4DIXA

Crystal structure of the ig-ph domain of actin-binding protein scab1
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
212
structure length
212
Chain Sequence
LVYEIDGTEALGSCLRVRPCSNDAPDLSKCTIQWYRSSSDGSKKELISGATKSVYAPEPFDVGRVLHADIIYDGHSLSLSTVGKIDPAAGLGSYVEALVRKHDVDFNVVVTQMSGEDHTSESIHLFHVGKMRIKLCKGKTVIAKEYYSSAMQLCGVRGGGNAAAQALYWQAKKGVSFVIAFESERERNAAIMLARRFACDCNVTLAGPEDRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Plant actin-binding protein SCAB1 is dimeric actin cross-linker with atypical pleckstrin homology domain
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Protein binding
molecule keywords Plectin-related protein
total genus 58
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16709 SCAB-Ig Ig domain of plant-specific actin-binding protein
A PF17684 SCAB-PH PH domain of plant-specific actin-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.140 Mainly Beta Roll PH-domain like PH-domain like 4dixA02
2.60.40.2700 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4dixA01
4DIXA
chains in the Genus database with same CATH superfamily
4P4RA 3T2PA 1XZ0A 1KB5H 4PD4K 1GS8A 3SE8H 2N7BA 3FUMA 2DQMA 4NQEA 4OJFH 3OKLA 4C56A 1JZ3A 2J8UE 4GH7B 4NUJB 5D7IA 2VM3A 4BZ2L 4QXUH 1CBVL 2ZJSH 3QPQC 3H8NA 1D7CA 3KPRE 1AGBA 3FQTB 2PCPA 5CS7A 3ZL2A 4YEEA 5TQ2L 3SDAA 1FF5A 1RU9L 5L9DL 3CDCA 3OJ2C 4R2GC 2CM6A 5ACZB 4PS7A 2XETA 3QR2A 1JGLL 1AI1H 1R3IL 3H9SD 1QFUH 4ALAH 2XN9E 4W9ZA 4WHTA 4G6MH 1OAJA 2NR6D 5IMLA 3LKRA 3HFFA 2DQUH 4LCWA 3ZL4L 3UJIH 2CBOA 3KBHE 1BD2B 1JFQL 3IJEA 3WY4A 3UZTA 2WPGA 3KG5A 5CEZL 4Y7OC 3GM8A 1HNFA 1MIML 4WI4A 4DKFH 1P3RA 2BNRB 2R2EB 5IW1A 3ARRA 4OLZL 2MJWA 5I24A 3HE7A 5I75C 4LSSL 4KMTH 4P3DA 3MROB 4ADJA 4XHJD 2ADJA 2IAMD 2DQFA 2LV4A 5K9QG 2WGXA 1MCQA 2ZOUA 4MMXC 4HKJB 6PAZA 4OD3L 5CUSH 1JNNL 1N8ZB 3EJYC 1ND0A 1W0YT 5GSVA 3GK8L 2E2XA 1AGBB 1PFCA 3TBWA 4MDRA 4U1MB 3PWUB 2WCSA 4Z76B 4NOBA 4XNYL 5DA4A 4F2MB 4ANKA 5C8JB 2R1YB 3P4OB 2R4SL 3HVNA 4MCNA 1AR1D 1HWGB 3BH8A 4Y7MA 2P46B 2EEFA 3P2TA 4N5UA 4DEPC 5A6MA 1RZIB 3PHAA 4P46D 1CN4A 1XL6A 3CVIH 1GZHC 2K70A 3T8XA 4F37K 4P49A 3WTXA 3TVMB 4ZFZA 1NAMH 5D93B 4A6FB 1TLKA 4Q0XH 1AVAA 5GGUA 2CBQA 1F90L 1HIMH 3LKNB 5E4AA 1QLEH 1FORH 2BERA 3HBQA 3T0WA 5D1QE 3SKOA 1UA6L 5D2LF 1NBYB 2XTJB 3MLVH 2D3VA 2ADZA 1XKEA 4NAQA 1T66C 1XSKA 1LDPL 2EINB 5AYUH 3QEQE 4Z7UF 3S96A 4V1DA 4U3CA 2F7OA 3DX6A 4MNQD 1T7ZA 4FFWD 2DMBA 4B27A 1KTCA 1S3KL 3O4LD 5A2IH 2FX9L 1FGNL 2DRUA 4P04A 2I5YH 1BIHA 5HD8C 1T1XB 1U8IA 2EDYA 3DO3A 2EE3A 1J48A 2FJLA 4Y1AE 3DJZA 2NZ9D 3RPKA 5LXGH 1WFIA 4CSTA 3BDXA 5I75B 5I19H 2JTDA 4HJ0C 1YNTA 5EEVA 2Z93A 5FV1L 1GIGH 1GRWA 2VWEC 4UTCA 3O2DL 1XAUA 1FFNB 3REVB 4X6EB 3L2LA 5DQJB 1WFTA 2BWDA 3AG3B 2OQJA 2VLMD 4G3YH 4GI6A 5C0ND 2VZ1A 1HHHB 1J1XL 3HRZB 3VDAA 3LQZB 3P11L 4UTAA 4PMEA 5I15H 1ADQA 2YBRB 1VFAB 4RMRA 2WLKA 1YEIL 5F9WB 4UDTA 2BJMH 4NRXA 1OAYH 4AM0B 4XNZC 4UOJA 1EVTC 3TA4D 1Q1JL 2X2YA 1BOGB 1R5VB 2VXVL 2KT6A 3KAAA 4QRUB 2NSXA 3UTTB 3MBWB 5GS1B 1I82A 1U5GA 3LS5L 3CH1B 1N6QL 1Q0YH 5D71H 1IQWH 3NH7H 3LPPA 3WAKA 1LHZA 3TX4A 3QT2A 3LRLA 3T3PB 4UOW1 3DV4B 5KWYC 1C5BL 1YSOA 4GXFA 2MQCA 3SKNB 4JM2B 1UXSB 2F18A 3KEDA 4HIIA 1KZGA 2A74C 3MPXA 3MFGB 4NZTH 2WUCL 5EO0B 4AQ8A 1DJHA 3CPLB 3QUXA 2IAMA 4UTBA 3OKKA 3EG9B 3KVDD 1NEUA 4H2AA 2WJ5A 3SQRA 5D7HA 2XRAL 3L2MA 4UM9D 5KQ4A 4QXUL 3V0AC 1CBVH 1KGCE 5I71C 4TVPE 1M56B 1LXMA 5DJAA 3VQMA 3MPCA 3L1OH 1EXUB 1BVOA 2FK9A 1JBJA 3NJHA 4OJFL 4ZX5A 1IUZA 1HSBA 1RSYA 4MCZA 5CSBA 4YWGH 3POHA 1Y0LA 3RWFA 5E8PA 3L9RA 4PJDE 3QNXA 3HC3L 1JE6A 1MFDH 2AKRB 5AYQA 5AKRA 4DGVL 3O6MH 1G7IB 1CD8A 4XVOA 3GMOA 2CUMA 5EU6E 4V1DB 1NL0L 5D2NA 2ITDB 1GGCH 3QUKA 3FU7B 3VSQA 4RWYL 3LPGA 3PJSA 4I18C 1BM3H 2Y7MA 1MIXA 4O51A 4OW6A 1ZSDB 2DN6A 4FJZA 4M1CD 5BW7C 2YKLH 1IAOA 2OL3H 2DLWA 5D1ZD 4G7RB 1DJXA 4HUCA 4K5OA 2JI3A 4X7CC 1MFVA 3SDAC 3PUCA 4Q89A 4KOBA 2E7DA 4XCFL 1JV2B 2FHBA 3U30B 3RBSA 4R7XA 4BFKA 4D9LL 3DWTA 1R5IA 2H2SC 3PHQA 5EOTB 3C5ZC 4RQQA 3B6SB 4IMKC 1NM9A 1V5MA 2BCKB 4Y2DD 2A73B 3ULVL 3VGFA 3C5SB 1OP3K 2BOCB 1NCAH 3GSXB 3KYNB 3SDAD 4BXVA 3W11C 4F5CE 1JD7A 5DHFB 1UWXH 5CGTA 3CLEH 1R9FA 1AGCB 1JAEA 2E75C 3WHE0 3CFMA 3DSNA 3TPUA 2VERN 4TM9A 3FB6A 3UFIA 1FLRL 1E8ZA 4EKUA 3FB7A 5ETUB 4KK5D 2NUTB 1FG2B 3BESR 2AEQH 4XCNA 3WIHH 3T0XA 3VXPB 2CO3A 1IC4H 1CTOA 2CR3A 4F9LC 5JHDB 4WDIB 5FGSA 2KIGA 3LNFA 3PAVA 1YEHL 5EO9A 3EHBB 1Z9PA 4R97C 1DSWA 1Q9KB 1URLA 4OTXL 4UT6H 3G5YB 2WBKA 5F93C 1NMCB 2EIMB 3OAUL 5DJ2A 3WKML 2GJRA 1E6OL 3KPTA 5C09D 4HPOL 1JWUB 4PJDB 3KRXA 3FOLA 1K8DA 1YZZA 2HFEA 1CGSL 1DZBA 2BSRB 1KZQA 4YOKA 4U3XA 3VXRA 3MGAA 4G9FD 2FSEA 4XO8A 1JTTA 1R47A 1KYFA 5C0AA 2ATKA 2EH8H 1XTMA 3AMLA 4BELD 2IGFH 1QFOA 4X9GA 3F58L 1MZYA 2PCFA 4TSCH 1WLHA 2WLLB 1BBDL 3LZNA 3QJZA 5FOBB 3I02A 4S2SB 1FA4A 1WVHA 1MQKH 3PWLA 2FQEA 1ZMYA 4JO3L 4YDLB 1A22B 3ETBJ 4M9OA 5FA4B 2Q86B 4AMWA 1SDYA 1ZPUA 3RY5A 5LDSA 1KJ2L 1QP1A 4MS8C 4J2XA 3BN3B 2WXOA 3RDTA 2M8XA 4N8VB 2P5EE 1FL6B 1KBBA 4RMSA 4B9GA 5C0NC 2BCKA 4KK8D 2O1AA 1VFOA 4YDNA 3WE1A 2FGWL 5FB8B 5JYLA 5DS8A 4OCRL 2WQAA 4W4NA 4XE0A 2QMJA 4KK6C 3GUFA 3RYMA 1R5WB 4PVMA 2EDKA 1QFPA 