2LOXA

Nmr structure of the complex between the ph domain of the tfb1 subunit from tfiih and rad2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
115
structure length
115
Chain Sequence
PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/hydrolase
molecule keywords RNA polymerase II transcription factor B subunit 1
publication title Structural and functional characterization of interactions involving the Tfb1 subunit of TFIIH and the NER factor Rad2.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 16
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2012-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2loxA00
2LYDA 4K2PA 1U5DA 1PLSA 2W2XD 1OY2A 1TXDA 1GC7A 1X1FA 4D0NB 4Y94A 4Z2NA 5D3WA 2RLOA 1X05A 4GPTB 2Z0OA 4HAYB 4K2OA 1MK9B 1FAOA 5D3YA 3D8DA 5DH9B 2EMTA 2CY4A 2EMSA 5D3VA 4HB2B 2J0JA 2HE7A 3TCAA 2KUPA 2R09A 3KZ1A 2R0DA 1WI1A 2K00A 4ZRKA 2H7DA 1DYNA 1WVHA 2D11A 2Y7BA 2LOZA 3DXEA 5J3QA 2OQBA 4WVFB 5JP4A 4HB4B 2RSGA 4DX8A 1DDWA 3AU5A 4A5KA 4XWXA 2UVMA 1ZC4B 2DN6A 3ZVRA 4EJNA 5LOPB 1Y5OA 2P8VA 2D9YA 1MIZB 4HAXB 5DIFB 4MK0A 3KY9A 1DDMA 5JHGA 5EFXA 2YRYA 1ZM0A 1MKEA 3X23A 4F7HA 1BTKA 4KVGB 1V5PA 3SO6A 4KHBB 3O96A 4GN1A 3FSSA 2YF0A 4HAVB 2V76A 1J19A 1V89A 4NSWA 1DROA 3WA0A 2YS3A 4WSFA 2Z0PA 1U5EA 3D8EA 2YS5A 3A98B 5CLLB 2CAYA 3TVVA 3LJUX 2MFQA 3ODXA 1BWNA 1XR0B 2RVBB 4HAUB 2Z0QA 1EAZA 5CLQB 1B55A 3F0WA 3TW1A 2M14A 2GCLA 2FJLA 3SUZA 1SGHA 4Z2MB 2ADZA 4A6FA 1V5UA 2ROZB 4K81A 1P3RA 2CRFA 1BAKA 2GS0A 1DBHA 1LW3A 1UEFA 5J3YA 3P7ZA 4DXAB 2AEHA 2DA0A 4HAZB 2COAA 2I1KA 1V88A 2H7EA 2YT0A 4CHJA 5JHHA 1M7RA 2LULA 5C5BA 5J3TA 3RCPA 5JLJB 3QBVB 2D4QA 3CIKA 1J0WA 1MPHA 4MY6A 2COCA 2J0MA 3PVWA 2KGXB 4IOYX 3ULCA 3A8QA 2NMBA 1SHCA 2MDXA 2EJ8A 1V61A 4NY0A 2Q13A 5D27A 4HDOA 4HATB 3DXCA 3PG7A 5HE2A 2D2QA 5C5BB 4IAPA 1FHXA 1DDVA 2RNRB 2COFA 2YSZA 2QKLA 1FB8A 1WGUA 3GYPA 2N23A 1U5GA 2HTHB 1EGXA 3HW2B 1I7AA 2K2UA 3A8PA 1OQNA 1H10A 1RRPB 3PVLA 5DI9B 2P0FA 5HE0A 4KHOA 3HQCA 1ZSQA 2AL6A 2ELAA 3FEHA 2DX1A 2D10A 4ZRIA 2D9ZA 3OANA 5FI0A 2ZPYA 5KCVA 2X18A 4KAXB 3G9WA 2M38A 4EKUA 1NTVA 4BBKA 1X11A 1U27A 3QIJA 2DYQA 5HE1A 2ELBA 1ISNA 1M7EA 1Q67A 3P6AA 2DX5A 2DYNA 5HE3A 2RUKB 3VIAA 2MKRA 2PZ1A 1N3HA 3AJ4A 4HB0B 2E2XA 3PSCA 2ROVA 4GZUA 1GG3A 2LKOA 4YL8A 1U29A 5C79A 2GJYA 4EMOA 2P0HA 1ZC3B 2W2XC 1XKEA 1OMWA 1V5MA 3SYXA 1NTYA 1RJ2A 1XCGA 2L2IA 3BINA 4HHVA 2YVCA 3KRXA 1PFJA 1K5DB 2L1CA 4MT7A 1MK7B 2DHIA 4HB3B 1GC6A 2VKIA 2NZ8B 3TO1A 1UPRA 3GYOA 3IVFA 2G35A 2I5CA 3N7CA 3U8ZA 1W1DA 1H4RA 4WJ7A 4A6FB 3KRWA 4GXBA 2IYBA 4IFSA 4HDQA 2DHKA 1P5TA 3CXBB 1WG7A 1U5FA 4CYEA 5DHAB 4GMVA 5L81A 4F7GA 1LB1A 3ODOA 2VSZA 2DHJA 1EF1A 2DLWA 2KCJA 3M1IB 1AQCA 4PNKA 1NU2A 1X1GA 4YONA 1WJ1A 2LOXA 1U2BA 2RGNB 5DHFB 2I1JA 2J59M 3ML4A 4KHAA 5D3XA 2JP2A 1QQGA 5C16A 1WJMA 1FHWA 2D9XA 3F5RA 4HAWB 3V5WA 2W2WA 4A6KA 1ZVRA 1KZGA 2J0KA 1W1HA 2MWNB 3SV1A 1XODA 1TJ6A 3FM8C 1XD4A 3DXDA 2XQNM 4F7UP 1MIXA 