3BT2H 2WINA 4R97B 4H2CA 1U3HC 5DUPL 4XZ4A 3ARXA 2J55A 3OKDA 4WU5A 4YGAB 1QZ1A 4DP0X 4WF7A 3VTTA 4P9HH 3QJHB 3E1F1 3G08A 1LD9A 4OLUL 1GC7A 3CXBB 2J1XA 2H1LM 1L9TA 2VM3A 4GAGH 3T8XA 4ABWA 3TBTB 1OP3K 1GJWA 2BRQA 1WWAX 5F9WC 1NGZA 3BKYH 4N87A 4GN1A 3HAEB 4EXPX 4U1KB 4XNUL 2NY1B 3ZE2B 2AJSH 1U8NA 3D51A 4PB9L 2QR0A 1UM4H 4V1DD 4ZPVB 1H5BB 4IDLA 3G5ZB 2NQ3A 2Y72A 4HCFA 1MW0A 3ZOAA 4UQ2B 1JNHA 2D9WA 4PG9B 4UV4H 1FVEA 4JHBA 1UVQB 4IDJH 5AVRB 3F12B 3ARFA 3D50A 4K8RH 4JQVC 1NL0L 1TQVA 2LLGA 4N5EC 4BK8A 4F93B 4GP8B 4PJCA 3DVNA 4L0YA 1BWNA 1CGVA 1D5MA 1PNDA 3QFDB 2ZUVA 1LO3L 4LFHD 3WKYA 3K8KA 4H25B 2VUOA 3QRLA 4GLRI 1RP8A 2E74C 4N22A 4YO0B 1L9RA 2EQDA 4ZI8A 2DM2A 3U4AA 2E3VA 2Q7AA 3VFUA 1BYPA 2R1WA 3MRCA 4IJ3B 5DQJB 4CW1B 1PZ5B 2BRRH 1AR1C 3ZJAA 1RVFL 3MNMA 2DL9A 2XVGA 4F15C 4AT6B 4R8WL 4P5SA 1AI1L 1OAKL 1TOXA 2E9GA 4KVNH 2FEDC 1KTKE 4TOYL 1I3VA 4IRSA 2IDTA 1FG9C 2GEEA 3JWDL 3ORJA 3BSZA 1XH2A 4PJ9A 2ESVA 4TRPL 5ISZD 1IE4A 3AS0A 3N44B 3UTQA 5I73B 5H35B 4F9LC 1LTXA 3VWJC 1UD3A 3C5JA 5DGQA 2IBGA 1G9EA 4K2UH 4YUEH 2H0FA 2UV3A 2Y4SA 3SQOH 5C3TA 3TEYA 4L1SA 5LGJB 4DN3L 2IH3B 4LF3A 1FNEA 3G6DL 5BW7C 3CVDA 5KJ4A 3VQMA 1MCNA 4JJ5A 1MKEA 5HVHB 2H26A 2HJFA 2OZ4A 5EN3A 2D9ZA 4NZRH 1WBYB 3BH9B 4AQEA 4KTDL 4RX4D 1B0RA 2I9TA 3BPOB 4YGVB 4JS7A 3TP4A 1D5ZB 3FQUA 5GGSA 2AJVH 5GRVL 4KXDA 2BP8A 5F9OH 5I8EB 1IAIM 2AI0L 2X7LB 1MCKA 1GRWA 1RU9L 3RIFF 2R0DA 3Q8EA 2CHWA 2ROYA 3QNZA 5DURB 2J6EH 3QRGH 2UZSA 4G8IA 5EO1B 3WENA 5TE7H 5JO5A 5CEYA 3IJSA 2F5AH 3N43B 2D7PA 2LOZA 1FZOA 3KPOA 1T0PB 4YDKL 1N8ZB 3NABH 2K49A 2VZUA 1JIBA 3GXTA 4UU9B 3F5WA 1SOXA 3HHMA 1CS6A 4L4VE 3BPLB 3TVVA 1OGTA 3FSSA 1NAMA 3MLZL 4WUKH 5IVNA 5HE1A 2DTMH 3MRFB 3RWHA 2IH8A 3CFNA 3DSNB 1AHWB 2ZUQC 5EORH 3S2AA 2H1PL 2XKSA 1AXTH 1U2HA 3VXNB 1IX2A 1A2YB 1O9WA 2R69L 4F33A 4NC1C 1J0JA 1YPZF 3MRLA 2DW5A 4QYAA 4DUVA 3DCXA 2GSGB 4ONHB 3GEFA 4HWNA 2WQWA 3EUUA 2AEOA 3SE6A 4ENZA 4OQTH 4GQQA 2UWEA 2WXFA 3ARGB 1RURL 3DTXA 1UOLA 4LLWB 2ROVA 4MA1C 5B38A 3WNNA 5DFVC 3N9GH 3MLSH 4FABL 3AQYA 4IRJD 2NT1A 1RZ8B 