2LOXA

Nmr structure of the complex between the ph domain of the tfb1 subunit from tfiih and rad2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
115
structure length
115
Chain Sequence
b'PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase II transcription factor B subunit 1
publication title Structural and functional characterization of interactions involving the Tfb1 subunit of TFIIH and the NER factor Rad2.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/hydrolase
total genus 16
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2012-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2loxA00
1WGQA 5C6RA 3ODWA 2E2XA 2GJYA 2UZSA 2EJ8A 4TKNA 1FB8A 4DX90 1U2BA 1PLSA 2DX5A 2EC1A 2PZ1A 3X23A 2W2WA 5C5BA 3A8QA 3PZDA 1ZC4B 2CRFA 5D27A 3AU5A 2D9YA 1DDWA 4HHVA 4GMVA 3TFMA 2D11A 1LW3A 2J0JA 2W2XC 3IVFA 5FI0A 2NZ8B 1UPRA 2V76A 1XCGA 1X1FA 4KHOA 2MKRA 3HW2B 2COFA 2UVMA 5CLQB 2MDXA 1XODA 5CLLB 4WVFB 2HE7A 2RVBB 4BBKA 1EAZA 2H7EA 2QKMA 5JHHA 3M1IB 1J0WA 2RGNB 2D9VA 3PG7A 1DDVA 2EMTA 3P6AA 4H8SA 3FSSA 2CY5A 4CYEA 1SGHA 2MWNB 5DHAB 2BCJA 1TQZA 4HDOA 4HAVB 4IAPA 3OANA 2DA0A 4F7GA 2DFKA 4GN1A 4EJNA 2N0YA 1RJ2A 4PNKA 2M38A 1FOEA 1K5DB 2QKLA 3TO1A 2K2JA 2DLWA 3KRXA 3ODOA 4C0AA 2D9XA 5DH9B 1NTYA 5C79A 5J3QA 3DXCA 2YSZA 5C16A 2DKQA 3O96A 1XX0A 3F0WA 2D4QA 1DYNA 2AL6A 1OMWA 2ROVA 2CAYA 1FHXA 1IRSA 5D3VA 2NMBA 3D8EA 1U29A 4HAUB 4DBBA 4D0NB 2LOZA 2YRYA 2R0DA 1V61A 3N7CA 3GYOA 1WGUA 1GC6A 1ZSQA 3A8PA 2Y8GA 1AQCA 1U5FA 3QBVB 1MAIA 5D3YA 1U5EA 1UNRA 3SO6A 4MT7A 5HE1A 2J0MA 4HAZB 1MKEA 3BJIA 1BWNA 1LB1A 3D8DA 1BTNA 1GC7A 4YL8A 4K2PA 4HB3B 1I7AA 4Y94A 1U5DA 2CODA 5LONB 2YS3A 3MPXA 2GS0A 2YVCA 3VIAA 1TXDA 2DHKA 4K17A 5D3XA 3KRWA 4PQ0A 1WI1A 3TW1A 3WA0A 2DYQA 1ZC3B 4DXAB 3ZVRA 1E5WA 1EVHA 5HE0A 1K5GB 1H10A 2YS5A 1NI2A 1KZGA 2MFQA 4GZUA 1V89A 1V5PA 4HATB 4B6HA 2VRWB 3SNHA 3ODXA 5L81A 4CHMA 3UZTA 2OTXA 3TCAA 1SHCA 4EMOA 1Q67A 1WJMA 4A6KA 2CY4A 1ZM0A 2FJLA 2DN6A 3QWMA 3SV1A 1MK9B 1Y5OA 2DX1A 5JLJB 4TYZA 2P0FA 1WJ1A 2Z0PA 3CXBB 2DYNA 4HDQA 2DKPA 2YT0A 1EGXA 4K2OA 1BAKA 1X86A 4K81A 2KGXB 1W1GA 2AEHA 1UPQA 5GOWB 1TJ6A 5DHFB 2P0HA 1Y19B 2HTHB 4F7HA 4P7IA 2D9ZA 2ELAA 1V5MA 3ULBA 2I5CA 5LOPB 4NY0A 1FGZA 2JP2A 4YONA 2RUKB 4WSFA 3PVUA 2P8VA 1AWEA 2J59M 2W2XD 3VOQA 1P6SA 1DDMA 2ZPYA 1X11A 5KCVA 1X05A 2Q13A 3KSYA 4HAXB 2DHJA 4ZRIA 3DXDA 4A5KA 1W1HA 5KQ1A 1UNPA 2K2UA 4KVGB 4HAYB 4IFSA 5J3YA 1BTKA 1FHOA 5DI9B 4KHAA 2L2IA 3SYXA 2G35A 4CHJA 4ZRKA 2LG1A 3U8ZA 1OQNA 2YS1A 2YT1A 3BINA 2KCJA 2IYBA 4L6EA 1X1GA 2Z0OA 1J19A 5J3TA 1I2HA 1MPHA 4GPTB 1W1DA 2COCA 1RRPB 3PVLA 2LYDA 3PP2A 1QQGA 3T06A 2ADZA 5D3WA 4A6HA 2GCLA 1PFJA 2LKOA 4DX8A 2ROZB 4KHBB 4MY6A 2DHIA 5JHGA 1XKEA 4HB4B 3U7DA 2DTCA 4A6FA 1V88A 2D2QA 2H7DA 3QIJA 1DROA 4HAWB 5HE3A 4Z2NA 1B55A 1M7RA 1U27A 3V5WA 1MK7B 3ZDTA 1UNQA 4A6FB 1H4RA 2Y8FA 1WG7A 3KY9A 2GCJA 3WYFB 3HK0A 1FHWA 2VKIA 1NTVA 5C5BB 2KUPA 3MDBC 3KZ1A 3G9WA 