3SNHA 4CHMA 3AU4A 3PP2A 1TQZA 1I2HA 1BTNA 1FOEA 1UNPA 2BCJA 1UNRA 2DTCA 2N0YA 1FGZA 1EVHA 3T06A 5GOWB 4C0AA 4DX90 4P7IA 2YS1A 3QWMA 1X86A 1MAIA 3BJIA 2Y8GA 4A6HA 1W1GA 4K17A 2DFKA 2UZRA 4TKNA 1NI2A 2K2JA 5KQ4A 3ULBA 4B6HA 5FI1A 5LONB 2Y8FA 5KQ1A 4H8SA 2DKQA 1WGQA 4L6EA 1Y19B 2VRWB 3NSUA 1QC6A 2QKMA 3ZDTA 5C6RA 2IFSA 2CODA 3U7DA 2D9VA 1KI1B 3VOQA 3TFMA 3D8FA 1XX0A 1E5WA 1AWEA 1Z87A 2LG1A 3KSYA 4TYZA 2DKPA 4ZRJA 4GMXB 2OTXA 1FGYA 4DBBA 3HK0A 3PZDA 1P6SA 2P0DA 2I5FA 3UZTA 1UNQA 1KZ7A 2CY5A 3PEGA 3WYFB 2GCJA 2D9WA 1K5GB 1FHOA 2YT1A 1UPQA 1PMSA 3PVUA 2EC1A 3ODWA 2UZSA 4PQ0A 1IRSA 3MDBC 3MPXA
chains in the Genus database with same CATH superfamily
2LYDA 2FJUB 4K2PA 1U5DA 1PLSA 2W2XD 1OY2A 1TXDA 1GC7A 1X1FA 4D0NB 4Y94A 4Z2NA 5D3WA 2RLOA 1X05A 4GPTB 2Z0OA 4HAYB 4K2OA 1MK9B 1FAOA 5D3YA 3D8DA 5DH9B 2EMTA 2CY4A 2EMSA 5D3VA 4HB2B 2J0JA 2HE7A 3TCAA 2KUPA 2R09A 3KZ1A 2R0DA 1WI1A 2KIGA 2K00A 4ZRKA 2H7DA 3NWFA 1DYNA 1WVHA 2D11A 2Y7BA 2LOZA 3DXEA 5J3QA 2OQBA 4WVFB 5JP4A 4HB4B 2RSGA 4DX8A 1DDWA 3AU5A 4A5KA 4XWXA 2UVMA 1ZC4B 2DN6A 3ZVRA 4EJNA 5LOPB 1Y5OA 2YT2A 2P8VA 2D9YA 1MIZB 4HAXB 5DIFB 4MK0A 3KY9A 1DDMA 5JHGA 5EFXA 2YRYA 1ZM0A 1MKEA 3X23A 4F7HA 1BTKA 4KVGB 1V5PA 3SO6A 4KHBB 3NWAA 3HSAA 3FSSA 3O96A 2YF0A 4GN1A 4HAVB 2V76A 1J19A 1V89A 4NSWA 1DROA 3WA0A 2YS3A 4WSFA 2Z0PA 1U5EA 3D8EA 2YS5A 3A98B 5CLLB 2CAYA 3TVVA 3LJUX 2ZKMX 2MFQA 3ODXA 1BWNA 1XR0B 2RVBB 4QJ3B 4HAUB 2Z0QA 1EAZA 5CLQB 2KUQA 1B55A 3F0WA 3TW1A 2Z59A 2M14A 1T77A 2GCLA 2FJLA 3SUZA 1SGHA 4Z2MB 2ADZA 4A6FA 1V5UA 2ROZB 4QJ5B 4K81A 1P3RA 2CRFA 1BAKA 2GS0A 1DBHA 1LW3A 1UEFA 5J3YA 4GNKB 3P7ZA 4DXAB 2AEHA 2DA0A 4HAZB 2COAA 2I1KA 1V88A 4OSNA 2H7EA 2YT0A 4CHJA 5JHHA 1M7RA 2LULA 5C5BA 5J3TA 2GUMA 3RCPA 5JLJB 3QBVB 2D4QA 3CIKA 2Z14A 1J0WA 1MPHA 2KR0A 4MY6A 2COCA 2J0MA 3PVWA 2KGXB 4IOYX 3ULCA 3DCXA 3A8QA 2NMBA 1SHCA 2MDXA 2EJ8A 1V61A 4NY0A 2Q13A 5D27A 3FVCA 4HDOA 4L1RA 4HATB 3DXCA 3PG7A 5HE2A 2D2QA 4HSIA 5C5BB 4IAPA 1FHXA 1DDVA 2RNRB 2COFA 2YSZA 2QKLA 1FB8A 1WGUA 3GYPA 2N23A 1U5GA 3NWDA 2HTHB 2R2YA 1EGXA 3HW2B 1I7AA 2K2UA 3A8PA 1OQNA 1H10A 1RRPB 3PVLA 5DI9B 2P0FA 5HE0A 4KHOA 3HQCA 2Z13A 1ZSQA 2AL6A 1ZYIA 2ELAA 3FEHA 2DX1A 2D10A 4ZRIA 2D9ZA 3OANA 5FI0A 2ZPYA 5KCVA 2X18A 4KAXB 3G9WA 2M38A 4EKUA 1NTVA 4BBKA 1X11A 1U27A 3QIJA 2DYQA 5HE1A 2ELBA 1ISNA 5LG4B 1M7EA 3A58A 1Q67A 3P6AA 2DX5A 2DYNA 5HE3A 2RUKB 4OT1A 3VIAA 3HIEA 2MKRA 2PZ1A 1N3HA 3AJ4A 5M4YB 4HB0B 2E2XA 3PSCA 2ROVA 4GZUA 1GG3A 2LKOA 4YL8A 1U29A 5C79A 2GJYA 4EMOA 2P0HA 4CSQA 1ZC3B 2W2XC 1XKEA 1OMWA 1V5MA 3SYXA 1NTYA 1RJ2A 1XCGA 2L2IA 3BINA 4HHVA 2K8EA 2YVCA 3KRXA 5I2SA 1PFJA 1K5DB 2L1CA 4MT7A 1MK7B 2DHIA 4HB3B 1GC6A 2VKIA 2NZ8B 3TO1A 1UPRA 3GYOA 4GOUA 3IVFA 2G35A 2I5CA 3N7CA 3U8ZA 1W1DA 1H4RA 4WJ7A 4A6FB 3KRWA 4GXBA 2IYBA 4IFSA 4HDQA 4QJ4B 2DHKA 1P5TA 3CXBB 1WG7A 1U5FA 4CYEA 5DHAB 4GMVA 5L81A 4F7GA 1LB1A 3ODOA 2VSZA 2DHJA 1EF1A 2DLWA 2KCJA 3M1IB 1AQCA 4PNKA 3U12A 