1R5WB 2G3ZA 3RKPA 4EO5A 2VDPB 3VB9A 5D1ZC 4G2AA 1KJ2A 3LQAC 3QNXA 4OU3A 3TO4D 5JYLA 5DSCA 3TZVD 5TFSL 4WVRA 3N0PB 3SDXE 1YMMA 3X3GH 1DSWA 1NDTA 5F7MC 2WBJD 1CUOA 3Q6FB 2F1BA 3BWAB 3WU1A 3U2JA 1D9KB 2YAEA 5F3HA 2XNAA 4OZFA 5HDBB 4C57C 4FHBD 2NZIA 4JGJA 1SYSB 2KLSA 4AGPA 2D3JA 1G7PB 4FI7A 4WGWB 2E6QA 2R2CA 4LPYA 4UOZA 5C0DB 2V7NA 1QR1A 2W92A 4X9IA 4C56D 3GHEL 1VCAA 5DVOA 3QXVA 5DLLA 3DHPA 4NWUH 2D11A 2TRYA 1UXSA 2OSLB 4D3CL 3WL9B 3VU1A 2W0KA 3BEVA 5CD5C 2VLJB 3E6HA 4NHUB 1L9QA 1NC4D 5F1SA 3IFPA 4F5CA 2GBVA 2NZ9C 4P4KA 4G8GA 4R7NA 2J59M 2DI9A 2F53E 4LCWB 3CFUA 2OV0A 2VITB 2GCYB 2AK1H 2J8HA 4K3DL 4PVBA 4GUQA 3B83A 3INOA 4EMZA 5FHBL 1DQTA 4AEIL 4CBPA 3ETSA 3CVBA 1BOGB 2G5BA 1UKSA 1LO2H 4OD1H 3GJEA 5E6SB 4W9KC 4GY4A 5C0EB 1WITA 1G9NL 4FNSA 5E08H 2QVMA 4K3JL 1S7XA 1E4XH 4EN2A 2Z1KA 2VR3A 4OCXH 4RZKA 3E2HB 4PRHB 4PVNA 4ZXBB 2P7TB 2EH7H 3C60D 1OCCB 3NSDA 5D93C 1WFMA 4D9RD 1EMTH 1UOWA 5E23A 3STZA 3W11C 1X7TA 4WEBH 5EU4B 4NIKB 1UNQA 3SDCC 5CJOL 4HGKC 3IDIB 1NMBH 4HPHA 1RUKL 4X8CA 1F90L 2L04A 2WYIA 4NKQB 4PLOB 1KENL 4M6NH 3FB6B 4MAYD 1WC7A 2DL2A 3BUYA 3EFFB 4FFYL 3DVGB 3SO3B 1T2QH 4XNYH 3DUHA 5E51A 1LP9B 2R1XA 4MSWB 2W9DL 3VXSB 5I15H 2G9HA 4G7SB 3HE6C 4F7MA 4HS6A 4WNQA 2Y69B 3ATDA 2JE8A 5D7SH 5ABAA 4LVNB 4BV1A 4LSTH 3VI3E 1XHHA 4YSTA 2GITA 3FO1B 4G70B 4OB5H 4WI3A 3ZSSA 4FXTA 3KXFA 4WSGA 3HVDA 4L1HA 4JG0H 4GG6F 1VZHA 2PUQT 2CQVA 2E7BA 1ZANH 2B2XL 1F5WA 4PREB 1I1AA 4UQ3A 3ARRA 1LP9E 5SWSE 2QV4A 4U1HB 4QR7A 5E2TH 1J8HD 3SGKA 4PY7A 3BAIA 4KXZH 2C7UA 1QBLL 4AH2A 2X09A 3OAUH 1WZKA 4NQCB 1U29A 4L9LA 5F0JB 2J1WA 3BGFC 3FRPA 4H13C 4LHUA 1ACXA 3QJUB 1CFSA 4FA7B 3REVB 2HP4A 4PJAB 1N19A 2V5SA 2QFPA 5DDHA 2PCFB 3CIQA 4HXAL 1EEYA 1J8KA 5CJXA 1L5GB 4JN1L 4U1JB 1BAFL 2ATAA 3QUYD 1PEZA 4LBEB 2AXFA 3MV8D 1HJBC 2EYRA 5IROC 1BECA 2AQ3A 3G5YB 4G8EA 2YRBA 4JCLA 4YL9A 5I16A 4E9TA 3O3EA 4IBZA 1F3DJ 2C9PA 4YR6A 1MHPH 3VXRB 3UROR 3WD5L 3FFCD 4PJBE 1MFBH 3AU1A 4JKNA 3RFZC 5EFXA 1RLWA 2DX1A 1YY8B 4U1SA 3A6OA 3QWRD 4I9WE 5LCVA 5BXFA 1TVBA 4YAQB 5EO9A 5LNEA 3ZDXB 1WD9A 