4DIXA

Crystal structure of the ig-ph domain of actin-binding protein scab1
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
212
structure length
212
Chain Sequence
LVYEIDGTEALGSCLRVRPCSNDAPDLSKCTIQWYRSSSDGSKKELISGATKSVYAPEPFDVGRVLHADIIYDGHSLSLSTVGKIDPAAGLGSYVEALVRKHDVDFNVVVTQMSGEDHTSESIHLFHVGKMRIKLCKGKTVIAKEYYSSAMQLCGVRGGGNAAAQALYWQAKKGVSFVIAFESERERNAAIMLARRFACDCNVTLAGPEDRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Plectin-related protein
publication title Plant actin-binding protein SCAB1 is dimeric actin cross-linker with atypical pleckstrin homology domain
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Protein binding
total genus 58
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16709 SCAB-Ig Ig domain of plant-specific actin-binding protein
A PF17684 SCAB-PH PH domain of plant-specific actin-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.140 Mainly Beta Roll PH-domain like PH-domain like 4dixA02
2.60.40.2700 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4dixA01
4DIXA
chains in the Genus database with same CATH superfamily
1KELH 2CIIB 3PNWA 4M6AA 1ZWIA 1FL3B 4JN2A 4O2CB 2DKSA 3KPOA 3ISRA 3KPLB 5TDNA 5K9KA 1NM9A 1UXSB 5IMKA 1WFIA 1KIQB 2YMOA 2ZKHL 4FNRA 2EDLA 4AT6A 1KYDA 5JHDD 2ATPA 4YWGH 4HZAA 3UPRB 3AC0A 1WP6A 3FQWA 4N5ED 2OSWA 5ICUA 4F8TA 2DYPD 2ZX5A 4WI0A 3NSDA 1E28A 1GZHC 1YEDA 3MOBH 4P06A 2BOLA 1F1DA 3QIWB 1V5PA 1BQHA 3S3SA 2C3WA 1UB5A 3QNZB 1K5WA 2Y25A 1J9RA 4PTUA 2HA1A 5I6LA 4YDJA 1CC3A 1QHOA 2CODA 1L6ZA 1MW2A 2NTFA 3C6EA 4C56A 5ISZE 5KYXB 5EC1A 1UA3A 4HS6B 4FAAB 2YD2A 4GKNB 2QKIA 4IBTA 5AL8A 1NFDF 3HE7D 2P43B 1TEGA 3CX5J 3OMZA 4JFVA 3T6XA 4F58H 1DP0A 4TQIA 1BVOA 2BIQA 3SKMA 4Q97A 4NZUL 5DRWA 3TJHC 2NUTA 4HV8B 5D4HA 3RDTB 1G7QB 1WK0A 4JDZB 1MCWW 5A2AA 5E2JA 4JM2F 4MA1C 4A6FB 2Q8AL 3KLHC 3BZFB 4YN3A 1I7UA 4WJ5A 4KKCD 2W0FB 5FWQA 2EJ1A 1BFOB 3OL2A 5E1AA 4BA0A 5C71A 1SQ2N 1U8OB 1X7SA 4PI0A 4TNWK 2B2XH 1GKEA 1JDAA 3EFFB 2NQDA 4HHVA 4NAJA 1UB6A 3SO3B 5A1AA 4JQXA 2R1WB 1VKXA 2EH7H 4PY8J 1TQWA 2LOXA 3OHXC 2WYZA 3MO1B 4JRYE 2RHEA 4RZCB 4NC0B 1E5WA 3EYUH 2HRPL 1XFPA 2VXTL 2ORBH 3VM7A 4A37A 4NFCA 3WNOA 3NABL 4EN3B 5B38A 4ZO6A 3G7TA 1Z9MA 2O61B 1Z5HA 1EJOH 2B08A 1UYWH 3D52A 4OLYL 4DAGL 3KGRA 3VI4E 1YEGL 2A4ZA 1XIWD 2EDKA 4H20H 4XC1L 3TXAA 5T3XD 4PJIA 4OT1L 1E42A 3MV9E 1OGTB 5CO1A 1D9KA 3CU7A 1XB8A 3V9FA 4IGBC 1S7WA 1RP8A 4QTHB 5E9DA 4MWFB 4QCIA 2DKPA 1XGPA 1YVLA 3GI8H 1CICA 3U0WL 5LCVA 3HCVB 2VLRE 1CYWA 2AI0H 2Z8WC 3H2PA 2WBKA 5FC9A 5E0QA 4JO2L 3ERXA 3G6DH 2MHAB 2CQVA 3V8OA 2BLFA 2P9RA 5EWIH 4ZMYA 2VKXA 2OW6A 2H0EA 4KY1L 2EVJA 2F53A 5IQMA 2BIOA 5TDOB 3T4AC 4G72B 3ZGIA 4CSSA 1BJ8A 1LMKA 4GO8A 1J5CA 4OKVA 2K2JA 5C09E 2XN9E 2CGRH 1G7LB 1NCUA 2RALA 3NCYP 2EE9A 2A6DB 5KVGE 4JR9H 4NQXA 3FS9A 3LJUX 4GW5A 3SCMA 2C9XA 3LRSA 3U46A 1BQSA 4IBYA 1E9PA 1J5HA 4JFDB 1B2WL 2BNRA 4U3SA 2Z65C 4L8DB 2QPEB 3BRFA 2J1WA 2OFQA 4PV9B 4OSNA 1HOCA 5LGJA 4UDUA 2G3NA 5BRZA 1YEIH 1ETZB 2CNYA 3JTSA 1U3HB 3HC3H 4JQIH 5KG9B 3GLDA 1T04B 1HHHB 1J9CT 2A5UA 4AKPA 4NUGL 4C56D 3IAPA 1AGBB 3L16A 4PJBE 1HVXA 1NCBH 2XFXA 5GGSB 1ITBB 1PDKB 3B7TA 3MOAL 1IGCL 3NWDA 2X4UA 3SQOL 3F58L 5IVZB 3CH1A 4MD5A 2N0MA 4NJ9H 4WW1B 2AXGB 2F9BT 3C5JA 1BPVA 1UD4A 3BGFC 4K2OA 2XDHA 3MXVL 3WIFB 3WS6C 2P7TB 3FL7A 1QFWI 4PRHE 5C0DA 2K00A 2X89A 4G2AA 4E41E 3K8KA 3T77B 3U2JA 3NJHA 3KL3A 2AK1H 3QS2A 4YL9A 2FRGP 2B4CL 1AHMA 1GZHA 3KE0A 4MA8H 2GEEA 3SD5A 4FCHA 1ZTXH 3PSCA 3LZLA 1NGPH 3EH5B 5HYFA 4NCC2 4XAWH 2JI1A 4PJ5B 3BWAA 4OLXL 4BXSV 1RIHH 1AMXA 3FUEA 4KKBC 1IQWL 1MJ8L 2UY7B 1NGXB 5CNHA 4IHOA 4EKJA 5JYMA 2VMEA 3BRDA 1J8SA 1DVFD 1JSYA 3H2QA 4U6HB 5C0RL 4ELMA 5JXEC 3U6RA 2D10A 2I9TA 1A7PL 2P5WA 3MJ8A 1AGEA 1E8XA 3IJSB 5IB5A 5E8EB 3CQQA 4PV8A 2DIBA 4E9YA 5JDSB 5FO9B 2AVFA 2CLRA 3BAJA 2QVMA 4NKIL 4JJ5A 1QWHA 1JPTH 2YWYA 4TVPD 3ROOB 2GKIA 1BWMA 3OVUB 1GCFA 4KRNA 4PJEA 2DQDH 2FYYB 1TZGH 2OK0H 4LLQB 1JGDB 2RQEA 2ERJB 3AROA 5EORH 2PWEA 2NY5L 3QORC 2APSA 2G75A 3IFOA 1C8PA 1JN6B 3K6OA 4AUUA 5DEJA 3QHFL 4YS4A 5BUPA 2C9SA 5A3ID 1QBBA 2ZUWA 3MJ9A 1F8TH 1FJ1B 4H8PA 1CICD 1P69B 1MFAL 5DHYA 1OV8A 4WSJA 2DOCA 4X6FA 4ZO9A 4JFZH 4DK3A 4N2BA 1T7WA 3RFZB 1EAQA 1A4KB 5L0QB 2IGFH 2ZCKL 4BFJA 3VSVA 2ZJSH 3LRGA 3M1OA 3C5SB 4OIAA 2F53D 1U8KB 3MBWA 4WNQB 3EH1A 3U0PA 2I7OA 3H0TA 1NPNA 1NCHA 3GRGA 4NRXA 5TF1H 1SYSA 1UM4H 1S78D 3CAFA 3LHPL 4KJPD 4XB7A 2LU7A 1OAKL 3V8CA 3GSRB 5AW1B 2Z13A 2BNRD 2C1OA 2XZAL 3CVHA 4IGBA 4PIRF 4XNZC 3WLWD 4KJYB 5B39A 3ZKXC 3LS5H 5BRZD 3IM1A 1T1ZB 1SXZA 4MT7A 2EEFA 4Q9BA 2MCMA 2X6AA 3EJPA 2DWDA 3L2MA 2J43A 2DX1A 2Y7MA 4YDKL 3ES6A 3CH8A 2JKRM 1A6AB 4FQCL 4DPRA 1BV8A 3ARUA 2HFEB 5KSBE 3T4AA 2WB1A 2YKLH 1GOHA 3P54A 3VFGL 3A67H 4PYGA 2H9GA 4BQ9A 1G1YA 3BN3B 4JL2A 3LRHA 1SVZA 2X89D 3FFCE 2IXQA 3GKWH 3RX8A 3LNFA 3HBQA 4BM7A 4V33A 4XWGL 1K8DA 3EYSH 2NNFA 4RMVA 5IVXF 2X2UA 1D7FA 3TF7C 4J6IA 4GAGH 4PRIE 3BVTA 1SEBA 4HF5H 4HATB 8FABA 2C9AA 4BZ1L 5GRYA 1ZLVH 1VACB 3EBHA 3GSWB 4UT6A 1MZYA 4L37A 2PYEE 1QLEH 5KVMC 1M1SA 1WQVT 2D3JA 4F7PB 3S7GA 2C5DC 5C9KA 1RAMA 4DGWC 2BHYA 2PCPA 3IU3A 2UZIL 3V6ZA 1U58B 1NM4A 1GJUA 1J0IA 2F74A 4U7KA 