4DIXA 1NU2A 1X1GA 4YONA 1WJ1A 2LOXA 1U2BA 2RGNB 5DHFB 2I1JA 2J59M 3ML4A 4KHAA 5D3XA 2JP2A 1QQGA 4D6WA 5C16A 1WJMA 1FHWA 2D9XA 3F5RA 4HAWB 3V5WA 2KIEA 2W2WA 4A6KA 5I2MA 1ZVRA 1KZGA 2J0KA 1W1HA 2MWNB 3SV1A 1XODA 1TJ6A 3FM8C 1XD4A 3DXDA 2Z4DA 2XQNM 4F7UP 1MIXA 3SNHA 4CHMA 3AU4A 3PP2A 1TQZA 1I2HA 1BTNA 1FOEA 1UNPA 2BCJA 1UNRA 2DTCA 2N0YA 1FGZA 1EVHA 3T06A 5GOWB 2K49A 4C0AA 4KHBA 4DX90 4P7IA 2YS1A 3QWMA 1X86A 1MAIA 3BJIA 2Y8GA 4A6HA 2RRFA 1W1GA 4K17A 1MI1A 2DFKA 2UZRA 4TKNA 1NI2A 2K2JA 5KQ4A 3ULBA 4B6HA 5FI1A 5LONB 2Y8FA 5KQ1A 4H8SA 2DKQA 1WGQA 4L6EA 1Y19B 2VRWB 2NBVA 3NSUA 1QC6A 2QKMA 3ZDTA 5C6RA 2IFSA 2CODA 3U7DA 2D9VA 3B77A 1KI1B 3VOQA 3TFMA 5IRSA 3D8FA 1XX0A 1E5WA 1AWEA 1Z87A 2LG1A 3OHMB 3KSYA 4TYZA 2DKPA 4ZRJA 4GMXB 2OTXA 1FGYA 4DBBA 3HK0A 3PZDA 1P6SA 2P0DA 2I5FA 3UZTA 1UNQA 1KZ7A 2CY5A 3PEGA 3WYFB 2GCJA 2D9WA 1K5GB 1FHOA 2YT1A 1UPQA 1PMSA 3PVUA 2EC1A 3ODWA 2UZSA 3NW8A 4PQ0A 1IRSA 3MDBC 4QXAB 3MPXA
chains in the Genus database with same CATH topology
2LYDA 4K2PA 1U5DA 1PLSA 2W2XD 1OY2A 1TXDA 1GC7A 1X1FA 4D0NB 4Y94A 4Z2NA 5D3WA 2RLOA 1X05A 4GPTB 2Z0OA 4HAYB 4K2OA 1MK9B 1FAOA 5D3YA 3D8DA 5DH9B 2EMTA 2CY4A 2EMSA 5D3VA 4HB2B 2J0JA 2HE7A 3TCAA 2KUPA 2R09A 3KZ1A 2R0DA 1WI1A 2K00A 4ZRKA 2H7DA 1DYNA 1WVHA 2D11A 2Y7BA 2LOZA 3DXEA 5J3QA 2OQBA 4WVFB 5JP4A 4HB4B 2RSGA 4DX8A 1DDWA 3AU5A 4A5KA 4XWXA 2UVMA 1ZC4B 2DN6A 3ZVRA 4EJNA 5LOPB 1Y5OA 2P8VA 2D9YA 1MIZB 4HAXB 5DIFB 4MK0A 3KY9A 1DDMA 5JHGA 5EFXA 2YRYA 1ZM0A 1MKEA 3X23A 4F7HA 1BTKA 4KVGB 1V5PA 3SO6A 4KHBB 3O96A 4GN1A 3FSSA 2YF0A 4HAVB 2V76A 1J19A 1V89A 4NSWA 1DROA 3WA0A 2YS3A 4WSFA 2Z0PA 1U5EA 3D8EA 2YS5A 3A98B 5CLLB 2CAYA 3TVVA 3LJUX 2MFQA 3ODXA 1BWNA 1XR0B 2RVBB 4HAUB 2Z0QA 1EAZA 5CLQB 1B55A 3F0WA 3TW1A 2M14A 2GCLA 2FJLA 3SUZA 1SGHA 4Z2MB 2ADZA 4A6FA 1V5UA 2ROZB 4K81A 1P3RA 2CRFA 1BAKA 2GS0A 1DBHA 1LW3A 1UEFA 5J3YA 3P7ZA 4DXAB 2AEHA 2DA0A 4HAZB 2COAA 2I1KA 1V88A 2H7EA 2YT0A 4CHJA 5JHHA 1M7RA 2LULA 5C5BA 5J3TA 3RCPA 5JLJB 3QBVB 2D4QA 3CIKA 1J0WA 1MPHA 4MY6A 2COCA 2J0MA 3PVWA 2KGXB 4IOYX 3ULCA 3A8QA 2NMBA 1SHCA 2MDXA 2EJ8A 1V61A 4NY0A 2Q13A 5D27A 4HDOA 4HATB 3DXCA 3PG7A 5HE2A 2D2QA 5C5BB 4IAPA 1FHXA 1DDVA 2RNRB 2COFA 2YSZA 2QKLA 1FB8A 1WGUA 3GYPA 2N23A 1U5GA 2HTHB 1EGXA 3HW2B 1I7AA 2K2UA 3A8PA 1OQNA 1H10A 1RRPB 3PVLA 5DI9B 2P0FA 5HE0A 4KHOA 3HQCA 1ZSQA 2AL6A 2ELAA 3FEHA 2DX1A 2D10A 4ZRIA 2D9ZA 3OANA 5FI0A 2ZPYA 5KCVA 2X18A 4KAXB 3G9WA 2M38A 4EKUA 1NTVA 4BBKA 1X11A 1U27A 3QIJA 2DYQA 5HE1A 2ELBA 1ISNA 1M7EA 1Q67A 3P6AA 2DX5A 2DYNA 5HE3A 2RUKB 3VIAA 2MKRA 2PZ1A 1N3HA 3AJ4A 4HB0B 2E2XA 3PSCA 2ROVA 4GZUA 1GG3A 2LKOA 4YL8A 1U29A 5C79A 2GJYA 4EMOA 2P0HA 1ZC3B 2W2XC 1XKEA 1OMWA 1V5MA 3SYXA 1NTYA 1RJ2A 1XCGA 2L2IA 3BINA 4HHVA 2YVCA 3KRXA 1PFJA 1K5DB 2L1CA 4MT7A 1MK7B 2DHIA 4HB3B 1GC6A 2VKIA 2NZ8B 3TO1A 1UPRA 3GYOA 3IVFA 2G35A 2I5CA 3N7CA 3U8ZA 1W1DA 1H4RA 4WJ7A 4A6FB 3KRWA 4GXBA 2IYBA 4IFSA 4HDQA 2DHKA 1P5TA 3CXBB 