2L8AA 1CXHA 4TNWF 5DD0L 2H0FA 3GSXA 3IVFA 3KYNA 3V4LA 5I1CH 1H6UA 4O2EA 1ZPLA 4M5TA 3SNHA 4XMXA 4GMXB 5HDLA 5EIIG 3KPSB 3KS0J 3QXTA 5TE4H 2DW5A 1I1AC 1SJVA 1WEJL 4XZUB 1OTTD 4AQ8C 3KBFA 4DBBA 3QUKB 3ULUC 3HI6L 3KPQA 2B2XH 2BZDA 1U6AH 3QA3A 1OAQH 5FYKL 3U2IA 3A67L 3NPZB 3P0YH 4AQEB 1QNZL 1CYGA 1KGXA 3MA9H 4M6ML 2L04A 1QSED 1FVEA 2IADB 3NWAA 1HHGB 1UGKA 2DQGH 3EDKA 4XNUH 5BRZE 1W1HA 4XR8C 4GAFB 1U36A 1S7TB 5EO9B 3QJFA 4AKOA 3E0GA 3OKYA 2X6UA 3Q48A 1FRGL 3TGXA 3MLRH 3P6AA 1QBBA 1JYVA 1EAZA 4HK3J 1FJ1A 2L3BA 5KJ7E 1D5BA 3MTXA 5TGBB 3RFZB 5D1ZB 2VDQH 1NDTA 1L5GB 4AMKH 3BWUF 4YLBA 5DC2A 4MY6A 1CD1A 2MKRA 1EUTA 3GLZA 4PJ7E 1EAPA 3W9EB 1J18A 3B8SA 2IXQB 3RZWA 5C0CB 5FR3A 4HIJB 3TEXA 3UX9B 3B9KC 3MC0A 1MQKL 1YYML 1CVRA 3BFOA 4IIZA 3FL7A 5E9NA 4ZG1A 3LEXB 3G5VB 1CI5A 2CO7A 2ZKWA 2LTQB 1F42A 3S4SB 4A04A 3EO1B 5J1TC 2WMPB 1KIPB 2WXHA 2YS4A 2AJYL 5LBVA 4DOHB 2IGFL 1TNMA 1IL1A 1KXTA 2CO6B 2YD2A 3ECVA 3F7VA 1XX9C 4Z7UB 1M71A 1PD0A 2CUHA 1P4UA 4HCIA 4JZNB 1G9EA 3QXVA 3SODB 3HG1E 5D5MF 1YN6A 2DMGA 4PLJC 1XGTB 3C5ZA 3ECQA 3N91A 1NBZA 1E27A 5CXPA 1LEIB 2ZYRA 3FUIA 5LWYL 5AL0A 1TTRA 1NZRA 3N42B 1R24A 4UWQB 3ZIYA 3HW2B 4NWTL 5AOKA 4BFGA 3EGDB 1EXGA 1OGAD 4K2UL 4N8UA 5T1LA 3C6EA 4GAGL 4D6WA 2VDKH 4NQDA 4P23B 5T3XL 1RERA 4RNRA 4OGXH 3OKEB 1YNTB 1DN2A 3MX0A 3FAWA 3UYRL 3NW8A 3I9GL 4ZSOA 2HPTA 2YZ1A 4XVJH 3FQ1A 3PE9A 4JGJA 4ZDHA 4PTTB 4FA6A 4G72B 2GJ6E 3HRZA 1FV1B 3QJSB 3U4EA 2OTXA 2BHYA 2WV3A 3MRFA 3CLFL 1B4JL 4CVXA 4KVCL 2VLKE 1I7AA 3V0EA 1JN6A 4B41A 1JXJA 3S48A 1NGYB 5J89A 4NX0A 3VDBA 4AENB 3C87A 3G7TA 1TR7A 3VXSB 2DY2A 4GAGH 4PBVC 4YQXH 1J9SA 1MAJA 3P77B 4PJHE 4PFEA 4GMSL 3HE6C 1PPIA 3Q5OA 4FFTA 5E2UH 3SDDB 2WB7A 2OW6A 3GJFB 3MNVB 2EVIA 3B7SA 4XWGL 1Z0NA 3QIUA 2EIKB 4FCAA 1TT6A 3ZDZF 1JPTH 3ULVF 4LDOB 4R7NA 4M4RB 4TUKL 3ULUH 3OKKB 2RSGA 1CFMA 4HAYB 1FNEB 4O02H 5INCB 4QGTA 1NC2D 2F8IA 4WI5A 4WU7A 1JGDA 3V6ZB 3DXEA 1KEMH 1XR8A 3HFMH 3CC1A 1CTMA 1XMWA 4FN0A 4DNLA 4YAQA 1FFOA 4UOZA 3AY4A 4XP5L 4KUZH 2C4FT 2LOXA 1OOWA 4WTQA 5GS2H 3IU4L 3WFHB 5DUMH 1D5XB 3H2WA 3KPMB 2LYDA 5LO7A 2CBMA 2DWDB 3BJIA 1NSNL 1I3RB 2P49B 3IFNL 5F9OH 4DGIL 1UM5H 5BUGA 3WHE1 3K46A 3T3MF 4N0YH 4QY8B 3RDTC 4LK4A 1P6SA 3BKCH 2BXYA 3GS7A 3NIGF 1OAXL 3T6ZA 4PP1D 4I87A 2ROZB 2V7NB 5CEZE 4LSTH 2Q2EB 5HHQB 3ESVF 2ZKXA 2V5MA 4XNBA 1GGIL 3S5LG 4JFEA 1TYEB 3ZTCC 5KVGL 3CCHA 2F74A 5JW4R 2CKBB 1OGTA 4FQJH 4I1PA 4HH9A 4ZPVA 2K6WA 5KYUA 4PM1A 2VR3A 4JN1H 4MNGA 2IQ9L 2OSYA 3CFBA 2Z0PA 4G7YL 4K81A 1FB8A 1SN5A 3CVDA 4AQOA 1U41A 2GY5A 1CYXA 3ETTA 3M1CA 4ZFGH 1D5IH 4WO4C 4BFRA 1KNOA 1U8PB 4NC0B 1CLZH 2HH0L 4D9QE 3HUJE 1G7JB 1A1MB 1BEXA 1CTNA 4GIAA 4P06A 1XBRA 4NN6C 2YXMA 1DVZA 3DV6A 4KKAC 3BT2H 5IBTH 2OMUA 1F4YH 2F7QA 1N0LB 1W8NA 2DMKA 3CMOH 5FDWB 1W6WA 1DUYA 3ATAA 2BJML 2D7NA 3NN8B 1MFBH 5E1GA 1WGQA 3GZQA 4OZHF 5CCKL 4NLAA 1J1XH 4XNZB 3C75A 4NBZB 4G3YL 1A3ZA 5L8KB 4PJ7F 4ODWA 5K1JA 3O0RL 5EUOA 4KNSA 4Z7WE 5LHDA 1NFIA 2HWZL 2E86A 1JMZA 3OC8A 3FM8C 3C60A 4ODVL 4KKCC 4S1SH 1DQLL 2GSIB 2JE8A 1T0NA 3SSGA 5F3HA 3FTXA 4Z23A 1BBDH 1J12A 1A3RH 1LWHA 3G04A 3PUUA 3ZRFC 2VDLL 1ZIBA 2OCCB 1MQ8A 4JE4B 1IM9D 2Q76A 4U31A 2YWYA 3DI3B 4ANWA 2P9RA 2WK2A 5EORH 3OR6A 4UAOB 5EIIB 4B95C 4MMYA 5I1DB 1JNHA 4I89A 2X42A 5GSRB 4C8XA 5KSAA 2WXGA 4FNUA 5EB9A 1GYWA 2V7NA 3GTNA 1HSBB 3RHWF 3MTRA 2AXGB 3FZUC 5K1NA 5BXFB 3ASNB 4L3CA 1CL7I 2H1PL 4XAWL 1YYLH 3BP5A 4NFCA 2YPKB 4NQVA 2Y5EA 4HIEB 4XBEH 4A39A 3RAJH 1LILA 4I0PB 5I1IL 4QRPE 2MQ0A 1WA1X 1FUNA 1RHHA 4RRPG 2DX1A 3SZ6A 1QQDB 3LXBA 3IDIA 2YSSB 2LR4A 1AOZA 5F8RC 1HWHB 2BVOA 1HINH 4Q6IC 3P9WB 4GY4A 4YE4L 2I27N 5IBUG 2Y06L 3VD0A 3TLRA 4PP2A 4QWWC 1FNSL 4JRLA 4M48H 5IMMA 1RRPB 4B6HA 1F86A 4WO4D 1EVUA 4URTB 3ILDA 5LGYA 4GRWH 1PIGA 3GK8H 4DP2X 4HK0A 3TBTB 1DVFD 4FQPA 3DIVA 2C1PB 3WL9B 1DQDL 3FFCE 4AEFA 1DUZA 5KEZA 4UINH 5BS0A 3R06A 4FI6A 3SYQA 1OO2A 1ZT1A 2DPKA 2E27H 5BO1H 4JFVA 5GGVL 3NRPA 3HK0A 1KTBA 3LKQB 1UYWL 4JJHA 5CEZH 2FAUA 2B14A 4PG9A 4F57L 1MLBB 3MRLB 3VUAA 1DBBL 1ZTXE 4L5FH 4BGDA 1SPDA 5IHLB 4OCXL 3ULBA 2QKMA 5E6ZA 3DXAE 1CE6A 2IPTH 3GRWA 5F0LB 3JYBA 3C6SB 4FC3E 2FVNA 2HKFL 2VRQA 2NQCA 1FVCB 2OL3A 2WTPA 1X5KA 4TQEL 5MERB 1A7OL 4HS8L 3PHQB 4OF8A 5TDNB 2QMKA 2X4PA 1ETZA 4RDBA 2J12B 3LCYA 1MI5E 5GZNA 2YLKA 1A5FL 4DKEH 2WYIA 5L4MA 1J88A 3HS0C 4HLJA 1HEZB 3BD5A 3NFSH 4HHWA 5IR1B 3EOBB 3TCTA 3G5WA 4Y19E 2ADIA 5C08A 4BWWA 3HG1A 4ZUTA 3LQAC 2FZ3A 1N7MH 1OHQA 5D27A 1S5HB 3TL5A 1WWWX 1URIA 3C6LA 1TZOA 1OSPH 3EJTA 4OD1L 3QEGL 4MJ6B 2AJVH 3CZUB 1IFHH 3O6ML 3OLEA 4HB3B 4WO0A 4YHML 4I7ZC 2VZ3A 2ZWNA 2VDPB 4JPWL 4X9BA 1PSKH 2DEWX 2MFQA 4AL8L 2IIJA 3FUJA 4TTGA 3D4GA 3ML8A 4HALA 3SO3C 2QKIB 2Z8VC 3QQ9C 1DQQA 1VIWA 2GCYA 4XB7A 4A2HA 3BRFA 3L1OL 1Q8MA 2QDVA 4KX7A 2UV3A 2VDNL 4KTDH 5IGXH 4XO5A 3H2PA 3KLQA 4ZFFA 1M42A 4ZFQA 2WBJB 2KQMA 3ESUF 4EI5A 5DJAB 2ZOKA 2NY7L 2BSBA 4U1MA 3S3SA 3WN5B 5I2IA 3BE1L 1UOKA 1QSFB 3S0PA 4B9IA 3JXAA 2QDWA 4ZQKA 1Z32X 1FIGL 1JPFA 5IOPB 1A7NL 4PWGA 4P2OA 3H4FA 4Y19A 3EYVB 1CWVA 1G6RB 4K07A 4PJ5D 3TBTA 4XCYA 4Y16A 1RH8A 2J5LB 5DMKB 1C1EH 3KXFD 2YQBA 3AWFA 4CAGA 1JGVH 5EWIH 4AQZA 5E5MB 4CW1A 2HT4C 4ONHB 3FMGH 3VE0A 3QAZB 3IJHA 3QO1B 