2I60H 2EEAA 2KLTA 2K6WA 2HVKA 1I8MB 2P5WD 4OF6A 5FV2A 3PWPB 5ADOH 4JY5H 5D7IA 1C1EH 2ALAA 3QYNA 3QNYB 2XU9A 3J7HA 3V4UL 3T3PB 2VXQL 3TBWB 5IUCA 4NZ8A 3BUTA 2GUOB 3WS6A 2NZIA 3TJHD 4K7PY 3UZQB 1YEEL 3CIQA 4OUOA 2ZWYA 2IV9A 5E1QA 3N5AA 5HHVL 1MLBA 1TSHA 3IDJB 3KLHD 4WCYL 2PPEA 1A6UL 1EMTL 2YKKA 3V0WH 4X6EB 5HD8D 5DHXB 3OV6A 5F7EL 1A5FL 2WCPA 4OCSH 5SWZA 2QEJA 4JUSA 2NRDA 1ZLWK 1MUJB 1UWEL 5JPMB 4DCQB 1IGFH 3IJHB 4M48H 3RWCB 3ZTNL 3AM8C 4L3CB 3IXTB 1ZRUA 5HI5C 4KQ4L 4PW3A 5DD6B 5CJOH 4Z9KB 5JXEA 3ZHLA 1GRWA 2FVNA 1YDPB 2UWEA 3VFOB 3RVXD 1QFUL 1JXJA 4MZRA 5IR1A 1BAWA 4CN6A 2XPYA 2AQTA 1RJYA 3RPIB 1YEJL 3WMQA 3LOWA 1GSMA 4HDIB 2BDNL 3LPOA 2QKSA 3HRZB 1IM9B 3RU8L 3QORA 1OAZL 4KJWC 5CLZA 4QRTA 2GBVA 4BRVA 4OCYL 1ONQB 1UACL 4PJXA 4IGBD 1QWNA 5CJQH 4LBEB 3ZY7A 2A99A 2DTML 4NENB 1UWYA 4YHOH 4IEFB 3KW8A 4W9LC 3EYVB 3RZCB 4HB0B 3S37H 3KHOA 4OGYH 2UXVA 4G5AA 4P7IA 3VFPB 4HWZA 3EFDH 1MXDA 5KJ4A 4ZMAT 3ULVF 1EUUA 5FA3A 3VXNB 2Q2LA 1UT1A 5B21A 3FUHA 5GSRA 4Y19B 2X4PB 2DN6A 4XTRD 5D70L 5EG6C 4Y9GA 2YD8A 3HNVL 3O8XC 4Z7UE 1E27A 1SYVA 1ITCA 3CMOH 1GZQB 3GJFA 3CFEB 5B1CA 4BV1A 3FTGA 1AO7A 1KJVA 2Y5QA 3ODXA 1QYGH 3NCJL 4M1DL 4PRPA 4UQ2B 1B4RA 3QB7C 5EO9B 2HVBA 2XZCL 1D7BA 1CXLA 1XF5A 2MCAA 3U6XA 4DGIH 1MCRA 1U8HB 2DMCA 4MMZA 3DX9B 2C7FA 3FQNA 5C0NC 2KBGA 1D5MB 3B9KD 1M71B 3M46A 4MLSA 4ZUTB 3VW3L 4MB5A 4IRSC 3UADA 2XFGB 3ZJAA 3NSJA 3WEXB 4D0DA 4OCRH 4F3FB 5I73C 4JFTA 2ENSA 1ZS8B 3C60C 1IBGH 1L3WA 43C9B 5C5BB 3ZT6A 2DRUA 4NQEE 2P0FA 2A9DA 5ESAB 3ULVL 4K3JL 2NW3B 5JOFB 2QQKL 1C12A 4QIRA 3STLB 3KY9A 3N44B 1GMEA 3RHWF 3BVNA 1K2DB 1BHGA 4UIKL 5HGHA 4F80A 1Q0YL 1XGRB 4H13C 4HJTA 1FGZA 4H8WL 3PLYA 4WDIA 3DUUA 2P5EA 5IJVB 4WFFE 4O02B 3NIDB 5FYLL 2VT0A 2YS5A 1N4XH 1IZKA 4FNQA 3POCA 4J7RA 5SWZD 5B3JE 3CU1A 3IJEB 1DDWA 4JY4B 4M8VA 1MCOH 1H0DA 3HG2A 4KKBD 1ADQA 5EU5B 1AIFB 1CD1B 3KCWA 1E5CA 1I8KA 4X9BA 1ZVSB 1I7RB 2J56A 1KG0A 4YE0A 2BFVH 3OR7A 4LAQL 4KZDH 5JXED 2PCXA 5FYKE 1H4RA 4JRFA 3BKYL 1VF5C 3QUML 1QACA 1XF4B 5K1NA 3WFHB 2NR6A 4ODUB 2CXGA 1RJCA 2IEPA 3CX2A 3TEZA 5F0JB 5D3WA 3HUJA 1NGZB 4JQIA 4RDQF 4XBEL 5HHNB 1IGML 2FJHB 2IMMA 1E3FA 1RHFA 3O2VL 4AQ1C 1WFUA 1RK0B 1L0PA 1AD0A 2FTAA 3QORD 4F7HA 5FUCC 3EGSB 3DX6B 3KW7A 2YARA 4J3SA 1F4YL 2JXMA 3RGVC 5KJRL 1JK8B 3X3FL 2F53E 5F1SA 5I8OH 2C1PB 1OALA 1BTNA 3MV11 4XVTH 5I9QC 1G4MA 3KDMB 2EEXA 3L6FB 4ZDHA 2VXVL 2OMUB 2XRAH 2ZXQA 1KOAA 4P57A 3UFIA 4FQLH 4HAZB 2WVSA 3G9WA 3SDXA 3W39B 4APQC 1CJYA 4GXUN 1MCQA 4N2HA 4GG6F 3D2UA 3DHPA 3CSYB 1PMSA 3OD3A 2VLME 4UT7L 4Y1AA 3FB5B 5T8IA 2YSSB 2FEDC 2X4TA 4PBVC 4XH2B 4G6ML 4N8VG 4G8EA 2UX6A 1EZLA 1URLA 2EP6A 2QQLH 3QRGL 1HEHC 1AO7D 4PRPD 4HKJB 3Q2CA 5EZOH 1CVSC 1INDL 3WMSA 1N2RA 2LLGA 4XP5L 3KPRB 4XNUL 3PGFH 2WLIA 3NRQA 2O6FA 4Y9FA 5EEUA 3VRJA 3NEOA 2D31B 3FUFA 4NP4L 5L4IA 1UASA 2OYLA 2CO6A 5CP3A 5GGQH 3TIDA 2DZEA 1DL7H 3MRLB 3QPXL 4PUBL 4OI8A 1XHHA 1R3IH 4EUPA 4P05A 1VENA 4ZTPH 5C1MB 1OOAA 1AY1L 1B4TA 3VXUB 4MD4A 1XSIA 2OMWA 2B0SH 4PB0H 4Y5VB 1DE4B 4PJGA 1G9ML 2UXTA 7FABL 1WFJA 3CD4A 4FXKB 3OJMB 5KVDL 3VD3A 1T2QH 4OZIB 2YK1L 3O8XA 4WGWB 5BVPL 1NIBA 2FJLA 4FFYL 3JV4B 4IJTA 3HR5A 4DVRL 4XPTH 4QF1B 3E2HB 2XG4B 2PNDA 4J3OG 4TULH 5E6ZA 4O2FB 2DMGA 3QIWC 4MBOA 5HJ3B 5HYQB 3IN0A 1SRDA 5L88L 4Z7WB 1UKTA 3L3HB 2BSRA 1YPZB 3RURA 1D2OA 2OTUA 2YLHA 2VDML 3BZ4B 3HC0A 2EYTB 3PV7A 3RX5A 5J57B 4BWTA 5DC9B 4KXAA 4NDMA 5KBPA 2C9UA 1NI2A 3V7AG 1SMAA 1KIRA 3HZVA 3PCYA 4IRSA 4JCMA 4YC2B 2YAMA 1CTMA 2NY6B 4AIZB 5EOTA 2DQEL 4OZHF 1Z0NA 4NLHA 4XBPA 3HAEG 2V9QA 5GS0L 4ZMZA 1LP9F 2N1TE 2DI7A 3D0VA 4RFNB 5F3FA 3AXHA 3HG0A 1OW0C 1PTZA 3RDTC 3FSZA 4JRLA 4Y5XB 2OMTB 2NR6D 3GM8A 4ZAKA 4AK1A 2Q7YB 2BVQB 4JHAL 4W68A 1TTCA 4H26B 5IB1B 1KN4L 3BAEH 3GS4A 1ZLSL 2DEWX 4BQBA 1WUZA 1OLLA 2R1XB 1KCWA 4P49A 4RAVB 3JT0A 5I66A 1DEEB 4DKDC 1PG7L 3A6CH 1DO6A 1L0QA 4UAOB 4WWKB 5BOPA 2VW7A 3IDMB 2CUMA 4DW2L 3PQYE 1Z32X 4CUCA 1MRCH 4JFFB 4MNQE 4N0CC 4ISVA 5JIHA 2YFNA 3TBTA 2E75C 2A77H 1OGAA 1OY2A 3EGDB 1DQVA 3TCLA 1KGCE 1WVZA 3ZKSD 5DD3L 5CEZE 1KPRB 2AERT 5HI5D 4R4FH 1BQLL 3WO4B 2PO6C 1HJCA 3D2UD 1AQKH 4P3CH 3JVFC 4Y1AD 4P2RA 1U8QB 1OD9A 4GBXB 3CZSA 5L8LB 5MP6H 1QEXA 3DV4A 1U8IB 4NKMB 1GYWA 1BWNA 4Q56A 3LPGA 4JM4H 4RNRB 4IOYX 3K5RA 3QUKB 4NI3A 4Z7VB 4AQ1A 4ACTA 3G6JB 3MXWH 2ZX7A 4FOMA 4Y4KB 5GQBA 4KJWD 4RIRB 4ELDA 4JDVB 3GDCA 3RGVA 4PG9A 2VAJA 3I6LD 3D2TA 4O00A 1F02I 5JA9A 2CKNA 3LZPA 5DVPA 4ECNA 1JF1A 3MPCA 3L48A 1XL4A 2FWOA 4YX2L 5INCA 2XQYK 2X70B 1MREL 5FO8A 1LJMA 3MV7A 1BXVA 2QZQA 3FTUA 3UIYA 1IE5A 4APQA 4PP2B 2DH3A 5E6RB 1NFDB 3H55A 5D9SB 1RUML 1WBXB 4QJ5B 2X4SA 1Q4NX 4XVJH 4YFEA 3E6HB 3QR1A 3O8XD 2W9LA 4LARH 4RAUA 4YDZA 2ADYA 2EUVA 3S98A 2AQSA 3L5WB 2V5RA 3KBEA 2AQ2A 3DKHA 5C0GA 1MFMA 3DVGA 1AFVL 1BZ7A 4OQTH 5DO2C 1QLRA 5DJ2A 4FP8H 1CLZH 5DDHA 3U1SH 1GGYA 4HCFA 2VSKB 4PS3A 4FFWC 2I25N 2EDBA 4N2OA 4EIBA 2NYYC 2IMNA 3CLWA 5DJXA 5KSAB 3OANA 1RK1B 4JKPH 1UCTA 1ZT7B 3FRPB 2OCJA 1M7UA 3F12A 3EIFA 3P4MB 3R18A 4F20A 1AH1A 3CSPA 3H54A 2V17H 3G5YB 4MAUH 4RMUA 2CIIA 2EDTA 1KBVA 4GQ9L 1FL3A 3PUUA 4O2CA 5IK3B 2A9AA 2AKRB 5JZ7D 3F04A 5I8CB 3AACA 1MW1A 3KCPB 4AUJA 5IW6B 1KIQA 4R7DB 1H8LA 4HBCL 4HSAC 