1PMSA 3ML4A 2EMSA 1ISNA 1KZ7A 3D8FA 3FM8C 2P0DA 4MK0A 2XQNM 1EF1A 4HB2B 1UEFA 2K00A 2R09A 5HE2A 3LJUX 1XR0B 2RSGA 3AU4A 3DXEA 4WJ7A 3RCPA 4ZRJA 3A98B 3FEHA 4IOYX 5JP4A 3F5RA 1P3RA 1V5UA 3PSCA 5EFXA 4GXBA 3HQCA 5KQ4A 1QC6A 1ZVRA 2J0KA 1N3HA 2I1JA 2RNRB 2I5FA 4Z2MB 2YF0A 2LOXA 1GG3A 1DBHA 4EKUA 1P5TA 3CIKA 1KI1B 1WVHA 4NSWA 2D9WA 5DIFB 4KAXB 1FAOA 2VSZA 5FI1A 2I1KA 4XWXA 2ELBA 4HB0B 2UZRA 3SUZA 1FGYA 2OQBA 1OY2A 2RLOA 2IFSA 1MIXA 3NSUA 1MIZB 2Z0QA 1NU2A 1XD4A 2N23A 3ULCA 1Z87A 2L1CA 3PVWA 4F7UP 1M7EA 2LULA 2X18A 1U5GA 2COAA 3PEGA 3AJ4A 2D10A 3GYPA 3TVVA 2Y7BA 2M14A 4GMXB 3P7ZA
chains in the Genus database with same CATH superfamily
1WGQA 5C6RA 3ODWA 2E2XA 2GJYA 2GUMA 2EJ8A 2UZSA 4TKNA 1FB8A 4DX90 1U2BA 1PLSA 2DX5A 2EC1A 2PZ1A 3X23A 2W2WA 4QXAB 5C5BA 2KIEA 3A8QA 3PZDA 1ZC4B 5I2MA 2CRFA 5D27A 3AU5A 4QJ4B 2D9YA 1DDWA 4HHVA 4GMVA 3TFMA 2D11A 1LW3A 2J0JA 2W2XC 3IVFA 5FI0A 2NZ8B 1UPRA 2V76A 1XCGA 1X1FA 3NWDA 4KHOA 2MKRA 3HW2B 2COFA 2ZKMX 2UVMA 5CLQB 2MDXA 1XODA 5CLLB 4WVFB 2HE7A 2RVBB 4BBKA 2KIGA 1EAZA 2H7EA 2QKMA 5JHHA 3M1IB 1J0WA 2RGNB 2D9VA 3PG7A 1DDVA 2EMTA 4OSNA 2KUQA 3P6AA 4H8SA 3FSSA 2CY5A 4CYEA 1SGHA 2MWNB 5DHAB 2BCJA 1TQZA 2R2YA 4HDOA 4L1RA 1MI1A 4HAVB 4IAPA 3OANA 2DA0A 4F7GA 2DFKA 4GN1A 4EJNA 2N0YA 1RJ2A 4PNKA 2M38A 1FOEA 1K5DB 2QKLA 3TO1A 2K2JA 2DLWA 3KRXA 3ODOA 4C0AA 2D9XA 5DH9B 1NTYA 5C79A 5J3QA 3DXCA 2YSZA 5C16A 2DKQA 3O96A 1XX0A 3F0WA 2D4QA 1DYNA 2AL6A 1OMWA 2ROVA 2CAYA 1FHXA 1IRSA 5D3VA 2NMBA 3D8EA 1U29A 4HAUB 4DBBA 4D0NB 2LOZA 2YRYA 2R0DA 1V61A 3GYOA 3N7CA 1WGUA 1GC6A 1ZSQA 3A8PA 4CSQA 2Y8GA 1AQCA 1U5FA 3QBVB 5I2SA 1MAIA 5D3YA 1U5EA 1UNRA 3SO6A 4MT7A 5HE1A 2J0MA 4HAZB 1MKEA 3BJIA 1BWNA 2Z59A 1LB1A 3D8DA 1BTNA 1GC7A 4YL8A 3HSAA 4HB3B 1I7AA 4K2PA 4Y94A 1U5DA 2CODA 5LONB 2YS3A 3MPXA 2GS0A 2YVCA 3VIAA 1TXDA 2DHKA 4K17A 5D3XA 3HIEA 3KRWA 4PQ0A 1WI1A 3TW1A 3WA0A 2DYQA 1ZC3B 4DXAB 3ZVRA 1E5WA 4GNKB 1EVHA 5HE0A 1K5GB 1H10A 2YS5A 1NI2A 1KZGA 2MFQA 4GZUA 1V89A 1V5PA 4HATB 4B6HA 5LG4B 4DIXA 2VRWB 3SNHA 3ODXA 5L81A 4CHMA 3UZTA 2RRFA 2OTXA 3TCAA 1SHCA 4EMOA 1Q67A 1WJMA 3NWFA 2CY4A 4A6KA 1ZM0A 2FJLA 2DN6A 3QWMA 4HSIA 3SV1A 1MK9B 1Y5OA 2DX1A 2YT2A 5JLJB 4TYZA 2P0FA 1WJ1A 2Z0PA 3CXBB 2DYNA 3FVCA 4HDQA 3OHMB 2DKPA 2FJUB 2YT0A 1EGXA 2KR0A 4K2OA 1BAKA 2Z14A 1X86A 3DCXA 4K81A 2KGXB 1W1GA 2AEHA 1UPQA 5GOWB 1TJ6A 5DHFB 1T77A 1ZYIA 2P0HA 1Y19B 2HTHB 4F7HA 4D6WA 4QJ5B 4P7IA 2D9ZA 2ELAA 1V5MA 3ULBA 2I5CA 5LOPB 4NY0A 4QJ3B 1FGZA 2JP2A 4YONA 2RUKB 4WSFA 3PVUA 2P8VA 1AWEA 2J59M 2W2XD 3VOQA 1P6SA 1DDMA 3A58A 2ZPYA 1X11A 5KCVA 1X05A 2Q13A 3KSYA 4HAXB 2DHJA 4ZRIA 3DXDA 4A5KA 1W1HA 5KQ1A 1UNPA 2K2UA 4KVGB 4HAYB 4IFSA 5J3YA 1BTKA 1FHOA 5DI9B 4KHAA 2L2IA 3SYXA 2G35A 4CHJA 4ZRKA 2LG1A 3U8ZA 1OQNA 2YS1A 4GOUA 2YT1A 3BINA 2KCJA 2NBVA 2IYBA 4L6EA 1X1GA 2Z0OA 1J19A 5J3TA 1I2HA 1MPHA 4GPTB 1W1DA 4KHBA 2Z13A 2COCA 1RRPB 3PVLA 2LYDA 3PP2A 1QQGA 3T06A 2ADZA 5D3WA 4A6HA 2GCLA 1PFJA 