2LOXA

Nmr structure of the complex between the ph domain of the tfb1 subunit from tfiih and rad2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
115
structure length
115
Chain Sequence
PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional characterization of interactions involving the Tfb1 subunit of TFIIH and the NER factor Rad2.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/hydrolase
molecule keywords RNA polymerase II transcription factor B subunit 1
total genus 16
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2012-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2loxA00
4MT7A 5CLQB 4GXBA 3O96A 1LB1A 1BWNA 4CHJA 3ULCA 5J3QA 1XD4A 5D27A 2RLOA 1MK7B 3VIAA 2DYNA 5HE0A 4H8SA 3ZDTA 1V89A 4HB4B 4Z2NA 3ML4A 3F0WA 4DBBA 2E2XA 1U29A 2NZ8B 2VSZA 3BJIA 2UZSA 4A6HA 2J0MA 2N23A 2YVCA 1GC6A 2DX1A 1U5EA 3D8DA 3PSCA 4B6HA 3AU5A 3SYXA 5DI9B 4IOYX 3NSUA 4A6FA 5HE3A 2D9VA 1X1GA 2KGXB 3PVLA 2R09A 2UVMA 1ISNA 5L81A 3TVVA 3ULBA 3V5WA 3IVFA 4P7IA 1UNRA 2J0JA 3CXBB 1SHCA 1B55A 1NTVA 1BTKA 2K00A 4GPTB 3LJUX 2LYDA 2ELAA 4HB3B 3CIKA 4A5KA 5DIFB 1WG7A 2DHIA 5JHHA 2CRFA 2CY5A 3HQCA 3WA0A 2J59M 5DHAB 3G9WA 2W2WA 3GYOA 1LW3A 3MDBC 4GMXB 2YS1A 3DXEA 4DXAB 4MK0A 1FGZA 2Z0OA 2OQBA 1EAZA 2ROVA 1W1DA 4K2OA 1W1HA 2RNRB 1NTYA 2BCJA 5C6RA 3KZ1A 3KSYA 3FM8C 5EFXA 2YS5A 1FHOA 2COCA 3HW2B 4PQ0A 2RSGA 3PZDA 1DDMA 2GJYA 2UZRA 1XR0B 2X18A 1ZSQA 1TXDA 2MKRA 1UEFA 4F7GA 4TYZA 1IRSA 3PVWA 1BAKA 4XWXA 1PLSA 4K17A 1GG3A 2EC1A 2IYBA 2Z0PA 2I1JA 1UNPA 2YT0A 2LOZA 4PNKA 1M7EA 4HAYB 3ODWA 1U27A 2N0YA 3KRXA 4WVFB 5CLLB 4KVGB 2K2UA 4L6EA 5JP4A 3FEHA 1X86A 2DTCA 1N3HA 2IFSA 5JHGA 1E5WA 1MIZB 3FSSA 1EVHA 3MPXA 2AL6A 2COFA 3D8FA 4IFSA 2P0HA 2Z0QA 1TQZA 4F7HA 2J0KA 3OANA 2ROZB 2DHJA 2DA0A 2JP2A 3N7CA 3ZVRA 1MKEA 3TCAA 2R0DA 5KQ4A 2W2XC 1J19A 1DDWA 2OTXA 2YS3A 1AWEA 1V61A 1WJMA 3PVUA 1P3RA 5C5BB 4NSWA 2K2JA 2YSZA 1FGYA 2CY4A 4YL8A 3SUZA 5C5BA 1MPHA 1Y19B 1H10A 2KCJA 5GOWB 4HB2B 4WJ7A 2Q13A 2Y8GA 2D10A 2XQNM 3T06A 1DROA 1I2HA 2DHKA 1FHXA 5HE2A 1MAIA 1OMWA 1RJ2A 4ZRKA 4KHOA 1J0WA 1FB8A 1KI1B 5C16A 1DYNA 2L2IA 4K81A 3M1IB 3UZTA 4NY0A 2QKMA 1ZC4B 1XODA 3DXCA 2VKIA 2G35A 2D9XA 3U8ZA 3P6AA 2DFKA 1XKEA 2GS0A 2AEHA 1X11A 2D4QA 3QWMA 4MY6A 2LOXA 2HE7A 5KQ1A 1NU2A 4HAZB 2I5CA 2EMSA 1KZGA 4F7UP 1V88A 3SV1A 2V76A 1DDVA 2LULA 4A6FB 4K2PA 2H7DA 1Z87A 3QBVB 3F5RA 3ODOA 2NMBA 4EJNA 1I7AA 2P8VA 2P0FA 1W1GA 4CYEA 3SO6A 1WI1A 1BTNA 3PP2A 4EKUA 4BBKA 2ADZA 2Y8FA 1V5UA 5J3YA 3X23A 1UPQA 2MDXA 4HAWB 4KHBB 3DXDA 1NI2A 3VOQA 2HTHB 2EMTA 1MK9B 4HAUB 1P5TA 2RVBB 3TW1A 1WVHA 2GCLA 3GYPA 1X1FA 1U5GA 1M7RA 2ELBA 4GMVA 4YONA 2LKOA 2PZ1A 1Q67A 2D11A 1WGUA 2DYQA 1TJ6A 1ZM0A 2QKLA 5FI0A 5HE1A 5D3XA 1K5GB 2D9ZA 4DX90 1PMSA 1QQGA 2CODA 2I5FA 5J3TA 4IAPA 1ZC3B 2YF0A 1SGHA 2L1CA 2RUKB 2D2QA 5JLJB 1Y5OA 1FAOA 1H4RA 2I1KA 4Z2MB 5LOPB 3A98B 3RCPA 1UNQA 1XCGA 3TO1A 4HAVB 4HB0B 2GCJA 1WJ1A 3D8EA 1V5MA 2VRWB 3AJ4A 