2LOXA

Nmr structure of the complex between the ph domain of the tfb1 subunit from tfiih and rad2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
115
structure length
115
Chain Sequence
PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional characterization of interactions involving the Tfb1 subunit of TFIIH and the NER factor Rad2.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/hydrolase
molecule keywords RNA polymerase II transcription factor B subunit 1
total genus 16
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2012-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2loxA00
1FAOA 4Z2MB 1J19A 1RRPB 1U27A 4L6EA 4HATB 1BTKA 1H4RA 1GG3A 4IAPA 2UZSA 2D2QA 1U5DA 4TYZA 2PZ1A 5C79A 1NTYA 4ZRJA 3BJIA 1RJ2A 2M38A 4NY0A 4K2OA 1WGQA 4KHOA 5DIFB 5D27A 2E2XA 3WA0A 1TQZA 3KRXA 1AQCA 4GPTB 1TXDA 4PNKA 3CXBB 1FHXA 3GYPA 1FOEA 2COFA 2GCJA 2VRWB 3BINA 3KZ1A 3F5RA 2P0DA 1BTNA 3RCPA 2N23A 2L2IA 3D8DA 3PZDA 1ZC4B 5DI9B 4H8SA 2NMBA 1P6SA 5D3YA 5DH9B 4CYEA 4F7HA 2XQNM 1W1HA 4GN1A 4P7IA 2K00A 1W1GA 1U5FA 2ZPYA 1MK9B 3TO1A 3A98B 3TCAA 2RLOA 4ZRKA 2I5CA 4MK0A 3SUZA 2D11A 3ML4A 3PEGA 1V89A 2DHKA 1DDVA 4YL8A 1GC7A 1WVHA 2YRYA 2IFSA 3LJUX 1MAIA 2EJ8A 2DFKA 1ISNA 4XWXA 5KQ4A 1XX0A 2J0JA 2BCJA 2DKQA 2D4QA 2VKIA 1MKEA 4MY6A 1TJ6A 2R0DA 1Y19B 4GXBA 1XCGA 1V5PA 3G9WA 4KHAA 1DYNA 1U5EA 1E5WA 3HQCA 3IVFA 5HE3A 5C6RA 1OMWA 2YS5A 1I7AA 4A6KA 3UZTA 3PP2A 2RNRB 4PQ0A 2YS1A 4IOYX 3N7CA 4TKNA 5EFXA 5D3VA 1W1DA 1U5GA 3PSCA 3U8ZA 2W2WA 1NI2A 3DXCA 2MKRA 3FM8C 2CODA 4HDOA 5FI1A 2IYBA 2Y8GA 1Q67A 3U7DA 3FEHA 1LB1A 2D9VA 1DBHA 3HW2B 1FHWA 2L1CA 4A6FB 3PVWA 3QBVB 4GMVA 2EC1A 2LULA 3ZVRA 1K5DB 3KRWA 4HHVA 1KZ7A 1BAKA 2DHJA 1DDWA 3DXDA 1KI1B 3ULCA 2KGXB 3HK0A 4HB3B 1Y5OA 2CY4A 3AU4A 2COAA 1V88A 4BBKA 1ZC3B 4HDQA 2N0YA 3ODXA 1WJMA 5KCVA 4HB2B 1FGYA 2DLWA 2YS3A 1V5UA 2J59M 2M14A 2D9WA 5C5BA 4B6HA 4GMXB 3VIAA 4Z2NA 5JHGA 2DX1A 4K2PA 3D8EA 3PVUA 2DYQA 2LOXA 1LW3A 2P0HA 1SHCA 1M7RA 1U2BA 1FGZA 3VOQA 1UNQA 2J0MA 3KSYA 2Y7BA 1QQGA 1XD4A 1FHOA 5DHAB 3MPXA 2DN6A 1KZGA 2LKOA 1FB8A 2AEHA 1PLSA 2RSGA 2D9ZA 4WJ7A 2OTXA 3P6AA 1Z87A 1ZM0A 1UPRA 3SO6A 2CAYA 2I5FA 2H7EA 2Q13A 3PG7A 2P0FA 2DX5A 2AL6A 1U29A 4F7GA 5L81A 1NU2A 3OANA 1EGXA 3ODWA 3A8PA 1MK7B 4CHMA 4DXAB 2Z0PA 1MPHA 2MDXA 5J3TA 4C0AA 3SNHA 1XODA 4K17A 3TFMA 5JHHA 4NSWA 2MFQA 1PMSA 5JP4A 5HE0A 1IRSA 2W2XD 4HAVB 2DKPA 3QWMA 5CLQB 1X11A 2CRFA 5DHFB 2LYDA 2DTCA 2DYNA 2YF0A 2DA0A 2YT0A 3GYOA 2Y8FA 3QIJA 2UZRA 2YVCA 1SGHA 1X86A 5HE2A 2KCJA 2P8VA 2D10A 2DHIA 3MDBC 3T06A 1P3RA 1X1GA 2RGNB 3V5WA 2X18A 1EVHA 2D9XA 1GC6A 2LOZA 1PFJA 1DROA 1ZVRA 2EMSA 4GZUA 1XKEA 1NTVA 4WSFA 4F7UP 5LOPB 4HB0B 2GJYA 3M1IB 2UVMA 2QKMA 4HAZB 3SV1A 5GOWB 1MIXA 3O96A 3ULBA 3A8QA 1P5TA 1WGUA 4DX90 4EMOA 3AU5A 5CLLB 1UEFA 1K5GB 2KUPA 4HAXB 2K2JA 3ZDTA 1OQNA 3P7ZA 2JP2A 4KHBB 3SYXA 4A6FA 3FSSA 4DX8A 1X05A 3TW1A 4Y94A 2CY5A 2RUKB 2D9YA 1N3HA 1BWNA 5J3YA 2I1JA 