3AJ4A

Crystal structure of the ph domain of evectin-2 from human complexed with o-phospho-l-serine
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
112
structure length
112
Chain Sequence
GSMAFVKSGWLLRQSTILKRWKKNWFDLWSDGHLIYYDDQTRQNIEDKVHMPMDCINIRTGQECRDTQPPDGKSKDCMLQIVCRDGKTISLCAESTDDCLAWKFTLQDSRTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pleckstrin homology domain-containing family B member 2
publication title Intracellular phosphatidylserine is essential for retrograde membrane traffic through endosomes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 31
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3aj4A00
4C0AA 2DN6A 1MIXA 3A98B 2RLOA 2DHIA 2XQNM 5J3TA 1UPRA 4ZRIA 2AEHA 3FM8C 1WJ1A 1V5PA 2NMBA 3DXCA 1X05A 1BTKA 1BWNA 1NI2A 3DXDA 4XWXA 3PP2A 2DLWA 1WGQA 4Y94A 5D3WA 2RUKB 2YSZA 2I5CA 3U8ZA 1SGHA 2GCLA 5C16A 3PZDA 2DFKA 1SHCA 1B55A 5DH9B 1EGXA 3KSYA 2X18A 1PMSA 2CRFA 3QWMA 4GMXB 1TJ6A 2DHKA 5C5BB 3MDBC 3GYPA 5C6RA 4DX8A 3QIJA 1J0WA 2UZSA 2RGNB 2HTHB 1U27A 3KRXA 2K00A 1UEFA 2CAYA 5DHFB 4K2PA 4HB4B 4HAWB 2DYNA 4KAXB 3KZ1A 2COCA 1UNRA 1IRSA 2ADZA 3F5RA 2JP2A 3KRWA 2EMSA 2MFQA 2ROZB 5HE0A 2VRWB 3FSSA 1FOEA 1KZ7A 2E2XA 2ROVA 2GS0A 5DIFB 5JHGA 4GZUA 4EKUA 3D8DA 2VKIA 1U29A 2D9YA 5D3VA 1FAOA 3BINA 4PNKA 2PZ1A 1NU2A 4ZRJA 3BJIA 1ISNA 3P7ZA 3RCPA 1X1GA 2EMTA 3SO6A 3A8QA 4TYZA 3ULCA 3PSCA 4KHOA 1AQCA 2Z0QA 1GG3A 5JHHA 2NZ8B 2LULA 3ODOA 5L81A 1WG7A 5LONB 5J3YA 1UNPA 2IFSA 4GXBA 5KQ4A 1ZM0A 1FGZA 4GMVA 4HAXB 4A6HA 2UZRA 1XD4A 4CHJA 2Y8FA 1AWEA 2LYDA 2HE7A 2LG1A 2L2IA 5GOWB 2VSZA 1N3HA 2D9ZA 2YF0A 3OANA 5HE3A 2P0DA 4HAZB 5FI0A 2K2JA 3AJ4A 2DX5A 2D2QA 1Y5OA 2KCJA 2COAA 1U5GA 3D8EA 1Z87A 2L1CA 2RVBB 4Z2NA 1LW3A 4PQ0A 2OTXA 2QKMA 2DYQA 1E5WA 3PVLA 1DYNA 4GPTB 1P6SA 2RSGA 3D8FA 2J0KA 1WGUA 2AL6A 1P5TA 2K2UA 4ZRKA 1EVHA 1DROA 2GCJA 4NSWA 4HAVB 2D10A 1MAIA 2EC1A 3ZDTA 4EJNA 5C5BA 1Q67A 2LOZA 1I7AA 3DXEA 1UPQA 1V5UA 1FHXA 3PG7A 1BAKA 4K81A 1MKEA 1TQZA 1EF1A 1FB8A 3A8PA 1TXDA 4KHBB 5D3YA 2Y7BA 1UNQA 2YS1A 3LJUX 2H7EA 1ZVRA 2DTCA 2P0FA 4F7GA 3WYFB 1M7EA 2D9VA 4BBKA 3G9WA 1V5MA 4Z2MB 4IOYX 2BCJA 2GJYA 2J0JA 4HATB 5FI1A 2I5FA 3HQCA 5CLQB 1W1HA 1MIZB 3HW2B 3O96A 3TO1A 1DDVA 1H10A 1XODA 2P0HA 4HAUB 4DXAB 5LOPB 3AU4A 2DA0A 3AU5A 3TVVA 3KY9A 1W1GA 1ZC3B 3PVWA 2DKPA 3HK0A 2Z0PA 2KUPA 3GYOA 3ODWA 3ML4A 1X1FA 2H7DA 1PFJA 2UVMA 4A6FA 2M38A 2YVCA 3VIAA 3CIKA 3SYXA 5JLJB 2D11A 2I1JA 2G35A 2YS5A 4HB0B 3TCAA 1KZGA 3UZTA 3M1IB 2N23A 1GC6A 3X23A 2YT1A 4HDOA 3ODXA 3WA0A 4WJ7A 4TKNA 5CLLB 1OMWA 1U5FA 2COFA 2R0DA 2EJ8A 2DHJA 4K17A 2RNRB 2YS3A 4CYEA 3TFMA 4MT7A 2W2XD 4P7IA 1M7RA 1V61A 2DKQA 4F7UP 1WJMA 4CHMA 1V89A 4DBBA 2MDXA 4D0NB 4IAPA 4A6KA 2LKOA 2IYBA 3F0WA 2ELAA 3SUZA 3ZVRA 3VOQA 1NTVA 1Y19B 2W2WA 1K5DB 1KI1B 5JP4A 2ZPYA 4DX90 1K5GB 5KCVA 1U2BA 1P3RA 5DHAB 1LB1A 4HB3B 2J0MA 5KQ1A 3TW1A 5C79A 5EFXA 2CY4A 5HE2A 1PLSA 3P6AA 5DI9B 5J3QA 1U5DA 2MWNB 1J19A 4GN1A 