1U92B 4X6BA 2VN4A 2NY6C 4LCCB 4MDJB 1F4YL 1NKRA 4L5FE 3WGUB 1YEFL 4Y4HB 4ZW3A 2FJGB 2FWLB 3SJVB 2DLFH 4NYLB 2HJLA 2DEWX 1DQQA 1WCBB 2XPGB 2XFXB 4FADA 1A6UL 1HCZA 2YMOA 3GJFH 3POHA 3LYRA 4KAQL 3MRKA 4DN4L 3QZBA 2D7TH 3BXNB 5I24A 4HV8A 2OMXA 5IJKC 3K5SA 2CBPA 5INDA 1B4LA 1A65A 2UXVA 3HG4A 1ZLVH 3RWFB 3ZDXE 3B5GA 4AIZB 5JLZA 5EZOH 2WANA 3JTBA 1BX2A 4J3TA 1E65A 2C4FT 1Q9LA 3PGFH 2ZX5A 2BSSB 3BQVA 5KSAA 3HE7A 3MXVL 1M7IB 1RUQH 3W2DH 2JJSA 3BP5B 4ZS6C 2DRUA 2NY3B 4MJ5A 2KUQA 1P5TA 3LKPB 3GSOB 4W70A 5ANMB 5A2FA 1Z32X 2VDOL 4NENA 1F4AA 4DO6A 2QQNL 3QO0B 5EIIA 3QRBA 2ZE0A 5CJ8A 4RMTA 2BVQB 4N28A 3MREA 5DHXB 1T3FB 4NGHH 2NY7L 5KQ4A 1I4FA 3MCLL 5HGBB 2UY7A 5J06A 4WV1A 3BW9A 4P2QA 3LZNA 2CUMA 4H8UA 3VNYA 5KZCB 3GS0A 2CCWA 2HX7A 2ZXEB 3D0LB 2WSDA 3EFOB 3TH2T 2CIIA 5ANME 1BQHG 2DQTH 3ZIYA 5KSVB 5IFJA 1Z5YD 2QMJA 1E7VA 1BZ7B 1U3HD 1MAMH 3UIZA 1OTUC 4JY6B 5IFHL 4PJXF 4YSCA 1BFTA 5DA4A 2ZUTA 3H9HB 4Z7VF 3Q9QA 4PJIE 5B3JF 5GGRA 3X3FL 3CNKA 4A7SA 3VD4A 1UEFA 2VJ0A 3BI9X 3HNVH 4I85A 5EOCH 1UKQA 3O6FB 4PS7A 1WJ1A 3MFFA 4TTGA 2B7DT 1N4XH 2P3YA 4JB9L 4QPEA 4LCIL 3PHOB 3L3KB 2FJFB 5JXAH 3JYBA 5KEZA 4WFHE 5E99L 5IIEB 4GXFA 5D6CA 4ACTA 2MOVA 5IT2L 1T4KA 1UD2A 2IFFL 4K8RC 4A37A 1P84K 2P26A 3VGBA 4ZO8A 2J5LC 3SPHA 4O2FA 2BFGA 1SLVA 4MASA 4MZRA 4S1SL 5C07B 3B7YA 3U4EA 3A24A 3FO2B 2YUZA 1USZA 3EADA 3TC9A 3VXPA 5C70A 1AS7A 5IQMA 3LS4L 2CJUH 5F1NA 3IFNL 3ZKNC 1DN2A 5E0QA 2W9LA 5E8NB 1EXHA 2EP6A 3GT6A 4ZJ9A 5FKAA 3WEAA 5CEZE 4JDZB 3JTSA 4NPKA 3P30H 4NRYA 3S5LB 4QTFA 3KPSD 5AAMA 3H9SD 3O6KH 1R3HB 1RPKA 1KXQA 1BQ5A 2C34A 2NNCA 4P5MB 4IOYX 5C07E 1MHHA 3OB0H 4OZGA 3BPCA 3NIDB 3ZGIA 3AXLB 4OSUL 6CGTA 3TF7C 5IFAH 4QO1A 3M1IB 1M2VB 1OGAB 4ZNEA 1VADA 4U1MA 4XC1L 3V7AG 5I1GH 2OMTA 4RZCA 1JTTA 1UYWL 3CFQA 4XMLL 3WELA 4A7TA 1V5MA 4HUKB 1E3ZA 1SPDA 2FWOA 3CFTA 1G0XA 3QUZD 1X1FA 1NFIB 3HS0B 4JRYA 4YFEA 4NXKA 1WISA 3DV4A 1E6OH 3VWJD 4LGSB 2O5YL 4GQRA 4XO5A 5DZ9A 2JLPA 1SHCA 5EU3A 2UYLA 4YSOA 2P8MA 4FE9A 4S2SB 2PABA 4Y7MA 3TVMB 3EZJB 3RCPA 3U7YL 2VC2L 3WY2A 5DMKB 3RWJB 