3GKWL 4BSJA 4DCQA 2F53A 4Z8FH 3AAZB 4IJ3C 5I74B 1OAYL 3QWOB 3RVVC 3RY4A 1IBBA 5DUJA 1KZYA 1ZLUH 1ZGLA 3P11H 2AI0H 2YEQA 3D25B 2XHNA 3AJ7A 3QORB 1A9VA 2C1OA 2P8LB 2X1XR 1MW0A 3MRQA 4I1RA 4JR9H 4HOMA 5EC1A 4Y5VA 4LHUA 1NJ9A 4H40A 1XEUA 2VN3A 3P3YA 5BOPA 1ZJAA 1KPRB 5CINL 3C60C 4XCCH 5IJKA 3RWJA 4R2GD 1E5BA 3PV6A 4YL8A 3JVGC 2X0VA 3RVVD 5FM5M 2I5YL 2AQRA 5HGAA 3MNVA 4R90L 5ID0A 2LLNA 2J0KA 4AYGA 3IDMA 3S8FB 4Y2LA 1CIDA 3BCDA 2YRBA 3RGBA 3X3GL 1RFDH 5JHAA 4AJWA 2R27A 2W81C 3QXAA 5BV7L 4K5MA 4ZZKA 1OAKH 1RZKC 3Q13A 4XO9A 4XN1A 2NQDA 3K4ZA 2PO6B 3IDNB 1OMWA 3N44B 1S78D 4W6WB 4W70A 1HYSC 3AY2A 4EQ2A 3D8FA 5LJYH 4I3GA 2HP4A 3JWDC 3KPPA 1BSIA 2R23B 3L3JA 4FKEA 3VWJA 3LY6A 5BVPL 4U1HB 1S7QB 2PWHA 4EUPH 4H5SB 4DEUA 4D3CH 3NJJA 3PDGA 5JXEC 3F84A 3FT3B 3F0WA 2VM9A 4K3DL 3VSTA 1FO0B 1OQXA 1YECL 3GMPB 4PIBA 4PRIB 3AABA 5J7CC 4NQVB 3MRDB 4M62L 5AW1B 5C71A 4HFWA 2ZG2A 4CVUA 5HDOA 2NY5C 5MP6H 2FBJH 4EOWH 3WELA 2YRPA 3N44F 1EO7A 2GK0A 1XL4A 2DQJL 3HBZA 3GSOA 3L3OA 1WI1A 3IKKA 1CFQA 2YMOA 2YAMA 1AXSA 2J44A 3RL2B 4E5XA 3ZK0A 4LU5L 5A2CA 3VXQB 1TU2A 2FWOB 4P2RE 1LO0L 4NI6A 4FXGA 5E03A 1S7QA 5BZZA 2LTQC 2J88H 3HKFA 4LIQL 4HBQA 2FLRT 3HE6B 3IDUA 4GKSA 1C1EL 4BXSV 2B9BA 4KPHH 2FYYB 2NX5D 4PJEA 5CBAA 1IT9L 3GBEA 4S2SA 2W2XC 2ODHA 2A9NH 2Y5QA 2Z8RA 3EADA 4G8GD 5EDSA 1CXIA 3PP4H 4NKDB 5DVLA 3D2UD 3QFJA 4WKZA 5DK0B 5KW9H 1IKNA 2DQ6A 3SBWA 4WFFD 3WJLA 3WYFB 3NCEB 3TZVB 5D7LD 3QR1A 4MASA 5FA4A 1GJWA 2UZXB 1N0LA 4KTDL 2QVMA 2DEXX 1GS6X 3DDGA 3FRPA 4CADB 3AT8A 1CGUA 1T7WA 3VI3E 2WM0A 2Y1AA 2IANE 4YSDA 4EN3C 2OS7A 3M1IB 2XKNB 1FCCA 3NYKA 3FCSB 2R29A 3ARWA 3MRPB 3OTTA 5CLWA 4LLVB 4F27A 4PU2A 3P73B 1UCBH 1G94A 1RJCA 5DEZA 3GYOA 1DBAL 3AT9A 3DVIA 3O3EB 3BSZL 3MV8A 3JYCA 4P59H 3KLHD 4OLXL 3KVPA 1HL9A 2CK0L 2AZAA 5JPMA 1IAII 2FZ3B 2KI6A 1ZD6A 3ZU8A 1DLHB 3HLAB 3NAAH 4JFFA 4E9SA 1ZK5A 2PPEA 1KJ3H 2MCPL 1WE5A 3SKJL 2AFNA 2CDFB 2AQSA 4AY0A 4G9FA 2BSED 3DRTB 3IJSB 4EI5C 4GRMB 4J1UB 3WFDL 5DJXA 2O4EA 4FTVE 3ZZLA 5DWUH 4BRJA 4EI0A 1UXLA 5T1JA 1T1ZB 3QIWC 4OIIH 4BCXA 2DM3A 2FSDA 1ORSB 3CFIC 1SRDA 1E28B 3CFQA 3A4DA 3L4TA 4PJIA 3WJMB 1TJIL 2H32B 4F8OA 1HL5A 3RBGA 5C0IA 3GXNA 43C9A 3MFFB 3QCVL 5CP3A 3E8UL 4PJ8B 4QRBA 2WVVA 2X2IA 2QT6A 3WXVL 4JFQB 3MBEB 5GGVH 2PXYC 1EO8L 5C0CA 4XMKL 4P5TD 2XI9A 3U9PH 1U3HC 4OFYD 1DLHA 1O7SA 3UZVA 4U2ZA 4K3JH 3L1GA 5FF6A 5FAAA 4K3EL 4KXDA 4IKIA 4IGBA 3L3DA 4L8BB 1ZLSH 1XO8A 4WHCA 3BKYL 5FWRA 4LF3A 5E5MA 2APWA 4FJYA 4RIRA 3BSZA 2P5EA 4KK9C 6TAAA 1J9TA 3FBKA 4YE4H 4G43B 1PZDA 3P7ZA 4KOCA 1CGVA 3HG5A 3GMMA 1ODUA 4IRJA 1GC1L 4FNTA 1Q72H 3K2MC 5IROD 4N2EA 3L4XA 3N0PB 3RURA 2EYTA 4AVKA 1UWFA 1ZEAL 2CSPA 2DL2A 5I1IH 1EHLH 3GPEA 3V5WA 4TN9A 1XFPA 2FWSA 2ICWJ 3BJLA 4HS3A 2ZCKL 3V4UL 3U46B 2VT0A 3ZVRA 3HB3D 3FFDB 3N41F 1ZTXH 4H1LA 3TT3L 4IRZH 2GI0A 2J72A 4NZUL 3HVDA 5SV4A 4A1RA 1E67A 5HDBB 3T71A 1HI6B 2WO4A 4JVWA 4AYFA 3RVWD 3L3DB 3FVCA 4CILA 3HRPA 3QIBA 1UEYA 4XP9L 3GMRA 4Y94A 4OUUB 3T1FB 4Z7OF 2XC8A 4MMZA 1PJ9A 2O6EA 3ECBA 4ZDHB 3X12B 4EKXA 4UQCA 5ILTL 3X1EA 3W56A 5KJRH 5B4MC 4L37B 1PZAA 4V1DE 4AT6B 5D2LA 5JXEA 1IC0A 3IFOB 1NIBA 4OI7A 1DO6A 4JRWA 2H8PB 5DVNA 1AD0B 2MKWA 3EGXB 4FQ2H 1JOIA 1FYTD 2WKGA 4PRHA 3D39B 5BZWB 4X9IA 4ZYKA 3KLSA 2YAHA 3A0OA 4GQZA 4TL5A 2B59A 3I3EA 5D4IA 3V7MA 3ARBC 2A73A 3BZFA 1HE7A 2E59A 3DX1A 2G5UA 3WTUA 5E1AB 5I82A 1MCDA 4ODWB 3ELQA 4N0FA 4DFIA 1UKSA 3W39A 3SGJC 4Z7OB 3DGDA 5IW3A 3L3OC 4M7ZC 2C9XA 2OTWB 1WZKA 4XC3H 4FE9A 3CU7A 4NWUL 2XKNA 4IRSD 4NNPL 5C0AD 2ITEA 2WWMC 3TV3H 5F89B 1NMCC 4EO5A 3QQNA 4W4OA 1FL3A 3O81A 4IM8A 1C7SA 1BFVH 2VQUA 2GJZB 1ZK9A 2ZP8A 3MGOB 4RGND 3FU0A 5D72H 2AK1L 5KSUA 1F18A 1LO3L 1RD6A 4KKCD 4AJVA 1XB3A 3GSRA 3NACH 5T1MB 3BZEB 3SBWC 1HYRC 4G8GA 4IEFA 3R7RA 4TUOA 4X7FC 4NKDA 4PB0H 5J3QA 2YGQA 4N1EA 1CS6A 4JHVA 4OT1H 5HHXH 5JHDA 4A68A 3MRJA 3RNKA 4GRWE 4XVTL 1MCRA 2K00A 1G9MC 5FOJA 5I8EA 4JFXA 4QRTB 4IU3B 3SKMB 3JWNC 2NW3A 3WS3B 1S9VB 1FI8C 3MKKA 1R19A 4KTEL 2VO5A 5D9SB 5T3ZE 1QQDA 2W2WA 4BQ6A 2IPKA 2WXMA 1E5YA 1RZJC 1KJ2A 3K71A 4NQUA 2UWEB 3C60B 3C09B 3O41A 4CMMB 1TZ8A 4N2FA 2GC4C 2YA0A 4C58B 5E2JA 3OKMB 4HWBH 1U5FA 3BVNA 5HYSG 2DLEA 4WUKH 4EDWH 2IG2L 1QA9A 2FATL 2P1YA 3L4VA 4KJQD 4XI5C 3RVXD 4FQIL 5EFIA 1I1AD 5F3FA 3PWUA 2ZCHL 3CBRA 1AYOA 3QJRB 4IJ3B 4HJGA 4RFEB 2HAZA 4LGRB 4NZRH 5GS1C 3TJHD 4S1DD 4O2CA 2GUOB 3LHPL 4BH8A 2FIRT 4OLVH 1DZ0A 5C3TA 5J3TA 1IGFH 4PY7A 4ZO7A 5ALBL 3PY9A 4U6HA 4RISL 4PJ8D 2WLYA 2Y2YA 5DH9B 6FABH 2X6VA 3I6GB 3IN0A 2LFGA 3KR3H 3O3UN 4L1LA 3BUYB 4QHMB 1PFOA 2N4IA 5EEXA 1KFAL 5JHLL 3SQBA 2ZWZA 1J5CA 2A9BA 3ARED 4Q2ZB 5DFVD 5C7XH 4F91B 2F2HA 2R2HB 4GBXB 4UNVA 4LVHC 2X9YA 2GSIA 2EDOA 4KNTA 5E5UB 1FIEA 1FWXA 3FULA 3GBNH 4UYQA 2YOAA 3LQAL 3EJQA 3BRGC 2ICEB 2DH3A 2WWOA 2P24A 1X4XA 1AZRA 5TFSL 3DHPA 1MFEL 1UPQA 1TTAA 1A14L 2HLEB 4FYTA 4D8OA 3MUY1 1YDPB 2EMSA 4DKAA 2XN9D 3GZOA 4M6AA 4BDVA 4B96A 2XX0A 3M88A 2EADA 2PCPB 3WFHA 3TNMB 1COBA 5CP7B 1NGZA 2C9UA 4G43A 4KITB 1WG3A 1CZ8H 1GAFH 4HXBL 3IU3A 1BF2A 1A6AA 4JO2H 1NC2B 5ANMA 3NPSC 4HEME 4MJ2A 1L3WA 3RKDD 2JKNA 5J5EA 4AQ1A 2PYEE 3FT2A 3KM2A 5TF1H 4KZDH 4Z7WB 3GGWB 3E9TA 3W39B 3FSAA 3SPVA 4G42B 4PJBE 3T09A 