3B4NA 1TT6A 2ZPKL 1G7IB 4KKNA 4HPOH 4ZAKD 3UPRA 1IC7H 3KJ6L 4AGOA 1G43A 3CV5A 4G7SB 4Q9CA 4DESA 1T03H 1CDCA 3GWJA 2FHBA 1QBLH 3T8XB 1P5TA 3QIWA 3R7RA 1ZM0A 1XR8B 4NX0A 5EB9A 5IMOB 4AGMA 3LAFA 2VB5A 3ML4A 4TTGA 3QNZA 1P84J 5H37H 3P0YL 1KYUA 2C9QA 3WUWB 2CBQA 3QIBC 4GH7B 5KYXA 4HS6A 3MRCB 4A2LA 4CDHA 1OGAD 4XN1A 4GKNA 1H3GA 4HUMB 1FE8H 1CDBA 5KTEH 4XVSH 3B9EA 4KH9A 4PBWD 1CFQB 1X5ZA 4HV8A 5CJBA 1MIXA 1HHKB 3QCTH 3RDTA 1G7QA 4P2RD 1LE5B 2WYHA 4JDZA 5AOJA 1JGUH 4A6FA 12E8H 2CLZB 1OCWL 2ERJC 3BZFA 1JP5A 3GXMA 4QXVA 3UTSE 5A2FA 4PWKA 5FOBB 1AYOA 2W0FA 3K4AA 4HDQA 5I2IB 1GC7A 2X18A 1Q1JH 4KMLB 1BFOA 3X14B 1OIOA 3SE6A 1U8OA 3P3SA 5FW6A 1Y6MR 3ABMB 5EEVA 3EFFA 3RGVD 2WXGA 1KTKE 2R1WA 3SHSA 2HT4C 1SY6L 3MO1A 4ZW5A 5DF0A 4RZCA 1FAKT 3EJYC 1Z87A 1M9SA 2LABA 1BEYL 5DZVA 3ZK0A 2P49B 4AQOA 4HQQH 4AY0A 3MV7D 2ZNWA 1OM3H 1UC6A 5MEQB 3V52H 4APQD 4A2FA 4EN3A 1LO4H 4I2XA 4E9VA 1DTUA 1QZ1A 1Z9NA 2OR7A 4OCXH 3INUL 3L1OH 3V6FB 4PY7B 4WEUD 3GHEL 2GJRA 1R75A 4G8FB 3EHBB 1T89A 2VMDA 4E0RB 2LKOA 1ETA1 1NIAA 4OUUB 3UTTE 4PV1C 5JIPA 5JXAL 1FL5B 3K7UA 4TQ8A 4QTHA 2BW4A 1CLOH 2W60B 1ISNA 4MWFA 4A39A 5L2JB 2K8EA 4PBXA 5FV1L 2MJWA 4JDTH 4QXAB 3JWDH 2OR9H 1MY7A 1U27A 3HCVA 35C8H 1SLVA 2X1PA 3RYMA 2QMJA 3DBXB 2HTLC 2YPLE 2WV3A 5CLTA 5HHOE 1JF6A 2MHAA 2XQBH 2I7SA 2AXFB 1FNFA 2WKLA 4M5ZH 1CFMA 5DK0B 3UROR 5TDOA 2P8VA 2AJZB 4O02H 1OP3K 1F4HA 3DGCR 4XPAH 5B1AB 2CALA 3TA3C 1PLAA 2HRHA 2Z31B 1G7LA 2CDGB 3MHZA 2AV7B 4XXWC 1L7TL 3QHZH 1TZHB 4N8CL 2A6DA 1TQTA 1IGIL 3QI9B 3O6ML 2XLLA 4HUWB 3GLAA 3I9GH 2B20A 4JFDA 2QVIA 3WFEH 4YDLB 4FS0A 4L8DA 4OD1L 1JZ7A 3QIWD 1D5ZB 3KRWA 1QSEE 4PV9A 5CCHE 3SOTA 3L1GA 4XVOA 3ZE2E 4U7SA 1RUKL 2M38A 1ETZA 2BOBA 2ICCA 4OIIL 1U3HA 3F7RA 3HC4H 3Q2LA 3C09B 5KG9A 1T04A 2CO7B 3AAZA 3UBXB 1CMOA 2F08A 2O6DA 1M7IB 1AGBA 3H56A 5GGSA 3RQ3A 4JFHD 4KZ0A 1LQSR 4KX8A 4DKAA 1PDKA 3S88L 5DMKB 4HHWA 1JGIA 4UNTA 4UB0H 5IVZA 4WW1A 4WUUB 1R0AH 1IJNA 5FEBA 2AXGA 4I7ZC 1QQGA 4XXCC 1NOFA 1W8OA 4OM0L 3JWNG 4FZ8H 3WIFA 2P7TA 1HS6A 3FF8A 3QE5A 3OPUA 1ZEAH 3RDTD 1FFPB 2A1WL 1KCVH 1YECL 3DVFA 3O0LA 2R29H 2ZAIA 5EIIG 3T77A 2CAKA 5FF6B 5FGRA 1CF1A 1FNAA 5I75C 3VQ1C 2ZXEB 2K8MA 1QFOA 2FT8A 1N19A 3GBNH 3OZ9H 2B59B 5A2IH 1QTPA 4M6ML 3L3OB 4PJ5A 4ZFOL 4CVZB 2CSPA 1EHKB 4Y1AE 4P99A 4N0CD 5ID1B 5JPMC 2UY7A 1NGXA 5EN3A 4P5TB 2X4NB 3AGVA 2OW7A 5SWQA 1LO3L 5BMFH 4M93B 4U6HA 3QRFM 5CJ5A 4YGVA 1FV1B 3IJSA 3ZO0A 5E8EA 4NS0A 4EN3D 5D93B 5JDSA 2GSGB 3CZUB 5FO9A 3WD5L 5LN8A 5SX4I 4K3EH 3QJFA 4K71B 1YJDH 3ROOA 2E9JA 1OF2B 2YMTA 3I6LE 5AZ2H 3MRPB 4DGYH 1SLWA 1M57B 2FYYA 4Q14A 1MJ7L 3F6LA 5JW5A 1JGDA 1ND0B 3HRZC 2NPLX 3VGEA 1RJZB 4YOKA 1Z2KA 3LH8A 1JN6A 5GJSH 5EU3B 3OLIA 3DIVA 4XNQB 5IVXB 2IO5A 5IB3B 2HKFH 3NZ8B 1FJ1A 2F2HA 1FGNL 1P7KB 3DXCA 5IJKA 5A43C 3LKQB 2XX1A 4IW4C 5DVKA 4F9PC 2AEPL 2WLKA 1A4KA 1MH5B 4K7FB 5J13B 1CLYL 3C5SA 1U8KA 2DQHL 4WNQA 1CR9H 1DFXA 1P4BH 5BO0D 1JZ3A 1MKFA 3D50A 4TRPL 3ULUF 1SPDA 4PEEA 1ZMYA 1FRGH 1EH9A 3SKJH 3W2DL 5IESH 4KNUA 1KC5H 2KUPA 5EOQL 2W2XC 3MA7B 3PP3H 2YOAA 3GSRA 4PWEA 4JFDD 5KQ4A 3DHMA 4S0HA 1XGYH 4FD0A 5DO2D 2QPFA 2YA2A 1WDAA 2BK8A 4KJYA 3WKMH 5GZNA 5DHDA 1PX8A 1CUOA 4GW4B 1BZOA 3P73B 4TN9A 4FFWD 2P28B 1U3HD 3N7CA 1PD6A 2NYYD 3EDEA 3IS0X 3DRTB 3ESNA 1FNEA 1ZV5A 3WENA 1A6AA 1RVFL 3AT0A 4RRPG 2IPUK 3DURB 2FBRA 2BY0A 1QI3A 2HFEA 2Y72A 3OX8B 1EHLH 4LKXB 4N6QA 5F9AC 3R8QA 4GXUM 5FYKU 2LOEA 4XP4H 3JWDC 1I8AA 1KYOJ 1YY8B 4DP2X 5I6OA 3L95B 4IDJH 4XXWA 4S1DC 2X0UA 2HJLA 1J12A 5EZLA 3WEMA 4ZBJA 3DMMC 5D2LF 5FYKH 2PP7A 3TP4A 4S2SB 5KEZA 3CK0L 3VXSE 1UGNA 5FO2A 1NC4B 3UG5A 4F8QA 2A9BA 1VACA 3GSWA 3PHOB 2HG0A 1D5IL 4PJ5D 2JCWA 2PW1B 3N9GL 5KVEE 1USZA 4P2RE 2XT1B 2ZTBA 4F7PA 1I3GL 4AV4A 3PPSA 1U58A 2WQ8A 5K9JL 4X8JB 1TETL 1I8MA 5I74C 3PWPA 2RUKB 3W5NA 5EF3A 5I6XC 3QNYA 1MCWM 4XXCA 1KN2L 3TBWA 1FZJB 1JZDC 2GUOA 3IMWA 3AQZA 1ROWA 5A2CA 4PGJA 2YGPA 1CZ8H 1TJXA 4MQTB 3UZQA 3SDYL 3FO1B 1KJ2L 2FR4B 3IDJA 1GPOL 3PGDB 3S35X 4K8RL 2A4EA 5C0BB 3KZ8A 2AJYH 3BAIA 5IW1B 3W82A 5AUMB 4X6EA 1U8PB 4L5FH 5IQOA 4OGQC 5E9AA 2JJUA 1MUJA 3NK3A 5JPMA 3SE8H 4DCQA 3IJHA 4HAXB 3RWCA 2HT4D 4L3CA 1YC7A 1BREA 3EJYD 5DD6A 2YJQA 3PVWA 5L8JB 3UZEA 1YDPA 3VFOA 1VFOA 2JLPA 3BP6B 1NDMB 4OLWH 3WY3A 4YSCA 4DXAB 3WMPA 3WSQH 4MY6A 5H37A 2MFNA 5CKAA 4FABH 2WXHA 3EH4B 4HDIA 4WHDA 5FHBH 5L7XL 2WXFA 3HRZA 3BESR 5DD5L 2AS5M 1IM9A 1LLAA 1F58L 3WHE0 2YA0A 2F7IA 5MHSE 4OTXL 1UD6A 4LBEA 3ARGB 2EYRB 4JFSA 5GZND 5LBSH 4NENA 2YBGA 2FDBP 1FFQA 1YJDC 1BP3B 2Z34A 4IEFA 2FLBT 2UUDK 3EYVA 4ZTOH 3VFPA 4CADB 3RZCA 2YPVH 4EBQL 4ZFGL 1EV2E 2HTLD 2VR8A 4Y5VC 3VXNA 4EEEA 2DFKA 3KYOB 2X4PA 4FXKC 2W9DL 1P5VB 2VDRB 3QG7L 2X44D 1GZQA 2J59M 4GMXB 2FEEI 3W0WE 4LLMA 4B53A 1MFVA 3EYFB 5I18H 1KENL 1F11B 4NBYB 2CPCA 2NW2B 4UQ2A 5DQDL 3E2HC 1KACB 2CXKA 1D7CA 3MJGX 4NHUB 5EO9A 4WTZG 4IRZL 4BKSC 5CJXC 5ANHA 1K5NB 4GQQA 5FGCE 4HD5A 4Y89A 2NY1B 2ZKWA 1CS6A 1U8HA 4KUCF 3DX9A 3PXLA 5TPWL 3ZQXA 1DDHB 4YDIH 2VMCA 4NBZB 3T6ZA 5D2NB 5CILH 2BOCB 1D5MA 5AYTA 2QGBA 3IVKB 1CFNB 5J1AB 3QPKA 4PRNB 4ZUTA 2KPNA 4YC2C 3WEXA 2NY6C 3KRXA 4FTVB 4N0YL 3N42F 4ZW8A 1ZS8A 4EOWL 1WGVA 1MWAB 1ACZA 4RFNC 3VTAA 3PWPD 4NERA 3OKOB 