1JF5A 1S8DA 4OUUB 1QQDB 4BSVB 2VDMH 3LPPA 2VQUA 4R0LC 1IFGA 4UB0L 3K6SA 3S36X 5H37G 3MLYH 4DTGH 2JH2A 1N5AB 2J72A 5JW5A 4DVBB 1QRND 2JB5L 5DRXB 3B9KD 1MCOL 3EIFA 2L7QA 3VFOA 5HJ3B 4MGXA 4FX5A 3SY0B 2O61B 3HMWL 4A67A 5F1OB 3D39D 3I9GL 3T0DA 2K0RA 4KKZA 1EV2E 2DKSA 2IQ9L 4MXQC 1KLGA 5DEGA 4A7VA 1II4E 4NO0A 1TZAA 1PFJA 1ZLSH 2J44A 2YMXH 3AM8A 4B96A 4DPBX 4HU8A 4LRNL 2Q20A 1NSNL 1OZTG 6FABL 5JIPA 1QI3A 5DS8B 2GK0A 4AQ1C 4HG4K 1AO7D 3EG9B 2YO3A 1F6FB 1RZJH 1D2PA 1UA7A 4L0ZA 2X4SB 1HZHH 2CDGB 2ZSVB 1LQBC 4FHKA 1ZCRA 1XX0A 5AG9A 1G7IA 1FGNL 2WKOA 3BUTA 2DYPB 5LOPB 4XX1G 3SKNB 2I7OA 4U1NB 3QQDA 1C5DA 1MUJB 4RA3A 1ZC3B 5KVGL 1W9XA 3O3BA 2YAPA 3P0VL 5TDOA 3BDBA 2N0MA 1PD1A 4YE4H 4LMQE 4HAUB 3FQWB 1WBXB 3GXDA 4LP4A 4TUOB 5CJQH 3P9MB 3ODOA 2O4EA 5IMMA 1CI3M 3F58H 5CCJA 1P1VA 3ALPA 4GPTB 1Z6JT 4A68A 3I2CL 3LIZL 4PJEE 4AMKH 5C0CA 1XD1A 3FEHA 4PJFB 1XGPB 1EAQA 1OEZW 4KHTL 5JDSB 1LO4L 2V2TB 5B7EA 2WINB 4IBQA 3BFQG 5FI0A 1FUNA 3MLXH 3AWGA 2AJYL 4YHIA 2TRHA 3Q1SH 4OIAA 3LHPH 3CHQA 1KCVL 2NT0A 3MJWA 3MUGA 3G08B 1LD9B 1AFVH 4G6AC 1U30A 4HZLA 2BVPB 2ZG1A 2Y7QA 5E2VL 4RFNB 4UV7H 2WCPA 1NGZB 5GZOD 2DI8A 4PY8I 3P9WB 4J3WA 4OGZA 4YLBA 3GBLA 4P48A 1Z9PA 4QYOB 1U8NB 2D7MA 2QR0B 1QLEB 4FG4A 4KC3B 5CP3H 4P57A 5IEHA 4Z7IA 4BK5A 1MFUA 1UM6H 5AYUH 1SGKA 1J18A 2VW7A 3H2WA 4KKCD 2QMKA 2Y3NA 5FYLH 1K72A 4DZBA 2B8OT 1WAEA 3OF6A 3ARFB 5D71L 1K5WA 2VSCA 4QWWC 3PPEA 3N06B 3NIFF 4U0QB 2EDXA 2VUYA 3WO3B 3O4LB 4AVKA 5ABDE 5I74B 1UD4A 3MDJA 4PJCB 1UZGA 2OW7A 5EEVA 3QAZB 5IUCA 1J10A 2Z7ZA 3EH4B 1WK0A 3Q6GH 3S97C 3JVFC 3ZDYE 2DMBA 2IO5A 4ILDA 4JFEB 3WIIH 1GTFA 4ZMLA 7TAAA 4Y89A 4Z7UB 1KGYE 1YN6A 4DKDC 1FHOA 2E59A 4XHQA 3IE4A 3VFUB 2R1WB 3MRCB 1O9ZA 2NY0B 3FU7A 3SKMA 4OZHE 5JOPD 4XNDA 2ITCA 4HD5A 1JHKH 4D0BA 4M62L 4JO3H 1N0XL 3OKEA 4QTHA 2E9IA 5CILH 4HB4B 1CL7I 1SY6A 3PABB 4ZD3L 3VD0A 1X7SA 5CGMA 4NLAA 5JPMB 2QVTA 3KPPA 2BWIA 3TWYA 2WXQA 4IRSB 3SDDB 1IJNA 1KWKA 5I17B 4JFEE 4XBMA 4A04A 2OTPA 4Z7UE 4PJ9B 2H6PA 3W11D 1IBBA 3KWWA 3EO1A 4I18C 1AZCA 3HC2A 3UTQB 4H7VA 4JHAL 