4W68A 1J9QA 3LN5B 2YS5A 2OV0A 4HW6A 5IB5B 1RUQH 4AGOA 3WS6A 3MLZH 1A25A 3KNBA 4GSQA 3RVXC 2R83A 5FGCE 3STZB 2AEIT 3MLYH 4OFYA 3LIZH 4LL1A 4Z5RB 1O9ZA 3EFOB 2IVFC 5ICZA 4MMZB 1YYMH 3D87B 4ZO9A 2EDFA 2DQFB 4NRYB 4UI2A 5B1CA 2FATH 1FYTB 2QADC 2ED7A 1T2XA 2NRDA 3QC5X 5I6OA 2CIIB 5JW5B 3BAEH 1XR0B 1R3LB 2JQMA 3DJRA 5D4JA 5JTWA 4FTVA 2ATPB 1MLBA 3MRLA 3TW1A 3FB8B 4WHDA 2V2TB 4NLHA 4UF7C 1W72L 3O0LA 1P7QB 5GRZA 3V5DA 4XMPL 4JN2B 4NZFA 1TMQA 3KHQA 3IT8D 5C6WH 1TQUA 3SOTA 5D5MA 2JIXB 4TUJA 4HUMB 5AW9B 1TENA 1Z5LB 1UACH 4X5XB 2H7EA 4P48A 4ZW8A 3MV9D 1HQ4B 4DK6A 1WC7B 4NSWA 4ZODA 1YMMB 3IJ8A 4N9OB 2V4LA 3ARDA 4GEIA 3DUUA 3UH8A 1AIZA 1BA9A 4LOFA 2CRZA 4F7MA 2AK1H 1I9RL 2IANA 5JHDD 1KBVA 2F19L 4ETQA 1OP4A 2KDYA 3ARDD 4Y5XA 4I4WA 3QI9D 5K33A 5KVDE 2ATPA 5E6IC 1AGEB 2XYCA 1K5NB 3ZYOA 3WKNA 1BYNA 4OLYH 1A4BA 2VN7A 2X70B 5D96B 5DD0H 3OMNB 5FF6B 3WNPA 5BRZB 5JW3L 4NN5C 4YE0A 4K0OA 4XC3L 3SDYL 3HE7C 2BP3A 4ENED 2YD1A 2XVGA 5I1GH 4MMYB 3IETA 3LQZA 2HSIA 1ZHKA 3QISA 5AALA 3LPOA 3NDZE 2MWCA 1ZLVH 1WBZB 2YN5A 4ODHL 4CSZA 1FJ1B 2NNAA 2ZYSA 3VD9A 1OAUH 3KXFE 5BO0D 1TTUA 4OFDA 5EHFA 1TTFA 3GSWB 4G2AA 4Y4HC 2VDOB 3IXTB 3ZQWA 1KLGA 1ZE3H 2GBTA 2BY0A 2NTFA 2D7MA 2G60H 3TT1H 5HDBF 1CF1A 4DVRL 3MBWA 3QI9C 1MY5A 5GS1A 4MD4B 3WYRA 1FLTX 2A9AA 3K6OA 1IKFH 3ZKND 1T7XA 1KCSH 1SFDA 4UZGA 3MDJA 4NRZB 5HYQA 2P48B 1WF5A 2EC8A 3L5IA 4J6IA 4AI7A 3D85D 2QZ5A 4WKXA 3B56A 5KUKA 3DTUB 1E9QB 1GH7A 1JV5A 4PYHA 1MPAH 4F9PC 2X7LB 5I8KL 4ELME 1X5GA 4NZUH 1TCRA 3FF8A 1X7TA 1E6OH 3D30A 3DO7B 1TZIB 2AAVA 1MCOL 1YEGL 3PIQA 3VD5A 4P0DA 3HHMA 1IGMH 3BDYH 4NHUB 2MKLC 3HCVA 3UYPA 2A77H 1ZEAH 2VZTA 1KZ7A 1SEQH 3FSSA 2CO4A 2IV8A 3DPBB 4NC1C 3P02A 2E9BA 5FIEA 1GOGA 2ZUQC 1G84A 1NWOA 4D7PA 4Q2ZA 1HCYA 2CY5A 2CXKA 1LEGA 5SX5H 2GIMA 3U6RB 4EUPB 3RL1B 5DEGA 1LK3H 4ZPVB 1X6LA 2Z34A 5L2KE 5KYUB 2DMHA 4EIBA 1OGAB 2X6CA 3VXMD 3Q6FA 2QHRL 5GHWH 1BXAA 1ZT7B 3BKYH 4FHJA 2GUMA 1H3PH 3O4LE 2KPNA 2Q86A 3UAAA 1OQNA 2DN7A 4LVNC 2K1MA 5C07D 4PJIE 5E1IA 2K8EA 4O2FB 1IU1A 2XJKA 3D34A 3MRMA 4WQOA 5JHMA 2YMXH 3WFBL 2IOMA 1G9ML 1AIFA 3PP3K 3C2SA 2VXUL 2XZAH 4JFFD 1CUOA 3GMLB 4YN3A 2V5TA 4L9LA 3WD5L 1G1OA 4E42B 4DO6A 4RQQB 3MYZA 1B0GB 3U4BH 3EO9L 4LP5A 4AYDC 4MZ2A 1PD1A 1ZVSA 4YONA 3LMJH 1N64L 4XCFH 1TEGA 2Q20A 2WYZA 1OPGL 1JYWA 3EBAA 2DI7A 3J07A 4JGNA 2YIHA 2ZZUT 4FYRA 4KKLD 4RGMC 3RNQB 4LPTA 1HSAB 4APQC 2LAGB 1BV8A 1LD9A 3ZE1E 1UOLA 2QADD 3ML4A 2C3XA 5E2VL 1MHHA 2FX7H 3WGUB 3PABB 4ZMQA 2O5NA 1SMOA 5C0FB 4TSAL 4GP5B 2V9UA 4PY8J 4TPRH 4X6CF 3MRMB 4DN4H 3NCJL 1UFUA 1V3JA 2J57A 1XR9A 1KGYE 4XCNB 1U8NB 4NNYA 1J5IA 1BLNA 4PJ9D 1MJJB 5HHOA 5D1QB 1YAZA 2LFEA 3WHXB 4A7SA 3CIKA 3UTPE 4WFFE 4L3FA 4HIHB 4DGVH 3TPUB 2P80D 3QJQB 2BWQA 1D9KA 5FKAA 1Q4NX 1WCBA 1P4IH 2BVUA 1EEUA 3OGOE 2F7RA 2XT1B 3VGBA 2JP2A 3ARFB 5TH2A 3ZSTA 5J9PB 3DX2A 3IWUA 4N6QA 1UB6B 1V55B 3CIQA 4RGNB 5JIHA 5HGHB 1U3NA 1I8LA 3AB0B 4OJCA 1GGBL 1CE1L 2IAAC 4M6OL 1YEEH 4NKIH 4W9JC 3GXTA 5JPNC 3KPOA 1JWUA 1TSHA 1UJ3C 1RZFL 2YWZA 2Z31A 4X8JB 1UT1A 4LESA 4XXDB 4DP7X 5DJ2B 5C0AB 3T1WA 3J2PA 3IFLH 1E27B 4QO1A 1N70A 2QTVA 4X5XA 3HMWL 5HJGA 3LSOB 1KPRA 4PCSA 2P8VA 4NQSB 2HFTA 2YK1L 4PJCF 2CM5A 4S1DC 2X53A 1YMHB 1BHGA 3NEXA 1AP2A 2VIRA 2WXKA 2AV1A 3ZYJA 4NJ9L 1M71B 1X86A 1JPGA 4G11A 5IEHB 3D85B 3WA0A 3PWPD 3ASOB 3MLWH 3IPFA 1CQYA 5GS2D 3BUIA 4P2YA 2EXSA 1HZLA 4TYUA 5CN2A 2GBAA 1R3HA 2X4QA 3NJGA 3L3IA 5FLUA 3Q2VA 1IEAA 3VWJD 1VACA 5IQOA 4QRQB 2W9EL 4LPUA 1JN6B 2FBJL 3QJHA 4YDKL 2VRWB 1NCBH 1XH0A 4HF5H 3A21A 2ED9A 2W60A 2R4RL 3MRCB 1F97A 4M62H 2UZSA 4H8PA 3FQ2A 1DANT 3VNZA 2C3GA 1JSYA 5ISZA 5I8OH 2Z7UA 4GO9A 2CA3A 5ALCH 1JPGB 5KS9F 2QGDA 2X3AA 2FX9H 2FJSA 3W0WA 3GGWA 3U7YH 1M9WA 4S1RH 4AYFB 1ZA3A 5IJDC 1FGZA 4I3SH 1W1DA 4Q9BA 3QA3B 2HKHH 2R0KL 4HISA 4KJQC 3R4DA 4PGEA 3HC0B 4Z7VF 5LVEA 1SY6H 3VFUA 4Y4FD 5CD5C 4X6CE 4LF3B 4QUOA 5BV7H 3NRQA 1S9XB 4YX2L 4L18A 1TIUA 2EC9T 4L8BA 3A6CH 4KX9A 3QDMD 5JPNB 1VCBC 2YS3A 5ALCL 3CZKA 2FLMA 3UBHA 2DLFL 2J6WA 1QBLH 2AL6A 1ANUA 1FN4B 4NKOB 3Q8CA 4HWZB 4N9GA 4JY6B 4LNVA 4WNQB 3UBXA 4DERA 5JW4N 4NRXB 4GKZB 4RGNC 4WENB 4XMLH 5C0BA 3QJUB 2F1EA 1BOGA 1R5VA 5E4IA 3ROOA 3PNWA 2FTAA 3V4VA 4K7PH 1SFHA 3L2NA 1WAAA 2IO5A 4NEHB 2EDJA 4YZFF 3FSZA 2ZF9A 5A1AA 4PGCB 2WVTA 3HSAA 2V5SA 2KZWA 2VDKB 1AQDA 4TVPH 1DJIA 3GSVA 4JFTA 2P0HA 3NIDB 1JRHL 3BPCA 3G5VA 3LPWA 4LBAA 5FGRA 2EH7L 3B5HA 4R9HA 3VSVA 4NUPA 2NY6C 4O58H 1P69B 1XIWD 3UJJL 1BWNA 3KYMA 4ZRKA 2DLGA 4B53A 4CU7A 5JHHA 4L9LC 3FU5A 4ZX3A 3MLUH 5DD1L 5C2UB 4ETQB 1PLGH 2QL1A 1UGNA 1X6NA 1UA7A 3FQXA 4G8EA 3C5ZB 4WEBL 2FECI 5DXWA 3RWHB 3JUYA 1VERA 4PWEA 1XWVA 5A6IA 2R56L 2RVBB 4MNHA 5KSBB 4U4BA 3BE1H 2JJUA 2B59B 4L0PB 4P9HL 4LLMA 5GGUB 1DVYA 1KXVA 2A4CA 4B5ZA 4F92B 1ZRUA 3KPOB 1RZPA 1ADQH 2XBDA 3SKOB 4UANA 3TVMA 4M6OH 5IGXL 3NZSA 1ZHLB 2X0UA 3PWPA 4ZO6A 5DJDB 4N90D 4OZGF 3S35X 1A6UH 3T0VA 2C3VA 1DN0A 4Z77A 1KB5L 5T33H 2H4EA 1IZJA 4RGNE 4GYBA 5CLXA 3UDWC 4LLQB 1F02I 5LBSA 2I24N 2ICEA 4PS4L 4L4VE 3K8KA 3WIFB 4QXGH 5JXAL 1RP9A 3WN6A 5FHAH 2HJKB 1OSPL 2UYLA 1MJJA 4OD1H 2B77A 5DRNA 1D2OA 4PG2C 4JFYA 3RVWC 4O2EB 1YNLH 3SOBH 2YAEA 4GEJA 3WSQL 1XR9B 2VZVA 1U2BA 2ESVA 5CJXA 