4EMOA 2R09A 2M14A 2KGXB 5D27A 4H8SA 1DDMA 1RRPB 1WVHA 1X86A 2MKRA 1X11A 2Z0OA 3FEHA 1XCGA 1XR0B 3U7DA 1OY2A 2P8VA 1FGYA 4K2OA 1XKEA 3PVUA 1MK9B 1BTNA 1RJ2A 4HB2B 2I1KA 2V76A 3QBVB 4HAYB 3V5WA 3T06A 3N7CA 3PEGA 2ELBA 2Y8GA 1OQNA 4L6EA 4KHAA 4HDQA 2J59M 3CXBB 1XX0A 4IFSA 2D9XA 2D9WA 1MK7B 4YONA 2QKLA 4F7HA 4WVFB 4A5KA 1V88A 5HE1A 3MPXA 2LOXA 4KVGB 1I2HA 1ZC4B 1U5EA 1ZSQA 1GC7A 1EAZA 2FJLA 1QC6A 2Q13A 3SNHA 1H4RA 2W2XC 1QQGA 1WI1A 4A6FB 5D3XA 1DDWA 3NSUA 4WSFA 4B6HA 3ULBA 4HHVA 1DBHA 1FHWA 2OQBA 2DX1A 2CY5A 2CODA 1MPHA 2YT0A 2YRYA 4MK0A 2N0YA 3IVFA 4YL8A 1NTYA 1FHOA 2D4QA 4NY0A 3SV1A 4MY6A 1W1DA
chains in the Genus database with same CATH superfamily
2Z59A 4C0AA 2DN6A 1MIXA 3A98B 2RLOA 2DHIA 2XQNM 2Z14A 5J3TA 1UPRA 3HIEA 4ZRIA 2AEHA 3FM8C 1WJ1A 1V5PA 2NMBA 2KR0A 1X05A 3DXCA 1BTKA 1T77A 1BWNA 1NI2A 3DXDA 4XWXA 3PP2A 2DLWA 1WGQA 4Y94A 5D3WA 2RUKB 2YSZA 2I5CA 3U8ZA 1SGHA 2GCLA 5C16A 3PZDA 2DFKA 1SHCA 1B55A 5DH9B 1EGXA 3KSYA 2X18A 1PMSA 2CRFA 3QWMA 4GMXB 1TJ6A 2DHKA 5C5BB 3MDBC 3GYPA 5C6RA 4DX8A 3B77A 3QIJA 2KIGA 1J0WA 2UZSA 2RGNB 2HTHB 1U27A 5I2MA 3KRXA 2K00A 1UEFA 2CAYA 5DHFB 4K2PA 4QXAB 4HB4B 4HAWB 2DYNA 4KAXB 3KZ1A 2COCA 1UNRA 1IRSA 2ADZA 2KIEA 3F5RA 2JP2A 3KRWA 2EMSA 2K8EA 2MFQA 2ROZB 5HE0A 5I2SA 2VRWB 3FSSA 1FOEA 1KZ7A 2E2XA 5IRSA 2ROVA 2GS0A 5DIFB 5JHGA 4GZUA 2Z13A 4KHBA 4EKUA 2K49A 3D8DA 2VKIA 1U29A 2D9YA 5D3VA 1FAOA 3BINA 4PNKA 2PZ1A 1NU2A 4ZRJA 3BJIA 1ISNA 3P7ZA 2FJUB 3RCPA 1X1GA 2EMTA 3SO6A 3A8QA 4TYZA 3ULCA 3NWDA 4GNKB 3PSCA 4KHOA 1AQCA 2Z0QA 1GG3A 5JHHA 2NZ8B 2LULA 3ODOA 5L81A 1WG7A 5LONB 5J3YA 1UNPA 2IFSA 4GXBA 5KQ4A 1ZM0A 1FGZA 2GUMA 4GMVA 4HAXB 4A6HA 4QJ5B 2UZRA 1XD4A 4CHJA 2Y8FA 1AWEA 2LYDA 2HE7A 2LG1A 2L2IA 5GOWB 2VSZA 1N3HA 2D9ZA 2YF0A 3OANA 5HE3A 2P0DA 4HAZB 5FI0A 2K2JA 3AJ4A 4HSIA 2DX5A 2D2QA 3U12A 1Y5OA 2KCJA 2COAA 2KUQA 1U5GA 3D8EA 1Z87A 2L1CA 2RVBB 4Z2NA 1LW3A 4PQ0A 2OTXA 2QKMA 2DYQA 1E5WA 3PVLA 1DYNA 4GPTB 1P6SA 2RSGA 3D8FA 2J0KA 1WGUA 2AL6A 1P5TA 2K2UA 3OHMB 4ZRKA 3NWFA 1EVHA 3HSAA 1DROA 2GCJA 4NSWA 4HAVB 2D10A 1MAIA 2EC1A 3ZDTA 4EJNA 5C5BA 1Q67A 2LOZA 1I7AA 3DXEA 1UPQA 1V5UA 1FHXA 3PG7A 1BAKA 4K81A 1MKEA 1TQZA 1EF1A 1FB8A 3A8PA 1TXDA 4KHBB 5D3YA 2Y7BA 1UNQA 2YS1A 3LJUX 2H7EA 1ZVRA 2DTCA 2P0FA 4F7GA 3WYFB 1M7EA 2D9VA 4BBKA 3G9WA 1V5MA 4Z2MB 4IOYX 2BCJA 2GJYA 2J0JA 4HATB 5FI1A 2I5FA 3HQCA 5CLQB 1W1HA 1MIZB 3HW2B 3O96A 3TO1A 1DDVA 1H10A 1XODA 2P0HA 4HAUB 4DXAB 5LOPB 3AU4A 4D6WA 2DA0A 3AU5A 3TVVA 3KY9A 1W1GA 1ZC3B 3PVWA 2DKPA 3HK0A 2Z0PA 2KUPA 3GYOA 3ODWA 3ML4A 1X1FA 2H7DA 1PFJA 2UVMA 4A6FA 2M38A 2YVCA 3VIAA 3CIKA 3SYXA 5JLJB 2D11A 2I1JA 2G35A 2YS5A 4HB0B 3NW8A 3TCAA 1KZGA 3UZTA 3M1IB 2N23A 1GC6A 3X23A 2YT1A 4HDOA 3ODXA 5LG4B 3WA0A 4WJ7A 4TKNA 5CLLB 1OMWA 1U5FA 2COFA 2R0DA 2EJ8A 2DHJA 4K17A 5M4YB 2RNRB 2YS3A 4CYEA 3TFMA 4MT7A 2W2XD 4P7IA 1M7RA 1V61A 2DKQA 4F7UP 1WJMA 4CHMA 1V89A 4DBBA 2MDXA 4D0NB 4IAPA 4A6KA 2LKOA 2IYBA 3F0WA 2ELAA 