4KHAA 1DBHA 1ZVRA 3TFMA 3A8QA 1U5FA 2FJLA 4HAXB 4DX8A 3KY9A 4CHMA 2RGNB 2MWNB 4TKNA 2YT1A 2DX5A 1V5PA 4EMOA 1P6SA 1OY2A 2DKPA 1FOEA 4HHVA 1EF1A 1U2BA 1XX0A 1RRPB 4D0NB 4HDOA 2DLWA 4HDQA 4Y94A 1K5DB 1EGXA 1FHWA 3AU4A 4A6KA 2W2XD 2COAA 4WSFA 1U5DA 1UPRA 5DHFB 5D3VA 1OQNA 3ODXA 1PFJA 1QC6A 3A8PA 4GN1A 5KCVA 3HK0A 4GZUA 2LG1A 3SNHA 5D3WA 4ZRJA 4ZRIA 2H7EA 2MFQA 1AQCA 1WGQA 1GC7A 1X05A 2KUPA 3KRWA 2DKQA 5D3YA 3PG7A 2ZPYA 2M38A 5C79A 1KZ7A 2D9WA 2P0DA 3WYFB 2Y7BA 2EJ8A 4C0AA 2D9YA 2M14A 3U7DA 4HATB 5FI1A 5LONB 1MIXA 5DH9B 3BINA 3QIJA 2DN6A 3P7ZA 2CAYA 3PEGA 2YRYA 4KAXB
chains in the Genus database with same CATH superfamily
4MT7A 2Z14A 5CLQB 4GXBA 3O96A 1LB1A 1BWNA 4CHJA 3ULCA 5J3QA 1XD4A 5D27A 2RLOA 5I2SA 1MK7B 3VIAA 2DYNA 5HE0A 4H8SA 3ZDTA 1V89A 4GOUA 4HB4B 4Z2NA 2FJUB 3ML4A 3F0WA 4DBBA 2E2XA 1U29A 2NZ8B 3NW8A 2VSZA 3BJIA 4KHBA 2UZSA 4A6HA 2J0MA 2N23A 2YVCA 1GC6A 2DX1A 1U5EA 3D8DA 3PSCA 4B6HA 3AU5A 3SYXA 5DI9B 4IOYX 3NSUA 4A6FA 5HE3A 2D9VA 1X1GA 2KR0A 2KGXB 3PVLA 2R09A 2UVMA 1ISNA 5L81A 3TVVA 3ULBA 5IRSA 3DCXA 3V5WA 3IVFA 4P7IA 1UNRA 2J0JA 3CXBB 1SHCA 2ZKMX 1B55A 1NTVA 1BTKA 2K00A 4GPTB 3LJUX 2LYDA 2ELAA 4HB3B 3CIKA 4A5KA 2Z13A 5DIFB 1WG7A 2DHIA 5JHHA 2CRFA 2CY5A 3HQCA 3WA0A 2J59M 5DHAB 3G9WA 2W2WA 4OSNA 3GYOA 1LW3A 3MDBC 4GMXB 2YS1A 1ZYIA 3DXEA 3NWFA 4DXAB 4MK0A 1FGZA 2Z0OA 2OQBA 1EAZA 2K49A 2ROVA 1W1DA 4K2OA 3A58A 1W1HA 2RNRB 4QXAB 1NTYA 2BCJA 5M4YB 5C6RA 3KZ1A 3KSYA 3FM8C 3NWAA 5EFXA 2YS5A 1FHOA 2COCA 3HW2B 4PQ0A 2RSGA 3PZDA 1DDMA 2GJYA 2UZRA 1XR0B 2X18A 1ZSQA 1TXDA 2MKRA 1UEFA 4QJ3B 4F7GA 4TYZA 1IRSA 3PVWA 1BAKA 4XWXA 4CSQA 1PLSA 2YT2A 4K17A 1GG3A 2EC1A 2IYBA 2Z0PA 2I1JA 1UNPA 2YT0A 2LOZA 4PNKA 1M7EA 4HAYB 3ODWA 1U27A 2N0YA 3KRXA 4WVFB 5CLLB 2GUMA 4KVGB 2K2UA 4L6EA 5JP4A 3FEHA 1X86A 2DTCA 1N3HA 2IFSA 5JHGA 1E5WA 1MIZB 3FSSA 3FVCA 1EVHA 3MPXA 2AL6A 2COFA 3D8FA 4IFSA 2P0HA 2Z0QA 1TQZA 4F7HA 2J0KA 3OANA 5LG4B 2ROZB 2DHJA 2DA0A 2JP2A 3N7CA 3ZVRA 1MKEA 3TCAA 2R0DA 5KQ4A 2W2XC 1J19A 1DDWA 2OTXA 2YS3A 1AWEA 1V61A 3NWDA 1WJMA 3PVUA 1P3RA 5C5BB 4NSWA 2K2JA 2YSZA 1FGYA 2CY4A 4YL8A 3SUZA 5C5BA 1MPHA 2RRFA 1Y19B 1H10A 2KCJA 5GOWB 4HB2B 4WJ7A 2Q13A 2Y8GA 2KIEA 2D10A 2XQNM 3T06A 4L1RA 1DROA 1I2HA 2DHKA 1FHXA 5HE2A 1MAIA 1OMWA 1RJ2A 4ZRKA 4KHOA 1J0WA 1FB8A 1KI1B 5C16A 1DYNA 2L2IA 4K81A 3HIEA 4D6WA 3M1IB 3UZTA 4NY0A 2QKMA 4QJ4B 1ZC4B 1XODA 3DXCA 2VKIA 1T77A 2G35A 2D9XA 3U8ZA 3P6AA 3HSAA 2DFKA 1XKEA 2GS0A 2AEHA 1X11A 2D4QA 3QWMA 4MY6A 2LOXA 2HE7A 5KQ1A 1NU2A 4HAZB 2I5CA 2EMSA 1KZGA 4F7UP 1V88A 4QJ5B 3SV1A 2V76A 3B77A 1DDVA 2LULA 4HSIA 4A6FB 4K2PA 2H7DA 1Z87A 3QBVB 3F5RA 3ODOA 2NMBA 2Z59A 4EJNA 1I7AA 2P8VA 2NBVA 2P0FA 1W1GA 4CYEA 3SO6A 1WI1A 1BTNA 3PP2A 4EKUA 4BBKA 2K8EA 2ADZA 2Y8FA 1V5UA 5J3YA 3X23A 4DIXA 1UPQA 2MDXA 4HAWB 4KHBB 3DXDA 1NI2A 3VOQA 2HTHB 2EMTA 1MK9B 4HAUB 1P5TA 2RVBB 3TW1A 1WVHA 2GCLA 3GYPA 1X1FA 1U5GA 1M7RA 2ELBA 4GMVA 4YONA 2LKOA 2PZ1A 1Q67A 