1WG7A 1U5FA 4CYEA 5DHAB 4GMVA 5L81A 4F7GA 1LB1A 3ODOA 2VSZA 2DHJA 1EF1A 2DLWA 2KCJA 3M1IB 1AQCA 4PNKA 1NU2A 1X1GA 4YONA 1WJ1A 2LOXA 1U2BA 2RGNB 5DHFB 2I1JA 2J59M 3ML4A 4KHAA 5D3XA 2JP2A 1QQGA 5C16A 1WJMA 1FHWA 2D9XA 3F5RA 4HAWB 3V5WA 2W2WA 4A6KA 1ZVRA 1KZGA 2J0KA 1W1HA 2MWNB 3SV1A 1XODA 1TJ6A 3FM8C 1XD4A 3DXDA 2XQNM 4F7UP 1MIXA 3SNHA 4CHMA 3AU4A 3PP2A 1TQZA 1I2HA 1BTNA 1FOEA 1UNPA 2BCJA 1UNRA 2DTCA 2N0YA 1FGZA 1EVHA 3T06A 5GOWB 4C0AA 4DX90 4P7IA 2YS1A 3QWMA 1X86A 1MAIA 3BJIA 2Y8GA 4A6HA 1W1GA 4K17A 2DFKA 2UZRA 4TKNA 1NI2A 2K2JA 5KQ4A 3ULBA 4B6HA 5FI1A 5LONB 2Y8FA 5KQ1A 4H8SA 2DKQA 1WGQA 4L6EA 1Y19B 2VRWB 3NSUA 1QC6A 2QKMA 3ZDTA 5C6RA 2IFSA 2CODA 3U7DA 2D9VA 1KI1B 3VOQA 3TFMA 3D8FA 1XX0A 1E5WA 1AWEA 1Z87A 2LG1A 3KSYA 4TYZA 2DKPA 4ZRJA 4GMXB 2OTXA 1FGYA 4DBBA 3HK0A 3PZDA 1P6SA 2P0DA 2I5FA 3UZTA 1UNQA 1KZ7A 2CY5A 3PEGA 3WYFB 2GCJA 2D9WA 1K5GB 1FHOA 2YT1A 1UPQA 1PMSA 3PVUA 2EC1A 3ODWA 2UZSA 4PQ0A 1IRSA 3MDBC 3MPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LYD A;  4K2P A;  1U5D A;  1PLS A;  2W2X D;  1OY2 A;  1TXD A;  1GC7 A;  1X1F A;  4D0N B;  4Y94 A;  4Z2N A;  5D3W A;  2RLO A;  1X05 A;  4GPT B;  2Z0O A;  4HAY B;  4K2O A;  1MK9 B;  1FAO A;  5D3Y A;  3D8D A;  5DH9 B;  2EMT A;  2CY4 A;  2EMS A;  5D3V A;  4HB2 B;  2J0J A;  2HE7 A;  3TCA A;  2KUP A;  2R09 A;  3KZ1 A;  2R0D A;  1WI1 A;  2K00 A;  4ZRK A;  2H7D A;  1DYN A;  1WVH A;  2D11 A;  2Y7B A;  2LOZ A;  3DXE A;  5J3Q A;  2OQB A;  4WVF B;  5JP4 A;  4HB4 B;  2RSG A;  4DX8 A;  1DDW A;  3AU5 A;  4A5K A;  4XWX A;  2UVM A;  1ZC4 B;  2DN6 A;  3ZVR A;  4EJN A;  5LOP B;  1Y5O A;  2P8V A;  2D9Y A;  1MIZ B;  4HAX B;  5DIF B;  4MK0 A;  3KY9 A;  1DDM A;  5JHG A;  5EFX A;  2YRY A;  1ZM0 A;  1MKE A;  3X23 A;  4F7H A;  1BTK A;  4KVG B;  1V5P A;  3SO6 A;  4KHB B;  3O96 A;  4GN1 A;  3FSS A;  2YF0 A;  4HAV B;  2V76 A;  1J19 A;  1V89 A;  4NSW A;  1DRO A;  3WA0 A;  2YS3 A;  4WSF A;  2Z0P A;  1U5E A;  3D8E A;  2YS5 A;  3A98 B;  5CLL B;  2CAY A;  3TVV A;  3LJU X;  2MFQ A;  3ODX A;  1BWN A;  1XR0 B;  2RVB B;  4HAU B;  2Z0Q A;  1EAZ A;  5CLQ B;  1B55 A;  3F0W A;  3TW1 A;  2M14 A;  2GCL A;  2FJL A;  3SUZ A;  1SGH A;  4Z2M B;  2ADZ A;  4A6F A;  1V5U A;  2ROZ B;  4K81 A;  1P3R A;  2CRF A;  1BAK A;  2GS0 A;  1DBH A;  1LW3 A;  1UEF A;  5J3Y A;  3P7Z A;  4DXA B;  2AEH A;  2DA0 A;  4HAZ B;  2COA A;  2I1K A;  1V88 A;  2H7E A;  2YT0 A;  4CHJ A;  5JHH A;  1M7R A;  2LUL A;  5C5B A;  5J3T A;  3RCP A;  5JLJ B;  3QBV B;  2D4Q A;  3CIK A;  1J0W A;  1MPH A;  4MY6 A;  2COC A;  2J0M A;  3PVW A;  2KGX B;  4IOY X;  3ULC A;  3A8Q A;  2NMB A;  1SHC A;  2MDX A;  2EJ8 A;  1V61 A;  4NY0 A;  2Q13 A;  5D27 A;  4HDO A;  4HAT B;  3DXC A;  3PG7 A;  5HE2 A;  2D2Q A;  5C5B B;  4IAP A;  1FHX A;  1DDV A;  2RNR B;  2COF A;  2YSZ A;  2QKL A;  1FB8 A;  1WGU A;  3GYP A;  2N23 A;  1U5G A;  2HTH B;  1EGX A;  3HW2 B;  1I7A A;  2K2U A;  3A8P A;  1OQN A;  1H10 