3SUZA 3ZVRA 3VOQA 1NTVA 1Y19B 2W2WA 1MI1A 1K5DB 1KI1B 5JP4A 2ZPYA 4DX90 1K5GB 5KCVA 4QJ3B 1U2BA 1P3RA 5DHAB 3A58A 1LB1A 4OT1A 4HB3B 2J0MA 5KQ1A 3TW1A 5C79A 5EFXA 2CY4A 5HE2A 1PLSA 3P6AA 4QJ4B 5DI9B 5J3QA 1U5DA 4DIXA 2MWNB 1J19A 3DCXA 4GN1A 4EMOA 4OSNA 2R09A 2M14A 2NBVA 2KGXB 5D27A 4H8SA 1DDMA 1RRPB 1WVHA 1X86A 2Z0OA 1X11A 2MKRA 3FEHA 1XCGA 3NWAA 1XR0B 3U7DA 1OY2A 2P8VA 3FVCA 1FGYA 4K2OA 1XKEA 3PVUA 1MK9B 1BTNA 1RJ2A 4HB2B 2I1KA 2V76A 3QBVB 4HAYB 3V5WA 3T06A 3N7CA 3PEGA 2ELBA 2Y8GA 1OQNA 4L6EA 4KHAA 4HDQA 2J59M 3CXBB 2Z4DA 1XX0A 4IFSA 2D9XA 2D9WA 1MK7B 4YONA 2QKLA 4F7HA 4WVFB 4A5KA 1V88A 5HE1A 3MPXA 2LOXA 4KVGB 1I2HA 4GOUA 1ZC4B 1U5EA 1ZSQA 1GC7A 1EAZA 2FJLA 1QC6A 2Q13A 3SNHA 2YT2A 1H4RA 2W2XC 1QQGA 1WI1A 2R2YA 4A6FB 5D3XA 1DDWA 3NSUA 4WSFA 4B6HA 2ZKMX 3ULBA 4HHVA 1DBHA 1FHWA 2OQBA 2DX1A 4L1RA 2CY5A 2CODA 1ZYIA 1MPHA 4CSQA 2YT0A 2YRYA 4MK0A 2N0YA 3IVFA 4YL8A 1NTYA 1FHOA 2D4QA 4NY0A 3SV1A 4MY6A 1W1DA 2RRFA
chains in the Genus database with same CATH topology
4C0AA 2DN6A 1MIXA 3A98B 2RLOA 2DHIA 2XQNM 5J3TA 1UPRA 4ZRIA 2AEHA 3FM8C 1WJ1A 1V5PA 2NMBA 3DXCA 1X05A 1BTKA 1BWNA 1NI2A 3DXDA 4XWXA 3PP2A 2DLWA 1WGQA 4Y94A 5D3WA 2RUKB 2YSZA 2I5CA 3U8ZA 1SGHA 2GCLA 5C16A 3PZDA 2DFKA 1SHCA 1B55A 5DH9B 1EGXA 3KSYA 2X18A 1PMSA 2CRFA 3QWMA 4GMXB 1TJ6A 2DHKA 5C5BB 3MDBC 3GYPA 5C6RA 4DX8A 3QIJA 1J0WA 2UZSA 2RGNB 2HTHB 1U27A 3KRXA 2K00A 1UEFA 2CAYA 5DHFB 4K2PA 4HB4B 4HAWB 2DYNA 4KAXB 3KZ1A 2COCA 1UNRA 1IRSA 2ADZA 3F5RA 2JP2A 3KRWA 2EMSA 2MFQA 2ROZB 5HE0A 2VRWB 3FSSA 1FOEA 1KZ7A 2E2XA 2ROVA 2GS0A 5DIFB 5JHGA 4GZUA 4EKUA 3D8DA 2VKIA 1U29A 2D9YA 5D3VA 1FAOA 3BINA 4PNKA 2PZ1A 1NU2A 4ZRJA 3BJIA 1ISNA 3P7ZA 3RCPA 1X1GA 2EMTA 3SO6A 3A8QA 4TYZA 3ULCA 3PSCA 4KHOA 1AQCA 2Z0QA 1GG3A 5JHHA 2NZ8B 2LULA 3ODOA 5L81A 1WG7A 5LONB 5J3YA 1UNPA 2IFSA 4GXBA 5KQ4A 1ZM0A 1FGZA 4GMVA 4HAXB 4A6HA 2UZRA 1XD4A 4CHJA 2Y8FA 1AWEA 2LYDA 2HE7A 2LG1A 2L2IA 5GOWB 2VSZA 1N3HA 2D9ZA 2YF0A 3OANA 5HE3A 2P0DA 4HAZB 5FI0A 2K2JA 3AJ4A 2DX5A 2D2QA 1Y5OA 2KCJA 2COAA 1U5GA 3D8EA 1Z87A 2L1CA 2RVBB 4Z2NA 1LW3A 4PQ0A 2OTXA 2QKMA 2DYQA 1E5WA 3PVLA 1DYNA 4GPTB 1P6SA 2RSGA 3D8FA 2J0KA 1WGUA 2AL6A 1P5TA 2K2UA 4ZRKA 1EVHA 1DROA 2GCJA 4NSWA 4HAVB 2D10A 1MAIA 2EC1A 3ZDTA 4EJNA 5C5BA 1Q67A 2LOZA 1I7AA 3DXEA 1UPQA 1V5UA 1FHXA 3PG7A 1BAKA 4K81A 1MKEA 1TQZA 1EF1A 1FB8A 3A8PA 1TXDA 4KHBB 5D3YA 2Y7BA 1UNQA 2YS1A 3LJUX 2H7EA 1ZVRA 2DTCA 2P0FA 4F7GA 3WYFB 1M7EA 2D9VA 4BBKA 3G9WA 1V5MA 4Z2MB 4IOYX 2BCJA 2GJYA 2J0JA 4HATB 5FI1A 2I5FA 3HQCA 5CLQB 1W1HA 1MIZB 3HW2B 3O96A 3TO1A 1DDVA 1H10A 1XODA 2P0HA 4HAUB 4DXAB 5LOPB 3AU4A 2DA0A 3AU5A 3TVVA 3KY9A 1W1GA 1ZC3B 3PVWA 2DKPA 3HK0A 2Z0PA 2KUPA 3GYOA 3ODWA 3ML4A 1X1FA 2H7DA 1PFJA 2UVMA 4A6FA 2M38A 2YVCA 3VIAA 3CIKA 3SYXA 5JLJB 2D11A 2I1JA 2G35A 2YS5A 4HB0B 3TCAA 1KZGA 3UZTA 3M1IB 2N23A 1GC6A 3X23A 2YT1A 4HDOA 3ODXA 3WA0A 4WJ7A 4TKNA 5CLLB 1OMWA 1U5FA 2COFA 2R0DA 2EJ8A 2DHJA 4K17A 2RNRB 