2D11A 2Z4DA 1WGUA 2DYQA 1TJ6A 1ZM0A 2QKLA 5FI0A 5HE1A 5D3XA 1K5GB 2D9ZA 4DX90 1PMSA 1QQGA 3U12A 2CODA 2I5FA 5J3TA 4IAPA 1ZC3B 2YF0A 1SGHA 2L1CA 2RUKB 2D2QA 5JLJB 1Y5OA 1FAOA 1H4RA 2I1KA 4Z2MB 5LOPB 3A98B 3RCPA 1UNQA 1XCGA 3TO1A 4HAVB 4HB0B 2GCJA 1WJ1A 3D8EA 1V5MA 2VRWB 3AJ4A 4KHAA 1DBHA 1ZVRA 3TFMA 3A8QA 1U5FA 2FJLA 4HAXB 4DX8A 3KY9A 4CHMA 2RGNB 2MWNB 4TKNA 1MI1A 2YT1A 2DX5A 1V5PA 4EMOA 1P6SA 1OY2A 2DKPA 1FOEA 4HHVA 1EF1A 1U2BA 1XX0A 2KIGA 1RRPB 4D0NB 4HDOA 2DLWA 4HDQA 4Y94A 1K5DB 1EGXA 1FHWA 3AU4A 4A6KA 2W2XD 2COAA 4WSFA 1U5DA 1UPRA 5DHFB 5D3VA 1OQNA 3ODXA 2R2YA 1PFJA 5I2MA 1QC6A 3A8PA 4GN1A 5KCVA 3HK0A 4GZUA 2LG1A 3SNHA 5D3WA 4ZRJA 4ZRIA 2H7EA 2MFQA 4GNKB 1AQCA 1WGQA 1GC7A 1X05A 2KUPA 3KRWA 2DKQA 5D3YA 3PG7A 2ZPYA 2M38A 5C79A 1KZ7A 2D9WA 2P0DA 3WYFB 2Y7BA 2EJ8A 3OHMB 4C0AA 2D9YA 2M14A 3U7DA 4HATB 5FI1A 5LONB 1MIXA 5DH9B 3BINA 3QIJA 2KUQA 2DN6A 4OT1A 3P7ZA 2CAYA 3PEGA 2YRYA 4KAXB
chains in the Genus database with same CATH topology
4MT7A 5CLQB 4GXBA 3O96A 1LB1A 1BWNA 4CHJA 3ULCA 5J3QA 1XD4A 5D27A 2RLOA 1MK7B 3VIAA 2DYNA 5HE0A 4H8SA 3ZDTA 1V89A 4HB4B 4Z2NA 3ML4A 3F0WA 4DBBA 2E2XA 1U29A 2NZ8B 2VSZA 3BJIA 2UZSA 4A6HA 2J0MA 2N23A 2YVCA 1GC6A 2DX1A 1U5EA 3D8DA 3PSCA 4B6HA 3AU5A 3SYXA 5DI9B 4IOYX 3NSUA 4A6FA 5HE3A 2D9VA 1X1GA 2KGXB 3PVLA 2R09A 2UVMA 1ISNA 5L81A 3TVVA 3ULBA 3V5WA 3IVFA 4P7IA 1UNRA 2J0JA 3CXBB 1SHCA 1B55A 1NTVA 1BTKA 2K00A 4GPTB 3LJUX 2LYDA 2ELAA 4HB3B 3CIKA 4A5KA 5DIFB 1WG7A 2DHIA 5JHHA 2CRFA 2CY5A 3HQCA 3WA0A 2J59M 5DHAB 3G9WA 2W2WA 3GYOA 1LW3A 3MDBC 4GMXB 2YS1A 3DXEA 4DXAB 4MK0A 1FGZA 2Z0OA 2OQBA 1EAZA 2ROVA 1W1DA 4K2OA 1W1HA 2RNRB 1NTYA 2BCJA 5C6RA 3KZ1A 3KSYA 3FM8C 5EFXA 2YS5A 1FHOA 2COCA 3HW2B 4PQ0A 2RSGA 3PZDA 1DDMA 2GJYA 2UZRA 1XR0B 2X18A 1ZSQA 1TXDA 2MKRA 1UEFA 4F7GA 4TYZA 1IRSA 3PVWA 1BAKA 4XWXA 1PLSA 4K17A 1GG3A 2EC1A 2IYBA 2Z0PA 2I1JA 1UNPA 2YT0A 2LOZA 4PNKA 1M7EA 4HAYB 3ODWA 1U27A 2N0YA 3KRXA 4WVFB 5CLLB 4KVGB 2K2UA 4L6EA 5JP4A 3FEHA 1X86A 2DTCA 1N3HA 2IFSA 5JHGA 1E5WA 1MIZB 3FSSA 1EVHA 3MPXA 2AL6A 2COFA 3D8FA 4IFSA 2P0HA 2Z0QA 1TQZA 4F7HA 2J0KA 3OANA 2ROZB 2DHJA 2DA0A 2JP2A 3N7CA 3ZVRA 1MKEA 3TCAA 2R0DA 5KQ4A 2W2XC 1J19A 1DDWA 2OTXA 2YS3A 1AWEA 1V61A 1WJMA 3PVUA 1P3RA 5C5BB 4NSWA 2K2JA 2YSZA 1FGYA 2CY4A 4YL8A 3SUZA 5C5BA 1MPHA 1Y19B 1H10A 2KCJA 5GOWB 4HB2B 4WJ7A 2Q13A 2Y8GA 2D10A 2XQNM 3T06A 1DROA 1I2HA 2DHKA 1FHXA 5HE2A 1MAIA 1OMWA 1RJ2A 4ZRKA 4KHOA 1J0WA 1FB8A 1KI1B 5C16A 1DYNA 2L2IA 4K81A 3M1IB 3UZTA 4NY0A 2QKMA 1ZC4B 1XODA 3DXCA 2VKIA 2G35A 2D9XA 3U8ZA 3P6AA 2DFKA 1XKEA 2GS0A 2AEHA 1X11A 2D4QA 3QWMA 4MY6A 2LOXA 2HE7A 5KQ1A 1NU2A 4HAZB 2I5CA 2EMSA 1KZGA 4F7UP 1V88A 3SV1A 2V76A 1DDVA 2LULA 4A6FB 4K2PA 2H7DA 1Z87A 3QBVB 3F5RA 3ODOA 2NMBA 4EJNA 1I7AA 2P8VA 2P0FA 1W1GA 4CYEA 3SO6A 1WI1A 1BTNA 3PP2A 4EKUA 4BBKA 2ADZA 2Y8FA 1V5UA 5J3YA 3X23A 1UPQA 2MDXA 4HAWB 4KHBB 3DXDA 1NI2A 3VOQA 2HTHB 2EMTA 1MK9B 4HAUB 1P5TA 2RVBB 3TW1A 