5AAWC 4HAGA 5C5BA 3MNZB 4G3YH 4Y5XC 3ZE0E 2ZYSA 1FN4B 1A6TB 4U6TA 5ESAA 4GG6B 4WKZB 4X0KA 2QVKA 2NW3A 4GMTL 5JOFA 1OTSD 4DEPB 2ZOLA 3RKDC 5CEZH 3STLA 2HVJB 1FIGH 4HGKC 5FFOA 2OSLB 5FYJU 2MIZA 4G7YL 2XVKA 1K2DA 4WWKC 4G43B 4K7PX 2OQBA 1XGRA 2DL2A 3NFPB 5AVXB 3D06A 4A5KA 2BP0B 5IJVA 4O02A 4O2EA 3CXBB 2PR4H 5FYJH 3WNNA 4R90L 2VLKB 2R2HA 3IJEA 4NOFA 4JY4A 4X5PA 2E9WA 4GP4B 1MPHA 3MPXA 5EU5A 5F96L 3LQZB 2DQMA 1AIFA 5AENA 2L04A 4GOSA 1CD1A 3OHMB 1OCCB 3K6NA 4WRLA 1PLGH 1ZVSA 3OGOE 3SBRA 5KS9B 1SLUA 3HS8A 3WO4C 1X5XA 2FO8A 1VZGA 2O5YL 4XP6H 3UG4A 3NESA 1V5MA 4HSIA 4MD0B 2DQ6A 3V4PH 1S7TA 2ADFL 2BS8A 3FHQA 1XF4A 4RA3A 4ODUA 2FX8H 4IHBA 1W1DA 3TNMB 1WAEA 4YXKL 1NGZA 2G4EA 5HHNA 3DPDA 3QJOA 2FJHA 3TU6A 3FTSA 1ZS2A 4FQQB 1IM9D 1RK0A 4F57H 5ITBH 3ETTA 1P2CB 1Y6NR 1TENA 3PHSA 3VI3B 2P5PA 1AG0A 3DX6A 3EGSA 3SB3A 4ZW3A 1JGLH 1JK8A 2FX9H 2YQBA 2YGQA 2F19L 1K85A 4HIJB 2C1PA 1FB8A 4OJAA 5DUPH 3KDMA 1MW3A 2GW5A 4C8XA 3L6FA 3UZVB 3RZCD 3LKRB 4BGDA 3ZMEA 1A0QH 2OMUA 5C7XL 4AEIL 3PAYA 3F00A 5C0JB 2PMZA 2JP2A 3NEEA 3W39A 1WAPA 2DJSA 2VDKB 1IFHH 4W6WB 4Y19D 2VM4A 2MQ3A 3CSYA 4QTIL 3VGFA 5HYJB 2WXLA 3FB5A 4L8CB 2YSSA 4OZHB 4XH2A 1JFQL 4IJ3C 2CRYA 3JTTB 2UVMA 1O7DC 3WXVL 4HKJA 2X38A 4JM0A 3RI5F 5AVTB 1BD2E 3N1QC 2WZ6A 1P7HL 3QYCA 1MFDL 2W2XD 3E8UH 2F5BL 1TJHH 2J12B 2VW4A 3KPRA 1XSOA 4BWUA 4X80H 2D31A 5HDQH 4X6CF 1G7HB 1P4UA 3I3BA 2L7QA 2B3RA 5KSAC 3MRLA 1N64H 1FLTX 4DPCX 4KZEH 3QEGL 3CN4A 3NACL 4C4KO 1WITA 3UYOD 1UOLA 5I5RA 3VXUA 2LU4A 1WZMA 2VH5H 4Y5VA 1BJMA 1DE4A 1DROA 4LP4A 1U8LB 5D8JL 1FAIH 3D09A 3NCXA 4H1LG 1WLHA 4FXKA 1QTSA 5DCCA 3X1BA 4OZIA 4QRQB 2PZ1A 1Q0XH 2ZOOA 3QUYC 3SDAC 4FFZH 4HS8L 3K2KA 4Z78B 2AGJL 3LH2H 3JV4A 5F1NB 2XWXA 2VDQL 3MRQA 5A2KH 4S1DD 4QF1A 5E8PB 2QR0B 2XG4A 2ED7A 4O2FA 4MNHB 5CJXA 5HJ3A 3X1FA 2KQNA 5LG6A 3CHQA 1IILE 1JHLH 1G7PB 3L3HA 4Z7WA 2VOTA 1YPZA 1E5ZA 4BQ8A 4PB9L 3BZ4A 2EYTA 4S11A 5SV3A 3KWTA 2DQJH 4BZ2L 5T5NG 4W9FC 1CFSB 4ONHB 3ZO9A 1MCPH 1KTLB 1FDLL 5HYSA 4M7JH 2Y6SC 4OJFH 1ECZA 4AIZA 1J1PL 2A6KB 2RH0A 1ZLEA 2FT6A 3VVWA 3BVXA 4U6YB 3LS4L 5AAWA 2AV1B 2BVUA 2AVGA 1TQVA 2OMTA 4LHUG 3GSVB 4Y5XA 3TNNB 1QVOB 4Y5YB 2GB2A 2Q7YA 1PL3A 1XXFC 2BVQA 3PL6B 5EU6A 3NH7L 4H26A 4JHWH 5IB1A 3GO1L 1RPKA 3GIVB 4HJIA 2D2OA 2R1XA 5IMLB 4RAVA 5I15L 1DEEA 2P3YA 4WWKA 3QEUB 3IDMA 2N3JA 5IHUH 4ZTEA 4OLZH 3V2AR 2FATH 1NUDA 2AABH 4G8GB 1U5EA 2WBXA 4J8QA 1TIUA 1UPQA 1SOXA 2C3VB 1RQ5A 5E6YA 4XPGL 2R0LL 1OAXL 3I3EA 2DN7A 2XVGA 1OHZA 1X5YA 3EGDA 3ARQA 1CL7L 2XWBB 3TASA 3Q1EA 4G1EB 2OULB 1KPRA 2VSMB 5M4YB 2KUTA 4H88L 4N25A 3X12B 4E5XB 3QR0A 4NWTH 4YXLL 3SV1A 2GBTA 5FX3A 3D5OF 4CMHB 4HWBL 2LULA 2MKRA 5HI3D 4FQ2H 4GBXA 3VGAB 1MCJA 2BC4B 2ZCHH 3EHBC 1FCGA 4JRXE 3T0WA 3BWZA 3MLSL 2DMHA 2Z0UA 1TZ8A 4NKMA 4YK4B 2G5RA 2VRQA 1A14H 4CU7A 4F1ZA 1JZJA 4Z7VA 3QUKA 1V55B 3FTVA 3G6JA 3KPRD 3QNXB 4Y4KA 3NDZE 5GHWH 4RIRA 3WYFB 1NMBL 5A2LH 3VD5A 4G6KL 4JDVA 4JFPB 3KDPB 5B3NA 3L13A 4MZIA 1P7BA 4WGVB 3V0EA 3BWUF 4MJHA 4MRCA 4U0RB 5FLUA 2X70A 3VXUD 1QR4A 2DJ4A 1AKJB 4LQFL 2AZUA 4BFNA 3BIKB 2AQRA 3KPSB 4W6XB 3HNTL 3P40A 4PP2A 1GCYA 1NFDA 5D9SA 5KQ1A 1WBXA 2Z31C 2EDDA 2DHJA 1ZDQA 4PJHB 3E6HA 4F9LA 2CJ3A 1KCSH 3CTTA 4WUKH 3L5WA 2ROVA 2P8LB 4UUJA 4ZSOE 3CJJA 4OSUL 3FAWA 4YDLC 1CD8A 2Y36H 1J9QA 2VISB 2BSEA 1HYRC 3HG1A 3R06B 3TM6A 2LW3A 2QBWA 3UTZA 1ZK5A 4A6KA 1QSFB 3AMLA 4G5ZL 4GRMB 4M7LH 5KSAA 3C09C 3QR2A 4QOKE 1RK1A 5J5EA 1ZT7A 3FRPA 4KV5F 3P4MA 2VC2B 3NAAL 4IKJA 2CCVA 3G5YA 1AJ7L 4ZI8A 1RXLA 4GSXA 3MRBB 2A9MH 3LTVA 4ANWA 2KMWA 2NY6D 4YZWA 2YN5A 5IK3A 4X50A 1MAJA 2AKRA 4CVXB 1AS7A 2CBPA 3DIFA 3KCPA 5I8CA 2E8ZA 1A22B 1IE4A 5IW6A 4R7DA 3SYXA 4NM8H 1J5IA 1O7VA 4JKWA 1KPVB 3QWNA 3QUYA 1G7IA 3L9EA 1S9XB 3GINA 5CIPB 5DJZA 3ASWA 5C0IA 3SKNB 2WZ5A 4UV4L 5D3VA 5DD1L 4AIXA 1HEJC 3RKDD 1CB4A 1EEUA 3RY5A 3T8XA 4BFFA 1XR8A 4WWKD 1R19A 2EH8L 1BJ1J 3ATDA 6TAAA 1RURL 3GD1C 3L3OC 4LPCA 4GRWE 3VD4A 2Z64C 3WUWA 1B0RB 2WXOA 4WJG3 5FA4B 4R4NC 3MRCA 3TT3L 2GUYA 1R3HB 4OVUA 3N43F 4N2KA 2IBZY 5D93C 1EERB 3D34A 2X9YA 2BWQA 1MNUH 4K71C 4RGNE 1CFQA 2YAPA 1MDTA 3O41B 5DHMC 1HHKA 2FJSA 2C34A 2G2NA 5FUOH 1RMFL 4U1JB 1F56A 4G7RB 3T2PA 1LE5A 4GBXD 1JWUB 2CLZA 1XSKA 3BP5B 1GGBH 2VXUL 1HINL 2WVTA 5FOBA 5IBUG 1E0OB 4NKQB 5BUGA 3D05A 1BQHG 4Z7QF 5I2IA 2L4OA 5LG4B 3X14A 3BZ5A 4KU1A 4XAKE 1NWOA 3VXTB 4Y4KD 4LASH 4MCZB 3F0WA 1NEZA 3BZDA 4OV6F 4UT9L 4R3SB 4WWID 4Y19E 4ANVA 1R47A 1MAKA 1FZKB 2EE2A 1R46A 4LB8A 1PKQB 3NJIA 4G7VH 1V3LA 3GMNA 1YC8A 4LVNB 5FKPB 6PCYA 3CXDH 5KW9H 4PRDB 2I1KA 4DGVL 3B9AA 1CFVL 1UWGL 5MEQA 2CRIA 5T1MB 2E6PA 3JBG7 5DMGC 4PYHA 4NJAH 2DDQL 5IHZB 1DUYB 4KAXB 1IC4L 2WAHA 2ZXDA 4PY7A 3V6FA 1L6XA 4PLOB 1SXCA 1U36A 2QFPA 5FFGA 2XYBA 4XPFH 5L2KB 4OUUA 1P1ZB 1JOIA 3EXLA 4CVUA 4AMKH 2FJFB 1FL5A 3WA0A 4XZUB 5F88B 4JRWA 2BSED 5E94B 5L2JA 2W60A 3D85B 3HTLX 2XQ0A 3FULA 4UOQA 3GBDA 4AYSA 5SWSB 5D71L 3WNLA 2E59A 3A47A 1OE1A 2IGLA 5KSAD 3DBXA 4GEJA 2ZONA 4XXDB 3BPLC 2BWDA 3BN9C 3BLKA 4O51B 5B38G 1WT5C 2EDQA 2AXFA 3N85L 1DSFH 5DK0A 2JJWA 5ALCL 1WD9A 1BF5A 2AJZA 4HP5A 5E5RB 3V4VH 4B9GA 2L7UA 3NCCB 2Z31A 3P4OB 1OAQH 2CDGA 4EZLA 2AV7A 1U5FA 2V2XB 3FC8A 3REVB 1TZHA 2R0ZH 1VCAA 