2YS3A 4CYEA 3TFMA 4MT7A 2W2XD 4P7IA 1M7RA 1V61A 2DKQA 4F7UP 1WJMA 4CHMA 1V89A 4DBBA 2MDXA 4D0NB 4IAPA 4A6KA 2LKOA 2IYBA 3F0WA 2ELAA 3SUZA 3ZVRA 3VOQA 1NTVA 1Y19B 2W2WA 1K5DB 1KI1B 5JP4A 2ZPYA 4DX90 1K5GB 5KCVA 1U2BA 1P3RA 5DHAB 1LB1A 4HB3B 2J0MA 5KQ1A 3TW1A 5C79A 5EFXA 2CY4A 5HE2A 1PLSA 3P6AA 5DI9B 5J3QA 1U5DA 2MWNB 1J19A 4GN1A 4EMOA 2R09A 2M14A 2KGXB 5D27A 4H8SA 1DDMA 1RRPB 1WVHA 1X86A 2MKRA 1X11A 2Z0OA 3FEHA 1XCGA 1XR0B 3U7DA 1OY2A 2P8VA 1FGYA 4K2OA 1XKEA 3PVUA 1MK9B 1BTNA 1RJ2A 4HB2B 2I1KA 2V76A 3QBVB 4HAYB 3V5WA 3T06A 3N7CA 3PEGA 2ELBA 2Y8GA 1OQNA 4L6EA 4KHAA 4HDQA 2J59M 3CXBB 1XX0A 4IFSA 2D9XA 2D9WA 1MK7B 4YONA 2QKLA 4F7HA 4WVFB 4A5KA 1V88A 5HE1A 3MPXA 2LOXA 4KVGB 1I2HA 1ZC4B 1U5EA 1ZSQA 1GC7A 1EAZA 2FJLA 1QC6A 2Q13A 3SNHA 1H4RA 2W2XC 1QQGA 1WI1A 4A6FB 5D3XA 1DDWA 3NSUA 4WSFA 4B6HA 3ULBA 4HHVA 1DBHA 1FHWA 2OQBA 2DX1A 2CY5A 2CODA 1MPHA 2YT0A 2YRYA 4MK0A 2N0YA 3IVFA 4YL8A 1NTYA 1FHOA 2D4QA 4NY0A 3SV1A 4MY6A 1W1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C0A A;  2DN6 A;  1MIX A;  3A98 B;  2RLO A;  2DHI A;  2XQN M;  5J3T A;  1UPR A;  4ZRI A;  2AEH A;  3FM8 C;  1WJ1 A;  1V5P A;  2NMB A;  3DXC A;  1X05 A;  1BTK A;  1BWN A;  1NI2 A;  3DXD A;  4XWX A;  3PP2 A;  2DLW A;  1WGQ A;  4Y94 A;  5D3W A;  2RUK B;  2YSZ A;  2I5C A;  3U8Z A;  1SGH A;  2GCL A;  5C16 A;  3PZD A;  2DFK A;  1SHC A;  1B55 A;  5DH9 B;  1EGX A;  3KSY A;  2X18 A;  1PMS A;  2CRF A;  3QWM A;  4GMX B;  1TJ6 A;  2DHK A;  5C5B B;  3MDB C;  3GYP A;  5C6R A;  4DX8 A;  3QIJ A;  1J0W A;  2UZS A;  2RGN B;  2HTH B;  1U27 A;  3KRX A;  2K00 A;  1UEF A;  2CAY A;  5DHF B;  4K2P A;  4HB4 B;  4HAW B;  2DYN A;  4KAX B;  3KZ1 A;  2COC A;  1UNR A;  1IRS A;  2ADZ A;  3F5R A;  2JP2 A;  3KRW A;  2EMS A;  2MFQ A;  2ROZ B;  5HE0 A;  2VRW B;  3FSS A;  1FOE A;  1KZ7 A;  2E2X A;  2ROV A;  2GS0 A;  5DIF B;  5JHG A;  4GZU A;  4EKU A;  3D8D A;  2VKI A;  1U29 A;  2D9Y A;  5D3V A;  1FAO A;  3BIN A;  4PNK A;  2PZ1 A;  1NU2 A;  4ZRJ A;  3BJI A;  1ISN A;  3P7Z A;  3RCP A;  1X1G A;  2EMT A;  3SO6 A;  3A8Q A;  4TYZ A;  3ULC A;  3PSC A;  4KHO A;  1AQC A;  2Z0Q A;  1GG3 A;  5JHH A;  2NZ8 B;  2LUL A;  3ODO A;  5L81 A;  1WG7 A;  5LON B;  5J3Y A;  1UNP A;  2IFS A;  4GXB A;  5KQ4 A;  1ZM0 A;  1FGZ A;  4GMV A;  4HAX B;  4A6H A;  2UZR A;  1XD4 A;  4CHJ A;  2Y8F A;  1AWE A;  2LYD A;  2HE7 A;  2LG1 A;  2L2I A;  5GOW B;  2VSZ A;  1N3H A;  2D9Z A;  2YF0 A;  3OAN A;  5HE3 A;  2P0D A;  4HAZ B;  5FI0 A;  2K2J A;  3AJ4 A;  2DX5 A;  2D2Q A;  1Y5O A;  2KCJ A;  2COA A;  1U5G A;  3D8E A;  1Z87 A;  2L1C A;  2RVB B;  4Z2N A;  1LW3 A;  4PQ0 A;  2OTX A;  2QKM A;  2DYQ A;  1E5W A;  3PVL A;  1DYN A;  4GPT B;  1P6S A;  2RSG A;  3D8F A;  2J0K A;  1WGU A;  2AL6 A;  1P5T A;  2K2U A;  4ZRK A;  1EVH A;  1DRO A;  2GCJ A;  4NSW A;  4HAV B;  2D10 A;  1MAI A;  2EC1 A;  3ZDT A;  4EJN A;  5C5B A;  1Q67 A;  2LOZ A;  1I7A A;  3DXE A;  1UPQ A;  1V5U A;  