1ND0B 5DFTA 2BOBA 5ITFA 4G8GB 5A3ID 1IBHA 4XMTA 3UTTE 3N41B 1JNLH 2H45A 4L2YA 5JPNA 3D52A 3U0WH 2QQNL 4P5RA 4N25A 2GJYA 1D9KB 3JTBA 2TSBA 5FKAB 1AXIB 4GIPD 5I26A 1UUSA 3E9UA 4IDJL 5BS0D 5HVFB 3ABMB 3IGLA 5AG9A 5HHMB 1E9QA 2VC2H 3E6FA 4J28A 3X14B 5CD3B 3OZ9L 4XN5A 1AZZC 1M1SA 5DMIH 3ZRCC 4BFEA 3DPDA 2ID5A 3DX9A 4LSPL 1D5RA 4HWBA 2LLLA 2OSXA 4FXGB 4J3OH 4OCXH 5E9DD 3NA4A 4NBYB 1B6UA 4MB3A 3A6BL 3PDDA 3MOAL 3NVQA 4XVUD 3W0WB 1M9SA 3D3VA 3QI9B 5CJOH 3AQDA 1OANA 2WQRA 3SE6A 2FO4B 2H6UA 5D6CA 5AWNH 4ZW5A 3ZHNA 2H47C 4YEFA 4OAWB 3IMVA 4UQEA 4X6CA 4TXVB 3O96A 2C7UA 4XNQB 2BSTA 2BCJA 3L4CA 4I18B 3MNZA 4M61A 4X4XA 5D6DC 3ISRA 1I1YA 1DQML 1YJDL 2RQEA 1RUAH 2FNWA 4TLTA 2Y1VA 1M57B 3HRZC 3F00A 3K74B 3MOQA 4LMQI 3KJ4B 3WIAA 2BHUA 1MHPH 1G4RA 5FGCB 1FFPB 4NI3A 2C3WA 3ZSSA 1IC7L 1E4KC 1IEAB 2VH5H 5GISL 1M4KA 1NBQA 5F1NA 5J1SC 3EJJX 5FCUL 4PRAB 4KUCD 5EBWA 3WN5C 5CSGA 3K1DA 1I8IA 3QE5A 3BEWA 3SD2A 1N67A 2FL5B 2NY5H 4HJUA 3KZ8A 2MRYA 2YPLE 5DJDA 1E7UA 1H3GA 5D96C 1RJZB 2C34A 3L1FA 4XO4A 4Y9EA 3RIFF 2J1YA 3EUDA 5J56B 2G2NA 1N5AB 2WBXA 3BUYA 3THML 3EOAA 4UNTA 5E6IB 4ZRJA 4B9PA 3SN6N 4UQBA 4X6DA 1TMCB 1GZPA 2J8OA 3GFUA 5FFLA 4OV5B 5HGDB 4F15B 3VXTA 4IFSA 2G5RA 4BQBA 1P7HL 5DVOA 3CFCH 4F7KA 2F7IA 4JM2C 5EIQA 5KTEH 4J8RB 1AKPA 2E8YA 1GYCA 4PJFB 1BM7A 1IGTA 4MZRA 3BEVB 2VDML 4F2EA 3AY4C 5C16A 3O6FC 1JGEB 1WICA 2A99A 1O0VA 2Y8FA 3TBCA 4L6EA 1MW1A 2RH0A 1Z9MA 3H3PH 3FQXB 3MCKB 3TVMD 5DZVA 2R0WL 1LP9A 3DOHA 5TE6H 1QWNA 2V3FA 3B7TA 3DETD 1H9VA 4IRSB 1R46A 5ABAA 4EF3A 2KIEA 5BMFH 2NTSP 2F54B 4YHPB 4JHBA 2LG1A 3KXFB 43CAB 4P4KB 3LJ3A 5EU3B 1FNHA 5LB1A 1KTKE 2JKWA 3ARGA 3ROOB 1JK8A 3OV6A 5CEYB 4HOXA 1FZKA 1XD1A 2YXVA 1RIUH 1BAFL 4M7JL 5I1GL 4FXLA 4HKZA 4IU3A 3V0JA 4A2DA 2OYLA 3OF6A 5IBTL 1AQDB 2EDTA 3HR6A 5IIEB 1DBMH 4LQ1A 2X4TB 2HG0A 3NJMA 2YXFA 3FHQA 4OJYA 2BP8A 5IB5A 1C5CH 3QEHB 1K5GB 5K9JH 4KNQA 4ZQKB 1S46A 3PWVA 5KBDA 3OX8B 3CG8A 4Y5XB 4PV9B 3MHZA 3S9DB 1YC7A 3VXSD 1VFBA 4BKLA 3CZLA 1KEGL 3KPRD 3I3DA 1WFMA 3QPXL 4OCYL 4NDMB 4RRPA 3MRIA 4M1DL 2ZXWB 5EO0A 3UBXI 5BRZA 3QQDA 1NAKH 3KYOB 4Q6IB 4NIYE 1XQ4A 3WY2A 3LNDA 4Y5YC 1HK6A 3DURA 4PJDA 3SJVA 1P1ZB 5D3YA 2H7DA 5CIPA 4JW3A 1G4MA 3N43F 4HGWA 4I0PC 3QUYD 4M93C 3QWQB 1NA8A 3MUUA 2BY2A 2FJGA 4QHNB 1MK9B 1P7QA 4LSTL 4EZKA 2IMNA 3KBEA 1KTLB 2VGLM 3ZW3A 4HUVA 3VTTA 2NSQA 1T5KA 1O6TA 3HPJA 2AKRA 1ZDSA 3HZVA 2C9VA 2NY6B 5GRUH 4UAOC 4HB4B 2JF1A 4F8TA 5I8OL 4JFWA 2QQLH 4ZMTA 2HVBA 5C0DB 3LKSA 1E4HA 1Y6KR 1E5AA 2FR4A 2PW2A 1TCMA 1EJ8A 3BP6A 1X1FA 2F54D 2OMYB 4RCAA 4JFOA 1NFDF 4HF5L 4FEIA 4BK5C 2WHVA 3ZDZB 3VI3B 2CMRH 4L8CB 1WHOA 1XEDA 2A38A 5DFVC 3FBQA 1MCSA 1YC8A 15C8L 3KYAA 2XXFA 3QK0A 1P6AB 3D2UA 1OV8A 5KAQG 4QT5B 3S37L 4A6HA 1CE6B 2D2CC 2YKKA 1HZHL 1XH2A 4WHYG 4YHPA 4FXKA 2F61A 1FNFA 2XA8L 2GJ6B 2O6DA 1WPCA 3F04A 3PZDA 2Y7QB 5TF1L 1W91A 4FP8L 1YQVL 3OMZA 1G0YR 2KZBA 5T5FA 5FDWA 3CWGA 4U2YA 5H4ZA 4F8LA 2H3NB 1A6AB 2HYMA 3LZOA 3DYMA 5ANMB 3Q3GB 5JDSA 1IAIH 2YLHA 4MAUL 1ZVRA 4O02B 3BW9A 1NCNA 4A38A 3HMWH 1OF2A 1O7DC 4YC2B 1EH9A 1NICA 3NK4A 3T77A 1R3KB 4AQEA 1ZLDA 3DVFA 3NJFA 4PCYA 2R1XA 1KFGA 2IWKA 2PPAA 3HS9A 2X05A 3UIZA 3MV7A 3IVKB 1SQ2N 4KKLC 5E08H 1S8DB 5LKNA 4O2FA 3PSCA 1B6DA 1BYOA 1ZT4B 2CU9A 1H15B 4YR6B 2H6PA 4A6YB 2DYPB 1QUPA 1TJMA 4RMUA 2ZSWA 5H37G 1KGWA 4RESB 4XC1H 4QGYA 2DA0A 3BH8B 3MLXH 4G6JL 1P4IL 1LEKB 4K2UH 3PNRB 1SOXA 3SQOL 3JV5A 2Z35A 3PAZA 4PRIE 5DK3A 5IWLA 2YT0A 4ZS7L 4YUEL 3VXME 4AE1A 3RA7H 5LWYH 2VXQA 4XN7A 3TBYB 3RRQA 4RVBA 3TO2A 3GI8H 4Y4FB 4MNQE 1PZ3A 3ODWA 1B2WL 1QBML 3Q9QA 1ACXA 4NHUA 4QI3A 5D2NC 3LKPA 4S0HA 1N3NB 5JW4M 4YXKH 5GS0C 4J3XA 4AZ8A 4CC0A 3H7BB 4KVNH 4HUXA 1S8DA 3HNSH 5BW7A 4Z7IA 1BJ1H 1RIVH 1T22A 2A0LD 2CUIA 3D85A 5FO8B 1I7RB 2CE6A 1FZMA 2NY1B 3HZYA 3TA3C 1NIFA 2WQXA 4UIMB 1KYOJ 1ZGLB 1BOYA 2NZ8B 3RTQA 4WUKL 4LHUD 4EE2A 2WTOA 1OLZA 3HMXA 3C6LC 4MNGE 2EDRA 2DQCH 3I75A 3GMLA 4MZ3A 1R0AH 4Y8AA 5T1KA 2HX8A 2OSLB 3GIVA 4KKNA 1XF2A 1UZ6F 5F6IB 3TBYA 2XN9A 3JWNH 4PV8B 4U1NA 1GC6A 1P1ZA 1G9MH 3QEQD 1XAKA 2NNFA 4X98B 3EW3B 2ADGA 2AVGA 1Q9WB 2P4AB 1N4XH 4P2OD 5D2NE 5E1QA 5C9JB 1UH4A 4JBSA 4MJ5B 1OGSA 1JL8A 4HV8A 4KTGA 4ATWA 1UASA 1ZHKB 5AENA 1KJMA 3Q7JA 3DJ9A 1LO4L 3OANA 1BD2A 3KSYA 1I7TB 3IJEB 4QOKD 3HC2A 5IK3B 4Z3EA 4Q74A 3HI6H 3L9EA 4TF4A 3NACL 3O4LB 2BP8B 1G6RL 3W5NA 1FDLH 1OCZB 2G9HA 2W07B 3GIZL 3HTLX 5I0XA 2N1KA 5E9AA 5H37H 3S96B 3UZEC 2FR4B 1KGCD 4KKBD 4NKMA 3U7DA 4OZGE 3WBDA 4JPKL 1KPVB 4L2LA 3EXLA 4WI0B 4NUGL 5K9OA 5KOVC 5C0GB 4L1DA 5F21B 3P69A 4IK6A 4RGMB 5F9JA 3DIFA 3D3VD 3RP1A 3VAEA 1N0XH 2FIKB 2ZXEB 4PJIF 5HBBA 2BSTB 4YBQC 5ERWB 3PL6A 1NAMA 1TXKA 2H32H 1SGHA 1NCWL 4P2RD 4OJAA 3US1A 1NH6A 4FLQA 4MDJA 3IPEA 4R4FL 5FI0A 3SYAA 3UGUA 3O3DB 3PHSA 5KYXB 1BMGA 4PJBF 2GCJA 3S36L 5CD5D 1KCSL 4WI6A 3MUJA 3SJVB 4FQCH 5DD3L 5IQ7H 5DVMA 5ESVB 5SX4I 3U82B 2XV6B 5I6NA 2J2ZA 2DD8H 3WEXB 4Z0XA 4F33B 3TT1L 4PJHA 1VPOL 4JRXE 5ANHA 1DBKH 3SYCA 1Q0EA 5D1XB 4KO9A 4ABUA 1KJ2B 1T22B 1EMTL 2QV4A 1KCWA 3ILEA 4LPYA 2VL4A 3WLBB 4PBXA 5F44A 4TSCL 5D2NB 3CDGB 2NNCA 4Z95L 1JCVA 1FFRA 5HGGS 4ADIA 4FQLL 4P5TC 1HOCA 2VLKA 4Y19B 5AVYB 5GGQL 3B8YA 5ESQB 2EH8L 2AITA 2JTYA 5JDJA 