3HBPA 3QUYD 3HMXH 2FYVA 2ADIB 1M05B 3PVLA 4HUWA 4XN7A 2JK5B 1KJMB 2KI6A 4AK2A 3VX1A 1TU2B 5J1SC 4GO6B 2WCGA 3V4LA 5K33A 1A6ZA 3WDJA 1P6WA 1D5ZA 1CTOA 2HT2C 3P7ZA 2XV2A 2CG9X 2NY4B 3BFOA 3SGJC 5I0XA 3OB8A 2CO7A 1AQCA 1KPUB 5T1DL 4JHVA 1M7IA 3ZL4H 2BNUB 4GQZA 3P6AA 5DJDB 3QO0B 5D7EA 5DMKA 2K49A 3FQUB 2H32B 1WA1X 2Y6SD 3PNRB 4WUUA 1J0YA 5D7LE 4XP1H 2HZHA 3PWUB 1FGVH 1HU8A 3DOSB 5JMOC 5EPMB 1SMOA 3LMJH 2ELAA 1W15A 1FFPA 4K94C 4U05A 5ABAA 1VIWA 3DOHA 4FQXB 3CVCA 4HT1L 1HE7A 1D7DA 4R83A 4PN6A 5FF6A 1G6VK 3KZ1A 2W2WA 1KXQA 1UUNA 1AQMA 2B59A 2V9RA 2EXYC 5EOCL 2R27A 1BBDL 3FF7A 3HZYB 1T7YA 3DHJA 3L3OA 3ZRSA 4CVZA 4O4YH 5ID1A 5F7FA 3HVDA 4FFZA 2UX7A 4P5TA 4P4KB 2X4NA 3NEXA 1KGWA 1SN2A 1L4IA 2BSBA 5EBLB 4OFDA 4IM8A 3FN0H 1FV1A 2FGWH 3B8YA 2RLOA 4EQ3A 5AFAA 4JVWA 2GSGA 4QRFA 3RKPA 1CLVA 1T4WA 3WIIL 1OF2A 4KJQD 4LRNL 5C2BH 4DPBX 3MRPA 2B1HH 5FYJD 2XA8H 2OJEB 2YGOA 3EHBD 1ND0A 1S5HB 3ARDC 4YPGB 1KB5L 2N23A 1RJZA 2ZZUT 1WTGT 3EDJA 1KEML 3WJJC 4B9JA 3F7PC 1UT2A 4AJWA 5D2LB 4XNQA 4NN7B 1NICA 1UWFA 4ZW6A 1U8NA 5IB3A 1J19A 2GHWB 3NZ8A 1XF3B 4M43L 4C47A 1P7KA 5EFXA 4KAQL 3V0VB 4GOUA 2K6YA 3LKQA 1U93B 3IFPB 3O3EB 4FDWA 2JB5H 4UZSA 3PXHA 4CL7A 4M3HA 5TK4A 1MH5A 4QXUL 5FPIA 3EOTL 4OZGF 4LMQI 5GISL 2DQIH 2GFBB 2OX5B 3CZNA 1R24B 1DJHA 4Z7WE 3OC5A 3FHEA 4HHAB 5MERB 3T0EB 4UANA 5D5MF 1KB3A 2Z31D 2R8SL 4OAWB 5AWNL 3KG5A 4ZMXA 3SKUD 2EC9T 5AVQB 1QASA 3QI9D 3A6BH 4MKMA 3FB6B 3EYOB 3HKZA 1I9RH 1JZ5A 3GIZH 4GUCA 2NY1C 1MDAA 2NZ8B 1QO3A 1QNZH 3GRWA 5DTFA 3WY4A 1TTRA 4ONFL 3P69A 5D2NC 2EINB 1JNNH 3PJLA 4A7GA 4GW4A 3P73A 4NY0A 2IH1B 4HMCA 4RX4A 5DZNA 1WBZB 3MCKB 1M7XA 3NPZB 2WXRA 4ZFFB 5BZWB 2V7NB 3DRTA 1G7MB 2MCPH 3CVDA 3OAUL 4QR7A 1I4FB 1WT5A 3CPLB 3THMH 3DURA 4TYUA 3IPEA 3HVNA 4WUUD 3OX8A 1IQDB 3IGUA 4LKXA 4GKZB 4MXQD 3BSHA 4KXCA 4YUEL 2X88A 4JFFE 1YY8A 4YHPB 4CC1A 3L95A 3BQUB 3LXUX 3K8LA 4YFDB 1CXKA 1UH3A 3BH9B 3O6LL 3H85A 4S2SA 2BSSB 5HE2A 1BJ1H 1ROCA 4ATTA 2VL4A 4U3XA 1NC4A 5I16B 3OJDB 3PHOA 1U29A 2NBVA 1Z1WA 3M8OH 3NTCL 3ZYOA 2K4WA 1QAWA 3ZKMD 5J9PB 1H15B 4IRJB 2UVEA 3VFVB 1V3MA 1YYML 3SGJA 2CLVB 3DJTA 4KVCH 3T3MF 2X09A 4K9EH 4P5TD 3O2DL 4FI6A 4R4ND 1OT1A 4LEOB 4X8JA 4FG6C 4MJIE 3VXOB 1JYNA 1SXSA 3EXJA 1LEIB 2AANA 2NCEA 3EYQC 3FT0A 2WO3B 2K4AA 1FZJA 1Q9OA 3Q05A 2Y24A 3ARTA 2R7EB 4S1SL 3FTWA 3FO1A 1M6UA 3FCTB 2D7MA 3C2AL 3PGDA 2BPBA 1FNHA 5BRPA 5C0BA 3RWDB 4PS8A 5SX4H 3ENEA 2BVEA 5IW1A 5AUMA 5EF0A 5TJWK 4PJ7F 4LCCB 5JW3H 1H8NA 1A7NL 1U8PA 2G2RB 5I8KL 2ZWNA 2JJTA 3Q43A 2GY7B 1RIVL 4M00A 1FL6B 3M17B 1T1WB 5FWRA 5DFAA 4HJGA 3G08B 2XZZA 4LFHD 1Q9KA 5GIRB 3OGCB 1XXDC 3R8BB 1TJIH 4Y8AA 3NSFA 5I8EA 3BOVA 1GA2A 1ZGLM 3BP6A 1NDMA 1LW3A 3N42B 1GS8A 5DMGD 1DQMH 5EDXA 4N2LA 5D7KE 4WHYG 4L4TB 4KC3B 1X3DA 1WZ1H 3P3RA 4J3TA 1B4LA 4LPYA 3H3PH 2IOIA 2B14A 4I5BB 1K5GB 1UCBL 2Y7LA 2IDCA 2ESVE 2ISDA 4QY8A 4M7ZB 4YEEA 3V5DB 1JZ8A 4WV1B 3PGCA 3WJJA 1RZQA 4GMSH 3TCAA 3ARGA 5IHLB 2ENQA 1MCEA 4RX4D 2YAOA 2GYSA 5CD3B 3OXSB 5AW8B 4YSUA 4CADA 5TE6H 3CZJA 2UZXB 2IFFL 3CFCL 1ZAGA 1MZZA 3R1GH 5ESQB 5ID0B 1GIGL 3B56A 2CKBH 4HIIB 4UU9B 1OT2A 3EJQA 1GC1L 1VPOL 3BN9D 5HVHC 2NOYA 3KYOA 1TJ6A 2R83A 1P5VA 4NUMA 4ONGH 5LWYH 1DBAL 4M61B 1I3RB 5GRUL 2OYKA 2IQ9H 4ODTL 1I9JH 2BH0A 1D2PA 4UZGA 5T33H 3EYFA 3N40P 1N8ZB 1F11A 4NHUA 1BOGB 3VFNA 5AAPA 3QEQE 1K5NA 1L9OA 4P5KB 2V76A 4J6RH 5EN2B 4OFIA 4G80B 4YHIB 1DDHA 1ET7A 4N2GA 3B9DA 2HX9A 2ROXA 2RTTA 4J3XA 4F5CA 5D2NA 1NC4D 1L9QA 1WFTA 1G5GA 1KFAL 2BOCA 1A3ZA 2LAGB 2V0AA 4PCKA 5T3XL 4XWOC 5GXBB 3M7OA 3IVKA 1CFNA 5J1AA 4PRNA 2VQ1B 3LIUA 1VADA 3ECWA 3SD2A 4PVNA 4E42B 1RERA 1NBCA 4FLOA 5I82A 1PJWA 2RCSH 3NDYE 1EDYA 1MWAA 4FE9A 5I6KA 3VX0A 4GN1A 1VRSA 3OKOA 3MNZA 1NGWB 3DTXB 4ZYKB 1FN4A 1A6TA 4GG6A 1CGSH 4WKZA 3GSQB 2VXSH 3RJQB 3PWNB 3KL0A 3MBXL 3IGKA 5LGHH 2LG1A 2OSLA 1XR0B 3G5XB 2NY3C 4RSVA 3ZMRA 4A67A 4G43A 3SEPA 3B5GA 5C0BD 1MEXL 3NFPA 4ORZC 2IQAB 3VYPA 2AXJA 4OCMC 3BUBA 3HC2A 2YD3A 3IDXL 2APBA 2ZUYA 4RRPM 3V4VA 3SN6N 4V11A 3FQXB 2VLKA 4X6CB 3RG1C 9CGTA 2EO1A 3LQZA 3ZZLA 1ZYIA 4QD2E 2DBLL 2AJSL 1RUAH 3K74B 3TYFB 5KS9A 3UC0L 2HXAA 4UOZA 4HKBB 2VERA 4MD0A 1BVZA 1Z5LB 4ZOCA 4UILL 4CMHC 2F6AA 3ATBA 5DWUL 5JA8B 1TZIB 2YXFA 2BWIA 3TNMA 4YK4C 3ABGA 3WGUB 1IVLA 2EQDA 1YEKH 5AVVB 4PJIF 3US1A 4WI6A 2TSBA 1XF2B 1LD9A 1UA6H 4FQQA 5ECGA 4K3GA 1KCUL 2I5FA 1AE6H 1P2CA 3O6FB 3VI3A 1LYQA 1A4JA 5T3ZD 2RIKA 1DQKA 3IE4A 4TLTA 2Y7BA 1DJZA 3ARGD 4HIJA 4KX7A 4FMVA 1TTUA 3HLAB 2WTOA 2DD8L 1TKWB 4URKA 4F7CB 5EZIH 3UZVA 4U0RC 3LKRA 3EF7A 1CYGA 3WLBB 4H0GA 1IEHA 2BP8B 4WFEE 5C0JA 2HKHL 1XT5A 4LCWB 4M6NH 3GT6A 2F68X 2WXJA 3PHQA 4L18A 1I8IA 4Z95L 5HYJA 2OBGA 1PEZA 2AJUH 4L8CA 1G6RB 4HJEA 2P80A 4Y9EA 4ABUA 1F5WA 3CSTA 4XVUC 3R4DA 4GP8B 4JPIA 1HQ4B 3H3BC 4MCYB 5DT1H 2Z7ZA 3NIFF 4WSFA 4ALAH 2H32H 3PAUA 1HILB 4BSVA 2DQGL 3LQAH 3NZHL 2NY1D 1VEOA 4TVPL 3ZE1F 2JI3A 1G7HA 1UZ6F 2V9UA 4TM9A 5EH1A 2NT0A 2DX5A 3IB4A 3X3GH 4X4KA 4NZFA 2CIKB 2ZWSA 4X5RA 3GEWB 1ZVHA 1OO2A 1VHPA 1FO0H 2O6PA 1F4WL 5LXGH 1ZLWH 1UG9A 1HEZB 1OM9A 3UJIL 3H4HA 3S8FB 2YRBA 1U8LA 3DX4A 2LVEA 4GRWH 2ICES 3MNMA 3V10A 2FQEA 3Q6GH 1UUSA 4CHMA 4RVBA 5LCVL 4QRQA 5L4MA 4J5VA 1XWVA 1CIDA 3FO2B 