2LKOA 4DX8A 2ROZB 4KHBB 4MY6A 3B77A 2DHIA 5JHGA 3U12A 1XKEA 4HB4B 3U7DA 2DTCA 4A6FA 1V88A 2D2QA 2H7DA 3QIJA 1DROA 4HAWB 5HE3A 4Z2NA 1B55A 1M7RA 1U27A 3V5WA 1MK7B 3ZDTA 1UNQA 4A6FB 1H4RA 2Y8FA 1WG7A 3KY9A 2GCJA 3WYFB 3HK0A 1FHWA 2VKIA 1NTVA 5C5BB 2KUPA 3MDBC 2Z4DA 3KZ1A 3G9WA 1PMSA 3ML4A 2EMSA 1ISNA 1KZ7A 3D8FA 3FM8C 5IRSA 2P0DA 4MK0A 2XQNM 1EF1A 4HB2B 1UEFA 2K00A 2R09A 5HE2A 3LJUX 1XR0B 2RSGA 3AU4A 3DXEA 4WJ7A 3RCPA 4ZRJA 3A98B 3FEHA 4IOYX 5JP4A 3F5RA 2K8EA 1P3RA 1V5UA 3PSCA 5EFXA 4GXBA 3NWAA 3HQCA 5KQ4A 1QC6A 1ZVRA 2J0KA 1N3HA 2I1JA 2RNRB 2I5FA 4Z2MB 2YF0A 2K49A 2LOXA 1GG3A 1DBHA 4EKUA 1P5TA 3CIKA 4OT1A 1KI1B 1WVHA 4NSWA 2D9WA 5DIFB 4KAXB 1FAOA 2VSZA 5FI1A 2I1KA 4XWXA 5M4YB 2ELBA 4HB0B 2UZRA 3SUZA 1FGYA 2OQBA 1OY2A 2RLOA 2IFSA 1MIXA 3NSUA 1MIZB 2Z0QA 1NU2A 1XD4A 2N23A 3NW8A 3ULCA 1Z87A 2L1CA 3PVWA 4F7UP 1M7EA 2LULA 2X18A 1U5GA 2COAA 3PEGA 3AJ4A 2D10A 3GYPA 3TVVA 2Y7BA 2M14A 4GMXB 3P7ZA
chains in the Genus database with same CATH topology
1WGQA 5C6RA 3ODWA 2E2XA 2GJYA 2UZSA 2EJ8A 4TKNA 1FB8A 4DX90 1U2BA 1PLSA 2DX5A 2EC1A 2PZ1A 3X23A 2W2WA 5C5BA 3A8QA 3PZDA 1ZC4B 2CRFA 5D27A 3AU5A 2D9YA 1DDWA 4HHVA 4GMVA 3TFMA 2D11A 1LW3A 2J0JA 2W2XC 3IVFA 5FI0A 2NZ8B 1UPRA 2V76A 1XCGA 1X1FA 4KHOA 2MKRA 3HW2B 2COFA 2UVMA 5CLQB 2MDXA 1XODA 5CLLB 4WVFB 2HE7A 2RVBB 4BBKA 1EAZA 2H7EA 2QKMA 5JHHA 3M1IB 1J0WA 2RGNB 2D9VA 3PG7A 1DDVA 2EMTA 3P6AA 4H8SA 3FSSA 2CY5A 4CYEA 1SGHA 2MWNB 5DHAB 2BCJA 1TQZA 4HDOA 4HAVB 4IAPA 3OANA 2DA0A 4F7GA 2DFKA 4GN1A 4EJNA 2N0YA 1RJ2A 4PNKA 2M38A 1FOEA 1K5DB 2QKLA 3TO1A 2K2JA 2DLWA 3KRXA 3ODOA 4C0AA 2D9XA 5DH9B 1NTYA 5C79A 5J3QA 3DXCA 2YSZA 5C16A 2DKQA 3O96A 1XX0A 3F0WA 2D4QA 1DYNA 2AL6A 1OMWA 2ROVA 2CAYA 1FHXA 1IRSA 5D3VA 2NMBA 3D8EA 1U29A 4HAUB 4DBBA 4D0NB 2LOZA 2YRYA 2R0DA 1V61A 3N7CA 3GYOA 1WGUA 1GC6A 1ZSQA 3A8PA 2Y8GA 1AQCA 1U5FA 3QBVB 1MAIA 5D3YA 1U5EA 1UNRA 3SO6A 4MT7A 5HE1A 2J0MA 4HAZB 1MKEA 3BJIA 1BWNA 1LB1A 3D8DA 1BTNA 1GC7A 4YL8A 4K2PA 4HB3B 1I7AA 4Y94A 1U5DA 2CODA 5LONB 2YS3A 3MPXA 2GS0A 2YVCA 3VIAA 1TXDA 2DHKA 4K17A 5D3XA 3KRWA 4PQ0A 1WI1A 3TW1A 3WA0A 2DYQA 1ZC3B 4DXAB 3ZVRA 1E5WA 1EVHA 5HE0A 1K5GB 1H10A 2YS5A 1NI2A 1KZGA 2MFQA 4GZUA 1V89A 1V5PA 4HATB 4B6HA 2VRWB 3SNHA 3ODXA 5L81A 4CHMA 3UZTA 2OTXA 3TCAA 1SHCA 4EMOA 1Q67A 1WJMA 4A6KA 2CY4A 1ZM0A 2FJLA 2DN6A 3QWMA 3SV1A 1MK9B 1Y5OA 2DX1A 5JLJB 4TYZA 2P0FA 1WJ1A 2Z0PA 3CXBB 2DYNA 4HDQA 2DKPA 2YT0A 1EGXA 4K2OA 1BAKA 1X86A 4K81A 2KGXB 1W1GA 2AEHA 1UPQA 5GOWB 1TJ6A 5DHFB 2P0HA 1Y19B 2HTHB 4F7HA 4P7IA 2D9ZA 2ELAA 1V5MA 3ULBA 2I5CA 5LOPB 4NY0A 1FGZA 2JP2A 4YONA 2RUKB 4WSFA 3PVUA 2P8VA 1AWEA 2J59M 2W2XD 3VOQA 1P6SA 1DDMA 2ZPYA 1X11A 5KCVA 1X05A 2Q13A 3KSYA 4HAXB 2DHJA 4ZRIA 3DXDA 4A5KA 1W1HA 5KQ1A 1UNPA 2K2UA 4KVGB 4HAYB 4IFSA 5J3YA 1BTKA 1FHOA 5DI9B 4KHAA 2L2IA 3SYXA 2G35A 4CHJA 4ZRKA 2LG1A 3U8ZA 1OQNA 2YS1A 2YT1A 3BINA 2KCJA 2IYBA 4L6EA 1X1GA 2Z0OA 1J19A 5J3TA 1I2HA 1MPHA 4GPTB 1W1DA 