3WUWA 4WK2B 1NCJA 3QIBB 3NUKA 3MUZ1 5D70L 1T5WA 2MEJB 3BMWA 1MAIA 1H0DA 3NFNA 1FGVH 3L3IB 1H5BA 4U6TA 2IGTA 3BAJA 3S4SG 2PR4L 2R0DA 3MNWB 4KY1L 4YHLH 1PQZB 3BLPX 2XWBB 4L29A 4OLYL 3HW7A 4GXUN 4NQDE 5KVFE 1FN4A 4NKOA 1KUMA 1QSEE 2ZUSA 4WW2A 3QH3B 5EZJA 4A7QA 2WZPD 7PCYA 1UWEL 1NLDH 2YPVL 4LRNL 4DKTA 5TF0A 3S37X 4N6RA 1YNKH 2IANB 3GEFA 2W5PA 2WUBH 3FSVA 4WIQA 1F3DJ 1FDLL 1HH9A 4NZJA 4AG4L 4L05A 3GZPA 3FKUS 2AEQL 3UCRA 3JWNE 1U8PA 3GWJA 2VSZA 2XIIA 3EFDL 4TV3A 3ZKMD 2GFBB 3LKOA 3QDGE 4MSWB 5EU7E 4H0GA 1QR4A 1YEDA 1BAGA 1U21A 3QDAA 3TOPA 1MI1A 4K8RH 4X2UA 2XSKA 2X4TA 1S2EA 2Q10A 1EQWA 3VXOB 3Q8EA 3B2VH 2X44D 2CD0A 2EKSB 5F96L 5LN8A 4G9FE 5TK4A 5G4OA 1N5YH 2BK8A 3IBEA 4G9DB 2QPUA 4JFHD 3BRDA 3O6LH 1ASQA 4P5KA 2APVA 5D1XD 1NGQH 1OCCB 3FW6A 2F58L 4NO5A 1PZUB 3WNJA 2YGVA 3SPVB 3ROLB 4PJIB 5A3IC 4H8HA 2KHAA 1NBCA 3KPNB 3QIBD 2BW4A 5J1AA 4E5XG 3IN2A 3RNKB 4IDLA 3D4ZA 4AQ1B 1A3LL 3MJ7B 2N3JA 4PJ8A 3NIFF 1EHKB 3VCLB 2GTQA 3AFLA 1F56A 1KJ3L 1P0SE 1T3FB 3GS0A 4K9JA 4LCWE 1DQIA 4YXKL 3C08H 4PYGA 1T7VA 2NCEA 1P53A 2CQVA 5DC0A 4H26B 5E2WL 4J8QA 3RTQC 2Z6FA 4KMQA 1WH0A 2R9HC 1CJYA 4JO1H 4UIKL 3DYPA 1YJDC 4M93B 3EF4A 2XG5B 4OGAC 1QUNA 2JK5A 3K5SA 5H37A 4BK8A 1MFDL 5JHLA 4H20H 4BWTA 3BUPA 4KKQA 4AMXA 2FIKA 1XCTB 2Z4DA 5E94B 3UG4A 5KVFL 2X1PA 2AABL 1UKQA 2QGCA 2TRYA 1ZY9A 3I50H 4HIEA 2YSSA 4PIRF 5CWSA 1MVUB 2OK0H 1X05A 3O41B 4X83A 4CMMA 4OZHA 3EYFA 2FL5A 2ZP0T 1OARH 3MU3A 1F6AA 3P77A 3Q43A 2E6QA 1T1WA 2X2HA 3QJVB 1U9KA 4RBPH 4I3RH 1NCDH 2VR6A 3T0DA 4MXQD 4HZAA 5DMJB 1N5AA 2RNRB 4JKMA 4WU5A 4JO4L 2WUCH 1PZ2A 1WV7T 1Z6JT 2QADB 3O9WD 5DEGB 3IE9A 3QIWA 1KG0B 1YQ2A 2IH1B 2HLFD 1IB5A 4HWNA 5CLTA 4CRPA 3AWEA 1N8ZA 5DS1A 5J13B 2EVGA 3QUYB 3KGSA 1EZSA 2J88L 2OULB 3ECBB 3M7FB 3UL4A 1N6QH 1AZBA 3PL6C 1OSZB 3G6DL 4S10A 4UBDD 5H35A 5T3ZH 3OKOB 4AYID 3SDCA 4P5SA 2Y23A 3P4LA 3WDIA 1J86A 1A7PL 2WZ0A 5E70A 1P4LA 4U1JA 5E8NB 1OP3H 5I8CB 3S37H 1LLAA 3T2OA 2EDNA 2OZNA 2HUEA 2K9FB 3IAGC 3N7CA 1C5DA 3H9HA 1FP5A 3CDFA 4NFBA 3Q2LA 1DJZA 2X3BA 4LAQL 3B3BA 3FUHA 2DBJA 3VFPA 5CLYA 3QORC 1TQSA 2BNUA 3PL6D 4E2OA 2WAQA 2ZCHH 3PGFH 4NJAL 4XPHH 3H9SB 2BRRL 4IRJC 4UV4H 4XTRC 1OAZH 3C8DA 3E1ZA 4A66A 5IVZB 1I1FB 4JQIL 4YHIA 5DD6B 3P30H 4J3OG 5G5DA 4WV1A 5B1JA 3LQMA 4G7QB 2HLFC 2NY1D 4XOEA 5BUPA 5I73B 3P40A 3S3DB 1QTSA 3IK2A 3TO2B 1ASOA 3VGAB 3K8MA 2OQBA 4WFHE 3VXTB 4U1HA 2COQA 5I66A 2GIXA 3CVCA 4JLRA 1OE2A 4OZGA 3CFBB 3UTSD 3HIZA 4P4KD 2Q7AA 3GSRB 5T1MA 3BZEA 4YBHA 4FABL 2YGOA 1GTNA 5B7EA 5LAXA 5B39G 5I8EB 2VDRH 1QNIA 4OLUL 4JFXB 4LO9A 4Z3TA 3IXAA 1AR1C 1JRHI 3K3QA 3QFJD 2AVFA 3CZFB 3RPIA 1I2HA 1FH5H 1EK3A 1XGUB 5HHXL 5HHOD 3FNKA 5IESH 2BDNH 2OYPA 1XD4A 4W9GC 3DJSA 3RIAF 2GTWA 4AVHA 3QYCA 5FUOH 1QR1B 1QHOA 5J6HB 2NW2B 3VXUB 3P1VA 5I71B 1IM3A 2DTCA 5CINH 5TD4A 1KIRA 2ZIDA 1AXSB 3FQWA 1KCVL 3MX0B 4MA1B 3OGCB 3W2DH 4MB1A 4CL7A 5K9JL 3CFJA 3EDFA 2PYFB 2EYTB 3N40F 4Q6YA 5G4MA 3B6SA 4FZEL 2QKSA 4NNPH 3GB7B 3B7RL 2ZUTA 4Z8FL 1L7TH 2VITB 1BAFH 4M7JH 1KLFA 2QFRA 1CDGA 1RMFH 2ZCLH 3QO1A 2VAAB 3LRSB 1RPQA 2MOQA 4UZUA 1D6EB 4AT6A 1AIFB 1ZKAA 3BPNC 1DJGA 1AQMA 2IBZX 5I1AB 4JFDE 1XD0A 4JFSA 2PW1A 3RJOA 4C55A 2DQUL 3RU8L 3ZL4H 2DOCA 2DI8A 3RHWK 4BM7A 3FO1B 1JDAA 4Z7NF 4IBYA 5I8CA 3EF7A 4L4JA 2F8OA 4QT5A 1FO0H 2ZKHH 1B3IA 2GJ6D 3ATBA 1RPUA 1ZXKA 2OP4H 4HH9B 2W2XD 2Q2LA 2NXZD 5AW7B 3VXMA 4X7SL 5I2IB 1QFWH 2YJLA 1D5MB 3FCTA 3ROLA 4M1CC 1AZVA 4J3TA 3X3FL 4HZLB 2VDNH 1AXTL 2DQEL 1GW0A 2XIDA 1P2CB 5CIPH 4Z7UE 4XOBA 3BIKB 3G6JB 1F8TL 1KTLA 4ZFOL 4NKQB 1L0PA 5HHPB 2RR3A 1BPVA 3SO6A 3FH5A 2YD3A 2VN4A 5E9DB 1XGQB 4XRCA 1TQBC 3V4VL 1OQOA 1AGDA 3ZIMA 3O6KH 5AVWB 1WTLA 2HXAA 4NN7B 1NGXA 2VUOA 1J05B 5I73C 3PABA 1WS8A 1B4TA 2XKSA 4M7LH 5F7NC 1INDL 1HAUA 4MLSA 1UD8A 3MRDA 1NGZB 4ES8A 2P7TA 4RETB 3SCMC 3NT0A 4XB8A 2K2UA 5DZOA 5MEPA 3CFDB 3ZX1A 3I6KA 3U4KA 3KYOA 4Q6IA 2D3JA 3VFSA 1XCQA 1M7XA 5D4QA 4BEIA 5JIPA 3DUSA 1AANA 2KC0A 3OQRA 2WNGA 5TQ0L 1H5BB 1EZUA 2WB1A 2YPLA 3MLSH 3QZMA 5DMGC 3RCPA 3V0WL 1BW8A 1UH2A 3OLIA 2DB8A 2CGYA 2OL3B 1DL7L 3H6JA 5E9DA 2E3VA 2EXWC 5MERA 3UZVB 1I8KB 2XV3A 1TQVA 4CBPA 2ZOLA 3I84A 4QLWA 3U9PL 4B3VA 3NA9H 2ICES 2YJQA 4G1EB 4N2IA 1KCUH 3ZTNL 4KXCA 4CJ1A 2NXYC 4QRUA 2Y7LA 4ZOEA 1BVKB 2KBGA 2Z4TA 1QW8A 4HK3N 4WTZG 3US0A 4LGPB 1QABA 1NM4A 1KGIA 2YRLA 4GLRH 2E27L 1A6ZA 1OY2A 5DMIL 1DLFL 2FNBA 2HMID 1OB1B 1I9JL 1NMAL 3OJMB 5T5NG 5GS0D 3FYIB 5DGRA 1KENL 1HFUA 5CCHE 5DYOA 4MJJA 1EDYA 1ES0B 4LHQB 1DEEB 4HJEA 3QORA 4WEMB 5I23A 2DF3A 2ZSWB 4NUMA 4HV8B 3SKJH 1UM4L 1UB5A 2Z8SA 2BVOB 5FO7B 5FK9A 1HH6B 1QFHA 4GAYB 1CQKA 5DJ8B 4WI7A 4LCIH 4X98A 3G3LA 3OXRB 5DTFB 2V2XA 1QEWA 2XQYA 1MNUH 5B1JC 1WD9A 4RSVA 4HK0B 2EDXA 3P73A 1EUUA 1SLUA 4S11A 4R7VA 4JZOA 4NKMB 5GRVL 1AD9B 3Q8FA 1L9OA 3MRPA 2A6DB 1JPSH 3U9WA 4O4YL 4NP9A 3L8QA 4ODSH 3V4VH 2I7OA 3VVWA 1HHIB 2GK2A 4KDTA 4HAGA 4AM0A 4OY9A 2FT7A 4GP8B 3D0LA 2YA2A 5EIIA 1JTOA 3CUPB 3O9WC 5FO8A 1X1GA 1NCCL 1RK0A 4PWKA 5GQBA 2I9TB 1HCZA 1QG3A 2R23A 1MREL 2DJMA 3L3JB 4GW1A 4XBGA 2ESVD 3C6SA 1FG2A 2P42B 3NMEA 3EYSH 1AR2A 4FNRA 5KYYA 5HSFA 1BCIA 5DK0A 1FNGB 1X5MA 4F37F 4DP6X 1U91A 2HLAA 3H85A 3KLAA 3TCLB 5HHOB 2AQTA 4MQ7B 4PCKA 2RHEA 