2G35A 4K81A 4CHJA 4ZRIA 5FI0A 4D0NB 1M7EA 4HAYB 5LONB 2HTHB 4EJNA 1EF1A 3D8FA 2Z0OA 2W2XC 4EKUA 2ELBA 1X1FA 4DBBA 3NSUA 1V5MA 2Z0QA 1DDMA 3PVLA 2I1KA 3ODOA 1WG7A 2QKLA 3WYFB 2COCA 5D3WA 4IFSA 3KY9A 1AWEA 1MIZB 4A5KA 1UNRA 4HAUB 1ZSQA 4KAXB 2RVBB 4YONA 5D3XA 2VSZA 1EAZA 4HB4B 4WVFB 1QC6A 5C5BB 5C16A 3F0WA 2MWNB 1UPQA 2NZ8B 2OQBA 4KVGB 2ROVA 4A6HA 1H10A 2LG1A 3DXEA 1B55A 2ROZB 5KQ1A 2HE7A 2GS0A 2R09A 2YSZA 5JLJB 5J3QA 4HAWB 2YT1A 2J0KA 1J0WA 3TVVA 1WI1A 2ADZA 2H7DA 1OY2A 1WJ1A 2V76A 2K2UA 1UNPA 1V61A 4MT7A 1XR0B 2ELAA 3AJ4A 2EMTA 2FJLA 1I2HA 3X23A 3CIKA 2GCLA 5HE1A
chains in the Genus database with same CATH superfamily
2YT2A 1FAOA 5IRSA 4Z2MB 1J19A 1RRPB 3HIEA 1U27A 4L6EA 4HATB 1BTKA 1H4RA 1GG3A 4IAPA 2UZSA 2D2QA 1U5DA 4TYZA 2PZ1A 5C79A 1NTYA 4ZRJA 3BJIA 1RJ2A 2M38A 4NY0A 4K2OA 1WGQA 4KHOA 5DIFB 5D27A 2E2XA 3WA0A 1TQZA 3KRXA 1AQCA 4GPTB 1TXDA 4PNKA 3CXBB 5M4YB 1FHXA 3GYPA 1FOEA 2COFA 2GCJA 2VRWB 3BINA 3KZ1A 3F5RA 2P0DA 4OT1A 1BTNA 3RCPA 2N23A 2L2IA 3D8DA 3PZDA 1ZC4B 2GUMA 5DI9B 4H8SA 2NMBA 1P6SA 5D3YA 5DH9B 4CYEA 4F7HA 2XQNM 1W1HA 4GN1A 4P7IA 2K00A 1W1GA 1U5FA 2ZPYA 1MK9B 4QJ3B 3TO1A 3A98B 3TCAA 2RLOA 4ZRKA 2I5CA 1T77A 4MK0A 3SUZA 2D11A 3ML4A 3PEGA 1V89A 2DHKA 1DDVA 4YL8A 3A58A 1GC7A 1WVHA 4QXAB 2YRYA 2IFSA 3LJUX 1MAIA 2EJ8A 2Z13A 2DFKA 1ISNA 4XWXA 5KQ4A 1XX0A 2J0JA 2BCJA 2DKQA 2D4QA 2VKIA 4DIXA 1MKEA 4MY6A 1TJ6A 2R0DA 1Y19B 4GXBA 1XCGA 1V5PA 3G9WA 4KHAA 1DYNA 1U5EA 1E5WA 3HQCA 3IVFA 5HE3A 5C6RA 1OMWA 2YS5A 1I7AA 4A6KA 3HSAA 3PP2A 3UZTA 2RNRB 4PQ0A 2YS1A 4IOYX 3N7CA 4TKNA 3NWFA 5EFXA 5D3VA 1W1DA 1U5GA 3PSCA 3U8ZA 2W2WA 1NI2A 3DXCA 2MKRA 3FM8C 2CODA 4HDOA 5FI1A 2IYBA 2Y8GA 1Q67A 3U7DA 3FEHA 1LB1A 2D9VA 1DBHA 3HW2B 1FHWA 2L1CA 4A6FB 3PVWA 3QBVB 4GMVA 2EC1A 2LULA 3ZVRA 1K5DB 3KRWA 4HHVA 1KZ7A 1BAKA 2DHJA 1DDWA 2K8EA 3DXDA 4OSNA 1KI1B 3ULCA 2KGXB 3NWAA 3HK0A 4HB3B 1Y5OA 2CY4A 3U12A 3DCXA 3AU4A 2COAA 1V88A 4BBKA 1ZC3B 4HDQA 2N0YA 3ODXA 1WJMA 2Z4DA 2K49A 5KCVA 4HB2B 1FGYA 2DLWA 2YS3A 1V5UA 2J59M 2M14A 2D9WA 5C5BA 4B6HA 4D6WA 2NBVA 4GMXB 3VIAA 4Z2NA 5JHGA 2DX1A 4K2PA 3D8EA 3PVUA 2DYQA 2LOXA 1LW3A 2P0HA 1SHCA 1M7RA 1U2BA 1FGZA 3VOQA 1UNQA 2J0MA 3KSYA 2Y7BA 5I2SA 1QQGA 1XD4A 1FHOA 5DHAB 3MPXA 2DN6A 1KZGA 2LKOA 1FB8A 2AEHA 1PLSA 2RSGA 2D9ZA 4WJ7A 2OTXA 3P6AA 1Z87A 2RRFA 1ZM0A 1UPRA 3SO6A 2CAYA 2I5FA 2H7EA 2Q13A 3PG7A 2P0FA 3NWDA 2DX5A 2AL6A 1U29A 4F7GA 5L81A 1NU2A 3OANA 2FJUB 1EGXA 3ODWA 3A8PA 1MK7B 4CHMA 4DXAB 2Z0PA 1MPHA 2MDXA 5J3TA 4C0AA 3SNHA 1XODA 4K17A 5I2MA 3TFMA 5JHHA 4NSWA 2MFQA 1PMSA 5JP4A 5HE0A 1IRSA 4KHBA 2W2XD 4HAVB 2DKPA 3QWMA 5CLQB 1X11A 2ZKMX 2CRFA 5DHFB 2LYDA 2DTCA 2DYNA 2YF0A 2DA0A 2YT0A 3FVCA 3GYOA 2Y8FA 3QIJA 2UZRA 2YVCA 1SGHA 1X86A 5HE2A 2KCJA 2P8VA 2D10A 2KIGA 2DHIA 5LG4B 3MDBC 3T06A 1P3RA 1X1GA 2RGNB 3V5WA 2X18A 1EVHA 2D9XA 1GC6A 2LOZA 1PFJA 1DROA 1ZVRA 2EMSA 4GZUA 1XKEA 1NTVA 4WSFA 4F7UP 5LOPB 4HB0B 2GJYA 3M1IB 2UVMA 2KIEA 2QKMA 