1FHX A;  3PG7 A;  1BAK A;  4K81 A;  1MKE A;  1TQZ A;  1EF1 A;  1FB8 A;  3A8P A;  1TXD A;  4KHB B;  5D3Y A;  2Y7B A;  1UNQ A;  2YS1 A;  3LJU X;  2H7E A;  1ZVR A;  2DTC A;  2P0F A;  4F7G A;  3WYF B;  1M7E A;  2D9V A;  4BBK A;  3G9W A;  1V5M A;  4Z2M B;  4IOY X;  2BCJ A;  2GJY A;  2J0J A;  4HAT B;  5FI1 A;  2I5F A;  3HQC A;  5CLQ B;  1W1H A;  1MIZ B;  3HW2 B;  3O96 A;  3TO1 A;  1DDV A;  1H10 A;  1XOD A;  2P0H A;  4HAU B;  4DXA B;  5LOP B;  3AU4 A;  2DA0 A;  3AU5 A;  3TVV A;  3KY9 A;  1W1G A;  1ZC3 B;  3PVW A;  2DKP A;  3HK0 A;  2Z0P A;  2KUP A;  3GYO A;  3ODW A;  3ML4 A;  1X1F A;  2H7D A;  1PFJ A;  2UVM A;  4A6F A;  2M38 A;  2YVC A;  3VIA A;  3CIK A;  3SYX A;  5JLJ B;  2D11 A;  2I1J A;  2G35 A;  2YS5 A;  4HB0 B;  3TCA A;  1KZG A;  3UZT A;  3M1I B;  2N23 A;  1GC6 A;  3X23 A;  2YT1 A;  4HDO A;  3ODX A;  3WA0 A;  4WJ7 A;  4TKN A;  5CLL B;  1OMW A;  1U5F A;  2COF A;  2R0D A;  2EJ8 A;  2DHJ A;  4K17 A;  2RNR B;  2YS3 A;  4CYE A;  3TFM A;  4MT7 A;  2W2X D;  4P7I A;  1M7R A;  1V61 A;  2DKQ A;  4F7U P;  1WJM A;  4CHM A;  1V89 A;  4DBB A;  2MDX A;  4D0N B;  4IAP A;  4A6K A;  2LKO A;  2IYB A;  3F0W A;  2ELA A;  3SUZ A;  3ZVR A;  3VOQ A;  1NTV A;  1Y19 B;  2W2W A;  1K5D B;  1KI1 B;  5JP4 A;  2ZPY A;  4DX9 0;  1K5G B;  5KCV A;  1U2B A;  1P3R A;  5DHA B;  1LB1 A;  4HB3 B;  2J0M A;  5KQ1 A;  3TW1 A;  5C79 A;  5EFX A;  2CY4 A;  5HE2 A;  1PLS A;  3P6A A;  5DI9 B;  5J3Q A;  1U5D A;  2MWN B;  1J19 A;  4GN1 A;  4EMO A;  2R09 A;  2M14 A;  2KGX B;  5D27 A;  4H8S A;  1DDM A;  1RRP B;  1WVH A;  1X86 A;  2MKR A;  1X11 A;  2Z0O A;  3FEH A;  1XCG A;  1XR0 B;  3U7D A;  1OY2 A;  2P8V A;  1FGY A;  4K2O A;  1XKE A;  3PVU A;  1MK9 B;  1BTN A;  1RJ2 A;  4HB2 B;  2I1K A;  2V76 A;  3QBV B;  4HAY B;  3V5W A;  3T06 A;  3N7C A;  3PEG A;  2ELB A;  2Y8G A;  1OQN A;  4L6E A;  4KHA A;  4HDQ A;  2J59 M;  3CXB B;  1XX0 A;  4IFS A;  2D9X A;  2D9W A;  1MK7 B;  4YON A;  2QKL A;  4F7H A;  4WVF B;  4A5K A;  1V88 A;  5HE1 A;  3MPX A;  2LOX A;  4KVG B;  1I2H A;  1ZC4 B;  1U5E A;  1ZSQ A;  1GC7 A;  1EAZ A;  2FJL A;  1QC6 A;  2Q13 A;  3SNH A;  1H4R A;  2W2X C;  1QQG A;  1WI1 A;  4A6F B;  5D3X A;  1DDW A;  3NSU A;  4WSF A;  4B6H A;  3ULB A;  4HHV A;  1DBH A;  1FHW A;  2OQB A;  2DX1 A;  2CY5 A;  2COD A;  1MPH A;  2YT0 A;  2YRY A;  4MK0 A;  2N0Y A;  3IVF A;  4YL8 A;  1NTY A;  1FHO A;  2D4Q A;  4NY0 A;  3SV1 A;  4MY6 A;  1W1D A; 
#chains in the Genus database with same CATH topology
 2Z59 A;  4C0A A;  2DN6 A;  1MIX A;  3A98 B;  2RLO A;  2DHI A;  2XQN M;  2Z14 A;  5J3T A;  1UPR A;  3HIE A;  4ZRI A;  2AEH A;  3FM8 C;  1WJ1 A;  1V5P A;  2NMB A;  2KR0 A;  1X05 A;  3DXC A;  1BTK A;  1T77 A;  1BWN A;  1NI2 A;  3DXD A;  4XWX A;  3PP2 A;  2DLW A;  1WGQ A;  4Y94 A;  5D3W A;  2RUK B;  2YSZ A;  2I5C A;  3U8Z A;  1SGH A;  2GCL A;  5C16 A;  3PZD A;  2DFK A;  1SHC A;  1B55 A;  5DH9 B;  1EGX A;  3KSY A;  2X18 A;  1PMS A;  