A;  1RRP B;  3PVL A;  5DI9 B;  2P0F A;  5HE0 A;  4KHO A;  3HQC A;  1ZSQ A;  2AL6 A;  2ELA A;  3FEH A;  2DX1 A;  2D10 A;  4ZRI A;  2D9Z A;  3OAN A;  5FI0 A;  2ZPY A;  5KCV A;  2X18 A;  4KAX B;  3G9W A;  2M38 A;  4EKU A;  1NTV A;  4BBK A;  1X11 A;  1U27 A;  3QIJ A;  2DYQ A;  5HE1 A;  2ELB A;  1ISN A;  1M7E A;  1Q67 A;  3P6A A;  2DX5 A;  2DYN A;  5HE3 A;  2RUK B;  3VIA A;  2MKR A;  2PZ1 A;  1N3H A;  3AJ4 A;  4HB0 B;  2E2X A;  3PSC A;  2ROV A;  4GZU A;  1GG3 A;  2LKO A;  4YL8 A;  1U29 A;  5C79 A;  2GJY A;  4EMO A;  2P0H A;  1ZC3 B;  2W2X C;  1XKE A;  1OMW A;  1V5M A;  3SYX A;  1NTY A;  1RJ2 A;  1XCG A;  2L2I A;  3BIN A;  4HHV A;  2YVC A;  3KRX A;  1PFJ A;  1K5D B;  2L1C A;  4MT7 A;  1MK7 B;  2DHI A;  4HB3 B;  1GC6 A;  2VKI A;  2NZ8 B;  3TO1 A;  1UPR A;  3GYO A;  3IVF A;  2G35 A;  2I5C A;  3N7C A;  3U8Z A;  1W1D A;  1H4R A;  4WJ7 A;  4A6F B;  3KRW A;  4GXB A;  2IYB A;  4IFS A;  4HDQ A;  2DHK A;  1P5T A;  3CXB B;  1WG7 A;  1U5F A;  4CYE A;  5DHA B;  4GMV A;  5L81 A;  4F7G A;  1LB1 A;  3ODO A;  2VSZ A;  2DHJ A;  1EF1 A;  2DLW A;  2KCJ A;  3M1I B;  1AQC A;  4PNK A;  1NU2 A;  1X1G A;  4YON A;  1WJ1 A;  2LOX A;  1U2B A;  2RGN B;  5DHF B;  2I1J A;  2J59 M;  3ML4 A;  4KHA A;  5D3X A;  2JP2 A;  1QQG A;  5C16 A;  1WJM A;  1FHW A;  2D9X A;  3F5R A;  4HAW B;  3V5W A;  2W2W A;  4A6K A;  1ZVR A;  1KZG A;  2J0K A;  1W1H A;  2MWN B;  3SV1 A;  1XOD A;  1TJ6 A;  3FM8 C;  1XD4 A;  3DXD A;  2XQN M;  4F7U P;  1MIX A;  3SNH A;  4CHM A;  3AU4 A;  3PP2 A;  1TQZ A;  1I2H A;  1BTN A;  1FOE A;  1UNP A;  2BCJ A;  1UNR A;  2DTC A;  2N0Y A;  1FGZ A;  1EVH A;  3T06 A;  5GOW B;  4C0A A;  4DX9 0;  4P7I A;  2YS1 A;  3QWM A;  1X86 A;  1MAI A;  3BJI A;  2Y8G A;  4A6H A;  1W1G A;  4K17 A;  2DFK A;  2UZR A;  4TKN A;  1NI2 A;  2K2J A;  5KQ4 A;  3ULB A;  4B6H A;  5FI1 A;  5LON B;  2Y8F A;  5KQ1 A;  4H8S A;  2DKQ A;  1WGQ A;  4L6E A;  1Y19 B;  2VRW B;  3NSU A;  1QC6 A;  2QKM A;  3ZDT A;  5C6R A;  2IFS A;  2COD A;  3U7D A;  2D9V A;  1KI1 B;  3VOQ A;  3TFM A;  3D8F A;  1XX0 A;  1E5W A;  1AWE A;  1Z87 A;  2LG1 A;  3KSY A;  4TYZ A;  2DKP A;  4ZRJ A;  4GMX B;  2OTX A;  1FGY A;  4DBB A;  3HK0 A;  3PZD A;  1P6S A;  2P0D A;  2I5F A;  3UZT A;  1UNQ A;  1KZ7 A;  2CY5 A;  3PEG A;  3WYF B;  2GCJ A;  2D9W A;  1K5G B;  1FHO A;  2YT1 A;  1UPQ A;  1PMS A;  3PVU A;  2EC1 A;  3ODW A;  2UZS A;  4PQ0 A;  1IRS A;  3MDB C;  3MPX A; 
#chains in the Genus database with same CATH topology
 2LYD A;  2FJU B;  4K2P A;  1U5D A;  1PLS A;  2W2X D;  1OY2 A;  1TXD A;  1GC7 A;  1X1F A;  4D0N B;  4Y94 A;  4Z2N A;  5D3W A;  2RLO A;  1X05 A;  4GPT B;  2Z0O A;  4HAY B;  4K2O A;  1MK9 B;  1FAO A;  5D3Y A;  3D8D A;  5DH9 B;  2EMT A;  2CY4 A;  2EMS A;  5D3V A;  4HB2 B;  2J0J A;  2HE7 A;  3TCA A;  2KUP A;  2R09 A;  3KZ1 A;  2R0D A;  1WI1 A;  2KIG A;  2K00 A;  4ZRK A;  2H7D A;  3NWF A;  1DYN A;  1WVH A;  2D11 A;  2Y7B A;  2LOZ A;  3DXE