1WVHA 2GCLA 3GYPA 1X1FA 1U5GA 1M7RA 2ELBA 4GMVA 4YONA 2LKOA 2PZ1A 1Q67A 2D11A 1WGUA 2DYQA 1TJ6A 1ZM0A 2QKLA 5FI0A 5HE1A 5D3XA 1K5GB 2D9ZA 4DX90 1PMSA 1QQGA 2CODA 2I5FA 5J3TA 4IAPA 1ZC3B 2YF0A 1SGHA 2L1CA 2RUKB 2D2QA 5JLJB 1Y5OA 1FAOA 1H4RA 2I1KA 4Z2MB 5LOPB 3A98B 3RCPA 1UNQA 1XCGA 3TO1A 4HAVB 4HB0B 2GCJA 1WJ1A 3D8EA 1V5MA 2VRWB 3AJ4A 4KHAA 1DBHA 1ZVRA 3TFMA 3A8QA 1U5FA 2FJLA 4HAXB 4DX8A 3KY9A 4CHMA 2RGNB 2MWNB 4TKNA 2YT1A 2DX5A 1V5PA 4EMOA 1P6SA 1OY2A 2DKPA 1FOEA 4HHVA 1EF1A 1U2BA 1XX0A 1RRPB 4D0NB 4HDOA 2DLWA 4HDQA 4Y94A 1K5DB 1EGXA 1FHWA 3AU4A 4A6KA 2W2XD 2COAA 4WSFA 1U5DA 1UPRA 5DHFB 5D3VA 1OQNA 3ODXA 1PFJA 1QC6A 3A8PA 4GN1A 5KCVA 3HK0A 4GZUA 2LG1A 3SNHA 5D3WA 4ZRJA 4ZRIA 2H7EA 2MFQA 1AQCA 1WGQA 1GC7A 1X05A 2KUPA 3KRWA 2DKQA 5D3YA 3PG7A 2ZPYA 2M38A 5C79A 1KZ7A 2D9WA 2P0DA 3WYFB 2Y7BA 2EJ8A 4C0AA 2D9YA 2M14A 3U7DA 4HATB 5FI1A 5LONB 1MIXA 5DH9B 3BINA 3QIJA 2DN6A 3P7ZA 2CAYA 3PEGA 2YRYA 4KAXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MT7 A;  5CLQ B;  4GXB A;  3O96 A;  1LB1 A;  1BWN A;  4CHJ A;  3ULC A;  5J3Q A;  1XD4 A;  5D27 A;  2RLO A;  1MK7 B;  3VIA A;  2DYN A;  5HE0 A;  4H8S A;  3ZDT A;  1V89 A;  4HB4 B;  4Z2N A;  3ML4 A;  3F0W A;  4DBB A;  2E2X A;  1U29 A;  2NZ8 B;  2VSZ A;  3BJI A;  2UZS A;  4A6H A;  2J0M A;  2N23 A;  2YVC A;  1GC6 A;  2DX1 A;  1U5E A;  3D8D A;  3PSC A;  4B6H A;  3AU5 A;  3SYX A;  5DI9 B;  4IOY X;  3NSU A;  4A6F A;  5HE3 A;  2D9V A;  1X1G A;  2KGX B;  3PVL A;  2R09 A;  2UVM A;  1ISN A;  5L81 A;  3TVV A;  3ULB A;  3V5W A;  3IVF A;  4P7I A;  1UNR A;  2J0J A;  3CXB B;  1SHC A;  1B55 A;  1NTV A;  1BTK A;  2K00 A;  4GPT B;  3LJU X;  2LYD A;  2ELA A;  4HB3 B;  3CIK A;  4A5K A;  5DIF B;  1WG7 A;  2DHI A;  5JHH A;  2CRF A;  2CY5 A;  3HQC A;  3WA0 A;  2J59 M;  5DHA B;  3G9W A;  2W2W A;  3GYO A;  1LW3 A;  3MDB C;  4GMX B;  2YS1 A;  3DXE A;  4DXA B;  4MK0 A;  1FGZ A;  2Z0O A;  2OQB A;  1EAZ A;  2ROV A;  1W1D A;  4K2O A;  1W1H A;  2RNR B;  1NTY A;  2BCJ A;  5C6R A;  3KZ1 A;  3KSY A;  3FM8 C;  5EFX A;  2YS5 A;  1FHO A;  2COC A;  3HW2 B;  4PQ0 A;  2RSG A;  3PZD A;  1DDM A;  2GJY A;  2UZR A;  1XR0 B;  2X18 A;  1ZSQ A;  1TXD A;  2MKR A;  1UEF A;  4F7G A;  4TYZ A;  1IRS A;  3PVW A;  1BAK A;  4XWX A;  1PLS A;  4K17 A;  1GG3 A;  2EC1 A;  2IYB A;  2Z0P A;  2I1J A;  1UNP A;  2YT0 A;  2LOZ A;  4PNK A;  1M7E A;  4HAY B;  3ODW A;  1U27 A;  2N0Y A;  3KRX A;  4WVF B;  5CLL B;  4KVG B;  2K2U A;  4L6E A;  5JP4 A;  3FEH A;  1X86 A;  2DTC A;  1N3H A;  2IFS A;  5JHG A;  1E5W A;  1MIZ B;  3FSS A;  1EVH A;  3MPX A;  2AL6 A;  2COF A;  3D8F A;  4IFS A;  2P0H A;  2Z0Q A;  1TQZ A;  4F7H A;  2J0K A;  3OAN A;  2ROZ B;  2DHJ A;  2DA0 A;  2JP2 A;  3N7C A;  3ZVR A;  1MKE A;  3TCA A;  2R0D A;  5KQ4 A;  2W2X C;  1J19 A;  1DDW A;  2OTX A;  2YS3 A;  1AWE A;  1V61 A;  1WJM A;  3PVU A;  1P3R A;  5C5B B;  4NSW A;  2K2J A;  2YSZ A;  1FGY A;  2CY4 A;  4YL8 A;  