4HAZB 3SV1A 4GOUA 5GOWB 1MIXA 3O96A 3ULBA 3A8QA 1P5TA 1WGUA 4DX90 3B77A 4EMOA 3AU5A 5CLLB 1UEFA 1K5GB 2KUPA 4HAXB 2K2JA 3ZDTA 1OQNA 3P7ZA 2JP2A 4KHBB 3SYXA 4A6FA 3FSSA 4DX8A 1X05A 3TW1A 4Y94A 2CY5A 2RUKB 2D9YA 1N3HA 1BWNA 5J3YA 2I1JA 2KR0A 2G35A 4K81A 4CHJA 4ZRIA 5FI0A 4D0NB 1M7EA 4HAYB 5LONB 2HTHB 4EJNA 1EF1A 3D8FA 4QJ5B 2Z0OA 2W2XC 4EKUA 2ELBA 1X1FA 4DBBA 3NSUA 1V5MA 2Z0QA 1DDMA 3PVLA 2I1KA 3ODOA 1WG7A 2QKLA 1MI1A 3WYFB 2COCA 5D3WA 4IFSA 3KY9A 1AWEA 1MIZB 4A5KA 4CSQA 1UNRA 4HAUB 1ZSQA 4L1RA 3OHMB 2Z14A 4KAXB 2RVBB 4YONA 5D3XA 4QJ4B 2VSZA 1EAZA 4HB4B 2KUQA 4WVFB 1QC6A 5C5BB 5C16A 3F0WA 2MWNB 2Z59A 1UPQA 2NZ8B 2OQBA 1ZYIA 4KVGB 2ROVA 4A6HA 3NW8A 1H10A 2LG1A 3DXEA 1B55A 2ROZB 5KQ1A 2R2YA 2HE7A 2GS0A 2R09A 2YSZA 5JLJB 5J3QA 4HAWB 2YT1A 2J0KA 1J0WA 3TVVA 1WI1A 2ADZA 2H7DA 1OY2A 1WJ1A 2V76A 2K2UA 4GNKB 4HSIA 1UNPA 1V61A 4MT7A 1XR0B 2ELAA 3AJ4A 2EMTA 2FJLA 1I2HA 3X23A 3CIKA 2GCLA 5HE1A
chains in the Genus database with same CATH topology
1FAOA 4Z2MB 1J19A 1RRPB 1U27A 4L6EA 4HATB 1BTKA 1H4RA 1GG3A 4IAPA 2UZSA 2D2QA 1U5DA 4TYZA 2PZ1A 5C79A 1NTYA 4ZRJA 3BJIA 1RJ2A 2M38A 4NY0A 4K2OA 1WGQA 4KHOA 5DIFB 5D27A 2E2XA 3WA0A 1TQZA 3KRXA 1AQCA 4GPTB 1TXDA 4PNKA 3CXBB 1FHXA 3GYPA 1FOEA 2COFA 2GCJA 2VRWB 3BINA 3KZ1A 3F5RA 2P0DA 1BTNA 3RCPA 2N23A 2L2IA 3D8DA 3PZDA 1ZC4B 5DI9B 4H8SA 2NMBA 1P6SA 5D3YA 5DH9B 4CYEA 4F7HA 2XQNM 1W1HA 4GN1A 4P7IA 2K00A 1W1GA 1U5FA 2ZPYA 1MK9B 3TO1A 3A98B 3TCAA 2RLOA 4ZRKA 2I5CA 4MK0A 3SUZA 2D11A 3ML4A 3PEGA 1V89A 2DHKA 1DDVA 4YL8A 1GC7A 1WVHA 2YRYA 2IFSA 3LJUX 1MAIA 2EJ8A 2DFKA 1ISNA 4XWXA 5KQ4A 1XX0A 2J0JA 2BCJA 2DKQA 2D4QA 2VKIA 1MKEA 4MY6A 1TJ6A 2R0DA 1Y19B 4GXBA 1XCGA 1V5PA 3G9WA 4KHAA 1DYNA 1U5EA 1E5WA 3HQCA 3IVFA 5HE3A 5C6RA 1OMWA 2YS5A 1I7AA 4A6KA 3UZTA 3PP2A 2RNRB 4PQ0A 2YS1A 4IOYX 3N7CA 4TKNA 5EFXA 5D3VA 1W1DA 1U5GA 3PSCA 3U8ZA 2W2WA 1NI2A 3DXCA 2MKRA 3FM8C 2CODA 4HDOA 5FI1A 2IYBA 2Y8GA 1Q67A 3U7DA 3FEHA 1LB1A 2D9VA 1DBHA 3HW2B 1FHWA 2L1CA 4A6FB 3PVWA 3QBVB 4GMVA 2EC1A 2LULA 3ZVRA 1K5DB 3KRWA 4HHVA 1KZ7A 1BAKA 2DHJA 1DDWA 3DXDA 1KI1B 3ULCA 2KGXB 3HK0A 4HB3B 1Y5OA 2CY4A 3AU4A 2COAA 1V88A 4BBKA 1ZC3B 4HDQA 2N0YA 3ODXA 1WJMA 5KCVA 4HB2B 1FGYA 2DLWA 2YS3A 1V5UA 2J59M 2M14A 2D9WA 5C5BA 4B6HA 4GMXB 3VIAA 4Z2NA 5JHGA 2DX1A 4K2PA 3D8EA 3PVUA 2DYQA 2LOXA 1LW3A 2P0HA 1SHCA 1M7RA 1U2BA 1FGZA 3VOQA 1UNQA 2J0MA 3KSYA 2Y7BA 1QQGA 1XD4A 1FHOA 5DHAB 3MPXA 2DN6A 1KZGA 2LKOA 1FB8A 2AEHA 1PLSA 2RSGA 2D9ZA 4WJ7A 2OTXA 3P6AA 1Z87A 1ZM0A 1UPRA 3SO6A 2CAYA 2I5FA 2H7EA 2Q13A 3PG7A 2P0FA 2DX5A 2AL6A 1U29A 4F7GA 5L81A 1NU2A 3OANA 1EGXA 3ODWA 3A8PA 1MK7B 4CHMA 4DXAB 2Z0PA 1MPHA 2MDXA 5J3TA 4C0AA 3SNHA 1XODA 4K17A 3TFMA 5JHHA 4NSWA 2MFQA 1PMSA 5JP4A 5HE0A 1IRSA 2W2XD 4HAVB 2DKPA 3QWMA 5CLQB 1X11A 2CRFA 5DHFB 2LYDA 2DTCA 2DYNA 2YF0A 2DA0A 2YT0A 3GYOA 2Y8FA 3QIJA 2UZRA 2YVCA 1SGHA 1X86A 5HE2A 2KCJA 2P8VA 2D10A 2DHIA 3MDBC 3T06A 1P3RA 1X1GA 2RGNB 3V5WA 2X18A 