2COCA 1RRPB 3PVLA 2LYDA 3PP2A 1QQGA 3T06A 2ADZA 5D3WA 4A6HA 2GCLA 1PFJA 2LKOA 4DX8A 2ROZB 4KHBB 4MY6A 2DHIA 5JHGA 1XKEA 4HB4B 3U7DA 2DTCA 4A6FA 1V88A 2D2QA 2H7DA 3QIJA 1DROA 4HAWB 5HE3A 4Z2NA 1B55A 1M7RA 1U27A 3V5WA 1MK7B 3ZDTA 1UNQA 4A6FB 1H4RA 2Y8FA 1WG7A 3KY9A 2GCJA 3WYFB 3HK0A 1FHWA 2VKIA 1NTVA 5C5BB 2KUPA 3MDBC 3KZ1A 3G9WA 1PMSA 3ML4A 2EMSA 1ISNA 1KZ7A 3D8FA 3FM8C 2P0DA 4MK0A 2XQNM 1EF1A 4HB2B 1UEFA 2K00A 2R09A 5HE2A 3LJUX 1XR0B 2RSGA 3AU4A 3DXEA 4WJ7A 3RCPA 4ZRJA 3A98B 3FEHA 4IOYX 5JP4A 3F5RA 1P3RA 1V5UA 3PSCA 5EFXA 4GXBA 3HQCA 5KQ4A 1QC6A 1ZVRA 2J0KA 1N3HA 2I1JA 2RNRB 2I5FA 4Z2MB 2YF0A 2LOXA 1GG3A 1DBHA 4EKUA 1P5TA 3CIKA 1KI1B 1WVHA 4NSWA 2D9WA 5DIFB 4KAXB 1FAOA 2VSZA 5FI1A 2I1KA 4XWXA 2ELBA 4HB0B 2UZRA 3SUZA 1FGYA 2OQBA 1OY2A 2RLOA 2IFSA 1MIXA 3NSUA 1MIZB 2Z0QA 1NU2A 1XD4A 2N23A 3ULCA 1Z87A 2L1CA 3PVWA 4F7UP 1M7EA 2LULA 2X18A 1U5GA 2COAA 3PEGA 3AJ4A 2D10A 3GYPA 3TVVA 2Y7BA 2M14A 4GMXB 3P7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WGQ A;  5C6R A;  3ODW A;  2E2X A;  2GJY A;  2UZS A;  2EJ8 A;  4TKN A;  1FB8 A;  4DX9 0;  1U2B A;  1PLS A;  2DX5 A;  2EC1 A;  2PZ1 A;  3X23 A;  2W2W A;  5C5B A;  3A8Q A;  3PZD A;  1ZC4 B;  2CRF A;  5D27 A;  3AU5 A;  2D9Y A;  1DDW A;  4HHV A;  4GMV A;  3TFM A;  2D11 A;  1LW3 A;  2J0J A;  2W2X C;  3IVF A;  5FI0 A;  2NZ8 B;  1UPR A;  2V76 A;  1XCG A;  1X1F A;  4KHO A;  2MKR A;  3HW2 B;  2COF A;  2UVM A;  5CLQ B;  2MDX A;  1XOD A;  5CLL B;  4WVF B;  2HE7 A;  2RVB B;  4BBK A;  1EAZ A;  2H7E A;  2QKM A;  5JHH A;  3M1I B;  1J0W A;  2RGN B;  2D9V A;  3PG7 A;  1DDV A;  2EMT A;  3P6A A;  4H8S A;  3FSS A;  2CY5 A;  4CYE A;  1SGH A;  2MWN B;  5DHA B;  2BCJ A;  1TQZ A;  4HDO A;  4HAV B;  4IAP A;  3OAN A;  2DA0 A;  4F7G A;  2DFK A;  4GN1 A;  4EJN A;  2N0Y A;  1RJ2 A;  4PNK A;  2M38 A;  1FOE A;  1K5D B;  2QKL A;  3TO1 A;  2K2J A;  2DLW A;  3KRX A;  3ODO A;  4C0A A;  2D9X A;  5DH9 B;  1NTY A;  5C79 A;  5J3Q A;  3DXC A;  2YSZ A;  5C16 A;  2DKQ A;  3O96 A;  1XX0 A;  3F0W A;  2D4Q A;  1DYN A;  2AL6 A;  1OMW A;  2ROV A;  2CAY A;  1FHX A;  1IRS A;  5D3V A;  2NMB A;  3D8E A;  1U29 A;  4HAU B;  4DBB A;  4D0N B;  2LOZ A;  2YRY A;  2R0D A;  1V61 A;  3N7C A;  3GYO A;  1WGU A;  1GC6 A;  1ZSQ A;  3A8P A;  2Y8G A;  1AQC A;  1U5F A;  3QBV B;  1MAI A;  5D3Y A;  1U5E A;  1UNR A;  3SO6 A;  4MT7 A;  5HE1 A;  2J0M A;  4HAZ B;  1MKE A;  3BJI A;  1BWN A;  1LB1 A;  3D8D A;  1BTN A;  1GC7 A;  4YL8 A;  4K2P A;  4HB3 B;  1I7A A;  4Y94 A;  1U5D A;  2COD A;  5LON B;  2YS3 A;  3MPX A;  2GS0 A;  2YVC A;  3VIA A;  1TXD A;  2DHK A;  4K17 A;  5D3X A;  3KRW A;  4PQ0 A;  1WI1 A;  3TW1 A;  3WA0 A;  2DYQ A;  1ZC3 B;  4DXA B;  3ZVR A;  1E5W A;  1EVH A;  5HE0 A;  1K5G B;  1H10 A;  2YS5 A;  1NI2 A;  1KZG A;  2MFQ A;  4GZU A;  1V89 A;  1V5P A;  4HAT B;  4B6H A;  2VRW B;  3SNH A;  3ODX A;  5L81 A;  4CHM A;  3UZT A;  2OTX A;  3TCA A;  1SHC A;  4EMO A;  1Q67 