2CRF A;  3QWM A;  4GMX B;  1TJ6 A;  2DHK A;  5C5B B;  3MDB C;  3GYP A;  5C6R A;  4DX8 A;  3B77 A;  3QIJ A;  2KIG A;  1J0W A;  2UZS A;  2RGN B;  2HTH B;  1U27 A;  5I2M A;  3KRX A;  2K00 A;  1UEF A;  2CAY A;  5DHF B;  4K2P A;  4QXA B;  4HB4 B;  4HAW B;  2DYN A;  4KAX B;  3KZ1 A;  2COC A;  1UNR A;  1IRS A;  2ADZ A;  2KIE A;  3F5R A;  2JP2 A;  3KRW A;  2EMS A;  2K8E A;  2MFQ A;  2ROZ B;  5HE0 A;  5I2S A;  2VRW B;  3FSS A;  1FOE A;  1KZ7 A;  2E2X A;  5IRS A;  2ROV A;  2GS0 A;  5DIF B;  5JHG A;  4GZU A;  2Z13 A;  4KHB A;  4EKU A;  2K49 A;  3D8D A;  2VKI A;  1U29 A;  2D9Y A;  5D3V A;  1FAO A;  3BIN A;  4PNK A;  2PZ1 A;  1NU2 A;  4ZRJ A;  3BJI A;  1ISN A;  3P7Z A;  2FJU B;  3RCP A;  1X1G A;  2EMT A;  3SO6 A;  3A8Q A;  4TYZ A;  3ULC A;  3NWD A;  4GNK B;  3PSC A;  4KHO A;  1AQC A;  2Z0Q A;  1GG3 A;  5JHH A;  2NZ8 B;  2LUL A;  3ODO A;  5L81 A;  1WG7 A;  5LON B;  5J3Y A;  1UNP A;  2IFS A;  4GXB A;  5KQ4 A;  1ZM0 A;  1FGZ A;  2GUM A;  4GMV A;  4HAX B;  4A6H A;  4QJ5 B;  2UZR A;  1XD4 A;  4CHJ A;  2Y8F A;  1AWE A;  2LYD A;  2HE7 A;  2LG1 A;  2L2I A;  5GOW B;  2VSZ A;  1N3H A;  2D9Z A;  2YF0 A;  3OAN A;  5HE3 A;  2P0D A;  4HAZ B;  5FI0 A;  2K2J A;  3AJ4 A;  4HSI A;  2DX5 A;  2D2Q A;  3U12 A;  1Y5O A;  2KCJ A;  2COA A;  2KUQ A;  1U5G A;  3D8E A;  1Z87 A;  2L1C A;  2RVB B;  4Z2N A;  1LW3 A;  4PQ0 A;  2OTX A;  2QKM A;  2DYQ A;  1E5W A;  3PVL A;  1DYN A;  4GPT B;  1P6S A;  2RSG A;  3D8F A;  2J0K A;  1WGU A;  2AL6 A;  1P5T A;  2K2U A;  3OHM B;  4ZRK A;  3NWF A;  1EVH A;  3HSA A;  1DRO A;  2GCJ A;  4NSW A;  4HAV B;  2D10 A;  1MAI A;  2EC1 A;  3ZDT A;  4EJN A;  5C5B A;  1Q67 A;  2LOZ A;  1I7A A;  3DXE A;  1UPQ A;  1V5U A;  1FHX A;  3PG7 A;  1BAK A;  4K81 A;  1MKE A;  1TQZ A;  1EF1 A;  1FB8 A;  3A8P A;  1TXD A;  4KHB B;  5D3Y A;  2Y7B A;  1UNQ A;  2YS1 A;  3LJU X;  2H7E A;  1ZVR A;  2DTC A;  2P0F A;  4F7G A;  3WYF B;  1M7E A;  2D9V A;  4BBK A;  3G9W A;  1V5M A;  4Z2M B;  4IOY X;  2BCJ A;  2GJY A;  2J0J A;  4HAT B;  5FI1 A;  2I5F A;  3HQC A;  5CLQ B;  1W1H A;  1MIZ B;  3HW2 B;  3O96 A;  3TO1 A;  1DDV A;  1H10 A;  1XOD A;  2P0H A;  4HAU B;  4DXA B;  5LOP B;  3AU4 A;  4D6W A;  2DA0 A;  3AU5 A;  3TVV A;  3KY9 A;  1W1G A;  1ZC3 B;  3PVW A;  2DKP A;  3HK0 A;  2Z0P A;  2KUP A;  3GYO A;  3ODW A;  3ML4 A;  1X1F A;  2H7D A;  1PFJ A;  2UVM A;  4A6F A;  2M38 A;  2YVC A;  3VIA A;  3CIK A;  3SYX A;  5JLJ B;  2D11 A;  2I1J A;  2G35 A;  2YS5 A;  4HB0 B;  3NW8 A;  3TCA A;  1KZG A;  3UZT A;  3M1I B;  2N23 A;  1GC6 A;  3X23 A;  2YT1 A;  4HDO A;  3ODX A;  5LG4 B;  3WA0 A;  4WJ7 A;  4TKN A;  5CLL B;  1OMW A;  1U5F A;  2COF A;  2R0D A;  2EJ8 A;  2DHJ A;  4K17 A;  5M4Y B;  2RNR B;  2YS3 A;  4CYE A;  3TFM A;  4MT7 A;  2W2X D;  4P7I A;  1M7R A;  1V61 A;  2DKQ A;  4F7U P;  1WJM A;  4CHM A;  1V89 A;  4DBB A;  2MDX A;  4D0N B;  4IAP A;  4A6K A;  2LKO A;  2IYB A;  3F0W A;  2ELA A;  3SUZ A;  3ZVR A;  