1EVHA 2D9XA 1GC6A 2LOZA 1PFJA 1DROA 1ZVRA 2EMSA 4GZUA 1XKEA 1NTVA 4WSFA 4F7UP 5LOPB 4HB0B 2GJYA 3M1IB 2UVMA 2QKMA 4HAZB 3SV1A 5GOWB 1MIXA 3O96A 3ULBA 3A8QA 1P5TA 1WGUA 4DX90 4EMOA 3AU5A 5CLLB 1UEFA 1K5GB 2KUPA 4HAXB 2K2JA 3ZDTA 1OQNA 3P7ZA 2JP2A 4KHBB 3SYXA 4A6FA 3FSSA 4DX8A 1X05A 3TW1A 4Y94A 2CY5A 2RUKB 2D9YA 1N3HA 1BWNA 5J3YA 2I1JA 2G35A 4K81A 4CHJA 4ZRIA 5FI0A 4D0NB 1M7EA 4HAYB 5LONB 2HTHB 4EJNA 1EF1A 3D8FA 2Z0OA 2W2XC 4EKUA 2ELBA 1X1FA 4DBBA 3NSUA 1V5MA 2Z0QA 1DDMA 3PVLA 2I1KA 3ODOA 1WG7A 2QKLA 3WYFB 2COCA 5D3WA 4IFSA 3KY9A 1AWEA 1MIZB 4A5KA 1UNRA 4HAUB 1ZSQA 4KAXB 2RVBB 4YONA 5D3XA 2VSZA 1EAZA 4HB4B 4WVFB 1QC6A 5C5BB 5C16A 3F0WA 2MWNB 1UPQA 2NZ8B 2OQBA 4KVGB 2ROVA 4A6HA 1H10A 2LG1A 3DXEA 1B55A 2ROZB 5KQ1A 2HE7A 2GS0A 2R09A 2YSZA 5JLJB 5J3QA 4HAWB 2YT1A 2J0KA 1J0WA 3TVVA 1WI1A 2ADZA 2H7DA 1OY2A 1WJ1A 2V76A 2K2UA 1UNPA 1V61A 4MT7A 1XR0B 2ELAA 3AJ4A 2EMTA 2FJLA 1I2HA 3X23A 3CIKA 2GCLA 5HE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FAO A;  4Z2M B;  1J19 A;  1RRP B;  1U27 A;  4L6E A;  4HAT B;  1BTK A;  1H4R A;  1GG3 A;  4IAP A;  2UZS A;  2D2Q A;  1U5D A;  4TYZ A;  2PZ1 A;  5C79 A;  1NTY A;  4ZRJ A;  3BJI A;  1RJ2 A;  2M38 A;  4NY0 A;  4K2O A;  1WGQ A;  4KHO A;  5DIF B;  5D27 A;  2E2X A;  3WA0 A;  1TQZ A;  3KRX A;  1AQC A;  4GPT B;  1TXD A;  4PNK A;  3CXB B;  1FHX A;  3GYP A;  1FOE A;  2COF A;  2GCJ A;  2VRW B;  3BIN A;  3KZ1 A;  3F5R A;  2P0D A;  1BTN A;  3RCP A;  2N23 A;  2L2I A;  3D8D A;  3PZD A;  1ZC4 B;  5DI9 B;  4H8S A;  2NMB A;  1P6S A;  5D3Y A;  5DH9 B;  4CYE A;  4F7H A;  2XQN M;  1W1H A;  4GN1 A;  4P7I A;  2K00 A;  1W1G A;  1U5F A;  2ZPY A;  1MK9 B;  3TO1 A;  3A98 B;  3TCA A;  2RLO A;  4ZRK A;  2I5C A;  4MK0 A;  3SUZ A;  2D11 A;  3ML4 A;  3PEG A;  1V89 A;  2DHK A;  1DDV A;  4YL8 A;  1GC7 A;  1WVH A;  2YRY A;  2IFS A;  3LJU X;  1MAI A;  2EJ8 A;  2DFK A;  1ISN A;  4XWX A;  5KQ4 A;  1XX0 A;  2J0J A;  2BCJ A;  2DKQ A;  2D4Q A;  2VKI A;  1MKE A;  4MY6 A;  1TJ6 A;  2R0D A;  1Y19 B;  4GXB A;  1XCG A;  1V5P A;  3G9W A;  4KHA A;  1DYN A;  1U5E A;  1E5W A;  3HQC A;  3IVF A;  5HE3 A;  5C6R A;  1OMW A;  2YS5 A;  1I7A A;  4A6K A;  3UZT A;  3PP2 A;  2RNR B;  4PQ0 A;  2YS1 A;  4IOY X;  3N7C A;  4TKN A;  5EFX A;  5D3V A;  1W1D A;  1U5G A;  3PSC A;  3U8Z A;  2W2W A;  1NI2 A;  3DXC A;  2MKR A;  3FM8 C;  2COD A;  4HDO A;  5FI1 A;  2IYB A;  2Y8G A;  1Q67 A;  3U7D A;  3FEH A;  1LB1 A;  2D9V A;  1DBH A;  3HW2 B;  1FHW A;  2L1C A;  4A6F B;  3PVW A;  3QBV B;  4GMV A;  2EC1 A;  2LUL A;  3ZVR A;  1K5D B;  3KRW A;  4HHV A;  1KZ7 A;  1BAK A;  2DHJ A;  1DDW A;  3DXD A;  1KI1 B;  3ULC A;  2KGX B;  3HK0 A;  4HB3 B;  1Y5O A;  2CY4 A;  3AU4 A;  2COA A;  1V88 A;  4BBK A;  1ZC3 B;  4HDQ A;  2N0Y A;  3ODX A;  1WJM A;  5KCV A;  4HB2 B;  1FGY A;  2DLW A;  2YS3 A;  1V5U A;  2J59 M;  2M14 A;  2D9W A;  5C5B A;  4B6H A;  4GMX B;  3VIA A;  4Z2N A;  5JHG A;  2DX1 A;  