3MMEA 2ZX9A 5C0IB 5DS8B 4YSAA 1Q67A 3H54A 3IGAA 1HXYB 3IGFA 1AS8A 1F00I 1A4AA 5KZCD 5BJTA 4GUOA 1IT9H 3V7AE 3QUXB 1AH1A 3O0RH 1W1GA 4JFPB 2AANA 2CR0A 1IGIH 4DGUA 3VGGA 1A6PA 5GRVK 2Y3AA 4GKOA 5DHVA 3EYFB 4GAJL 4QYOA 3E80A 1T0NB 4I0CC 4UYPA 4V11A 2R8SH 4EQ3A 1L7TL 2W0LA 2F0CA 3PGDB 4ZAKA 3T5WA 3MO1B 4YDIL 4HUXB 5EF2A 4PJEE 1U8HA 4HSAC 3QUML 3RZCC 3DMMA 3FTUA 4K7PY 1TQWA 1U8KB 3QDMA 4NQSA 3GXUB 2G3NA 3NZHH 4ZFOB 4HX1A 2RACA 2X9WA 4HSCX 5DO2C 4JG0L 4HT1H 3IGAB 3F12A 5IJKC 1CT8A 5BUAA 2OMUB 5EZOL 3HB3C 4GXBA 2VERA 5CEXA 3QUZB 3GXIA 4UQ3B 4FQ1L 4Z7VE 1ZSHA 3VYNA 1PY9A 1OSZA 5H35B 4D0NB 4A6KA 2CJ3A 1DR9A 3NZ8B 2ELBA 2OMVA 3QSKB 4K2OA 2GAZB 2BWIA 2UZXA 4NCDA 3VFWB 3CCHB 2F74B 2ADGB 1YN7B 1UVQB 3ZDYB 1GGIH 4HJJH 3GHBH 3EHBD 4JY4B 3U6RA 3PS6A 5B8CA 3A98B 3MACL 2Z13A 4PI0A 1AKJB 3UTZB 4LLQA 2MCAA 4HZLA 3U7YL 1A4JB 3RX7A 1AC0A 3CPUA 1P5VA 4MJ4A 5F7MC 1YEWA 3P30L 4KI5C 3L7FA 5K39A 4CC1A 3FQUA 2BRRH 4UV4L 4YIQA 3SCMA 3ULCA 2ZAIA 1ACYH 1TZHA 4K71B 4U49A 1LE5B 3U9UB 5C5BB 3AU4A 1A21A 2X89A 3MR9A 4XP5H 4YPGB 3GNMH 1XH3B 5ID1A 3ZKMC 5KVEE 4RWHA 4Y19D 4K17A 2AXGA 1N2RA 1DEEA 1I8AA 2EXWD 2WNXA 1NUDA 1F4WH 4Y0GA 5T5FH 2KUTA 5A6LA 3MDBC 1EJ6A 4OT1A 4UOW0 3TA3B 1S9WA 1AHWA 3T6WA 1TKWB 2AW2A 1LW3A 1UZ8A 2X2JA 1JPTL 4LZKA 2DM2A 2GKIA 2VL5B 4M7KH 1RVFL 2I60L 2NY0C 2XXMB 4OLEA 3TVVA 1S7VA 3LNGA 2ZWYA 4BFIB 1A4JA 1Q9KA 3ATDA 1RJYB 1IARB 3GHPA 4OLWL 3L48A 5HY9A 4Z7VA 2FX8H 3DX4A 2HMIC 3V6OC 1TJGH 2DLTA 3LXAA 4LLAA 4DESA 1BEYL 4HIJA 1MCWM 3V0HA 4PCTA 4EEEA 2CKBA 3PU7A 3ZE0B 4KXBA 1A7NH 3AU0A 3JWOH 2ZOLB 2PO6C 3PNWB 4WTXA 1T2QL 4MXWH 1DE4B 2XY1A 1E43A 4W9LC 5DRZB 4PGCA 3D0LB 1KN4L 5BCAA 1XF1A 4CA4A 2ZUQB 2WKOA 4Q9RH 2JLLA 5B1KA 1BZ9A 4HUUA 4IEFB 2D03L 2PWFA 3K6NA 1X11A 3RFZC 4WTWA 4JDTH 2OMXA 3CDGA 1ILUA 3LH2L 4NQQA 5SX4H 3AWGA 4M5YL 2IALB 3F5WB 3Q44A 3UYRH 4JFFB 3GMMB 5DFAA 3WNNA 4G42A 5I1JH 4ELDA 1TZIA 2J43A 1XT5A 3FT4B 1JDDA 5EBGA 2CGRH 1JZFA 4W6XB 2JVUA 4AQAB 1FHGA 5F6IC 5TDPB 5DJ8A 4G71B 4YBQD 4WGVB 2PTTA 5DJCA 4NWTH 2VW4A 2D9VA 3QDGD 2WLMA 3PVUA 3NWFA 2IBGA 2P45B 3J8F7 4GSUA 3MBED 4BYHA 5E2WH 2ISDA 5DQ9A 1MNNA 1IC5L 1RLBA 4LCCB 4QHLB 5C08B 3T6VA 4K7FB 3MLTA 3O9WA 4FG6C 2RCSH 2OXGA 4UCFA 5E23A 2OJ1A 4EXKA 4KTYA 2XOTA 1RZ7H 2NDGA 3I9IA 3L7FB 3ZT5A 3MJ6A 2DYQA 4RAUB 4JJ5B 4AIXA 3RWDB 2JELH 5FEBA 1XGQA 2M2DA 1NLBH 4M9PA 2D4FA 2QVTA 5E7BA 5KS9A 2HKFH 5LN4A 1CIUA 4RFNB 1FFNA 2Z59A 4DPRA 3N55A 4QHUB 5DR5H 3VQ2C 2IPTL 2OMZB 3S35H 1JF1A 1MCNA 2LULA 2V9QA 2ENYA 4ZTPH 5DWPA 4LSDA 3SKMA 1KXQE 1KYAA 1MI5A 2KLRA 4KJWC 1KJVA 3JWDH 5CJQL 5ADOL 1XGRA 4X4KA 3V7AG 2XICA 3Q6GL 3Q5YA 1B4LA 1ZHNB 4JFZL 5DZNA 4L4VD 3MLTB 3O9WB 1MKFA 4N0UE 4DGYH 4PJEF 1IEBB 1I8LC 4UT9H 4IGBC 3PAUA 2A2QT 2WXLA 4WU5B 1GPOL 3O3DA 5AD0A 1BJ8A 3RZCA 5D1ZA 2Z31C 3DX7A 3ESNA 4M48L 1NC4A 3A67H 4FFVD 4KO5A 1YDPA 4MS6A 4B0MM 1K6QH 4N8CL 5I66B 1OE3A 1ITBB 1FL3B 2HT2D 1DVTA 2XZQL 1DQKA 2I07B 4YSCA 2LHAA 3BI9X 1DVQA 4H8QA 5TE4L 3S5LB 4WWKC 2PYEA 4LCVA 3AACA 5EDXA 4OZIB 2GTWB 1YAIA 2A77L 3FRPG 1X44A 3LD8C 3UMTA 3VSUA 3QEHA 3S2CA 1SXCA 1MWAH 1YPZF 2QVFB 1QMUA 1M7IB 4FF9A 2F68X 3VRLF 1EV2E 1I9IH 1BG9A 1LTXA 1YUHB 2BLFA 1KXTB 2XG5A 1D7BA 4YHLL 2ITCB 4RMBA 1NMBL 2AF2A 2EDMA 4ZPTA 1TJHL 1I1CA 2BFVL 3H9HB 3S3PA 1FYTE 1RZIA 3ZRSA 1YA5A 4M00A 2Q87A 1LP9F 4NO0A 1WFNA 5I1KH 2X1QA 4QRPA 1JHKH 3MYJA 2W0FB 3QHFL 2NX5E 4X80H 1WRFA 5C8JA 3MRBB 4MMZC 4FQLH 2YF0A 3VG0L 4Z7VB 3MNZB 4M61B 3GXDA 1CBJA 1S7WB 2Q3ZA 3L6FB 3BPCB 35C8L 1J5HA 2XNAB 1UQSB 1IJNA 1AE6H 3HNVH 4KGJA 2R29H 3FUFA 5DJ6B 2ATAA 3MJGX 1MAML 4ZD3L 4N90E 3JV6B 3CZGA 1MF2H 5CHNA 5E6UB 5FFGA 3VG9C 2DWDA 4LPXA 5DLMH 4GRWF 3MRFB 1MUJB 3E6HB 1WGVA 5CZVL 4O2CB 4KWUA 3QHFH 1VADA 4L1SA 1XH3A 1IIKA 2V6HA 1DUYB 3LVEA 4HS6B 5J3YA 3CMOL 4N2AA 4X99A 3KPQB 5LNEA 2DIBA 4ZTOL 3IDIB 1FAKT 3KCPB 4ODXA 1WAEA 2QLYA 1QOKA 3EOAB 1TJ6A 1QR1A 1O6SA 4MWFA 4NQEB 1QZ1A 4LQFH 4OB5H 2Q8AH 1MWAL 5AVUB 3WNKA 3V6OA 3EOTH 3C6LD 4UILH 1U58A 2ZPYA 1CL7H 4FFZA 1D5IL 3RWEB 1HXYA 1H3WM 5GJSL 1D9KD 4FFYL 4GB9A 3D4YA 4DP5X 2IPKB 2K6ZA 2PCYA 2UYLB 2E7HA 1W80A 3B9KD 3CVHH 3LZQA 3DX7B 4IKJA 4N4YB 5HYJD 4JN1L 1E2VA 2VMEA 1QSFA 2EAEA 2AJSH 4X7TB 2J1ZA 2ZNXA 3AU1A 1OXYA 1IGYB 2O5ZH 3LHAA 1SYVA 1ORQA 4MAZA 1UA3A 3Q05A 5F8QC 4GBXC 5FYLH 1MVFA 2OJZL 4NCC2 1XF5B 3FYEB 3E2HC 4KHBA 1FZOA 3U1PA 1PCXA 4JFYB 2D2QA 5A2LH 1TFPA 2I1JA 3P3TA 3ULUE 4OZ4A 1U8CB 3OLGA 1GMEA 2EYSA 2JKLA 5FX3A 2Y7SA 3VXPA 3HQCA 3X1BA 4A6YA 1K5WA 3II3A 5DA0B 4AC2A 3TYGL 2OYMA 3IDJA 4H8WC 3EG9A 4ZFOA 2W0KA 3O45A 2TAAA 3L3KA 4N87A 3G08A 4XPBL 5IHBA 4O9HL 3S8GB 1F58H 2O5XH 3S35L 3AS0A 3ZMEA 1QLEB 4URKA 3BAEL 1PZ5B 4MAYA 3UACA 4D9RE 4XOCA 5DUML 1IVLA 5CGYD 4ZUTB 2E7LA 1XCXA 1AO7A 1WZ1H 1KBGL 3GINA 2XPZA 4D94A 2EDEA 3H3BC 1KN2H 4Z6AT 1M7DB 3TEWA 5TPWH 2PTUA 2Z3FA 3QS3A 1CFNB 1YHPA 2YAFA 4R4BB 1W0WA 2PUQT 4J3OF 2ZNWA 3OGCA 1T5XA 4JFDD 5FW8A 1YO4A 4Z3FA 3O3EA 4I85A 4V33A 1WAAE 4QXTA 4OM1H 1CK0L 4NAJA 1OOAA 2X2UA 3VWKA 3S7GA 3TJEH 1NPJA 2ITDA 2AGJL 5F9WC 3GI8L 4DUVA 1X5LA 1QFWM 2X09A 4GXUM 3BKJH 4LBEB 4XWGH 3PQYB 4XOAA 2GABA 1J0YA 3QG6A 3C5XA 4LDLB 4BV1A 1U4EA 2YSTA 5E8DL 2NY2D 2JXMB 4KH9A 4PG2A 3NJIA 3WEMA 5K69A 