3VOQ A;  1NTV A;  1Y19 B;  2W2W A;  1MI1 A;  1K5D B;  1KI1 B;  5JP4 A;  2ZPY A;  4DX9 0;  1K5G B;  5KCV A;  4QJ3 B;  1U2B A;  1P3R A;  5DHA B;  3A58 A;  1LB1 A;  4OT1 A;  4HB3 B;  2J0M A;  5KQ1 A;  3TW1 A;  5C79 A;  5EFX A;  2CY4 A;  5HE2 A;  1PLS A;  3P6A A;  4QJ4 B;  5DI9 B;  5J3Q A;  1U5D A;  4DIX A;  2MWN B;  1J19 A;  3DCX A;  4GN1 A;  4EMO A;  4OSN A;  2R09 A;  2M14 A;  2NBV A;  2KGX B;  5D27 A;  4H8S A;  1DDM A;  1RRP B;  1WVH A;  1X86 A;  2Z0O A;  1X11 A;  2MKR A;  3FEH A;  1XCG A;  3NWA A;  1XR0 B;  3U7D A;  1OY2 A;  2P8V A;  3FVC A;  1FGY A;  4K2O A;  1XKE A;  3PVU A;  1MK9 B;  1BTN A;  1RJ2 A;  4HB2 B;  2I1K A;  2V76 A;  3QBV B;  4HAY B;  3V5W A;  3T06 A;  3N7C A;  3PEG A;  2ELB A;  2Y8G A;  1OQN A;  4L6E A;  4KHA A;  4HDQ A;  2J59 M;  3CXB B;  2Z4D A;  1XX0 A;  4IFS A;  2D9X A;  2D9W A;  1MK7 B;  4YON A;  2QKL A;  4F7H A;  4WVF B;  4A5K A;  1V88 A;  5HE1 A;  3MPX A;  2LOX A;  4KVG B;  1I2H A;  4GOU A;  1ZC4 B;  1U5E A;  1ZSQ A;  1GC7 A;  1EAZ A;  2FJL A;  1QC6 A;  2Q13 A;  3SNH A;  2YT2 A;  1H4R A;  2W2X C;  1QQG A;  1WI1 A;  2R2Y A;  4A6F B;  5D3X A;  1DDW A;  3NSU A;  4WSF A;  4B6H A;  2ZKM X;  3ULB A;  4HHV A;  1DBH A;  1FHW A;  2OQB A;  2DX1 A;  4L1R A;  2CY5 A;  2COD A;  1ZYI A;  1MPH A;  4CSQ A;  2YT0 A;  2YRY A;  4MK0 A;  2N0Y A;  3IVF A;  4YL8 A;  1NTY A;  1FHO A;  2D4Q A;  4NY0 A;  3SV1 A;  4MY6 A;  1W1D A;  2RRF A; 
#chains in the Genus database with same CATH homology
 4C0A A;  2DN6 A;  1MIX A;  3A98 B;  2RLO A;  2DHI A;  2XQN M;  5J3T A;  1UPR A;  4ZRI A;  2AEH A;  3FM8 C;  1WJ1 A;  1V5P A;  2NMB A;  3DXC A;  1X05 A;  1BTK A;  1BWN A;  1NI2 A;  3DXD A;  4XWX A;  3PP2 A;  2DLW A;  1WGQ A;  4Y94 A;  5D3W A;  2RUK B;  2YSZ A;  2I5C A;  3U8Z A;  1SGH A;  2GCL A;  5C16 A;  3PZD A;  2DFK A;  1SHC A;  1B55 A;  5DH9 B;  1EGX A;  3KSY A;  2X18 A;  1PMS A;  2CRF A;  3QWM A;  4GMX B;  1TJ6 A;  2DHK A;  5C5B B;  3MDB C;  3GYP A;  5C6R A;  4DX8 A;  3QIJ A;  1J0W A;  2UZS A;  2RGN B;  2HTH B;  1U27 A;  3KRX A;  2K00 A;  1UEF A;  2CAY A;  5DHF B;  4K2P A;  4HB4 B;  4HAW B;  2DYN A;  4KAX B;  3KZ1 A;  2COC A;  1UNR A;  1IRS A;  2ADZ A;  3F5R A;  2JP2 A;  3KRW A;  2EMS A;  2MFQ A;  2ROZ B;  5HE0 A;  2VRW B;  3FSS A;  1FOE A;  1KZ7 A;  2E2X A;  2ROV A;  2GS0 A;  5DIF B;  5JHG A;  4GZU A;  4EKU A;  3D8D A;  2VKI A;  1U29 A;  2D9Y A;  5D3V A;  1FAO A;  3BIN A;  4PNK A;  2PZ1 A;  1NU2 A;  4ZRJ A;  3BJI A;  1ISN A;  3P7Z A;  3RCP A;  1X1G A;  2EMT A;  3SO6 A;  3A8Q A;  4TYZ A;  3ULC A;  3PSC A;  4KHO A;  1AQC A;  2Z0Q A;  1GG3 A;  5JHH A;  2NZ8 B;  2LUL A;  3ODO A;  5L81 A;  1WG7 A;  5LON B;  5J3Y A;  1UNP A;  2IFS A;  4GXB A;  5KQ4 A;  1ZM0 A;  1FGZ A;  4GMV A;  4HAX B;  4A6H A;  2UZR A;  1XD4 A;  4CHJ A;  2Y8F A;  1AWE A;  2LYD A;  2HE7 A;  2LG1 A;  2L2I A;  5GOW B;  2VSZ A;  1N3H A;  2D9Z A;  2YF0 A;  3OAN A;  5HE3 A;  2P0D A;  4HAZ B;  5FI0 