3JZYA 4GAFB 4BWWA 1DLFH 4QUOA 4Z78A 5F1NA 3RUGB 3ARVA 3LNIA 2OZ4A 4OLVH 3S3CB 1D6VL 5E8PA 3ZDZF 4FA7B 1PSKH 2DQTL 4MNHA 4NQCE 2QZ5A 2DF3A 3EDDA 1RZGA 1G7PA 4LSRL 3D8FA 3KPQB 2EMSA 1F4XL 4EUPG 5F44A 1EAOA 4WQOA 4ACPA 1QWUA 2H41A 3BD3A 3ZT7A 4XCNB 2VLKD 2HCZX 1CFSA 3PDDA 4ONHA 4XMKL 3T2QA 1KTLA 3GXPA 3P3YA 3UJTL 2EYSB 3IFLL 4ELMF 5KYYB 3MC0A 2A6KA 3GRBA 4NC2B 2XIDA 5DHAB 1PQZB 4L9LC 4FG6D 2WTRA 3I3DA 4U6YA 3MLYH 4N9GB 4XMPH 2AV1A 3OLDA 4YSTA 3TNNA 1NZRA 2WB7A 3EYQD 3GM0A 3BMVA 1QVOA 3GSVA 5EU7E 5IVXE 5HPMB 3HNSH 5F3HB 3PL6A 4HW6A 3RWHB 4CC4A 3GIVA 1IB5A 3WXWL 1E8ZA 5IMLA 4YXHL 1KCRL 1EFQA 1WJ1A 4WWOA 1YO4A 5B1JC 4JFXB 3QEUA 4PQXA 2AK4B 2CCWA 5DLLA 3ZUCA 4OM1H 5L4FA 4G8GA 2H6UA 1XCXA 1SHMA 3L45A 4LVNC 4A63A 5K9OB 1RCYA 3DXEA 2C3VA 1N9PA 4HAVB 4NFDA 1UURA 1UQSB 2XWBA 1Q94B 4G1EA 3KYMA 5C0AE 2DLFL 3UX9B 3X12A 4WNSA 3APCA 4E5XA 5JHLL 4WU5A 3BVDB 1UFGA 2YQGA 3AREB 5IWLC 1JCVA 2A9NL 3F85A 2ADGB 5HYJD 1H3XA 3ILQD 2P80D 2IAMB 2ZXCA 3BO8B 3MGAA 3ARWA 2BC4A 5TH2B 5I1CL 3P0VH 2UVFA 5LUMA 1PY0A 3DECA 1TQSA 4N90D 2E7HA 3QNXA 4NSWA 5JHAA 2V3EA 2IALB 3S6CA 5F7NC 4JFPA 4AEHH 3U7DA 5E7FA 4ZS7H 5FO7B 3E9TA 4QRBA 4DEUA 1U91B 1SHCA 3AT9A 1USQA 1E2ZA 5KVFE 1BIIB 3F84A 1AKJA 4B0MB 5J6HB 5JDJA 3KPSA 2ENPA 1A9EB 5TE4H 3O3AB 3D39B 5CLXA 4PLNC 3S48A 3AQXA 3U83A 3C08L 1SN5A 3N43B 4UF7C 3KXFB 1G5AA 4PJHA 4JLRB 1HAUA 4LOEA 1MLCB 4R5TA 3WY1A 2ZD0A 1II4E 4KKAC 3S36L 2P8LA 1V7NL 2VZUA 1AWEA 4N2NA 2QPUA 3PDGA 3MLUH 2IWKA 4HOXA 3D0AA 1MQ8A 3P77A 3U36B 2VISA 1RUPH 3GTNA 3ABZA 3R06A 4Z7QB 3ULVE 1JYXA 2YEQA 5MEPB 4BUHA 5C6TL 1QSFA 5HDOA 2FBOJ 2WLLB 5DMIL 3EKCA 3N41F 4XWOD 2YJLA 3DDFA 4HSQA 4X7EC 3NOIA 4HFUL 1PZDA 2X2YA 4ALAC 1J05B 3CVHL 2YAQA 2CMRH 3MRBA 5G4MA 3OSVA 1G9NL 3FMGL 3KR3H 3LQAC 4ZXBB 4CVXA 4EIUA 4TL4A 4WI8A 4L9DA 4OJYA 4I3RL 4PCYA 3MLZH 4Z18A 4QHPA 2GJPA 2Z8SA 3GMMB 4ODVH 1QABA 2YUXA 1FIEA 2Z4DA 1KPVA 2Q3AA 1S9XA 4JN1L 2GQHA 3Q8AA 4FQXC 2QTVA 2KH2B 2VDPH 3PL6D 1FHNA 1G0DA 2FWUA 3Q13A 5CIPA 4GUOA 3MRNB 3SKNA 1HT6A 2YEVB 2VABA 1DJIA 1NWPA 3AXIA 1SLXA 3QDGE 4KMTL 1JJUA 4Y2NA 2C3XA 3BT2H 3FO9B 3EJTA 4NZTL 4HPYH 4Q6YA 4TUKL 4G8GD 4J28A 4M9OA 4FMFA 4JO1L 1DUZA 2OTPA 4FKKA 1B0RA 3CLEL 2ITDB 5I23A 3GMPA 4ENED 1KLFB 1N26A 2Y5TB 4L1TA 3IN2A 3W56A 1R3HA 4IU2B 5K59F 4QHKJ 4XOAA 4RGNC 5J3QA 2UWEF 3NGBB 4KKZA 5GS1B 5IROC 2NX5E 4UT6L 1OAYL 4L9LA 2PYFA 3O41A 3WNMA 3H9SB 2X6CA 1S9WB 5I1LB 2ENYA 4W81A 4U1JA 1AXSA 4FFVC 5E1HB 5F1IB 4OLEA 1JWUA 3BP5A 3UEZA 1L9SA 5EU4B 1J9TA 1DZBA 5KYWB 3TPUB 5JNYB 3H7LA 5FECA 3H2WA 3L5HA 3VXTA 5B1JA 4MCZA 4Z7OF 2BMKA 2TRHA 4PJXF 4R3SA 3WNKA 2V6HA 4LCYB 4G11A 1XX9C 1PKQA 4W9HC 3AY2A 4NNYB 1PD1A 5FKPA 4LOVA 1DSWA 4PRDA 2QQQA 2G3MA 4HUNB 4I3SL 2WGNB 3A24A 3I02A 1JFHA 2GIXA 2ZKHH 5DZ9A 5GGUB 1KELL 1AKJD 2YHGA 4WSGA 1BQ5A 3ABKB 3KH3A 3MREB 4Y2DB 3KPSD 4JREC 5T1MA 1JXFA 1N0LB 3T0EC 2OMZA 2WWKT 1Q0EA 1GHFL 5IWLA 4YZFE 4P2QE 1ED3B 5KUMA 5IHZA 1DUYA 4FG0A 1NBZB 5A6MA 4XVUD 3IPFA 4XNYL 1UH2A 5IBTL 2MH4A 1GAFH 2APVA 4A55A 1W72L 1E8WA 3L3KB 1P1ZA 3VXRE 1XO8A 4Z7NF 4IBUA 2YR3A 2YXVA 5KVDE 2FJFA 3A4AA 3FZUC 4XZUA 5F88A 4FTVE 5E94A 5I30L 3D85A 1KCBA 3ZTJG 5SWSA 1QSFD 2IG2L 1JPSH 2OL3B 2UZPA 3E80A 1AHWB 5LOPB 1T1YB 1A4BA 3ULBA 4PSRA 1KGYE 2WQAA 4UBDD 4XXDA 1VZIA 2VAAB 3DTDA 4HETA 4NZUH 4O51A 4X5WB 2K2UA 3UEQA 2E6QA 4K55A 5I76B 1GR7A 1IX2A 1E2VA 3MV8B 2Q86B 1UWXK 3U4BL 5EIQA 2Q8AH 1WZLA 3P4OA 4PJFE 2V2XA 3REVA 4AM0B 1V05A 3LEYL 1TUPA 2ADIA 4LSQL 2Y8GA 1M05A 2NXZB 4DKEL 2JK5A 1KJMA 1TU2A 1XCQB 3MUGB 3A8PA 3DCXA 3O45B 5CEYB 2C9RA 1JGEB 1KLGB 1NCDL 3DSFL 5EIVA 5BV7L 1TO4A 1BECA 3ZDWA 5F97E 2QPDB 4GO9A 3BRGC 2HRPH 2VXTH 2C4XA 1IGTB 1UFUA 4HGWB 4J1UA 4JCLA 1L7IL 5LG1A 1JMZA 3NABH 3KWWA 3TOPA 3LZNA 2WNGA 1YN7B 1BQUA 2BNUA 4OB5H 5DJDA 1I7ZB 4OLYH 4DAGH 4KOBA 3QO0A 1YEGH 1S8DA 3FQUA 4NO5B 3TEXA 5I1GH 2H32A 1CGXA 4NAMA 3SY0B 3MRGB 1DJXA 4GSRA 3S5YA 4CN4A 2D7NA 3PWUA 1NEUA 4OT1H 4OZGB 3DOSA 5EPMA 3T08A 4TNGA 1U0QA 1HWWA 3V0GA 3V6OE 4PNKA 2IBZX 4H20L 2H47C 5CSBA 2BCMA 4FQXA 2YS1A 4PWFA 1LQBC 3U0WH 2RB8A 3ZW3A 3KHQA 3VQMA 2DWSA 1UD8A 5JOPE 2B77A 3KSYA 1HQRB 4JO2H 1LXMA 4LDOB 5EHFA 1AGFB 5IREA 4KY1H 4OZHE 4Y4FB 3MOQA 1TCRA 5DFVC 1LP9E 4OZFB 5E56A 1H9DA 1N6VA 2PPAA 1E6OH 3R0MA 2QSQA 2RQ8A 4FRWA 5DMYA 1IEAB 3LKPB 2VQ4A 1KY6A 3IJ9A 2QV2A 2Z93B 4JGNA 5CHNB 2A2QT 5IROA 2XHNA 5F70A 4TLKA 1B2WH 2WLYA 3ZKND 2WQVA 1ADQL 5AB1A 2DV6A 4JR9L 5H8DA 2OJEA 1S5HA 3U7WL 3CVIH 4YPGA 4M7ZC 4O58L 4NT6B 4AG4L 5L2KD 3DC0A 1Y0LB 4FXLA 3NSCA 1KWKA 4WV1C 4GLRI 2MEJB 1BXAA 5D2LA 1RY7B 3D1MC 4NUGH 3WHXB 2A6JB 1V8HA 3D85D 1XF3A 3VXME 3MOAH 1IGCH 4HAYB 5SWSD 4QAMB 3V0VA 3F58H 3K6SB 4MDIA 1U93A 3PIQB 3W9DB 3EJZC 2JKIS 3IFPA 3O3EA 2FWSA 3MXVH 1ET5A 1ETJA 5F9DC 4CHJA 3OMIB 4YQXL 1EAPB 4PJGF 1T6WA 3LVTA 2GFBA 2OX5A 4NJ9L 5FDWB 3T5WA 2Y3NA 1R24A 2FLMA 4HHAA 5MERA 3VU2A 3T0EA 2J8UF 2B4CH 4MK0A 4OAWA 2WWNA 1B4JL 1C08A 1JL8A 2VLJE 2J88L 2MTAA 2W88A 1U3NA 5IGXL 3FB6A 3EYOA 3ZVRA 4KKAD 2X2IA 4GFTB 3S37X 4PLJD 4OLXH 2NUPB 5I1JH 2KYIA 3WDHA 1IQWH 1MJ8H 4XNBA 1BQRA 1R33A 2EO7A 2RGSA 4M62L 2CJUL 3ZU8A 1TYJA 4ES9A 2ADJB 5C0RH 1OSPH 2IH1A 4PJ7B 3WJLA 1WBZA 3MCKA 2ZUVA 1A7PH 2NY4D 