3SUZ A;  5C5B A;  1MPH A;  1Y19 B;  1H10 A;  2KCJ A;  5GOW B;  4HB2 B;  4WJ7 A;  2Q13 A;  2Y8G A;  2D10 A;  2XQN M;  3T06 A;  1DRO A;  1I2H A;  2DHK A;  1FHX A;  5HE2 A;  1MAI A;  1OMW A;  1RJ2 A;  4ZRK A;  4KHO A;  1J0W A;  1FB8 A;  1KI1 B;  5C16 A;  1DYN A;  2L2I A;  4K81 A;  3M1I B;  3UZT A;  4NY0 A;  2QKM A;  1ZC4 B;  1XOD A;  3DXC A;  2VKI A;  2G35 A;  2D9X A;  3U8Z A;  3P6A A;  2DFK A;  1XKE A;  2GS0 A;  2AEH A;  1X11 A;  2D4Q A;  3QWM A;  4MY6 A;  2LOX A;  2HE7 A;  5KQ1 A;  1NU2 A;  4HAZ B;  2I5C A;  2EMS A;  1KZG A;  4F7U P;  1V88 A;  3SV1 A;  2V76 A;  1DDV A;  2LUL A;  4A6F B;  4K2P A;  2H7D A;  1Z87 A;  3QBV B;  3F5R A;  3ODO A;  2NMB A;  4EJN A;  1I7A A;  2P8V A;  2P0F A;  1W1G A;  4CYE A;  3SO6 A;  1WI1 A;  1BTN A;  3PP2 A;  4EKU A;  4BBK A;  2ADZ A;  2Y8F A;  1V5U A;  5J3Y A;  3X23 A;  1UPQ A;  2MDX A;  4HAW B;  4KHB B;  3DXD A;  1NI2 A;  3VOQ A;  2HTH B;  2EMT A;  1MK9 B;  4HAU B;  1P5T A;  2RVB B;  3TW1 A;  1WVH A;  2GCL A;  3GYP A;  1X1F A;  1U5G A;  1M7R A;  2ELB A;  4GMV A;  4YON A;  2LKO A;  2PZ1 A;  1Q67 A;  2D11 A;  1WGU A;  2DYQ A;  1TJ6 A;  1ZM0 A;  2QKL A;  5FI0 A;  5HE1 A;  5D3X A;  1K5G B;  2D9Z A;  4DX9 0;  1PMS A;  1QQG A;  2COD A;  2I5F A;  5J3T A;  4IAP A;  1ZC3 B;  2YF0 A;  1SGH A;  2L1C A;  2RUK B;  2D2Q A;  5JLJ B;  1Y5O A;  1FAO A;  1H4R A;  2I1K A;  4Z2M B;  5LOP B;  3A98 B;  3RCP A;  1UNQ A;  1XCG A;  3TO1 A;  4HAV B;  4HB0 B;  2GCJ A;  1WJ1 A;  3D8E A;  1V5M A;  2VRW B;  3AJ4 A;  4KHA A;  1DBH A;  1ZVR A;  3TFM A;  3A8Q A;  1U5F A;  2FJL A;  4HAX B;  4DX8 A;  3KY9 A;  4CHM A;  2RGN B;  2MWN B;  4TKN A;  2YT1 A;  2DX5 A;  1V5P A;  4EMO A;  1P6S A;  1OY2 A;  2DKP A;  1FOE A;  4HHV A;  1EF1 A;  1U2B A;  1XX0 A;  1RRP B;  4D0N B;  4HDO A;  2DLW A;  4HDQ A;  4Y94 A;  1K5D B;  1EGX A;  1FHW A;  3AU4 A;  4A6K A;  2W2X D;  2COA A;  4WSF A;  1U5D A;  1UPR A;  5DHF B;  5D3V A;  1OQN A;  3ODX A;  1PFJ A;  1QC6 A;  3A8P A;  4GN1 A;  5KCV A;  3HK0 A;  4GZU A;  2LG1 A;  3SNH A;  5D3W A;  4ZRJ A;  4ZRI A;  2H7E A;  2MFQ A;  1AQC A;  1WGQ A;  1GC7 A;  1X05 A;  2KUP A;  3KRW A;  2DKQ A;  5D3Y A;  3PG7 A;  2ZPY A;  2M38 A;  5C79 A;  1KZ7 A;  2D9W A;  2P0D A;  3WYF B;  2Y7B A;  2EJ8 A;  4C0A A;  2D9Y A;  2M14 A;  3U7D A;  4HAT B;  5FI1 A;  5LON B;  1MIX A;  5DH9 B;  3BIN A;  3QIJ A;  2DN6 A;  3P7Z A;  2CAY A;  3PEG A;  2YRY A;  4KAX B; 
#chains in the Genus database with same CATH topology
 4MT7 A;  2Z14 A;  5CLQ B;  4GXB A;  3O96 A;  1LB1 A;  1BWN A;  4CHJ A;  3ULC A;  5J3Q A;  1XD4 A;  5D27 A;  2RLO A;  5I2S A;  1MK7 B;  3VIA A;  2DYN A;  5HE0 A;  4H8S A;  3ZDT A;  1V89 A;  4GOU A;  4HB4 B;  4Z2N A;  2FJU B;  3ML4 A;  3F0W A;  4DBB A;  2E2X A;  1U29 A;  2NZ8 B;  3NW8 A;  2VSZ A;  3BJI A;  4KHB A;  2UZS A;  4A6H A;  2J0M A;  2N23 A;  2YVC A;  1GC6 A;  2DX1 A;  1U5E A;  3D8D A;  3PSC A;  4B6H A;  3AU5 A;  3SYX A;  5DI9 B;  4IOY