4V1DA 1BVLA 5DO2D 3RWCA 3AACA 5D4HA 4DGIL 5F3FA 1WVHA 1M3IA 1YVLA 5TH2A 2IAAC 5AZEL 4LSVL 2Y2WA 2ZX7A 1PL3A 1FNEB 2DQGL 3GTNA 4LF3B 5DI9B 2BW4A 3UPAA 3IDYC 1DN0A 2GB2A 3V0AC 3HE6D 4JJ5B 1HXYA 2NLJA 2H26B 2HJFB 4YK4C 1D5XA 4X80L 4X5QA 3GBMH 2AVGA 2H1XA 2N3JA 3DO7A 1U2CA 2K70A 4PGDA 2COAA 1B0RB 1ZIAA 2GT9B 2QSCH 3FFOA 3HPLA 3HEIB 5I6XB 1OAQH 4X6CF 4ACPA 1MWAH 1MK9B 3R1GL 5K1VA 2VAAA 3R18A 3FQUB 3L9RA 5GGSB 5H2BA 3ZKXB 5KS9A 1HEHC 4JFHD 1YQVH 4YFLF 2R4RL 3NCEB 2PMZA 1JL8A 2MCPH 4UOW1 1OAUL 4G8IB 2BH0A 5JO5B 1ZHKA 3IJSB 1FSKB 3QHFH 5C0RL 3KPOB 1FZOB 4DKTA 2X4QA 3T8MA 3L3OB 3F5WB 3X12A 1SZNA 3G6JE 5AD0B 1N0LB 3A47A 1OGTB 2WVTA 1NAMB 1UWYA 1HE8A 4IRZH 4TPRH 3E9UA 3L1OH 4NN6B 4M5SA 4S1RH 3I6SA 5ISZA 1O0VA 5BV7H 3BRDA 3RWHB 1XBRA 3QCTL 3GBNL 4HC1L 1E90A 2WLLA 1R0AL 5AAWC 3IU3B 2A6DB 1JPFA 2YOAA 4TSCH 5I2MA 1QABA 3G5VA 4ODUB 3NJVA 3V0WH 3EYUL 2I9LA 3FHAA 4F7TA 2OR9L 1K5DB 4KH2A 3ZTNH 4HU2A 5TF1L 4A2FA 3NPSB 4FNTA 2CGRL 2CE6A 3DTXB 2HMID 5B38B 3NN8A 2IWEA 3B3IA 3IDMA 4O00A 2K6WA 4MJHA 4XBPA 4GMSH 4RGNB 1P9MC 4ZTOH 1PKQE 5GS1C 4ELMB 1XD4A 1KJ2B 3QNXB 2G2RA 2BC4A 1J9TA 1K6QH 3HI1B 3UABA 5DSCB 4IFSA 1IGIH 3FSWA 1YMMB 3HG1E 3VCLB 1MN4A 3GSRA 4WI0B 4TVUA 1DJSA 2WWKT 5F7WC 1AH1A 3LRGA 2B1AH 1M05A 1EJ8A 3EF7A 3T08A 3D8EA 5D1XD 5E5MA 3LNIA 5F3HB 2XNAB 1KNOA 1UFGA 3MV7D 2FT6A 4OTXH 4PV8A 4HPYL 5FYJD 5I1KH 4ZODA 5FUZH 1Z9MA 2XPYA 4JO2L 4RGNE 1QLFA 3CH1B 4ELME 1QR1B 1MREL 3HN8A 4DGYH 1J0WA 1F02I 4JKWA 5FO9A 1UADC 2C3GA 3T2OA 5L9DH 3MKKA 3UGUA 3ZU8A 5EA0H 4UAOC 2KERA 2QPEB 1UXSB 1DJYA 4I0CC 4ZS6D 1V61A 3QAQA 5DUPH 4XVSL 3BEVB 2C1OB 3E6HB 1OP5K 3MRMA 2AABL 4FXKC 3H8NA 1GZQB 3IFPB 2PWGA 1DANT 3C87A 4G8GB 4P4KB 4R7NB 4CN1A 5DHAB 2ZUSA 1WZMA 1BMZA 2D2OA 3D2UB 4UTCA 3RIKA 1BQLL 3EDJA 3L54A 2K8MA 4WO4C 3N91A 1TJXA 1JVLA 1S9WA 4BQCA 1DVTA 1WUZA 2G5BB 3K72B 4IRJA 4XC3L 4XNUH 4Y5XC 1QSFE 3GJEB 1YMHA 3WN5C 3EOTL 5DHDA 4KTEH 3TO4A 3EKCA 4DERA 3FJTA 2C3VB 3TZVA 3H7BA 2FGZA 3U1PA 1S7XB 5IQ7L 2BP5M 1BYOA 1AQDA 1X5HA 4HK0A 2WBJA 4H20L 3RGHA 2FATH 2I85A 3FTVA 3H4HA 