3L8QA 1RIHL 3TIEB 3IE9A 1HNFA 3GYRA 1XX0A 2V7NA 2ZX8A 5BZWA 1G7MA 5GGTL 2AJVL 2VDMB 4K23L 2JV6A 2R69A 4EDWL 1I4FA 4PWHA 1IAKB 3MRFB 4U2YA 4NPKA 4DK6A 1LILA 2FBJL 2LQRA 2WSDA 2ZICA 3HLKA 1IQDA 4XMVA 1ZXQA 5BS0E 1MI5A 4GKZA 2NY5H 4KX9A 5E08L 4H2AA 1JWSB 2OKMA 3L3GB 4YHPA 3BQUA 4GXVL 1NAMB 1TMQA 3QHFH 3ULUD 4FQXD 2YS3A 4ZO7A 2Q13A 1KIPB 3CZKA 5DYOB 3BH9A 1RHHB 1MFAH 3GXFA 4KQ0A 2BSSA 1Q8MA 1T20B 5I16A 2VM9A 3OJDA 4PJAB 4X4ZA 2ZCKH 5F72S 3H8NA 4G9FB 5J9PA 1H15A 1QRNB 4IRJA 5C0CE 3UMNA 2UV3A 3VFVA 5KBMA 3FQ1A 2EKJA 2CLVA 2F54E 1EBAA 3A4FA 4NUQA 1AAJA 1EZUA 3CN2A 3P0GB 5MEOB 2AITA 1A47A 4K5OA 1GYVA 1A3LH 4KHOA 4LEOA 5IJCC 2N01B 2ID5A 2TAAA 3LHPH 3PNWB 4MNGB 5IROD 4NEHB 1F3JB 5TDNB 2CBMA 4XHJC 2XZAH 4PMEA 2R7EA 4HCGA 4FFVD 4DHLA 2TRYA 3ISWA 3NCWA 4GAJL 3O6FC 1UJTA 3RWDA 5F3BA 2TSAA 1U33A 4QLWA 3DYMA 4WI0B 2G2RA 2GI0A 4R8WL 4XNMB 5ICXA 3S3JA 4YDKH 1FL6A 5CM1A 3M17A 4FQCH 5F0MB 4F7GA 1TF4A 1RSFA 5GIRA 3OGCA 3BAYA 4PTUB 3RVWC 3NZSA 2YSZA 3VFGH 3VYNA 5GGRB 2NTFB 3QSKB 4YHKL 2G35A 1V27A 3ARFB 2AFNA 1XTMA 2XZQL 4Z2MB 3MLWL 2H3NB 3N3EA 4H0LC 4XWGH 1H6TA 3T0ED 1BSIA 3EO0B 3K4DA 4L4TA 3GJEB 1YNTF 2F18A 1NJ9B 2WWOA 5I6MA 4GSDL 5IHWA 1E5BA 4I5BA 4BZ1H 1TQZA 4TTDC 3BDXA 4L3EA 1ACCA 2LVCA 3EYSL 1HXMB 5PAZA 3TT1L 2GJZB 3V5DA 4WV1A 1I7UB 5KVEL 2JKJA 1EVHA 2UZIH 3TCXA 2DMKA 5CD3A 3OXSA 4PBDA 4AQZA 1LTXA 2Y6TE 1KGXA 2UZXA 5ID0A 5ESQA 2VERN 1D5XB 4HIIA 1AZRA 4UU9A 2VXQH 2PP8A 3EO9L 2B5IB 1SDDA 5D7JC 2I60L 3HFML 4M61A 5HHVH 2J0KA 1F3DJ 1I3RA 2H6OA 1MI5D 2VZOA 4GFXA 4WCYH 2WZPA 3DUHA 1A6UH 3BZEB 1EMTH 1SOSA 2D9CA 3LRKA 2OR8A 2DTSA 3A23A 1B0IA 3BQUD 4GT0A 1BOGA 1FPTL 3KWUA 1A5FH 2QVTA 2MKWA 2R51A 4X7SL 4C55A 2FX7L 2M1KA 4P5KA 5EN2A 1UWEH 5J1TC 4G80A 1GKOA 4AE0A 2CE6A 1LK2B 3ZTNH 3U2IA 1D9KB 5HP5A 4JFQB 3VMOA 2XACC 4KQ4H 3AWEA 1PLBA 4Y7MA 1GOFA 2B4CC 5E9DB 1MCNA 1OP4A 4IRJD 1QFUH 2VQ1A 4U0QB 4KUZL 4ODWB 4RGOH 1VCBC 1UKQA 5E1GA 3I6KB 4J3UA 3TYGL 3DO4A 4PGDB 2HUHA 1LNUB 1YEJH 3HG4A 3SY6A 4PJCA 3VMPA 2DWTA 5SV4A 2E27L 2GHZA 1R5IB 4DIXA 2BDNH 3BSGA 1NGWA 3DTXA 3RU8H 3ESMA 3ARPA 1OAZH 1XZ0B 2JKSA 5B1KA 3GSQA 4OCYH 1E4WL 5CGYC 1GYAA 1QPPA 4U31A 4WI4A 2WQUA 4OFQA 1TITA 5IT2L 2FQDA 2DTMH 2CR0A 3G5XA 5C07E 3DROB 1QBML 2NDFA 3NIFB 2IQAA 3ZBMA 2EXWC 3SCMB 2BP3A 3AS0A 1A66A 5IB2B 3P1VA 1E9QB 2NY5C 1VA9A 4NQVB 4AC4A 2DWEB 1RZ7L 3SJVE 3CDGB 3FQXA 3L4TA 5D70H 4UDUB 3EFDL 4HK3J 3B9VA 4WEEA 4Y4HB 3VWKC 3ZPDA 5DFVD 3T04D 4I1PA 3LN4B 4M03A 1HNGA 3NJNA 3TYFA 3CIKA 5L2KE 2DJMA 1YLBB 4LKCB 2X9ZA 2XETA 3NCJH 4HKBA 4KRLB 2EKSB 4M1DH 5DEZA 1Z5LA 2EDFA 4HAUB 1ZHBB 2OL3H 1Y07A 2K7PA 2XZCH 1TZIA 4AXWA 5B8CC 3S3BB 3NPSC 3KLLA 4L4TD 1E8YA 3D3VB 2EEDA 4GXBA 1PYWB 4P07A 1XF2A 1J8HB 1WGOA 2VDLB 4RAHA 4R5VA 2EIZB 1FORL 2DL9A 3O6FA 4LP5A 4F7EB 5IFHL 3VW3H 3ZDZB 4LOUC 1MY5A 2KUQA 4FNLH 4LLUA 2CO1A 4I3GA 4KI5C 1XMEB 4NO0B 1E7VA 2XQYA 4XRCB 2BVOB 1ZXKA 3HLAA 1XCGA 4UQAA 2VE6B 4MDRA 3S5LA 1TKWA 1S7SB 4F7CA 2NY0C 3K80A 3WLBA 2BP8A 4XPHL 3ARBC 3BWAB 2UXGA 4MZ3A 2XG5B 3H6AA 4XMXA 4E68A 4K3JH 4GSUA 1ILSA 3GSNL 3ZOAA 2KGXB 5GRZA 3O4LE 3U6RB 1G6RA 5LVEA 4L0YA 3ATEA 4LU5L 4UIKH 2WZPD 3LB6C 1X1GA 2YUWA 1Q0YH 3HJ0A 3VXQB 4XZ4A 3WIHA 4QRRB 4H8WH 1HQ4A 1WJ3A 4MCYA 2JELL 4G59C 4KDTC 5FYLH 4N1CA 1HILA 3LX9A 2Y07L 2OZNA 2WANA 4BSJA 3OZLA 2ZUTA 1X5JA 4UTAL 2OMBA 2EE0A 1PCXA 4HG4K 2XTSA 4OCWL 3V7AE 1JERA 4LAQH 2NMBA 4GJTB 4F2ME 3UYPB 2CIKA 1IAIL 3BKYH 1DSYA 2C4FT 2FH8A 3QUMH 2XBDA 1YMMB 2H2SC 3ULUE 2JWYA 4CJ0A 3BGMB 1HEZA 4J8RB 3OHXB 1EGJA 4KZDL 5D7JA 4XBEH 5AW3B 1IGMH 4HH9B 4JFEE 2PUQT 1QKZH 3O2VH 3DX3A 3VFUB 4ZMWA 1BAKA 1CDUA 3FO2A 1BLIA 3BH8A 4Y94A 5CN1A 1DYZA 4PLKC 3RUGA 5EEZA 1F4YH 3KWXA 3OAWA 1FYTB 3X3FH 3H0TB 5KJRH 3IGAB 1CLCA 5EEYA 3QZPA 1IBFA 4PGCB 1MRFL 1KXVC 1TJGL 3WE6B 1UZGA 4PP1C 2VXVH 1HL9A 3KPQA 4AL8L 3VA2C 3OSKA 1ZJBA 2D9XA 1TEFA 4MXVF 4XCNA 1WH0A 4X4XB 1CE1H 5E2TL 2XTJB 4UNUA 4LIQL 4UT7H 5EDSA 2E2XA 4WY7L 2VSCA 2EYSA 2UUDH 1HN1A 3QRGH 5KYYA 4IBWA 1C9SA 2VDNB 5GS1C 1AOHA 4KHAA 1PQZA 3JUZA 4X5LA 1MHPL 4C4UA 1BVNT 3CMGA 3W11C 4N9GA 3NCMA 1INDH 2EIJB 1OANA 2H0FA 5EU7C 5D2LE 4XP5H 1GH7A 4XNUH 4M5TA 1ZV9A 5BXFB 5F3HA 1Z3RA 2JCCB 3H6JA 1LO2L 4JG1L 4NP4H 5MI0C 4FULA 5EZOL 3TWCL 1N18A 3K8MA 5BNXD 1QZNA 3VGGA 4B5ZA 4IBQA 5I1HL 3QPXH 4PUBH 3PWJB 4DH2A 4JFXA 3WS3B 3O6FD 2AQ1A 4P9HC 4R4BB 3RL1B 2AK4A 1HE8A 2W1NA 2FWLB 4LEEA 4BCYA 4EQ2A 4LP8A 2ITCA 4EE2A 5K69A 4U1HA 2V5MA 4N2EA 5E99H 1G9MH 7FABH 1DJYA 4FLRA 2XYCA 3E38A 2NQCA 4D3CL 2W5PA 1UQSA 5DC2A 3W57A 1J1XL 2YK1H 1Q94A 5BVPH 5I5MA 1FFOB 3RVWD 3VVVA 4LCWD 3NFSL 4NLAA 4FFYH 4DVRH 1MXGA 4N8VB 2EIEA 2LOZA 3AREA 1UOWA 3SPCA 2ADGA 5D4IA 4EZKA 1EFXB 3BO8A 4P2CG 3VI4F 4JG9A 5TH2A 3ZHFA 3IT8D 5L88H 4N28A 3OPZL 1FG2B 2OYPA 3PHAA 3QS3A 2VDMH 1N12A 1QC6A 3BGFB 1ZHKB 4TTDD 4HXAL 5CSGA 1C7TA 5C08B 2CY5A 2XIBA 5FM5M 2VZTA 4QGTA 1NH6A 2IALA 1QLFB 1XDTT 4JHUA 5FO7A 4JGMA 3PVUA 4NKDB 3QQ9D 2J44A 1AHWC 4RETB 2DQEH 5DVLA 4OBSA 1U91A 5I6PA 5HHMD 3S9DB 1BIIA 1HCYA 2LFEA 4YHMH 3RLSA 1IARB 2JQMA 4AM0Q 5J6HA 3DK2A 4JQVC 1A9EA 1G94A 4YBQC 3O3AA 3D39A 1KN4H 5D7JD 5TGBA 1ZLSH 1V89A 4W1TA 1F3DH 3KXFA 1SN0A 4JLRA 3UGEA 1PG7H 2UWEB 1UD5A 4HMDA 2X1XR 