A;  1WJM A;  4A6K A;  2CY4 A;  1ZM0 A;  2FJL A;  2DN6 A;  3QWM A;  3SV1 A;  1MK9 B;  1Y5O A;  2DX1 A;  5JLJ B;  4TYZ A;  2P0F A;  1WJ1 A;  2Z0P A;  3CXB B;  2DYN A;  4HDQ A;  2DKP A;  2YT0 A;  1EGX A;  4K2O A;  1BAK A;  1X86 A;  4K81 A;  2KGX B;  1W1G A;  2AEH A;  1UPQ A;  5GOW B;  1TJ6 A;  5DHF B;  2P0H A;  1Y19 B;  2HTH B;  4F7H A;  4P7I A;  2D9Z A;  2ELA A;  1V5M A;  3ULB A;  2I5C A;  5LOP B;  4NY0 A;  1FGZ A;  2JP2 A;  4YON A;  2RUK B;  4WSF A;  3PVU A;  2P8V A;  1AWE A;  2J59 M;  2W2X D;  3VOQ A;  1P6S A;  1DDM A;  2ZPY A;  1X11 A;  5KCV A;  1X05 A;  2Q13 A;  3KSY A;  4HAX B;  2DHJ A;  4ZRI A;  3DXD A;  4A5K A;  1W1H A;  5KQ1 A;  1UNP A;  2K2U A;  4KVG B;  4HAY B;  4IFS A;  5J3Y A;  1BTK A;  1FHO A;  5DI9 B;  4KHA A;  2L2I A;  3SYX A;  2G35 A;  4CHJ A;  4ZRK A;  2LG1 A;  3U8Z A;  1OQN A;  2YS1 A;  2YT1 A;  3BIN A;  2KCJ A;  2IYB A;  4L6E A;  1X1G A;  2Z0O A;  1J19 A;  5J3T A;  1I2H A;  1MPH A;  4GPT B;  1W1D A;  2COC A;  1RRP B;  3PVL A;  2LYD A;  3PP2 A;  1QQG A;  3T06 A;  2ADZ A;  5D3W A;  4A6H A;  2GCL A;  1PFJ A;  2LKO A;  4DX8 A;  2ROZ B;  4KHB B;  4MY6 A;  2DHI A;  5JHG A;  1XKE A;  4HB4 B;  3U7D A;  2DTC A;  4A6F A;  1V88 A;  2D2Q A;  2H7D A;  3QIJ A;  1DRO A;  4HAW B;  5HE3 A;  4Z2N A;  1B55 A;  1M7R A;  1U27 A;  3V5W A;  1MK7 B;  3ZDT A;  1UNQ A;  4A6F B;  1H4R A;  2Y8F A;  1WG7 A;  3KY9 A;  2GCJ A;  3WYF B;  3HK0 A;  1FHW A;  2VKI A;  1NTV A;  5C5B B;  2KUP A;  3MDB C;  3KZ1 A;  3G9W A;  1PMS A;  3ML4 A;  2EMS A;  1ISN A;  1KZ7 A;  3D8F A;  3FM8 C;  2P0D A;  4MK0 A;  2XQN M;  1EF1 A;  4HB2 B;  1UEF A;  2K00 A;  2R09 A;  5HE2 A;  3LJU X;  1XR0 B;  2RSG A;  3AU4 A;  3DXE A;  4WJ7 A;  3RCP A;  4ZRJ A;  3A98 B;  3FEH A;  4IOY X;  5JP4 A;  3F5R A;  1P3R A;  1V5U A;  3PSC A;  5EFX A;  4GXB A;  3HQC A;  5KQ4 A;  1QC6 A;  1ZVR A;  2J0K A;  1N3H A;  2I1J A;  2RNR B;  2I5F A;  4Z2M B;  2YF0 A;  2LOX A;  1GG3 A;  1DBH A;  4EKU A;  1P5T A;  3CIK A;  1KI1 B;  1WVH A;  4NSW A;  2D9W A;  5DIF B;  4KAX B;  1FAO A;  2VSZ A;  5FI1 A;  2I1K A;  4XWX A;  2ELB A;  4HB0 B;  2UZR A;  3SUZ A;  1FGY A;  2OQB A;  1OY2 A;  2RLO A;  2IFS A;  1MIX A;  3NSU A;  1MIZ B;  2Z0Q A;  1NU2 A;  1XD4 A;  2N23 A;  3ULC A;  1Z87 A;  2L1C A;  3PVW A;  4F7U P;  1M7E A;  2LUL A;  2X18 A;  1U5G A;  2COA A;  3PEG A;  3AJ4 A;  2D10 A;  3GYP A;  3TVV A;  2Y7B A;  2M14 A;  4GMX B;  3P7Z A; 
#chains in the Genus database with same CATH topology
 1WGQ A;  5C6R A;  3ODW A;  2E2X A;  2GJY A;  2GUM A;  2EJ8 A;  2UZS A;  4TKN A;  1FB8 A;  4DX9 0;  1U2B A;  1PLS A;  2DX5 A;  2EC1 A;  2PZ1 A;  3X23 A;  2W2W A;  4QXA B;  5C5B A;  2KIE A;  3A8Q A;  3PZD A;  1ZC4 B;  5I2M A;  2CRF A;  5D27 A;  3AU5 A;  4QJ4 B;  2D9Y A;  1DDW A;  4HHV A;  4GMV A;  3TFM A;  2D11 A;  1LW3 A;  2J0J A;  2W2X C;  3IVF A;  5FI0 A;  2NZ8 B;  1UPR A;  2V76 A;  1XCG A;  1X1F A;  3NWD A;  4KHO A;  2MKR A;  3HW2 B;  