X;  3NSU A;  4A6F A;  5HE3 A;  2D9V A;  1X1G A;  2KR0 A;  2KGX B;  3PVL A;  2R09 A;  2UVM A;  1ISN A;  5L81 A;  3TVV A;  3ULB A;  5IRS A;  3DCX A;  3V5W A;  3IVF A;  4P7I A;  1UNR A;  2J0J A;  3CXB B;  1SHC A;  2ZKM X;  1B55 A;  1NTV A;  1BTK A;  2K00 A;  4GPT B;  3LJU X;  2LYD A;  2ELA A;  4HB3 B;  3CIK A;  4A5K A;  2Z13 A;  5DIF B;  1WG7 A;  2DHI A;  5JHH A;  2CRF A;  2CY5 A;  3HQC A;  3WA0 A;  2J59 M;  5DHA B;  3G9W A;  2W2W A;  4OSN A;  3GYO A;  1LW3 A;  3MDB C;  4GMX B;  2YS1 A;  1ZYI A;  3DXE A;  3NWF A;  4DXA B;  4MK0 A;  1FGZ A;  2Z0O A;  2OQB A;  1EAZ A;  2K49 A;  2ROV A;  1W1D A;  4K2O A;  3A58 A;  1W1H A;  2RNR B;  4QXA B;  1NTY A;  2BCJ A;  5M4Y B;  5C6R A;  3KZ1 A;  3KSY A;  3FM8 C;  3NWA A;  5EFX A;  2YS5 A;  1FHO A;  2COC A;  3HW2 B;  4PQ0 A;  2RSG A;  3PZD A;  1DDM A;  2GJY A;  2UZR A;  1XR0 B;  2X18 A;  1ZSQ A;  1TXD A;  2MKR A;  1UEF A;  4QJ3 B;  4F7G A;  4TYZ A;  1IRS A;  3PVW A;  1BAK A;  4XWX A;  4CSQ A;  1PLS A;  2YT2 A;  4K17 A;  1GG3 A;  2EC1 A;  2IYB A;  2Z0P A;  2I1J A;  1UNP A;  2YT0 A;  2LOZ A;  4PNK A;  1M7E A;  4HAY B;  3ODW A;  1U27 A;  2N0Y A;  3KRX A;  4WVF B;  5CLL B;  2GUM A;  4KVG B;  2K2U A;  4L6E A;  5JP4 A;  3FEH A;  1X86 A;  2DTC A;  1N3H A;  2IFS A;  5JHG A;  1E5W A;  1MIZ B;  3FSS A;  3FVC A;  1EVH A;  3MPX A;  2AL6 A;  2COF A;  3D8F A;  4IFS A;  2P0H A;  2Z0Q A;  1TQZ A;  4F7H A;  2J0K A;  3OAN A;  5LG4 B;  2ROZ B;  2DHJ A;  2DA0 A;  2JP2 A;  3N7C A;  3ZVR A;  1MKE A;  3TCA A;  2R0D A;  5KQ4 A;  2W2X C;  1J19 A;  1DDW A;  2OTX A;  2YS3 A;  1AWE A;  1V61 A;  3NWD A;  1WJM A;  3PVU A;  1P3R A;  5C5B B;  4NSW A;  2K2J A;  2YSZ A;  1FGY A;  2CY4 A;  4YL8 A;  3SUZ A;  5C5B A;  1MPH A;  2RRF A;  1Y19 B;  1H10 A;  2KCJ A;  5GOW B;  4HB2 B;  4WJ7 A;  2Q13 A;  2Y8G A;  2KIE A;  2D10 A;  2XQN M;  3T06 A;  4L1R A;  1DRO A;  1I2H A;  2DHK A;  1FHX A;  5HE2 A;  1MAI A;  1OMW A;  1RJ2 A;  4ZRK A;  4KHO A;  1J0W A;  1FB8 A;  1KI1 B;  5C16 A;  1DYN A;  2L2I A;  4K81 A;  3HIE A;  4D6W A;  3M1I B;  3UZT A;  4NY0 A;  2QKM A;  4QJ4 B;  1ZC4 B;  1XOD A;  3DXC A;  2VKI A;  1T77 A;  2G35 A;  2D9X A;  3U8Z A;  3P6A A;  3HSA A;  2DFK A;  1XKE A;  2GS0 A;  2AEH A;  1X11 A;  2D4Q A;  3QWM A;  4MY6 A;  2LOX A;  2HE7 A;  5KQ1 A;  1NU2 A;  4HAZ B;  2I5C A;  2EMS A;  1KZG A;  4F7U P;  1V88 A;  4QJ5 B;  3SV1 A;  2V76 A;  3B77 A;  1DDV A;  2LUL A;  4HSI A;  4A6F B;  4K2P A;  2H7D A;  1Z87 A;  3QBV B;  3F5R A;  3ODO A;  2NMB A;  2Z59 A;  4EJN A;  1I7A A;  2P8V A;  2NBV A;  2P0F A;  1W1G A;  4CYE A;  3SO6 A;  1WI1 A;  1BTN A;  3PP2 A;  4EKU A;  4BBK A;  2K8E A;  2ADZ A;  2Y8F A;  1V5U A;  5J3Y A;  3X23 A;  4DIX A;  1UPQ A;  2MDX A;  4HAW B;  4KHB B;  3DXD A;  1NI2 A;  3VOQ A;  2HTH B;  2EMT A;  1MK9 B;  4HAU B;  1P5T A;  2RVB B;  3TW1 A;  1WVH A;  2GCL A;  3GYP A;  1X1F A;  1U5G A;  1M7R A;  2ELB A;  4GMV A;  4YON A;  2LKO A;  2PZ1 A;  