A;  5J3Q A;  2OQB A;  4WVF B;  5JP4 A;  4HB4 B;  2RSG A;  4DX8 A;  1DDW A;  3AU5 A;  4A5K A;  4XWX A;  2UVM A;  1ZC4 B;  2DN6 A;  3ZVR A;  4EJN A;  5LOP B;  1Y5O A;  2YT2 A;  2P8V A;  2D9Y A;  1MIZ B;  4HAX B;  5DIF B;  4MK0 A;  3KY9 A;  1DDM A;  5JHG A;  5EFX A;  2YRY A;  1ZM0 A;  1MKE A;  3X23 A;  4F7H A;  1BTK A;  4KVG B;  1V5P A;  3SO6 A;  4KHB B;  3NWA A;  3HSA A;  3FSS A;  3O96 A;  2YF0 A;  4GN1 A;  4HAV B;  2V76 A;  1J19 A;  1V89 A;  4NSW A;  1DRO A;  3WA0 A;  2YS3 A;  4WSF A;  2Z0P A;  1U5E A;  3D8E A;  2YS5 A;  3A98 B;  5CLL B;  2CAY A;  3TVV A;  3LJU X;  2ZKM X;  2MFQ A;  3ODX A;  1BWN A;  1XR0 B;  2RVB B;  4QJ3 B;  4HAU B;  2Z0Q A;  1EAZ A;  5CLQ B;  2KUQ A;  1B55 A;  3F0W A;  3TW1 A;  2Z59 A;  2M14 A;  1T77 A;  2GCL A;  2FJL A;  3SUZ A;  1SGH A;  4Z2M B;  2ADZ A;  4A6F A;  1V5U A;  2ROZ B;  4QJ5 B;  4K81 A;  1P3R A;  2CRF A;  1BAK A;  2GS0 A;  1DBH A;  1LW3 A;  1UEF A;  5J3Y A;  4GNK B;  3P7Z A;  4DXA B;  2AEH A;  2DA0 A;  4HAZ B;  2COA A;  2I1K A;  1V88 A;  4OSN A;  2H7E A;  2YT0 A;  4CHJ A;  5JHH A;  1M7R A;  2LUL A;  5C5B A;  5J3T A;  2GUM A;  3RCP A;  5JLJ B;  3QBV B;  2D4Q A;  3CIK A;  2Z14 A;  1J0W A;  1MPH A;  2KR0 A;  4MY6 A;  2COC A;  2J0M A;  3PVW A;  2KGX B;  4IOY X;  3ULC A;  3DCX A;  3A8Q A;  2NMB A;  1SHC A;  2MDX A;  2EJ8 A;  1V61 A;  4NY0 A;  2Q13 A;  5D27 A;  3FVC A;  4HDO A;  4L1R A;  4HAT B;  3DXC A;  3PG7 A;  5HE2 A;  2D2Q A;  4HSI A;  5C5B B;  4IAP A;  1FHX A;  1DDV A;  2RNR B;  2COF A;  2YSZ A;  2QKL A;  1FB8 A;  1WGU A;  3GYP A;  2N23 A;  1U5G A;  3NWD A;  2HTH B;  2R2Y A;  1EGX A;  3HW2 B;  1I7A A;  2K2U A;  3A8P A;  1OQN A;  1H10 A;  1RRP B;  3PVL A;  5DI9 B;  2P0F A;  5HE0 A;  4KHO A;  3HQC A;  2Z13 A;  1ZSQ A;  2AL6 A;  1ZYI A;  2ELA A;  3FEH A;  2DX1 A;  2D10 A;  4ZRI A;  2D9Z A;  3OAN A;  5FI0 A;  2ZPY A;  5KCV A;  2X18 A;  4KAX B;  3G9W A;  2M38 A;  4EKU A;  1NTV A;  4BBK A;  1X11 A;  1U27 A;  3QIJ A;  2DYQ A;  5HE1 A;  2ELB A;  1ISN A;  5LG4 B;  1M7E A;  3A58 A;  1Q67 A;  3P6A A;  2DX5 A;  2DYN A;  5HE3 A;  2RUK B;  4OT1 A;  3VIA A;  3HIE A;  2MKR A;  2PZ1 A;  1N3H A;  3AJ4 A;  5M4Y B;  4HB0 B;  2E2X A;  3PSC A;  2ROV A;  4GZU A;  1GG3 A;  2LKO A;  4YL8 A;  1U29 A;  5C79 A;  2GJY A;  4EMO A;  2P0H A;  4CSQ A;  1ZC3 B;  2W2X C;  1XKE A;  1OMW A;  1V5M A;  3SYX A;  1NTY A;  1RJ2 A;  1XCG A;  2L2I A;  3BIN A;  4HHV A;  2K8E A;  2YVC A;  3KRX A;  5I2S A;  1PFJ A;  1K5D B;  2L1C A;  4MT7 A;  1MK7 B;  2DHI A;  4HB3 B;  1GC6 A;  2VKI A;  2NZ8 B;  3TO1 A;  1UPR A;  3GYO A;  4GOU A;  3IVF A;  2G35 A;  2I5C A;  3N7C A;  3U8Z A;  1W1D A;  1H4R A;  4WJ7 A;  4A6F B;  3KRW A;  4GXB A;  2IYB A;  4IFS A;  4HDQ A;  4QJ4 B;  2DHK A;  1P5T A;  3CXB B;  1WG7 A;  1U5F A;  4CYE A;  5DHA B;  4GMV A;  5L81 A;  4F7G A;  1LB1 A;  3ODO A;  2VSZ A;  2DHJ A;  1EF1 A;  2DLW A;  2KCJ A;  3M1I B;  1AQC A;  4PNK A;  3U12 A;  4DIX A;  