4K2P A;  3D8E A;  3PVU A;  2DYQ A;  2LOX A;  1LW3 A;  2P0H A;  1SHC A;  1M7R A;  1U2B A;  1FGZ A;  3VOQ A;  1UNQ A;  2J0M A;  3KSY A;  2Y7B A;  1QQG A;  1XD4 A;  1FHO A;  5DHA B;  3MPX A;  2DN6 A;  1KZG A;  2LKO A;  1FB8 A;  2AEH A;  1PLS A;  2RSG A;  2D9Z A;  4WJ7 A;  2OTX A;  3P6A A;  1Z87 A;  1ZM0 A;  1UPR A;  3SO6 A;  2CAY A;  2I5F A;  2H7E A;  2Q13 A;  3PG7 A;  2P0F A;  2DX5 A;  2AL6 A;  1U29 A;  4F7G A;  5L81 A;  1NU2 A;  3OAN A;  1EGX A;  3ODW A;  3A8P A;  1MK7 B;  4CHM A;  4DXA B;  2Z0P A;  1MPH A;  2MDX A;  5J3T A;  4C0A A;  3SNH A;  1XOD A;  4K17 A;  3TFM A;  5JHH A;  4NSW A;  2MFQ A;  1PMS A;  5JP4 A;  5HE0 A;  1IRS A;  2W2X D;  4HAV B;  2DKP A;  3QWM A;  5CLQ B;  1X11 A;  2CRF A;  5DHF B;  2LYD A;  2DTC A;  2DYN A;  2YF0 A;  2DA0 A;  2YT0 A;  3GYO A;  2Y8F A;  3QIJ A;  2UZR A;  2YVC A;  1SGH A;  1X86 A;  5HE2 A;  2KCJ A;  2P8V A;  2D10 A;  2DHI A;  3MDB C;  3T06 A;  1P3R A;  1X1G A;  2RGN B;  3V5W A;  2X18 A;  1EVH A;  2D9X A;  1GC6 A;  2LOZ A;  1PFJ A;  1DRO A;  1ZVR A;  2EMS A;  4GZU A;  1XKE A;  1NTV A;  4WSF A;  4F7U P;  5LOP B;  4HB0 B;  2GJY A;  3M1I B;  2UVM A;  2QKM A;  4HAZ B;  3SV1 A;  5GOW B;  1MIX A;  3O96 A;  3ULB A;  3A8Q A;  1P5T A;  1WGU A;  4DX9 0;  4EMO A;  3AU5 A;  5CLL B;  1UEF A;  1K5G B;  2KUP A;  4HAX B;  2K2J A;  3ZDT A;  1OQN A;  3P7Z A;  2JP2 A;  4KHB B;  3SYX A;  4A6F A;  3FSS A;  4DX8 A;  1X05 A;  3TW1 A;  4Y94 A;  2CY5 A;  2RUK B;  2D9Y A;  1N3H A;  1BWN A;  5J3Y A;  2I1J A;  2G35 A;  4K81 A;  4CHJ A;  4ZRI A;  5FI0 A;  4D0N B;  1M7E A;  4HAY B;  5LON B;  2HTH B;  4EJN A;  1EF1 A;  3D8F A;  2Z0O A;  2W2X C;  4EKU A;  2ELB A;  1X1F A;  4DBB A;  3NSU A;  1V5M A;  2Z0Q A;  1DDM A;  3PVL A;  2I1K A;  3ODO A;  1WG7 A;  2QKL A;  3WYF B;  2COC A;  5D3W A;  4IFS A;  3KY9 A;  1AWE A;  1MIZ B;  4A5K A;  1UNR A;  4HAU B;  1ZSQ A;  4KAX B;  2RVB B;  4YON A;  5D3X A;  2VSZ A;  1EAZ A;  4HB4 B;  4WVF B;  1QC6 A;  5C5B B;  5C16 A;  3F0W A;  2MWN B;  1UPQ A;  2NZ8 B;  2OQB A;  4KVG B;  2ROV A;  4A6H A;  1H10 A;  2LG1 A;  3DXE A;  1B55 A;  2ROZ B;  5KQ1 A;  2HE7 A;  2GS0 A;  2R09 A;  2YSZ A;  5JLJ B;  5J3Q A;  4HAW B;  2YT1 A;  2J0K A;  1J0W A;  3TVV A;  1WI1 A;  2ADZ A;  2H7D A;  1OY2 A;  1WJ1 A;  2V76 A;  2K2U A;  1UNP A;  1V61 A;  4MT7 A;  1XR0 B;  2ELA A;  3AJ4 A;  2EMT A;  2FJL A;  1I2H A;  3X23 A;  3CIK A;  2GCL A;  5HE1 A; 
#chains in the Genus database with same CATH topology
 2YT2 A;  1FAO A;  5IRS A;  4Z2M B;  1J19 A;  1RRP B;  3HIE A;  1U27 A;  4L6E A;  4HAT B;  1BTK A;  1H4R A;  1GG3 A;  4IAP A;  2UZS A;  2D2Q A;  1U5D A;  4TYZ A;  2PZ1 A;  5C79 A;  1NTY A;  4ZRJ A;  3BJI A;  1RJ2 A;  2M38 A;  4NY0 A;  4K2O A;  1WGQ A;  4KHO A;  5DIF B;  5D27 A;  2E2X A;  3WA0 A;  1TQZ A;  3KRX A;  1AQC A;  4GPT B;  1TXD A;  4PNK A;  3CXB B;  5M4Y B;  1FHX A;  3GYP A;  1FOE A;  2COF A;  2GCJ A;  2VRW B;  3BIN A;  3KZ1 A;  3F5R