1Q67 A;  2D11 A;  2Z4D A;  1WGU A;  2DYQ A;  1TJ6 A;  1ZM0 A;  2QKL A;  5FI0 A;  5HE1 A;  5D3X A;  1K5G B;  2D9Z A;  4DX9 0;  1PMS A;  1QQG A;  3U12 A;  2COD A;  2I5F A;  5J3T A;  4IAP A;  1ZC3 B;  2YF0 A;  1SGH A;  2L1C A;  2RUK B;  2D2Q A;  5JLJ B;  1Y5O A;  1FAO A;  1H4R A;  2I1K A;  4Z2M B;  5LOP B;  3A98 B;  3RCP A;  1UNQ A;  1XCG A;  3TO1 A;  4HAV B;  4HB0 B;  2GCJ A;  1WJ1 A;  3D8E A;  1V5M A;  2VRW B;  3AJ4 A;  4KHA A;  1DBH A;  1ZVR A;  3TFM A;  3A8Q A;  1U5F A;  2FJL A;  4HAX B;  4DX8 A;  3KY9 A;  4CHM A;  2RGN B;  2MWN B;  4TKN A;  1MI1 A;  2YT1 A;  2DX5 A;  1V5P A;  4EMO A;  1P6S A;  1OY2 A;  2DKP A;  1FOE A;  4HHV A;  1EF1 A;  1U2B A;  1XX0 A;  2KIG A;  1RRP B;  4D0N B;  4HDO A;  2DLW A;  4HDQ A;  4Y94 A;  1K5D B;  1EGX A;  1FHW A;  3AU4 A;  4A6K A;  2W2X D;  2COA A;  4WSF A;  1U5D A;  1UPR A;  5DHF B;  5D3V A;  1OQN A;  3ODX A;  2R2Y A;  1PFJ A;  5I2M A;  1QC6 A;  3A8P A;  4GN1 A;  5KCV A;  3HK0 A;  4GZU A;  2LG1 A;  3SNH A;  5D3W A;  4ZRJ A;  4ZRI A;  2H7E A;  2MFQ A;  4GNK B;  1AQC A;  1WGQ A;  1GC7 A;  1X05 A;  2KUP A;  3KRW A;  2DKQ A;  5D3Y A;  3PG7 A;  2ZPY A;  2M38 A;  5C79 A;  1KZ7 A;  2D9W A;  2P0D A;  3WYF B;  2Y7B A;  2EJ8 A;  3OHM B;  4C0A A;  2D9Y A;  2M14 A;  3U7D A;  4HAT B;  5FI1 A;  5LON B;  1MIX A;  5DH9 B;  3BIN A;  3QIJ A;  2KUQ A;  2DN6 A;  4OT1 A;  3P7Z A;  2CAY A;  3PEG A;  2YRY A;  4KAX B; 
#chains in the Genus database with same CATH homology
 4MT7 A;  5CLQ B;  4GXB A;  3O96 A;  1LB1 A;  1BWN A;  4CHJ A;  3ULC A;  5J3Q A;  1XD4 A;  5D27 A;  2RLO A;  1MK7 B;  3VIA A;  2DYN A;  5HE0 A;  4H8S A;  3ZDT A;  1V89 A;  4HB4 B;  4Z2N A;  3ML4 A;  3F0W A;  4DBB A;  2E2X A;  1U29 A;  2NZ8 B;  2VSZ A;  3BJI A;  2UZS A;  4A6H A;  2J0M A;  2N23 A;  2YVC A;  1GC6 A;  2DX1 A;  1U5E A;  3D8D A;  3PSC A;  4B6H A;  3AU5 A;  3SYX A;  5DI9 B;  4IOY X;  3NSU A;  4A6F A;  5HE3 A;  2D9V A;  1X1G A;  2KGX B;  3PVL A;  2R09 A;  2UVM A;  1ISN A;  5L81 A;  3TVV A;  3ULB A;  3V5W A;  3IVF A;  4P7I A;  1UNR A;  2J0J A;  3CXB B;  1SHC A;  1B55 A;  1NTV A;  1BTK A;  2K00 A;  4GPT B;  3LJU X;  2LYD A;  2ELA A;  4HB3 B;  3CIK A;  4A5K A;  5DIF B;  1WG7 A;  2DHI A;  5JHH A;  2CRF A;  2CY5 A;  3HQC A;  3WA0 A;  2J59 M;  5DHA B;  3G9W A;  2W2W A;  3GYO A;  1LW3 A;  3MDB C;  4GMX B;  2YS1 A;  3DXE A;  4DXA B;  4MK0 A;  1FGZ A;  2Z0O A;  2OQB A;  1EAZ A;  2ROV A;  1W1D A;  4K2O A;  1W1H A;  2RNR B;  1NTY A;  2BCJ A;  5C6R A;  3KZ1 A;  3KSY A;  3FM8 C;  5EFX A;  2YS5 A;  1FHO A;  2COC A;  3HW2 B;  4PQ0 A;  2RSG A;  3PZD A;  1DDM A;  2GJY A;  2UZR A;  1XR0 B;  2X18 A;  1ZSQ A;  1TXD A;  2MKR A;  1UEF A;  4F7G A;  4TYZ A;  1IRS A;  3PVW A;  1BAK A;  4XWX A;  1PLS A;  4K17 A;  1GG3 A;  2EC1 A;  2IYB A;  2Z0P A;  2I1J A;  1UNP A;  2YT0 A;  2LOZ A;  4PNK A;  1M7E A;  4HAY B;  3ODW A;  1U27 A;  2N0Y A;  3KRX A;  4WVF B;  5CLL B;  4KVG B;  2K2U A;  