1W8EA 2ITCA 1AZNA 1ETB1 4H8WH 1AR1B 4Y4KB 2N56A 3S88L 1T1ZA 1ZC4B 3DPBA 5D3XA 25C8H 2ICCA 2WXIA 4MCYB 4OF6A 4R3SB 5IFHL 2AS5M 1HHIA 3D33A 2HT2C 4FG2A 2BHFA 1UXWB 5B22A 3VXSE 1YYCA 1IM9A 4ZMPA 3L08A 1FH2A 1NUGA 2O5ZL 1ID5I 4HGKC 1KT2B 1U3ZA 2PYED 2WO3B 1KPUA 1OB0A 2QQKL 4UT7L 3V4PL 4ELMA 3KE0A 3UO8B 1SOKA 5IVNA 1XX0A 1D5MA 2X4UA 5LLIC 1CFTB 3CVHL 3OPZL 3ARDB 1I3GH 3R0MA 5HTSA 3LJUX 1Q1PA 3QRGH 1B9KA 4OCMC 4WEEA 2BNRD 4LP8A 5I5IA 2XTJC 4AX3A 4KJPD 5AD0B 1IAIL 3C8KA 5C7XL 3L3OB 3D25A 4M7ZB 3ZVVA 3U2SA 1NGXB 3L4YA 3MV9B 3LS5H 2LAAA 3K91A 4N2NA 5AG8A 1JYNA 3G5XB 1BQSA 1BQUA 2GJ6A 4G80A 2DQIH 4HU2A 1QI4A 2IWEA 3UP6A 2GG1A 3KR3L 3MJ9H 4DH2A 4ZO8A 4WVFB 4WDIA 2DICA 4HDOA 4ODTH 7FABL 1BAKA 5JUEL 3X17A 2NUTA 1F4WL 2ZF8A 5SWSB 2UZIL 1FYHB 3SDDC 4N24A 1W0VA 3G5YA 3PL6B 5KBNC 1MAMH 3S3BB 4ENZA 3LEXA 1ET7A 1NIAA 5CEYA 1XCGA 1VCAA 3MFFA 2G3ZA 5AAWC 3WMPA 5C0CE 3M8OH 4HKZB 4PBDA 1K9TA 3UOAB 3GRWL 3VXUA 1QKZL 5GRXG 3QCTL 4JNXA 1H3TA 4JFDB 5J3HD 1AJ7H 4X7TA 4GOSA 3H9SE 2VDQL 3SGEI 1EFXA 5ENWB 4LCCA 2ZD0A 4A37A 4PH8A 3MLRL 3QQ3B 2BY1A 4LE8A 5FOBA 5LCVH 5HI5D 5D7EA 2EUXA 1EF1A 1LDPH 3UBXB 5B3NA 2I25N 3OB0H 5FFOA 1FE8H 4ZX4A 4OAWA 5I30H 1HVXA 3BD3A 3DX8B 4PJ7A 1XCTA 1Q9LA 3TBVB 4JE0A 3NWDA 1TCRB 3D0VA 5BRQA 3MA9L 5EBLB 4O51B 2F1BA 4FLSA 3SDCD 3STLA 3L3GB 2EEDA 4KHTL 3T3MB 2AJZB 4HBCH 3VD4A 3QPXH 3RDJA 2K7QA 5HE2A 3T8XB 1JZ8A 2PP9A 4PVLA 1IM9B 4GBXD 3I2CH 4L1BA 3RDTD 3CJJA 5E6IA 2WSPA 1KCRH 5HYSB 3GBML 3JWNG 1LNUA 3V8OA 3ZYZA 1ZSDA 4J4PD 3K5RA 2FYYA 3W81A 1DBML 3FFCB 2D0FA 4AUUA 1CF8L 3SYPA 4JZJA 5IVXF 5FUZH 2UUDH 1R3HB 5MHSD 4OKVA 2O6CA 4JFZH 4J5VA 3HC4H 5JLJB 1REIA 5E8NA 4GAJH 3F5RA 4MA7L 5MENA 1PFJA 3B2XA 1PG7X 1KV3A 3VQLA 4MA3A 3QWRD 2NBVA 3GM0A 2DTMH 4NYLA 2QSQA 4FNQA 1DHKA 3CXDL 4MDIB 4IU2A 5IEKB 2HLAB 3TCLA 1U8CA 1E65A 1ZVNA 2P8MB 2CY4A 1WWBX 4PJDF 5FYLE 3ODXA 1NLBL 4N26A 3GSNH 3V6OE 1Q0XH 4FA8A 3FJTA 4OUOA 3UO1L 5FKPA 3PIQB 5JQ6L 3CNKA 1E3FA 4Z7OE 4LCWB 3RVTC 1ZOXA 1CDCA 2JKIS 1J19A 4AK1A 3VXUE 2QPDB 1A4KA 3MV7B 3U6XA 3H56A 3SE8L 4CHJA 3NQKA 1I1AB 3B34A 5K9OB 3SKNA 5JNYB 4GG6A 2CNYA 2VTFA 1YEKL 2CO2A 4PLKC 1RPKA 5ADPL 1CC3A 1SDAB 1X5HA 3VVVA 4AW4A 5K9KB 1E5CA 4IRJD 4XTRD 2EDHA 2B39A 4HPOH 4JDVA 1ESOA 2ZXAA 3WKMH 4JG9A 5DUPH 4IBTA 3AADB 4RGOL 1LEKA 4MX7A 1MLCA 3TBWB 3J27A 4B7LA 3RGVC 1TZGL 2B4CC 5F72S 1JTPA 4L1HA 1DEDA 1SN2A 1AQ8A 4W81A 3BD4A 4H8SA 4JDTL 4LNRA 4PGBB 5D1QC 1ZXQA 4BK5A 1FLRH 3QBVB 3QUZA 3HE7D 2P3YA 4NHCL 1KTDB 4WCYL 4ESKA 3QG7H 5IVOA 1A6TA 3TIDB 3LN9A 1BZ7B 2R7EA 1EERB 3VRLE 1BMZA 3K2UL 3EJPA 5JNYA 4GG6B 2UY6A 4GIOA 2XDHA 1DLFH 2BIHA 2ZUUA 3CXBB 2BP0A 3RWDA 2QSTA 3BWUC 1NBYA 3A8QA 2HJLB 3AT0A 4TYZA 3HZKA 3P2DA 5CJOL 1MI5D 4OLWH 3JWOC 2ENPA 5C0DA 4LPWA 4NAMA 1IAOB 3A6BH 1CLCA 3QCVH 2HTLC 4ZTEA 3D39D 1MAKA 1BMWA 4X5PA 3HPJB 2Z9TA 3B43A 1BZQK 4I1NB 2GVYA 3OG4B 3OZ9H 2OXHA 4X42A 2VXQL 2IDCA 3U7WL 4OGQC 3TASA 5FPIA 5GS0L 1PEZA 5DJ0B 4MDIA 3BLBA 3JTTB 3D2UB 3SDDA 3MODL 5IFJA 4OH2A 3IU3B 1SY6A 5EULV 3O4OC 3T4AC 4UB0L 1KIQA 3VFTA 4D0CA 4GW5B 3BAYA 1MJUH 2DAVA 4R4NC 1ZHBA 2VLLA 4DZBB 2B1OA 4QXWA 5AAMC 1FNGA 2OKMA 3VW3H 1TQCB 1CGTA 3JT0A 5HXMA 1J0HA 1GGCL 2OQJB 2SEBB 2QPEB 4F1ZA 3RWCB 5E6ID 1BBJB 3EJCA 4QRTA 3RB5A 4DK5A 4Z3GA 2NDFA 4ZT1A 2D8KA 2YGNA 5C07E 5FHAL 3T1FA 1I7TA 2G2PA 4D0BA 4JGUA 4YFLF 5FYJD 1KJMB 3CBJB 4HAKA 5J6GB 5DZAA 3TWYA 1TEYA 3NCYS 3O8XD 3FS9A 3TS8A 1ONQB 1UC6A 1AO7E 5EPMA 4JB9H 3LB6D 1AGCA 3UTSA 5F2FA 5HI3D 1A6UL 1MRDL 3NGBC 1QSVA 2V3DA 2DLIA 4OI9A 3CZSA 4PJGF 3MV8E 3X3FH 2FLBT 5L88H 2UXTA 2XCMC 5GPRA 3HB3B 4R6UA 5JQ6H 1PVHA 1FL5A 2E0PA 2GQHA 4P9HH 5D1QD 1J8RA 4PR5B 5EU3A 1U8KA 3QDMB 3X2QB 3WEBA 2QFPA 3GSNL 4MJHA 4WW1A 1AOHA 1L9RA 3LZFH 1CICC 5AW2B 5J8OA 3GI9H 4BFOA 2JIXD 2A9NL 3Q9PA 2I32A 1A3QA 1MCJA 4X8GA 4NXKA 1MCLA 5JR1H 3C2AL 3DETC 2VE6A 4HAZB 1C8QA 3WEXA 4F33A 3KMDA 4F58L 1VEMA 4MA8H 5ESVA 3BO8A 1ZVHA 4PRHE 3KJ6L 3SUZA 1N59B 4LEXL 5DQ9B 2J5LC 3MCLH 5C08E 3MCLL 3ULVE 3BP4B 1KT2A 5GGTL 1H6FA 5BS0B 2OCFD 4PJAB 5AKVA 2X4SA 1FL5B 4NBXB 5JR1L 2OAAA 2VLME 1U93A 4HEMA 1Z5HA 4G59C 2PWGA 2WOBA 2ED8A 1BDYA 4OKVB 4EVNB 1P5VB 3MSPA 3X11B 5B3JF 4RAUA 1QAWA 4GS7C 5IM7A 3IAPA 3UZEA 1YECH 4FQQA 4D7BA 4XPAH 5A2FA 4CVZA 1WT5C 1DVFB 2QKIC 2CCVA 1I8IB 2X6BA 1S9XA 3EOYG 3TTSA 2GHWB 4DZBA 1MREH 5BVPH 3G5ZB 4XPTH 3TESA 1MRDH 3TP4A 3AU1B 2DFKA 3LEVH 4OLUH 1E3XA 4JPVH 2C9SA 3HI1A 2P5ED 1RZGB 1U4FA 4FABH 5HDRA 2EEXA 1V61A 3IJYA 4ZW6A 1PF3A 3DVGA 5C0FA 4HB2B 5LCVL 4Y9CA 1NPUA 2VQ1A 1DDVA 4NFDA 1IGTB 2GIYA 2ZX6A 4Q0XL 3KPSA 5KSVB 3UXFA 2QBWA 2VXTH 4HXAL 1V5UA 1O6VA 1MH5B 3D2TA 3ILPA 1M7UA 3QEQA 4OQ1A 4WGKA 3RILA 3VFGH 1EJOH 2WZ6A 2PN5A 2VUKA 4AKPA 4ZZFA 3HEIB 5TH2B 5J9PA 3U36B 1BREA 3EUUA 3H6AA 2D9ZA 3MODH 1NEZB 4ZYKB 4PJEB 3ARGB 4L3AA 1G7HB 4P5MB 1TVBB 2RALA 5CUSL 2ZOOA 4OCSH 1H10A 1HDMA 5CM1A 4QHPA 4HKXB 1J9CT 3D48R 3N1PC 3N85H 5FI1A 5SV3A 4KMTL 4JFPA 4PJ9B 2NXYB 1CR9H 2VKXA 5AOMA 3ZE0F 4FFWC 5DT1H 1HHKA 4DETA 2GS0A 1PW3A 1LD9B 4CNIB 5MEOB 3HE6D 2AV1B 4ICXA 1JDCA 3CSBA 4YK4C 1INQA 4NENB 3RUGB 5I1HL 5KG9A 3S2AA 2PP7A 3MLSL 5C86A 4RDQF 4JX0A 1EWHA 5IVXB 1UWXK 2QQKH 4NRZA 1PDKB 3CHXA 4UT7H 4BGLA 1GJIA 4L4VA