4PLJC 3SSGA 1T04A 3IXTA 1HJCA 1HNFA 1OTUD 1YJDH 2J73A 4CVWA 1WFNA 2KHAA 1JHTA 1O7SA 1FHXA 2YGPA 2DKPA 3L7EA 4DVRL 2APVA 3ZRCC 3RG1C 4HDQA 3DX7A 2LGNA 5JHAA 2BY3A 4Z7QF 2VIRA 2NXZC 4KK6C 2P28B 4ETQA 4QHMA 3BUYB 3PHQA 1UM5L 4P46B 3FT4A 2OMVA 1EO8H 4MNGA 4LCUA 2BHYA 1DBBL 1JMZA 2A9CA 2GABA 2R1XB 2G9HB 4O58L 4CMMA 1OAKH 5I2IA 1NC4A 4F7MB 3P9LA 3X1NA 4GS7C 4KHOA 4WNQB 2W91A 1QSZA 4TOYH 1CZ8L 2ITFA 3FN3A 2J8UE 1IQDB 3JWDH 4F3FA 5TQ2L 4EN3C 2XQYG 3ZKND 4ZUSA 4H8VA 2ZSWA 4TRPH 1Q38A 1UENA 4Q58C 3S7GA 3KLKA 5SWZD 2CMRL 4LVHB 3U4BH 1I1AB 4UQ3B 3SUZA 4J3XA 3T6ZA 1BOYA 2H7EA 4Z8FL 4PWFA 4UOW0 4OCLC 5FR3A 4M8RA 3EYFA 2BINA 4PY7B 3BD4A 2C7UB 1V05A 5IK3A 4AH2B 4DN3H 3HRPA 3G6DH 1NGWB 4FQLH 3NFSH 3CC5A 4JKKA 4L9LB 3FRPB 3BIKA 4LHUB 1KJVA 1CFSB 3ARZA 1W2KT 3G6AA 1NUGA 2ED9A 2J7LA 2WOYA 3MV9D 4I3RH 4BXSV 3FQNB 4M8VA 1EEYB 2FT7A 4DP5X 3VG0H 4F57H 5C08E 1BQHA 2E47A 3C08H 2YS1A 4MAYA 3WO4B 3PU7A 3T4AA 3D30A 3L16A 5PCYA 2AXFB 2EO9A 2EYRB 4TVPL 5I16B 4G8EB 3SIKA 3O3EB 3A4AA 4YR6B 2AI0H 1YA5A 1RD6A 4H8HA 1EAPA 3AUWB 3CQQA 4FXGB 5LAXA 4Y4KB 4GBXB 3FB7A 2FQDA 3KPLA 3OMAB 4FI6A 3M7FB 3BMVA 2F8OA 5BXFB 3L3IA 5EO9B 1HYSC 4NQDB 2Z92A 1JHLL 3UDWA 2XWBB 4DGWC 1UC6A 4HEMA 1AQHA 2X12A 1SLXA 1UCBH 3MLZH 4XGZA 4I1PA 5ICUA 3DOHA 3V55A 4B27A 2HJLB 1EFXB 1LDSA 4GUOA 2H1PH 2FJHA 1PJ9A 5TTRA 3Q3GB 2A99A 2P44B 2PYEB 4OBSA 3VXMD 1J8HA 3FZUD 5J3HC 5CCKH 4KVCL 4QAWA 4HV8B 4CC4A 3MLWL 4ZFGL 1DROA 2OMXB 4MXQD 1ZT4B 5F6IC 1UASA 5INDB 4HATB 5AVQB 5JLZB 4OM0L 4NQDE 5I1AB 3S34L 1CC3A 1XMEB 1RZJC 1YAIA 4KUZL 1HZLA 1BX2B 4FERA 5FGSA 2LV4A 3HR6A 5CNHA 3R7RA 3TN0C 3QORD 1Q9LB 3US9A 3K2UH 3A6BL 5TE4L 2OULB 5KSAB 2RGSA 3QUYA 3F2LA 3QE5A 2COQA 2CDFA 1S7SA 3VQ1C 4P7IA 4MD5A 2C9QA 3SN6N 4MJ5B 5TFSH 2OMNA 4XOAA 3L9YA 3UTOA 3HG3A 5GGTA 2BNQD 3RZCC 2VR7A 4NENB 3F04A 3FFCA 3NSCA 5EIIB 3GM8A 3UPCA 2K00A 2IADA 3QWRA 1XH3A 5F0LB 4G5AA 2YF0A 2H0EA 4Y5YA 2I25N 5IB2A 4TL5A 4ZRIA 1I4FB 2UY7B 1ZJAA 2O5ZL 2IG2H 2GFBA 4WV1B 2KCJA 2X10A 5E70A 3BZDA 5HI4C 4U7SA 1J5HA 4URKA 4N1HB 4M7JL 3VFMA 1E8ZA 