4L6E A;  5JP4 A;  3FEH A;  1X86 A;  2DTC A;  1N3H A;  2IFS A;  5JHG A;  1E5W A;  1MIZ B;  3FSS A;  1EVH A;  3MPX A;  2AL6 A;  2COF A;  3D8F A;  4IFS A;  2P0H A;  2Z0Q A;  1TQZ A;  4F7H A;  2J0K A;  3OAN A;  2ROZ B;  2DHJ A;  2DA0 A;  2JP2 A;  3N7C A;  3ZVR A;  1MKE A;  3TCA A;  2R0D A;  5KQ4 A;  2W2X C;  1J19 A;  1DDW A;  2OTX A;  2YS3 A;  1AWE A;  1V61 A;  1WJM A;  3PVU A;  1P3R A;  5C5B B;  4NSW A;  2K2J A;  2YSZ A;  1FGY A;  2CY4 A;  4YL8 A;  3SUZ A;  5C5B A;  1MPH A;  1Y19 B;  1H10 A;  2KCJ A;  5GOW B;  4HB2 B;  4WJ7 A;  2Q13 A;  2Y8G A;  2D10 A;  2XQN M;  3T06 A;  1DRO A;  1I2H A;  2DHK A;  1FHX A;  5HE2 A;  1MAI A;  1OMW A;  1RJ2 A;  4ZRK A;  4KHO A;  1J0W A;  1FB8 A;  1KI1 B;  5C16 A;  1DYN A;  2L2I A;  4K81 A;  3M1I B;  3UZT A;  4NY0 A;  2QKM A;  1ZC4 B;  1XOD A;  3DXC A;  2VKI A;  2G35 A;  2D9X A;  3U8Z A;  3P6A A;  2DFK A;  1XKE A;  2GS0 A;  2AEH A;  1X11 A;  2D4Q A;  3QWM A;  4MY6 A;  2LOX A;  2HE7 A;  5KQ1 A;  1NU2 A;  4HAZ B;  2I5C A;  2EMS A;  1KZG A;  4F7U P;  1V88 A;  3SV1 A;  2V76 A;  1DDV A;  2LUL A;  4A6F B;  4K2P A;  2H7D A;  1Z87 A;  3QBV B;  3F5R A;  3ODO A;  2NMB A;  4EJN A;  1I7A A;  2P8V A;  2P0F A;  1W1G A;  4CYE A;  3SO6 A;  1WI1 A;  1BTN A;  3PP2 A;  4EKU A;  4BBK A;  2ADZ A;  2Y8F A;  1V5U A;  5J3Y A;  3X23 A;  1UPQ A;  2MDX A;  4HAW B;  4KHB B;  3DXD A;  1NI2 A;  3VOQ A;  2HTH B;  2EMT A;  1MK9 B;  4HAU B;  1P5T A;  2RVB B;  3TW1 A;  1WVH A;  2GCL A;  3GYP A;  1X1F A;  1U5G A;  1M7R A;  2ELB A;  4GMV A;  4YON A;  2LKO A;  2PZ1 A;  1Q67 A;  2D11 A;  1WGU A;  2DYQ A;  1TJ6 A;  1ZM0 A;  2QKL A;  5FI0 A;  5HE1 A;  5D3X A;  1K5G B;  2D9Z A;  4DX9 0;  1PMS A;  1QQG A;  2COD A;  2I5F A;  5J3T A;  4IAP A;  1ZC3 B;  2YF0 A;  1SGH A;  2L1C A;  2RUK B;  2D2Q A;  5JLJ B;  1Y5O A;  1FAO A;  1H4R A;  2I1K A;  4Z2M B;  5LOP B;  3A98 B;  3RCP A;  1UNQ A;  1XCG A;  3TO1 A;  4HAV B;  4HB0 B;  2GCJ A;  1WJ1 A;  3D8E A;  1V5M A;  2VRW B;  3AJ4 A;  4KHA A;  1DBH A;  1ZVR A;  3TFM A;  3A8Q A;  1U5F A;  2FJL A;  4HAX B;  4DX8 A;  3KY9 A;  4CHM A;  2RGN B;  2MWN B;  4TKN A;  2YT1 A;  2DX5 A;  1V5P A;  4EMO A;  1P6S A;  1OY2 A;  2DKP A;  1FOE A;  4HHV A;  1EF1 A;  1U2B A;  1XX0 A;  1RRP B;  4D0N B;  4HDO A;  2DLW A;  4HDQ A;  4Y94 A;  1K5D B;  1EGX A;  1FHW A;  3AU4 A;  4A6K A;  2W2X D;  2COA A;  4WSF A;  1U5D A;  1UPR A;  5DHF B;  5D3V A;  1OQN A;  3ODX A;  1PFJ A;  1QC6 A;  3A8P A;  4GN1 A;  5KCV A;  3HK0 A;  4GZU A;  2LG1 A;  3SNH A;  5D3W A;  4ZRJ A;  4ZRI A;  2H7E A;  2MFQ A;  1AQC A;  1WGQ A;  1GC7 A;  1X05 A;  2KUP A;  3KRW A;  2DKQ A;  5D3Y A;  3PG7 A;  2ZPY A;  2M38 A;  5C79 A;  1KZ7 A;  2D9W A;  2P0D A;  3WYF B;  2Y7B A;  2EJ8 A;  4C0A A;  2D9Y A;  2M14 A;  3U7D A;  4HAT B;  5FI1 A;  5LON B;  1MIX A;  5DH9 B;  3BIN A;  3QIJ A;  2DN6 A;  3P7Z A;  2CAY A;  3PEG A;  2YRY A;  4KAX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...