1MLCA 4DW2H 4UAHA 1JCKA 5CD5C 2NXZC 2JKTM 1EK3A 2R4SL 4KDTA 2AC0A 3GFUA 4ZMQA 1KBPA 4DP9X 4Y2OB 4GKSB 4JGJA 4K5NA 5E4AA 3L4WA 5MEPA 4P46B 3DXAB 5DD3H 1O75A 2O5NA 5B1BB 2GK2A 3VE0B 3A98B 4ZW7A 3GLZA 1BQLH 5IEHB 4N3UA 2G5BB 4H8WC 2VWEE 4PJBF 1J05A 2YT0A 4DBBA 4HWZB 3IDNA 4ZXBA 4JCWA 2GJYA 4L4VE 4NFBA 5JMRA 3L4CA 4Q4EA 2WN3A 5B3SB 3OKKB 1BMGA 3GJFK 3GMMA 3GUTB 1WC7B 1ID5I 1GL4B 5ABZA 1X7TA 1E27B 2FHCA 3MRNA 4JM4L 3MUUA 1ZSDB 4EAEA 4PG2C 5CR1A 1FFNB 4H8SA 1WRFA 1KXVA 3TBSB 4RISH 4Z7NB 3IS1X 3FO9A 4TYZA 3U25A 2AK4D 1CTNA 1QQDB 2EXWD 2M83A 3FRPG 3Q5OA 1KJ2B 1MREH 1DFBL 1AZZC 2OSYA 1E6JL 4RGMB 1A9BB 3BYYA 1FFTB 1T6BX 1MJJB 1RFDL 4RZKA 3FQNB 4XNZB 4EKUA 2H6PB 4FQ1L 3ZDXE 3EJUA 2CGYA 2ITDA 2Y06L 1JPST 1KLFA 2Y5TA 2CUIA 3NJGA 4YSRA 3L4VA 2WSPA 5TE7L 4EJNA 5BRQA 2O5XL 1HTYA 3OKMB 4K73A 4LAJH 5BZDB 4N2CA 4NRYB 3IVFA 3IDYB 5ANMB 1R4XA 5GS1A 4NYLB 4OJCA 4S1QH 2HSIA 3ARED 3QDJE 3H9SA 1S9WA 3HG3A 1AFVH 1ORSA 5D1XC 5I1LA 3BKJL 1ML0A 2FNBA 3ORJA 5F1IA 1G4RA 3IMVA 4ABQA 2APWA 5EU4A 4GIPD 5KYWA 3TPUA 5JNYA 1CD9B 3MA9H 1C12B 2WGXA 3NP3A 1T0PB 3OG6B 4FHBD 5IM7B 3RCPA 4LOUD 3WUWG 2QELA 2KHAA 4GG8B 4GQ9H 4KI5D 4POZD 5E6IB 3R4RA 4BFRA 1HL5A 1BEXA 4NNYA 2I1JA 2P5EB 4L29B 1Z3GL 5GGUA 3U4KA 2YUVA 4PGZA 4HBCH 2V5SA 1H6FA 2QMKA 1AQDB 3MREA 4Z0BL 1Z9SB 5HPOA 1N0LA 3D39D 4JPWL 3LQMA 5D3YA 1ED3A 1BFVL 3KXFD 4F7TB 2LU5A 1TYEB 1NBZA 4MYWB 4DVBB 3Q48A 1BA9A 4HPOL 1G9MC 4J27A 3I50L 1ZT1B 3UMTA 4Z7AA 5DIFB 2H1PL 1TNMA 2APXA 4X2UA 3L3KA 3KYKL 4R5XA 4D9LL 3P0YH 1Z0MA 5AVUB 4HJ0C 4GIOA 1BTKA 4IBZA 3QDHA 3IGLA 1PX3A 2BIMA 2XWEA 3AB0B 3MLRL 1U3YA 4LCUB 5FM4A 3LZOA 2OL3A 2OV0A 3C8KB 2E3VA 2BRQA 2JXMB 1AHWA 4ZUVB 3H9ZA 1T1YA 1OCOB 2WXNA 1QFHA 1PZSA 3DX7B 3S4SB 2VAAA 4IKNA 4X5WA 1XBDA 4ETQB 5I76A 1KXHA 5DD0L 2Q86A 2H2SD 3MV8A 2YEZA 4ZDHB 4ANUA 5KTEL 4U49A 2VDOL 1OCWH 3GUFA 4JQVA 3JWNE 4ZXBD 3HN5A 2MOGA 1KGIA 3C75A 3QCTL 1YYCA 1DN2A 4AM0A 1AZBA 5ALBL 12E8L 2WIMA 4NQDE 2PTTB 4X6CE 4PLKD 1FNLA 4HWNA 2Q8BL 3O45A 5CEYA 4ES8A 1NCCL 2WNKA 4LQ1A 1FZOB 1SY6H 1KLGA 2EDEA 3DX8B 3FBKA 3HQCA 5H4ZA 2RRFA 1JZFA 5CZVL 3QYMA 1BEYH 4PP1D 1BX2B 3AWFA 3NIDF 5JIKA 5I5IA 1P3RA 1IGTA 1BGXL 4HGWA 2PTUA 4RCAA 4XBGB 5DEGA 3VFRB 2X5PA 1AYRA 1YN7A 2QT6A 2WLMA 3D33A 1MNNA 1I7ZA 3ZMNA 3NA4A 4GKOA 1XZWA 3INUH 2R0KL 1UENA 3OJVC 4YSQA 4NO5A 1EIBA 3JYBA 1OM3L 3GHEH 3MRGA 1S9YB 3V52L 3DJSA 4MD4B 5AOZA 1F6AB 4OZGA 3MJWA 1EF1A 1QPKA 5FDYA 3W11D 2Q7AA 3H9SD 4HUUB 1OGPA 5JXAH 3ETBJ 2AQNA 3CC5B 4HB2B 5A7BA 4PD4K 1XCTA 3JVGC 2J8UB 4X6DE 4RMTA 4D0CB 3ROLB 3HPLB 3UTPD 1GGCL 3EJJX 3ESOA 3QUMA 2ZUXA 3SOBL 4B3VA 2J6WA 4PJDA 4PG2A 4LCWE 3G6AA 5IRSA 1EEYA 1HQRA 4FNPA 3UBXG 3QDMB 1NMCC 3JWDL 5DK2B 2NT1A 1RKRA 1AGFA 3CDZA 3VFSB 3V7MA 4ZUUB 4Y4FA 4RWYL 5M95B 4PVMA 4J4PC 4OZFA 4U1GC 3JUYA 4U1KB 5I0ZA 5G5DB 3C9NB 3PV6A 1IEAA 1L7TH 3ARFC 3LKPA 4N8CH 1RZFL 1KIRB 1IGIH 1U41A 5EEWA 4Y2DD 3O6MH 4O02L 4HEMA 2Z93A 5CHNA 5E2WL 4IRSB 3R7QA 3K3QA 1P6AB 4NZJA 5I73B 4ZPVB 3L3DB 3VACA 4GAYB 3C60B 3ILDA 3QHZL 4H40A 3PABB 4OD1H 1ZA6B 4WVRA 5TDPB 3D8EA 2RSGA 2J1ZA 4EVNB 4TL5A 1FNGB 1RUKH 1JTTA 2CDEB 4NT6A 1Y0LA 1OF0A 4QT5B 1PVHA 4JGUA 2IPTL 1BAGA 1X9RA 5DUML 1NUGA 2A6JA 3WHXA 3S88H 4OIBA 1LHZA 4PWJA 4LLWB 3K6SA 4Y8DC 3LZFL 2KIEA 4MJ5B 3UCQA 3PIQA 4N0UB 3W9DA 4OM0H 2W95A 4M02A 3RAJL 4NXKA 1BFSA 3FQ2A 2LTQC 3NQIA 2YF0A 3OF6A 4U6VL 1A02N 2A1WH 5DR5L 3MV8D 3E8VA 1EAPA 1YECH 1OP9A 1ZOXA 4PJ9C 3VDAA 5FDWA 3B5TA 1OK0A 4FG4A 1T7XA 2BNQB 3S96B 4YBQD 1A4AA 4DP4X 4Z7UF 3ULSB 4OZIF 2Q10A 1X6LA 3U7YL 3PFQA 5FCUL 3SYOA 2GEQA 1D3CA 5EV7A 3OKNA 5CD5D 3VUAA 2NXZD 2BSTB 4M6MH 2DYSB 2DEXX 2NUPA 3DV4B 4AH2B 1QLEB 2RA1A 3AG1B 1UPRA 3QCUH 1LO3H 2ADJA 4LFHG 4ETYA 4Q8BA 2G5UA 4PJ7A 3FU5A 3TIEA 4X6BB 3CFKB 3RGVB 1WG7A 1JZEA 1QHPA 4JO8A 1HWHB 4KI1A 3WD5H 3BVWA 5KUKA 2YO3A 3FH7A 4BBKA 4KTYA 1VFMA 3WTUA 1IAKA 3MRFA 5F7LB 2FWOB 3H7BA 4GYBA 2YGVA 3VAEA 2CUAA 5E8DL 5LBVA 1JWSA 3FO0L 3L3GA 2IANB 1U95B 4FEMA 1NDTA 1NAMA 2X4SB 1ZGLB 2E56A 2E9IA 3KLQA 1YNTB 1KIPA 1TOXA 2MWCA 1FGNH 1RHHA 2D9WA 2XN2A 2GTWB 4KV5E 4A6HA 1EEZB 1T20A 2AEPH 3DVGB 4KO5A 3U12A 4KWUA 4PJAA 4ZNEE 1ASPA 1RIUH 2MQCA 3D25B 3IU4L 5DDHB 4YPJA 2W0KA 4D9RE 1QRNA 1CLYH 1LDPL 1A3QA 2JB6B 3C5ZC 4Y4FD 1T3FB 2CU9A 2DQHH 3RP1A 4JO3L 1IAIM 2Q20A 4TRPH 5MEOA 5KSUB 1TG8A 1JD9A 3BJIA 2WN2A 3W2DH 1X5LA 3VTMA 3BSZA 4S1RL 5EOQH 5HSFA 4MNGA 4MQ7A 1QG3A 1BM7A 1UJ3C 1F3JA 1JXDA 1RI8A 1GGIH 1X9LA 4BUGA 1IU1A 1KC5L 3KLDA 4GSQA 2R23B 4I0KA 5JW4N 2AEQL 2QL1A 4Z7VF 2ICEB 1I53A 3G6JF 3QZMA 4FA8A 1BVKB 1V10A 4XNMA 2VTFA 4ZMTA 1BCIA 2MWNB 4J3OH 4UWQB 1RVFH 4YE4L 1GC6A 4I9XA 5IEKB 4GLRH 4J4PA 1OZTG 2R0WL 3QXWA 1WHOA 4PIBA 5GGRA 4X4YB 4WVFB 2DIJA 3IJ7A 3OF6D 4WEBL 3ARFA 2EJ8A 1SNRA 1I31A 3ESVF 2H3NA 1C5CL 3EH3B 4B9YA 3EO0A 4XI5C 5EF1A 3GJEA 3BPNC 4XNXL 1NJ9A 1Q9LB 2A73B 3CK0H 1XKEA 1FHWA 3DETC 3HAEH 4I9WD 2JMRA 2YMXL 1HXMA 1D5IH 2BHUA 1XH3B 5ECJE 3DWTA 2GJZA 3N9GH 4XCCL 2NNCA 3F05A 1P53A 3PXJA 3ZYIA 1QFWL 2PTVA 1I3GH 1LGVA 3LNGA 2Z0BA 4LNRA 4LSTL 5K9JH 1TETH 2APTA 3V5HB 2ZKYA 1YQ2A 5D55A 4LEXL 3L3JA 3NN8B 5HI4C 2R09A 4LBAA 1D5XA 3QBTB 3AJ4A 4AOFA 2KC0A 3V0FA 1MF2L 2G0LA 4XWXA 4N8PA 4WZ9A 4JPVL 2HMIC