A;  2P0D A;  4OT1 A;  1BTN A;  3RCP A;  2N23 A;  2L2I A;  3D8D A;  3PZD A;  1ZC4 B;  2GUM A;  5DI9 B;  4H8S A;  2NMB A;  1P6S A;  5D3Y A;  5DH9 B;  4CYE A;  4F7H A;  2XQN M;  1W1H A;  4GN1 A;  4P7I A;  2K00 A;  1W1G A;  1U5F A;  2ZPY A;  1MK9 B;  4QJ3 B;  3TO1 A;  3A98 B;  3TCA A;  2RLO A;  4ZRK A;  2I5C A;  1T77 A;  4MK0 A;  3SUZ A;  2D11 A;  3ML4 A;  3PEG A;  1V89 A;  2DHK A;  1DDV A;  4YL8 A;  3A58 A;  1GC7 A;  1WVH A;  4QXA B;  2YRY A;  2IFS A;  3LJU X;  1MAI A;  2EJ8 A;  2Z13 A;  2DFK A;  1ISN A;  4XWX A;  5KQ4 A;  1XX0 A;  2J0J A;  2BCJ A;  2DKQ A;  2D4Q A;  2VKI A;  4DIX A;  1MKE A;  4MY6 A;  1TJ6 A;  2R0D A;  1Y19 B;  4GXB A;  1XCG A;  1V5P A;  3G9W A;  4KHA A;  1DYN A;  1U5E A;  1E5W A;  3HQC A;  3IVF A;  5HE3 A;  5C6R A;  1OMW A;  2YS5 A;  1I7A A;  4A6K A;  3HSA A;  3PP2 A;  3UZT A;  2RNR B;  4PQ0 A;  2YS1 A;  4IOY X;  3N7C A;  4TKN A;  3NWF A;  5EFX A;  5D3V A;  1W1D A;  1U5G A;  3PSC A;  3U8Z A;  2W2W A;  1NI2 A;  3DXC A;  2MKR A;  3FM8 C;  2COD A;  4HDO A;  5FI1 A;  2IYB A;  2Y8G A;  1Q67 A;  3U7D A;  3FEH A;  1LB1 A;  2D9V A;  1DBH A;  3HW2 B;  1FHW A;  2L1C A;  4A6F B;  3PVW A;  3QBV B;  4GMV A;  2EC1 A;  2LUL A;  3ZVR A;  1K5D B;  3KRW A;  4HHV A;  1KZ7 A;  1BAK A;  2DHJ A;  1DDW A;  2K8E A;  3DXD A;  4OSN A;  1KI1 B;  3ULC A;  2KGX B;  3NWA A;  3HK0 A;  4HB3 B;  1Y5O A;  2CY4 A;  3U12 A;  3DCX A;  3AU4 A;  2COA A;  1V88 A;  4BBK A;  1ZC3 B;  4HDQ A;  2N0Y A;  3ODX A;  1WJM A;  2Z4D A;  2K49 A;  5KCV A;  4HB2 B;  1FGY A;  2DLW A;  2YS3 A;  1V5U A;  2J59 M;  2M14 A;  2D9W A;  5C5B A;  4B6H A;  4D6W A;  2NBV A;  4GMX B;  3VIA A;  4Z2N A;  5JHG A;  2DX1 A;  4K2P A;  3D8E A;  3PVU A;  2DYQ A;  2LOX A;  1LW3 A;  2P0H A;  1SHC A;  1M7R A;  1U2B A;  1FGZ A;  3VOQ A;  1UNQ A;  2J0M A;  3KSY A;  2Y7B A;  5I2S A;  1QQG A;  1XD4 A;  1FHO A;  5DHA B;  3MPX A;  2DN6 A;  1KZG A;  2LKO A;  1FB8 A;  2AEH A;  1PLS A;  2RSG A;  2D9Z A;  4WJ7 A;  2OTX A;  3P6A A;  1Z87 A;  2RRF A;  1ZM0 A;  1UPR A;  3SO6 A;  2CAY A;  2I5F A;  2H7E A;  2Q13 A;  3PG7 A;  2P0F A;  3NWD A;  2DX5 A;  2AL6 A;  1U29 A;  4F7G A;  5L81 A;  1NU2 A;  3OAN A;  2FJU B;  1EGX A;  3ODW A;  3A8P A;  1MK7 B;  4CHM A;  4DXA B;  2Z0P A;  1MPH A;  2MDX A;  5J3T A;  4C0A A;  3SNH A;  1XOD A;  4K17 A;  5I2M A;  3TFM A;  5JHH A;  4NSW A;  2MFQ A;  1PMS A;  5JP4 A;  5HE0 A;  1IRS A;  4KHB A;  2W2X D;  4HAV B;  2DKP A;  3QWM A;  5CLQ B;  1X11 A;  2ZKM X;  2CRF A;  5DHF B;  2LYD A;  2DTC A;  2DYN A;  2YF0 A;  2DA0 A;  2YT0 A;  3FVC A;  3GYO A;  2Y8F A;  3QIJ A;  2UZR A;  2YVC A;  1SGH A;  1X86 A;  5HE2 A;  2KCJ A;  2P8V A;  2D10 A;  2KIG A;  2DHI A;  5LG4 B;  3MDB C;  3T06 A;  1P3R A;  1X1G A;  2RGN B;  3V5W A;  2X18 A;  1EVH A;  2D9X A;  1GC6 A;  2LOZ A;  1PFJ A;  1DRO A;  1ZVR A;  2EMS A;  4GZU A;  1XKE A;  1NTV A;  4WSF A;  4F7U P;  5LOP B;  4HB0 B;  2GJY A;  3M1I B;  2UVM A;  2KIE A;  