2COF A;  2ZKM X;  2UVM A;  5CLQ B;  2MDX A;  1XOD A;  5CLL B;  4WVF B;  2HE7 A;  2RVB B;  4BBK A;  2KIG A;  1EAZ A;  2H7E A;  2QKM A;  5JHH A;  3M1I B;  1J0W A;  2RGN B;  2D9V A;  3PG7 A;  1DDV A;  2EMT A;  4OSN A;  2KUQ A;  3P6A A;  4H8S A;  3FSS A;  2CY5 A;  4CYE A;  1SGH A;  2MWN B;  5DHA B;  2BCJ A;  1TQZ A;  2R2Y A;  4HDO A;  4L1R A;  1MI1 A;  4HAV B;  4IAP A;  3OAN A;  2DA0 A;  4F7G A;  2DFK A;  4GN1 A;  4EJN A;  2N0Y A;  1RJ2 A;  4PNK A;  2M38 A;  1FOE A;  1K5D B;  2QKL A;  3TO1 A;  2K2J A;  2DLW A;  3KRX A;  3ODO A;  4C0A A;  2D9X A;  5DH9 B;  1NTY A;  5C79 A;  5J3Q A;  3DXC A;  2YSZ A;  5C16 A;  2DKQ A;  3O96 A;  1XX0 A;  3F0W A;  2D4Q A;  1DYN A;  2AL6 A;  1OMW A;  2ROV A;  2CAY A;  1FHX A;  1IRS A;  5D3V A;  2NMB A;  3D8E A;  1U29 A;  4HAU B;  4DBB A;  4D0N B;  2LOZ A;  2YRY A;  2R0D A;  1V61 A;  3GYO A;  3N7C A;  1WGU A;  1GC6 A;  1ZSQ A;  3A8P A;  4CSQ A;  2Y8G A;  1AQC A;  1U5F A;  3QBV B;  5I2S A;  1MAI A;  5D3Y A;  1U5E A;  1UNR A;  3SO6 A;  4MT7 A;  5HE1 A;  2J0M A;  4HAZ B;  1MKE A;  3BJI A;  1BWN A;  2Z59 A;  1LB1 A;  3D8D A;  1BTN A;  1GC7 A;  4YL8 A;  3HSA A;  4HB3 B;  1I7A A;  4K2P A;  4Y94 A;  1U5D A;  2COD A;  5LON B;  2YS3 A;  3MPX A;  2GS0 A;  2YVC A;  3VIA A;  1TXD A;  2DHK A;  4K17 A;  5D3X A;  3HIE A;  3KRW A;  4PQ0 A;  1WI1 A;  3TW1 A;  3WA0 A;  2DYQ A;  1ZC3 B;  4DXA B;  3ZVR A;  1E5W A;  4GNK B;  1EVH A;  5HE0 A;  1K5G B;  1H10 A;  2YS5 A;  1NI2 A;  1KZG A;  2MFQ A;  4GZU A;  1V89 A;  1V5P A;  4HAT B;  4B6H A;  5LG4 B;  4DIX A;  2VRW B;  3SNH A;  3ODX A;  5L81 A;  4CHM A;  3UZT A;  2RRF A;  2OTX A;  3TCA A;  1SHC A;  4EMO A;  1Q67 A;  1WJM A;  3NWF A;  2CY4 A;  4A6K A;  1ZM0 A;  2FJL A;  2DN6 A;  3QWM A;  4HSI A;  3SV1 A;  1MK9 B;  1Y5O A;  2DX1 A;  2YT2 A;  5JLJ B;  4TYZ A;  2P0F A;  1WJ1 A;  2Z0P A;  3CXB B;  2DYN A;  3FVC A;  4HDQ A;  3OHM B;  2DKP A;  2FJU B;  2YT0 A;  1EGX A;  2KR0 A;  4K2O A;  1BAK A;  2Z14 A;  1X86 A;  3DCX A;  4K81 A;  2KGX B;  1W1G A;  2AEH A;  1UPQ A;  5GOW B;  1TJ6 A;  5DHF B;  1T77 A;  1ZYI A;  2P0H A;  1Y19 B;  2HTH B;  4F7H A;  4D6W A;  4QJ5 B;  4P7I A;  2D9Z A;  2ELA A;  1V5M A;  3ULB A;  2I5C A;  5LOP B;  4NY0 A;  4QJ3 B;  1FGZ A;  2JP2 A;  4YON A;  2RUK B;  4WSF A;  3PVU A;  2P8V A;  1AWE A;  2J59 M;  2W2X D;  3VOQ A;  1P6S A;  1DDM A;  3A58 A;  2ZPY A;  1X11 A;  5KCV A;  1X05 A;  2Q13 A;  3KSY A;  4HAX B;  2DHJ A;  4ZRI A;  3DXD A;  4A5K A;  1W1H A;  5KQ1 A;  1UNP A;  2K2U A;  4KVG B;  4HAY B;  4IFS A;  5J3Y A;  1BTK A;  1FHO A;  5DI9 B;  4KHA A;  2L2I A;  3SYX A;  2G35 A;  4CHJ A;  4ZRK A;  2LG1 A;  3U8Z A;  1OQN A;  2YS1 A;  4GOU A;  2YT1 A;  3BIN A;  2KCJ A;  2NBV A;  2IYB A;  4L6E A;  1X1G A;  2Z0O A;  1J19 A;  5J3T A;  1I2H A;  1MPH A;  4GPT B;  1W1D A;  4KHB A;  2Z13 A;  2COC A;  1RRP B;  3PVL A;  2LYD A;  3PP2 A;  1QQG A;  3T06 A;  2ADZ A;  5D3W A;  4A6H A;  2GCL A;  1PFJ A;  2LKO A;  4DX8 A;  2ROZ B;  4KHB B;  4MY6 A;  3B77 A;  2DHI A;  5JHG A;  3U12 A;  1XKE A;  4HB4 B;  3U7D A;  2DTC A;  4A6F A;  1V88 A;  2D2Q A;  2H7D A;  3QIJ A;  1DRO A;  4HAW B;  5HE3 A;  4Z2N A;  1B55 A;  1M7R A;  1U27 A;  3V5W A;  1MK7 B;  3ZDT A;  1UNQ A;  4A6F B;  1H4R A;  2Y8F A;  1WG7 A;  3KY9 A;  2GCJ A;  3WYF B;  3HK0 A;  1FHW A;  2VKI A;  1NTV A;  5C5B B;  2KUP A;  3MDB C;  2Z4D A;  3KZ1 A;  3G9W A;  1PMS A;  3ML4 A;  2EMS A;  1ISN A;  1KZ7 A;  3D8F A;  3FM8 C;  5IRS A;  2P0D A;  4MK0 A;  2XQN M;  1EF1 A;  4HB2 B;  1UEF A;  2K00 A;  2R09 A;  5HE2 A;  3LJU X;  1XR0 B;  2RSG A;  3AU4 A;  3DXE A;  4WJ7 A;  3RCP A;  4ZRJ A;  3A98 B;  3FEH A;  4IOY X;  5JP4 A;  3F5R A;  2K8E A;  1P3R A;  1V5U A;  3PSC A;  5EFX A;  4GXB A;  3NWA A;  3HQC A;  5KQ4 A;  1QC6 A;  1ZVR A;  2J0K A;  1N3H A;  2I1J A;  2RNR B;  2I5F A;  4Z2M B;  2YF0 A;  2K49 A;  2LOX A;  1GG3 A;  1DBH A;  4EKU A;  1P5T A;  3CIK A;  4OT1 A;  1KI1 B;  1WVH A;  4NSW A;  2D9W A;  5DIF B;  4KAX B;  1FAO A;  2VSZ A;  5FI1 A;  2I1K A;  4XWX A;  5M4Y B;  2ELB A;  4HB0 B;  2UZR A;  3SUZ A;  1FGY A;  2OQB A;  1OY2 A;  2RLO A;  2IFS A;  1MIX A;  3NSU A;  1MIZ B;  2Z0Q A;  1NU2 A;  1XD4 A;  2N23 A;  3NW8 A;  3ULC A;  1Z87 A;  2L1C A;  3PVW A;  4F7U P;  1M7E A;  2LUL A;  2X18 A;  1U5G A;  2COA A;  3PEG A;  3AJ4 A;  2D10 A;  3GYP A;  3TVV A;  2Y7B A;  2M14 A;  4GMX B;  3P7Z A; 
#chains in the Genus database with same CATH homology
 1WGQ A;  5C6R A;  3ODW A;  2E2X A;  2GJY A;  2UZS A;  2EJ8 A;  4TKN A;  1FB8 A;  4DX9 0;  1U2B A;  1PLS A;  2DX5 A;  2EC1 A;  2PZ1 A;  3X23 A;  2W2W A;  5C5B A;  3A8Q A;  3PZD A;  1ZC4 B;  2CRF A;  5D27 A;  3AU5 A;  2D9Y A;  1DDW A;  4HHV A;  4GMV A;  3TFM A;  2D11 A;  1LW3 A;  2J0J A;  2W2X C;  3IVF A;  5FI0 A;  2NZ8 B;  1UPR A;  2V76 A;  1XCG A;  1X1F A;  4KHO A;  2MKR A;  3HW2 B;  2COF A;  2UVM A;  5CLQ B;  2MDX A;  1XOD A;  5CLL B;  4WVF B;  2HE7 A;  2RVB B;  4BBK A;  1EAZ A;  2H7E A;  2QKM A;  5JHH A;  3M1I B;  1J0W A;  2RGN B;  2D9V A;  3PG7 A;  1DDV A;  2EMT A;  3P6A A;  4H8S A;  3FSS A;  2CY5 A;  4CYE A;  1SGH A;  2MWN B;  5DHA B;  2BCJ A;  1TQZ A;  4HDO A;  4HAV B;  4IAP A;  3OAN A;  2DA0 A;  4F7G A;  2DFK A;  4GN1 A;  4EJN A;  2N0Y A;  1RJ2 A;  4PNK A;  2M38 A;  1FOE A;  1K5D B;  2QKL A;  3TO1 A;  2K2J A;  2DLW A;  3KRX A;  3ODO A;  4C0A A;  2D9X A;  5DH9 B;  1NTY A;  5C79 A;  5J3Q A;  3DXC A;  2YSZ A;  5C16 A;  2DKQ A;  3O96 A;  1XX0 A;  3F0W A;  2D4Q A;  1DYN A;  2AL6 A;  1OMW A;  2ROV A;  2CAY A;  1FHX A;  1IRS A;  5D3V A;  2NMB A;  3D8E A;  1U29 A;  4HAU B;  4DBB A;  4D0N B;  2LOZ A;  2YRY A;  2R0D A;  1V61 A;  3N7C A;  3GYO A;  1WGU A;  1GC6 A;  1ZSQ A;  3A8P A;  2Y8G A;  1AQC A;  1U5F A;  3QBV B;  1MAI A;  5D3Y A;  1U5E A;  1UNR A;  3SO6 A;  4MT7 A;  5HE1 A;  2J0M A;  4HAZ B;  1MKE A;  3BJI A;  1BWN A;  1LB1 A;  3D8D A;  1BTN A;  1GC7 A;  4YL8 A;  