1NU2 A;  1X1G A;  4YON A;  1WJ1 A;  2LOX A;  1U2B A;  2RGN B;  5DHF B;  2I1J A;  2J59 M;  3ML4 A;  4KHA A;  5D3X A;  2JP2 A;  1QQG A;  4D6W A;  5C16 A;  1WJM A;  1FHW A;  2D9X A;  3F5R A;  4HAW B;  3V5W A;  2KIE A;  2W2W A;  4A6K A;  5I2M A;  1ZVR A;  1KZG A;  2J0K A;  1W1H A;  2MWN B;  3SV1 A;  1XOD A;  1TJ6 A;  3FM8 C;  1XD4 A;  3DXD A;  2Z4D A;  2XQN M;  4F7U P;  1MIX A;  3SNH A;  4CHM A;  3AU4 A;  3PP2 A;  1TQZ A;  1I2H A;  1BTN A;  1FOE A;  1UNP A;  2BCJ A;  1UNR A;  2DTC A;  2N0Y A;  1FGZ A;  1EVH A;  3T06 A;  5GOW B;  2K49 A;  4C0A A;  4KHB A;  4DX9 0;  4P7I A;  2YS1 A;  3QWM A;  1X86 A;  1MAI A;  3BJI A;  2Y8G A;  4A6H A;  2RRF A;  1W1G A;  4K17 A;  1MI1 A;  2DFK A;  2UZR A;  4TKN A;  1NI2 A;  2K2J A;  5KQ4 A;  3ULB A;  4B6H A;  5FI1 A;  5LON B;  2Y8F A;  5KQ1 A;  4H8S A;  2DKQ A;  1WGQ A;  4L6E A;  1Y19 B;  2VRW B;  2NBV A;  3NSU A;  1QC6 A;  2QKM A;  3ZDT A;  5C6R A;  2IFS A;  2COD A;  3U7D A;  2D9V A;  3B77 A;  1KI1 B;  3VOQ A;  3TFM A;  5IRS A;  3D8F A;  1XX0 A;  1E5W A;  1AWE A;  1Z87 A;  2LG1 A;  3OHM B;  3KSY A;  4TYZ A;  2DKP A;  4ZRJ A;  4GMX B;  2OTX A;  1FGY A;  4DBB A;  3HK0 A;  3PZD A;  1P6S A;  2P0D A;  2I5F A;  3UZT A;  1UNQ A;  1KZ7 A;  2CY5 A;  3PEG A;  3WYF B;  2GCJ A;  2D9W A;  1K5G B;  1FHO A;  2YT1 A;  1UPQ A;  1PMS A;  3PVU A;  2EC1 A;  3ODW A;  2UZS A;  3NW8 A;  4PQ0 A;  1IRS A;  3MDB C;  4QXA B;  3MPX A; 
#chains in the Genus database with same CATH homology
 2LYD A;  4K2P A;  1U5D A;  1PLS A;  2W2X D;  1OY2 A;  1TXD A;  1GC7 A;  1X1F A;  4D0N B;  4Y94 A;  4Z2N A;  5D3W A;  2RLO A;  1X05 A;  4GPT B;  2Z0O A;  4HAY B;  4K2O A;  1MK9 B;  1FAO A;  5D3Y A;  3D8D A;  5DH9 B;  2EMT A;  2CY4 A;  2EMS A;  5D3V A;  4HB2 B;  2J0J A;  2HE7 A;  3TCA A;  2KUP A;  2R09 A;  3KZ1 A;  2R0D A;  1WI1 A;  2K00 A;  4ZRK A;  2H7D A;  1DYN A;  1WVH A;  2D11 A;  2Y7B A;  2LOZ A;  3DXE A;  5J3Q A;  2OQB A;  4WVF B;  5JP4 A;  4HB4 B;  2RSG A;  4DX8 A;  1DDW A;  3AU5 A;  4A5K A;  4XWX A;  2UVM A;  1ZC4 B;  2DN6 A;  3ZVR A;  4EJN A;  5LOP B;  1Y5O A;  2P8V A;  2D9Y A;  1MIZ B;  4HAX B;  5DIF B;  4MK0 A;  3KY9 A;  1DDM A;  5JHG A;  5EFX A;  2YRY A;  1ZM0 A;  1MKE A;  3X23 A;  4F7H A;  1BTK A;  4KVG B;  1V5P A;  3SO6 A;  4KHB B;  3O96 A;  4GN1 A;  3FSS A;  2YF0 A;  4HAV B;  2V76 A;  1J19 A;  1V89 A;  4NSW A;  1DRO A;  3WA0 A;  2YS3 A;  4WSF A;  2Z0P A;  1U5E A;  3D8E A;  2YS5 A;  3A98 B;  5CLL B;  2CAY A;  3TVV A;  3LJU X;  2MFQ A;  3ODX A;  1BWN A;  1XR0 B;  2RVB B;  4HAU B;  2Z0Q A;  1EAZ A;  5CLQ B;  1B55 A;  3F0W A;  3TW1 A;  2M14 A;  2GCL A;  2FJL A;  3SUZ A;  1SGH A;  4Z2M B;  2ADZ A;  4A6F A;  1V5U A;  2ROZ B;  4K81 A;  1P3R A;  2CRF A;  1BAK A;  2GS0 A;  1DBH A;  1LW3 A;  1UEF A;  5J3Y A;  3P7Z A;  4DXA B;  2AEH A;  2DA0 A;  4HAZ B;  2COA A;  2I1K A;  1V88 A;  2H7E A;  2YT0 A;  4CHJ A;  5JHH A;  1M7R A;  2LUL A;  5C5B A;  5J3T A;  3RCP