A;  2K2J A;  3AJ4 A;  2DX5 A;  2D2Q A;  1Y5O A;  2KCJ A;  2COA A;  1U5G A;  3D8E A;  1Z87 A;  2L1C A;  2RVB B;  4Z2N A;  1LW3 A;  4PQ0 A;  2OTX A;  2QKM A;  2DYQ A;  1E5W A;  3PVL A;  1DYN A;  4GPT B;  1P6S A;  2RSG A;  3D8F A;  2J0K A;  1WGU A;  2AL6 A;  1P5T A;  2K2U A;  4ZRK A;  1EVH A;  1DRO A;  2GCJ A;  4NSW A;  4HAV B;  2D10 A;  1MAI A;  2EC1 A;  3ZDT A;  4EJN A;  5C5B A;  1Q67 A;  2LOZ A;  1I7A A;  3DXE A;  1UPQ A;  1V5U A;  1FHX A;  3PG7 A;  1BAK A;  4K81 A;  1MKE A;  1TQZ A;  1EF1 A;  1FB8 A;  3A8P A;  1TXD A;  4KHB B;  5D3Y A;  2Y7B A;  1UNQ A;  2YS1 A;  3LJU X;  2H7E A;  1ZVR A;  2DTC A;  2P0F A;  4F7G A;  3WYF B;  1M7E A;  2D9V A;  4BBK A;  3G9W A;  1V5M A;  4Z2M B;  4IOY X;  2BCJ A;  2GJY A;  2J0J A;  4HAT B;  5FI1 A;  2I5F A;  3HQC A;  5CLQ B;  1W1H A;  1MIZ B;  3HW2 B;  3O96 A;  3TO1 A;  1DDV A;  1H10 A;  1XOD A;  2P0H A;  4HAU B;  4DXA B;  5LOP B;  3AU4 A;  2DA0 A;  3AU5 A;  3TVV A;  3KY9 A;  1W1G A;  1ZC3 B;  3PVW A;  2DKP A;  3HK0 A;  2Z0P A;  2KUP A;  3GYO A;  3ODW A;  3ML4 A;  1X1F A;  2H7D A;  1PFJ A;  2UVM A;  4A6F A;  2M38 A;  2YVC A;  3VIA A;  3CIK A;  3SYX A;  5JLJ B;  2D11 A;  2I1J A;  2G35 A;  2YS5 A;  4HB0 B;  3TCA A;  1KZG A;  3UZT A;  3M1I B;  2N23 A;  1GC6 A;  3X23 A;  2YT1 A;  4HDO A;  3ODX A;  3WA0 A;  4WJ7 A;  4TKN A;  5CLL B;  1OMW A;  1U5F A;  2COF A;  2R0D A;  2EJ8 A;  2DHJ A;  4K17 A;  2RNR B;  2YS3 A;  4CYE A;  3TFM A;  4MT7 A;  2W2X D;  4P7I A;  1M7R A;  1V61 A;  2DKQ A;  4F7U P;  1WJM A;  4CHM A;  1V89 A;  4DBB A;  2MDX A;  4D0N B;  4IAP A;  4A6K A;  2LKO A;  2IYB A;  3F0W A;  2ELA A;  3SUZ A;  3ZVR A;  3VOQ A;  1NTV A;  1Y19 B;  2W2W A;  1K5D B;  1KI1 B;  5JP4 A;  2ZPY A;  4DX9 0;  1K5G B;  5KCV A;  1U2B A;  1P3R A;  5DHA B;  1LB1 A;  4HB3 B;  2J0M A;  5KQ1 A;  3TW1 A;  5C79 A;  5EFX A;  2CY4 A;  5HE2 A;  1PLS A;  3P6A A;  5DI9 B;  5J3Q A;  1U5D A;  2MWN B;  1J19 A;  4GN1 A;  4EMO A;  2R09 A;  2M14 A;  2KGX B;  5D27 A;  4H8S A;  1DDM A;  1RRP B;  1WVH A;  1X86 A;  2MKR A;  1X11 A;  2Z0O A;  3FEH A;  1XCG A;  1XR0 B;  3U7D A;  1OY2 A;  2P8V A;  1FGY A;  4K2O A;  1XKE A;  3PVU A;  1MK9 B;  1BTN A;  1RJ2 A;  4HB2 B;  2I1K A;  2V76 A;  3QBV B;  4HAY B;  3V5W A;  3T06 A;  3N7C A;  3PEG A;  2ELB A;  2Y8G A;  1OQN A;  4L6E A;  4KHA A;  4HDQ A;  2J59 M;  3CXB B;  1XX0 A;  4IFS A;  2D9X A;  2D9W A;  1MK7 B;  4YON A;  2QKL A;  4F7H A;  4WVF B;  4A5K A;  1V88 A;  5HE1 A;  3MPX A;  2LOX A;  4KVG B;  1I2H A;  1ZC4 B;  1U5E A;  1ZSQ A;  1GC7 A;  1EAZ A;  2FJL A;  1QC6 A;  2Q13 A;  3SNH A;  1H4R A;  2W2X C;  1QQG A;  1WI1 A;  4A6F B;  5D3X A;  1DDW A;  3NSU A;  4WSF A;  4B6H A;  3ULB A;  4HHV A;  1DBH A;  1FHW A;  2OQB A;  2DX1 A;  2CY5 A;  2COD A;  1MPH A;  2YT0 A;  2YRY A;  4MK0 A;  2N0Y A;  3IVF A;  4YL8 A;  1NTY A;  1FHO A;  2D4Q A;  4NY0 A;  3SV1 A;  4MY6 A;  1W1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...