2QKM A;  4HAZ B;  3SV1 A;  4GOU A;  5GOW B;  1MIX A;  3O96 A;  3ULB A;  3A8Q A;  1P5T A;  1WGU A;  4DX9 0;  3B77 A;  4EMO A;  3AU5 A;  5CLL B;  1UEF A;  1K5G B;  2KUP A;  4HAX B;  2K2J A;  3ZDT A;  1OQN A;  3P7Z A;  2JP2 A;  4KHB B;  3SYX A;  4A6F A;  3FSS A;  4DX8 A;  1X05 A;  3TW1 A;  4Y94 A;  2CY5 A;  2RUK B;  2D9Y A;  1N3H A;  1BWN A;  5J3Y A;  2I1J A;  2KR0 A;  2G35 A;  4K81 A;  4CHJ A;  4ZRI A;  5FI0 A;  4D0N B;  1M7E A;  4HAY B;  5LON B;  2HTH B;  4EJN A;  1EF1 A;  3D8F A;  4QJ5 B;  2Z0O A;  2W2X C;  4EKU A;  2ELB A;  1X1F A;  4DBB A;  3NSU A;  1V5M A;  2Z0Q A;  1DDM A;  3PVL A;  2I1K A;  3ODO A;  1WG7 A;  2QKL A;  1MI1 A;  3WYF B;  2COC A;  5D3W A;  4IFS A;  3KY9 A;  1AWE A;  1MIZ B;  4A5K A;  4CSQ A;  1UNR A;  4HAU B;  1ZSQ A;  4L1R A;  3OHM B;  2Z14 A;  4KAX B;  2RVB B;  4YON A;  5D3X A;  4QJ4 B;  2VSZ A;  1EAZ A;  4HB4 B;  2KUQ A;  4WVF B;  1QC6 A;  5C5B B;  5C16 A;  3F0W A;  2MWN B;  2Z59 A;  1UPQ A;  2NZ8 B;  2OQB A;  1ZYI A;  4KVG B;  2ROV A;  4A6H A;  3NW8 A;  1H10 A;  2LG1 A;  3DXE A;  1B55 A;  2ROZ B;  5KQ1 A;  2R2Y A;  2HE7 A;  2GS0 A;  2R09 A;  2YSZ A;  5JLJ B;  5J3Q A;  4HAW B;  2YT1 A;  2J0K A;  1J0W A;  3TVV A;  1WI1 A;  2ADZ A;  2H7D A;  1OY2 A;  1WJ1 A;  2V76 A;  2K2U A;  4GNK B;  4HSI A;  1UNP A;  1V61 A;  4MT7 A;  1XR0 B;  2ELA A;  3AJ4 A;  2EMT A;  2FJL A;  1I2H A;  3X23 A;  3CIK A;  2GCL A;  5HE1 A; 
#chains in the Genus database with same CATH homology
 1FAO A;  4Z2M B;  1J19 A;  1RRP B;  1U27 A;  4L6E A;  4HAT B;  1BTK A;  1H4R A;  1GG3 A;  4IAP A;  2UZS A;  2D2Q A;  1U5D A;  4TYZ A;  2PZ1 A;  5C79 A;  1NTY A;  4ZRJ A;  3BJI A;  1RJ2 A;  2M38 A;  4NY0 A;  4K2O A;  1WGQ A;  4KHO A;  5DIF B;  5D27 A;  2E2X A;  3WA0 A;  1TQZ A;  3KRX A;  1AQC A;  4GPT B;  1TXD A;  4PNK A;  3CXB B;  1FHX A;  3GYP A;  1FOE A;  2COF A;  2GCJ A;  2VRW B;  3BIN A;  3KZ1 A;  3F5R A;  2P0D A;  1BTN A;  3RCP A;  2N23 A;  2L2I A;  3D8D A;  3PZD A;  1ZC4 B;  5DI9 B;  4H8S A;  2NMB A;  1P6S A;  5D3Y A;  5DH9 B;  4CYE A;  4F7H A;  2XQN M;  1W1H A;  4GN1 A;  4P7I A;  2K00 A;  1W1G A;  1U5F A;  2ZPY A;  1MK9 B;  3TO1 A;  3A98 B;  3TCA A;  2RLO A;  4ZRK A;  2I5C A;  4MK0 A;  3SUZ A;  2D11 A;  3ML4 A;  3PEG A;  1V89 A;  2DHK A;  1DDV A;  4YL8 A;  1GC7 A;  1WVH A;  2YRY A;  2IFS A;  3LJU X;  1MAI A;  2EJ8 A;  2DFK A;  1ISN A;  4XWX A;  5KQ4 A;  1XX0 A;  2J0J A;  2BCJ A;  2DKQ A;  2D4Q A;  2VKI A;  1MKE A;  4MY6 A;  1TJ6 A;  2R0D A;  1Y19 B;  4GXB A;  1XCG A;  1V5P A;  3G9W A;  4KHA A;  1DYN A;  1U5E A;  1E5W A;  3HQC A;  3IVF A;  5HE3 A;  5C6R A;  1OMW A;  2YS5 A;  1I7A A;  4A6K A;  3UZT A;  3PP2 A;  2RNR B;  4PQ0 A;  2YS1 A;  4IOY X;  3N7C A;  4TKN A;  5EFX A;  5D3V A;  1W1D A;  1U5G A;  3PSC A;  3U8Z A;  2W2W A;  1NI2 A;  3DXC A;  2MKR A;  3FM8 C;  2COD A;  4HDO A;  5FI1 A;  2IYB A;  2Y8G A;  1Q67 A;  3U7D A;  3FEH A;  1LB1 A;  2D9V A;  1DBH A;  