4K2P A;  4HB3 B;  1I7A A;  4Y94 A;  1U5D A;  2COD A;  5LON B;  2YS3 A;  3MPX A;  2GS0 A;  2YVC A;  3VIA A;  1TXD A;  2DHK A;  4K17 A;  5D3X A;  3KRW A;  4PQ0 A;  1WI1 A;  3TW1 A;  3WA0 A;  2DYQ A;  1ZC3 B;  4DXA B;  3ZVR A;  1E5W A;  1EVH A;  5HE0 A;  1K5G B;  1H10 A;  2YS5 A;  1NI2 A;  1KZG A;  2MFQ A;  4GZU A;  1V89 A;  1V5P A;  4HAT B;  4B6H A;  2VRW B;  3SNH A;  3ODX A;  5L81 A;  4CHM A;  3UZT A;  2OTX A;  3TCA A;  1SHC A;  4EMO A;  1Q67 A;  1WJM A;  4A6K A;  2CY4 A;  1ZM0 A;  2FJL A;  2DN6 A;  3QWM A;  3SV1 A;  1MK9 B;  1Y5O A;  2DX1 A;  5JLJ B;  4TYZ A;  2P0F A;  1WJ1 A;  2Z0P A;  3CXB B;  2DYN A;  4HDQ A;  2DKP A;  2YT0 A;  1EGX A;  4K2O A;  1BAK A;  1X86 A;  4K81 A;  2KGX B;  1W1G A;  2AEH A;  1UPQ A;  5GOW B;  1TJ6 A;  5DHF B;  2P0H A;  1Y19 B;  2HTH B;  4F7H A;  4P7I A;  2D9Z A;  2ELA A;  1V5M A;  3ULB A;  2I5C A;  5LOP B;  4NY0 A;  1FGZ A;  2JP2 A;  4YON A;  2RUK B;  4WSF A;  3PVU A;  2P8V A;  1AWE A;  2J59 M;  2W2X D;  3VOQ A;  1P6S A;  1DDM A;  2ZPY A;  1X11 A;  5KCV A;  1X05 A;  2Q13 A;  3KSY A;  4HAX B;  2DHJ A;  4ZRI A;  3DXD A;  4A5K A;  1W1H A;  5KQ1 A;  1UNP A;  2K2U A;  4KVG B;  4HAY B;  4IFS A;  5J3Y A;  1BTK A;  1FHO A;  5DI9 B;  4KHA A;  2L2I A;  3SYX A;  2G35 A;  4CHJ A;  4ZRK A;  2LG1 A;  3U8Z A;  1OQN A;  2YS1 A;  2YT1 A;  3BIN A;  2KCJ A;  2IYB A;  4L6E A;  1X1G A;  2Z0O A;  1J19 A;  5J3T A;  1I2H A;  1MPH A;  4GPT B;  1W1D A;  2COC A;  1RRP B;  3PVL A;  2LYD A;  3PP2 A;  1QQG A;  3T06 A;  2ADZ A;  5D3W A;  4A6H A;  2GCL A;  1PFJ A;  2LKO A;  4DX8 A;  2ROZ B;  4KHB B;  4MY6 A;  2DHI A;  5JHG A;  1XKE A;  4HB4 B;  3U7D A;  2DTC A;  4A6F A;  1V88 A;  2D2Q A;  2H7D A;  3QIJ A;  1DRO A;  4HAW B;  5HE3 A;  4Z2N A;  1B55 A;  1M7R A;  1U27 A;  3V5W A;  1MK7 B;  3ZDT A;  1UNQ A;  4A6F B;  1H4R A;  2Y8F A;  1WG7 A;  3KY9 A;  2GCJ A;  3WYF B;  3HK0 A;  1FHW A;  2VKI A;  1NTV A;  5C5B B;  2KUP A;  3MDB C;  3KZ1 A;  3G9W A;  1PMS A;  3ML4 A;  2EMS A;  1ISN A;  1KZ7 A;  3D8F A;  3FM8 C;  2P0D A;  4MK0 A;  2XQN M;  1EF1 A;  4HB2 B;  1UEF A;  2K00 A;  2R09 A;  5HE2 A;  3LJU X;  1XR0 B;  2RSG A;  3AU4 A;  3DXE A;  4WJ7 A;  3RCP A;  4ZRJ A;  3A98 B;  3FEH A;  4IOY X;  5JP4 A;  3F5R A;  1P3R A;  1V5U A;  3PSC A;  5EFX A;  4GXB A;  3HQC A;  5KQ4 A;  1QC6 A;  1ZVR A;  2J0K A;  1N3H A;  2I1J A;  2RNR B;  2I5F A;  4Z2M B;  2YF0 A;  2LOX A;  1GG3 A;  1DBH A;  4EKU A;  1P5T A;  3CIK A;  1KI1 B;  1WVH A;  4NSW A;  2D9W A;  5DIF B;  4KAX B;  1FAO A;  2VSZ A;  5FI1 A;  2I1K A;  4XWX A;  2ELB A;  4HB0 B;  2UZR A;  3SUZ A;  1FGY A;  2OQB A;  1OY2 A;  2RLO A;  2IFS A;  1MIX A;  3NSU A;  1MIZ B;  2Z0Q A;  1NU2 A;  1XD4 A;  2N23 A;  3ULC A;  1Z87 A;  2L1C A;  3PVW A;  4F7U P;  1M7E A;  2LUL A;  2X18 A;  1U5G A;  2COA A;  3PEG A;  3AJ4 A;  2D10 A;  3GYP A;  3TVV A;  2Y7B A;  2M14 A;  4GMX B;  3P7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...