A;  5JLJ B;  3QBV B;  2D4Q A;  3CIK A;  1J0W A;  1MPH A;  4MY6 A;  2COC A;  2J0M A;  3PVW A;  2KGX B;  4IOY X;  3ULC A;  3A8Q A;  2NMB A;  1SHC A;  2MDX A;  2EJ8 A;  1V61 A;  4NY0 A;  2Q13 A;  5D27 A;  4HDO A;  4HAT B;  3DXC A;  3PG7 A;  5HE2 A;  2D2Q A;  5C5B B;  4IAP A;  1FHX A;  1DDV A;  2RNR B;  2COF A;  2YSZ A;  2QKL A;  1FB8 A;  1WGU A;  3GYP A;  2N23 A;  1U5G A;  2HTH B;  1EGX A;  3HW2 B;  1I7A A;  2K2U A;  3A8P A;  1OQN A;  1H10 A;  1RRP B;  3PVL A;  5DI9 B;  2P0F A;  5HE0 A;  4KHO A;  3HQC A;  1ZSQ A;  2AL6 A;  2ELA A;  3FEH A;  2DX1 A;  2D10 A;  4ZRI A;  2D9Z A;  3OAN A;  5FI0 A;  2ZPY A;  5KCV A;  2X18 A;  4KAX B;  3G9W A;  2M38 A;  4EKU A;  1NTV A;  4BBK A;  1X11 A;  1U27 A;  3QIJ A;  2DYQ A;  5HE1 A;  2ELB A;  1ISN A;  1M7E A;  1Q67 A;  3P6A A;  2DX5 A;  2DYN A;  5HE3 A;  2RUK B;  3VIA A;  2MKR A;  2PZ1 A;  1N3H A;  3AJ4 A;  4HB0 B;  2E2X A;  3PSC A;  2ROV A;  4GZU A;  1GG3 A;  2LKO A;  4YL8 A;  1U29 A;  5C79 A;  2GJY A;  4EMO A;  2P0H A;  1ZC3 B;  2W2X C;  1XKE A;  1OMW A;  1V5M A;  3SYX A;  1NTY A;  1RJ2 A;  1XCG A;  2L2I A;  3BIN A;  4HHV A;  2YVC A;  3KRX A;  1PFJ A;  1K5D B;  2L1C A;  4MT7 A;  1MK7 B;  2DHI A;  4HB3 B;  1GC6 A;  2VKI A;  2NZ8 B;  3TO1 A;  1UPR A;  3GYO A;  3IVF A;  2G35 A;  2I5C A;  3N7C A;  3U8Z A;  1W1D A;  1H4R A;  4WJ7 A;  4A6F B;  3KRW A;  4GXB A;  2IYB A;  4IFS A;  4HDQ A;  2DHK A;  1P5T A;  3CXB B;  1WG7 A;  1U5F A;  4CYE A;  5DHA B;  4GMV A;  5L81 A;  4F7G A;  1LB1 A;  3ODO A;  2VSZ A;  2DHJ A;  1EF1 A;  2DLW A;  2KCJ A;  3M1I B;  1AQC A;  4PNK A;  1NU2 A;  1X1G A;  4YON A;  1WJ1 A;  2LOX A;  1U2B A;  2RGN B;  5DHF B;  2I1J A;  2J59 M;  3ML4 A;  4KHA A;  5D3X A;  2JP2 A;  1QQG A;  5C16 A;  1WJM A;  1FHW A;  2D9X A;  3F5R A;  4HAW B;  3V5W A;  2W2W A;  4A6K A;  1ZVR A;  1KZG A;  2J0K A;  1W1H A;  2MWN B;  3SV1 A;  1XOD A;  1TJ6 A;  3FM8 C;  1XD4 A;  3DXD A;  2XQN M;  4F7U P;  1MIX A;  3SNH A;  4CHM A;  3AU4 A;  3PP2 A;  1TQZ A;  1I2H A;  1BTN A;  1FOE A;  1UNP A;  2BCJ A;  1UNR A;  2DTC A;  2N0Y A;  1FGZ A;  1EVH A;  3T06 A;  5GOW B;  4C0A A;  4DX9 0;  4P7I A;  2YS1 A;  3QWM A;  1X86 A;  1MAI A;  3BJI A;  2Y8G A;  4A6H A;  1W1G A;  4K17 A;  2DFK A;  2UZR A;  4TKN A;  1NI2 A;  2K2J A;  5KQ4 A;  3ULB A;  4B6H A;  5FI1 A;  5LON B;  2Y8F A;  5KQ1 A;  4H8S A;  2DKQ A;  1WGQ A;  4L6E A;  1Y19 B;  2VRW B;  3NSU A;  1QC6 A;  2QKM A;  3ZDT A;  5C6R A;  2IFS A;  2COD A;  3U7D A;  2D9V A;  1KI1 B;  3VOQ A;  3TFM A;  3D8F A;  1XX0 A;  1E5W A;  1AWE A;  1Z87 A;  2LG1 A;  3KSY A;  4TYZ A;  2DKP A;  4ZRJ A;  4GMX B;  2OTX A;  1FGY A;  4DBB A;  3HK0 A;  3PZD A;  1P6S A;  2P0D A;  2I5F A;  3UZT A;  1UNQ A;  1KZ7 A;  2CY5 A;  3PEG A;  3WYF B;  2GCJ A;  2D9W A;  1K5G B;  1FHO A;  2YT1 A;  1UPQ A;  1PMS A;  3PVU A;  2EC1 A;  3ODW A;  2UZS A;  4PQ0 A;  1IRS A;  3MDB C;  3MPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...