4WW2C 1NCWL 1UA6H 1XB6A 3F7LA 1B3JA 4HAZB 3LKSA 4NQQA 5ADPH 3WTUA 1P4IH 4X4ME 2CIIB 5IWLC 1OCWH 1W0YT 5IFJB 2ADZA 4D3CH 2YS4A 4OY9A 1NGPL 2ZCLL 2XQ0A 5E8DL 3AT9A 2OL3A 4B7IA 2QGCA 3CFIC 4XNXH 2EE6A 5GGRB 1ADWA 3LJ3A 5H37A 1SBSL 5A40E 1G5GA 3Q9PA 2K2UA 3MFFB 3ZQWA 1TG8A 1RK1A 3WXWL 2A4EA 4AEIH 2ZWLT 5I2SA 2X1XR 3AG2B 4OFKA 4ZRGA 1E9PB 4LP5A 4YVUA 4GH7B 3UTPE 5D6CB 1TUPA 5I66A 2EVIA 3EGDA 4OLXH 3NP4A 4K3JH 5KYXA 4JPKL 4CNIA 1C7TA 1LQSR 4LARL 4KGLA 4O02A 2APBA 3QDGD 5I8CA 1A6AB 4QWWD 5IQOA 4U3SA 3U4EB 3AROA 3VXPB 2IAMC 3OLGA 5F1NB 4AVIA 3TLRA 3ULUE 2LU4A 3MBED 1KIQB 1JWSB 1X5KA 2HTLC 1ITCA 5CJOH 3U8ZA 3GIZL 3IDGA 5B1AB 1RUKH 3QYNA 5FKAB 1F90H 4JN2A 3SE9L 3NCCB 5C09D 2C26A 1KENH 2BJML 1O6VA 3GMPB 4FFYH 5F7EL 3CN3A 2D9QB 5IVXE 4WRLA 5FGBA 3P11L 2QZ5A 1U3HA 2XTLA 4UDUA 4JAMA 4NN5C 4BSWB 1ERNA 1MHHB 4OZGB 3KPMA 3BPCB 4HIXL 1NANI 5T3XD 1V3KA 4QO1B 4FF9A 3ET9F 3NEEA 4U1MB 3RY6A 4PJGE 1NMAL 2OMTB 2OMBA 1XF3A 15C8L 4RZCB 3T77A 4F1SA 1AGCA 1KCUL 4M7ZB 2FWOB 5AUMA 1EAZA 2AJUH 3ULSA 3VM5A 1KXHA 5KG9A 1H8NA 3E3QC 4BM7A 4JHWL 1MVFA 3RGBA 4JRYB 3MACL 2MDXA 5IVOA 1MK7B 3ELAT 4JRXE 4CILA 3QJFA 3FQRB 4NP4H 5E7BA 1TETL 5IW3A 2PCPA 3ULVL 2UYLB 5ESAB 2P8MB 2WQSA 4AKPA 2IV8A 4UOJA 2DLTA 2JNZA 1QBLH 4LSDA 1S8DB 4JEGB 2GI7A 2P8LB 3MJ9L 4Q97A 2X2IA 4U7KA 2DIJA 4P5TC 5D7LD 5AVZB 1SEQL 3K6SB 2WYZA 4GQZA 4HUWA 2RFXA 2WZ6A 4JPIA 4ZW6A 4HXAH 4GAYB 2EDWA 1KY7A 4PJ7A 3DTDA 3EH3B 2OMYA 4DP2X 4JN1H 4RBPK 4D8OA 1BAFH 3M07A 4JANA 2A0LC 1HWGB 4KFZC 3M1CA 5E1GA 3RPKA 3KPSA 3O3DA 5JA8B 3MLRL 3H9SA 5K9JH 5D72H 5C0BE 5DZVA 2OTUA 3UTSD 1DVFD 3WI9A 3JBG7 3VWKC 2OMWA 4GW5A 5DEGB 4OVUA 1DBML 1FN4A 4G72B 4NO0B 4NUPA 3KPQA 1IO4C 1ASQA 4PD4J 2YN5A 1FCGA 2Z8VC 5SX4I 2XICA 1T7ZA 3L2MA 3S36H 5F7HA 2IXQA 5EH1A 3T0XA 4M61A 5BV7C 4P5KA 2B5IC 1GMIA 3QUZA 1F4YH 2XZCH 3PL6C 1G7IB 4X5PA 2HVBA 3KCWA 1ZDSA 4Y7OC 5A3IC 3BOVA 3K1DA 3IDJA 5DK3A 1OK8A 1A6UH 4UT7L 3QQDB 5JZ7C 3RTQD 3DK2A 5EOTA 1MIEH 2F61A 4KAQH 3FT9A 4LSUL 4DN4H 4UZGA 1V5JA 1E5YA 2XU9A 3BH8A 4NPYA 2ADJA 3W0WD 1DUYA 4IBWA 1JZ7A 2A77H 4P2CG 1SF5A 3LS5L 5IMMB 3WBDA 3ARUA 3C6SA 2Z9TA 3ZMRA 4PGEA 2VDNL 3RLSA 2YPVH 4FKKA 5EB9A 1K8IB 4I0PC 2C3HA 1D5BA 5C0CB 3B37A 1R5IA 1TJIL 1QRNA 3QI9C 1E0OB 3B9KA 4ORZC 4W4NA 4TQEL 5E7FA 3MXVH 1HH6B 4U7MA 3DDFA 2E8YA 4OD3L 1CDUA 1LK2A 2OXHB 1RMFL 1QTYT 1X5AA 4IKKA 4FTDA 4YHIB 1J8RA 3EBIA 2ZJSH 3D39A 5IJVB 1TZHB 4UQEA 2E7MA 4Q6IA 4R3SB 4WY7L 2G3XA 5KN5A 2YKLH 4KY2A 5C2BL 4GMTL 3SCMB 2VR8A 4EI0A 3AVEA 5BUAA 3O6LL 3APMA 1BJMA 2ZOTA 3CN0A 1AO7A 3GRWA 1PJWA 1R4XA 3FUIA 4ETYA 2I1JA 1ZXKA 3GI9L 3ULBA 3AG3B 1UJ3A 5JXEC 1I7ZA 3GIVA 2OP4L 1AQMA 3DSFH 5FM8A 3UZQA 4AYFA 4CDHA 4CHMA 4HGMA 4MDRA 2KPNA 4P49A 4G1MA 4DZBB 5A2IH 2DHKA 1MELA 2QADD 4DP7X 1A1MA 2YJQA 5IFHH 2Q8AL 1QFWM 4MT7A 3PF2A 1SOQA 1ZC4B 3X3FH 2QL1A 3CHRA 4KK9C 1X5GA 1XAKA 2IEPA 4D94A 5AVUB 3NJNA 4WO4D 1SQ2N 3T4YB 5I6NA 2Q3XA 1S9VB 2EABA 2V8LA 3JV0A 4LCIH 3BAKA 3VD1A 2CCVA 1N10A 3FU7B 1F1AA 5GS0L 4ZUVA 3QXAA 2BVTA 2ITCB 3ML9A 4D0BB 4FTVE 1YPZE 3FSVA 2IFFH 4QTHB 1WFUA 3K6DA 4ZT1A 1OM3L 2V76A 4O4YH 2EUVA 3ULUL 4PLJD 3MJGX 3EJPA 3WKML 1UJTA 1JI1A 3FMGH 4LAQL 5ACLA 1E5CA 2E27L 3IYLW 2NX5D 4O2EB 1RJYA 1RLBA 1HHGA 4GQPH 1QSVA 2OA9A 3IFNH 5GZOA 1OK0A 3EO1B 2OR7A 3CSYB 3KWWB 4XVOA 3ODXA 1VAHA 2JWYA 1WIOA 4KK6D 2V8MA 3IFOA 4V1DB 1BVLB 2RRFA 3DJRA 3NDZE 1UGNA 5CBEA 4GKZA 2QPUA 1U8OA 3IPBA 4XAWH 3BKML 5I1IH 3TFBA 1INEL 4XVUD 5TH2B 4FA8A 1CDIA 5C0GA 4MQTB 4TNWF 4M6OL 1UFUA 3RI5F 4BQBA 1GPOH 1DN0B 5HPMA 1ZGLP 1HXYB 2NLJB 4OSUH 1CF8L 1D5XB 3JWDC 5DJCA 1QYGL 3BUQA 1ETB1 4ADIA 3DO7B 2HA1A 4XC1H 3ZTDC 2AV1A 4PGDB 5IR1A 4XMLH 4RDQG 3HPLB 2R29A 1WVZA 4EN3D 4UNUA 5ALBH 5ITBL 2WKOF 3L9RB 5J1SC 1NCAL 4Y8DC 5KS9B 3V5WA 2P5WD 5DTFA 2ETWA 4UF7C 2R0KL 3KJ4B 4POYA 2JJUA 2O5YH 1JSYA 3N42B 5C0JA 1JPTH 3N1MC 4AQOA 1TQBB 5C0IB 4MMZC 4E9LA 1QNIA 4W1TA 1ZHKB 3O45A 1B2YA 4EVNA 4I77H 2CHXA 2X4QB 4ZFOL 1QP1A 1MRFL 3X12B 4MD4A 2HH0L 4DPAX 5BRZD 5ISZB 5CHNA 1WWBX 3FT2A 5D27A 3B9AA 5IHBA 2JB5H 2C4XA 1MCOH 3VMOA 1JPFB 4U0RB 5K69A 4FQJL 5F72S 4FCAA 4JL1A 3UGXA 3G5VB 5AAPA 4JM2F 3IMBA 3P0GB 2I9LB 3HMWH 4L2YA<