3HW2 B;  1FHW A;  2L1C A;  4A6F B;  3PVW A;  3QBV B;  4GMV A;  2EC1 A;  2LUL A;  3ZVR A;  1K5D B;  3KRW A;  4HHV A;  1KZ7 A;  1BAK A;  2DHJ A;  1DDW A;  3DXD A;  1KI1 B;  3ULC A;  2KGX B;  3HK0 A;  4HB3 B;  1Y5O A;  2CY4 A;  3AU4 A;  2COA A;  1V88 A;  4BBK A;  1ZC3 B;  4HDQ A;  2N0Y A;  3ODX A;  1WJM A;  5KCV A;  4HB2 B;  1FGY A;  2DLW A;  2YS3 A;  1V5U A;  2J59 M;  2M14 A;  2D9W A;  5C5B A;  4B6H A;  4GMX B;  3VIA A;  4Z2N A;  5JHG A;  2DX1 A;  4K2P A;  3D8E A;  3PVU A;  2DYQ A;  2LOX A;  1LW3 A;  2P0H A;  1SHC A;  1M7R A;  1U2B A;  1FGZ A;  3VOQ A;  1UNQ A;  2J0M A;  3KSY A;  2Y7B A;  1QQG A;  1XD4 A;  1FHO A;  5DHA B;  3MPX A;  2DN6 A;  1KZG A;  2LKO A;  1FB8 A;  2AEH A;  1PLS A;  2RSG A;  2D9Z A;  4WJ7 A;  2OTX A;  3P6A A;  1Z87 A;  1ZM0 A;  1UPR A;  3SO6 A;  2CAY A;  2I5F A;  2H7E A;  2Q13 A;  3PG7 A;  2P0F A;  2DX5 A;  2AL6 A;  1U29 A;  4F7G A;  5L81 A;  1NU2 A;  3OAN A;  1EGX A;  3ODW A;  3A8P A;  1MK7 B;  4CHM A;  4DXA B;  2Z0P A;  1MPH A;  2MDX A;  5J3T A;  4C0A A;  3SNH A;  1XOD A;  4K17 A;  3TFM A;  5JHH A;  4NSW A;  2MFQ A;  1PMS A;  5JP4 A;  5HE0 A;  1IRS A;  2W2X D;  4HAV B;  2DKP A;  3QWM A;  5CLQ B;  1X11 A;  2CRF A;  5DHF B;  2LYD A;  2DTC A;  2DYN A;  2YF0 A;  2DA0 A;  2YT0 A;  3GYO A;  2Y8F A;  3QIJ A;  2UZR A;  2YVC A;  1SGH A;  1X86 A;  5HE2 A;  2KCJ A;  2P8V A;  2D10 A;  2DHI A;  3MDB C;  3T06 A;  1P3R A;  1X1G A;  2RGN B;  3V5W A;  2X18 A;  1EVH A;  2D9X A;  1GC6 A;  2LOZ A;  1PFJ A;  1DRO A;  1ZVR A;  2EMS A;  4GZU A;  1XKE A;  1NTV A;  4WSF A;  4F7U P;  5LOP B;  4HB0 B;  2GJY A;  3M1I B;  2UVM A;  2QKM A;  4HAZ B;  3SV1 A;  5GOW B;  1MIX A;  3O96 A;  3ULB A;  3A8Q A;  1P5T A;  1WGU A;  4DX9 0;  4EMO A;  3AU5 A;  5CLL B;  1UEF A;  1K5G B;  2KUP A;  4HAX B;  2K2J A;  3ZDT A;  1OQN A;  3P7Z A;  2JP2 A;  4KHB B;  3SYX A;  4A6F A;  3FSS A;  4DX8 A;  1X05 A;  3TW1 A;  4Y94 A;  2CY5 A;  2RUK B;  2D9Y A;  1N3H A;  1BWN A;  5J3Y A;  2I1J A;  2G35 A;  4K81 A;  4CHJ A;  4ZRI A;  5FI0 A;  4D0N B;  1M7E A;  4HAY B;  5LON B;  2HTH B;  4EJN A;  1EF1 A;  3D8F A;  2Z0O A;  2W2X C;  4EKU A;  2ELB A;  1X1F A;  4DBB A;  3NSU A;  1V5M A;  2Z0Q A;  1DDM A;  3PVL A;  2I1K A;  3ODO A;  1WG7 A;  2QKL A;  3WYF B;  2COC A;  5D3W A;  4IFS A;  3KY9 A;  1AWE A;  1MIZ B;  4A5K A;  1UNR A;  4HAU B;  1ZSQ A;  4KAX B;  2RVB B;  4YON A;  5D3X A;  2VSZ A;  1EAZ A;  4HB4 B;  4WVF B;  1QC6 A;  5C5B B;  5C16 A;  3F0W A;  2MWN B;  1UPQ A;  2NZ8 B;  2OQB A;  4KVG B;  2ROV A;  4A6H A;  1H10 A;  2LG1 A;  3DXE A;  1B55 A;  2ROZ B;  5KQ1 A;  2HE7 A;  2GS0 A;  2R09 A;  2YSZ A;  5JLJ B;  5J3Q A;  4HAW B;  2YT1 A;  2J0K A;  1J0W A;  3TVV A;  1WI1 A;  2ADZ A;  2H7D A;  1OY2 A;  1WJ1 A;  2V76 A;  2K2U A;  1UNP A;  1V61 A;  4MT7 A;  1XR0 B;  2ELA A;  3AJ4 A;  2EMT A;  2FJL A;  1I2H A;  3X23 A;  3CIK A;  2GCL A;  5HE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...