3AJ4A

Crystal structure of the ph domain of evectin-2 from human complexed with o-phospho-l-serine
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
112
structure length
112
Chain Sequence
GSMAFVKSGWLLRQSTILKRWKKNWFDLWSDGHLIYYDDQTRQNIEDKVHMPMDCINIRTGQECRDTQPPDGKSKDCMLQIVCRDGKTISLCAESTDDCLAWKFTLQDSRTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Pleckstrin homology domain-containing family B member 2
publication title Intracellular phosphatidylserine is essential for retrograde membrane traffic through endosomes
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3aj4A00
3DXEA 3PEGA 1AQCA 3SUZA 3P7ZA 2N23A 2MKRA 2E2XA 5KCVA 3A8PA 1OY2A 1X11A 2OQBA 2VRWB 4PQ0A 1DDVA 4HAWB 4HAYB 5JP4A 1H10A 4HB0B 2J59M 4HDOA 1MK9B 2CY5A 5DH9B 5DHFB 1WVHA 1NI2A 3AU5A 2D9YA 3KZ1A 1K5GB 4HB2B 1FB8A 3PG7A 2RUKB 1U5DA 5DHAB 3GYPA 1XCGA 4HAZB 3U8ZA 2CODA 4KHOA 5C79A 2UZSA 4Y94A 5J3QA 4DBBA 1W1DA 2D9VA 4ZRKA 4DX90 4HDQA 1U5FA 5DI9B 3WYFB 5GOWB 2DX1A 1Q67A 3TVVA 4TKNA 1K5DB 3AU4A 2D4QA 2D9XA 2UZRA 4GZUA 2IFSA 5KQ1A 3PVWA 3BINA 2FJLA 2NZ8B 4A6FA 2VKIA 5C16A 1U29A 3U7DA 2DHKA 3KY9A 1LB1A 2NMBA 2J0MA 3ZDTA 2UVMA 2KUPA 2LOXA 2YT1A 4KHBB 4NY0A 1BWNA 5JLJB 4A6HA 1WJMA 4Z2MB 2L2IA 2ROVA 2GCLA 2YT0A 2Y7BA 2Z0PA 3QBVB 4A6KA 3F0WA 2H7EA 3PP2A 5JHGA 1PLSA 4IFSA 5EFXA 5HE2A 1U5EA 2MDXA 5J3YA 5FI1A 2YRYA 3RCPA 2D9WA 2KCJA 1FHWA 2Z0OA 4HAVB 1KZ7A 3A8QA 1ZVRA 4L6EA 1WG7A 1QC6A 1MIXA 3LJUX 2EMTA 1MIZB 2W2XC 2M14A 3UZTA 1UEFA 2ZPYA 4HB3B 1X1FA 1X86A 2P8VA 3AJ4A 3CIKA 1PMSA 1V5PA 3HW2B 2YS1A 2XQNM 2Y8GA 2Q13A 2L1CA 1SHCA 1RRPB 4HAXB 2RGNB 2CRFA 1EGXA 5D3YA 1NTVA 1W1GA 3N7CA 1UNQA 3VOQA 4P7IA 2K2UA 1UNRA 4KAXB 5C5BB 1IRSA 4D0NB 3ULCA 1WJ1A 3PSCA 3FEHA 5C5BA 1OMWA 1UPRA 2ROZB 2DYQA 3V5WA 1MKEA 3PVLA 4NSWA 2EJ8A 2I5FA 4WJ7A 1AWEA 1DROA 4K2PA 1EF1A 1V5MA 5LONB 1XKEA 2DX5A 3GYOA 1ISNA 4DX8A 4IOYX 2DYNA 3HK0A 1ZM0A 3ULBA 3D8DA 1UPQA 2DLWA 5HE0A 3T06A 4A6FB 2G35A 4KVGB 2LULA 1Y5OA 2YSZA 2LOZA 5CLLB 1SGHA 1DBHA 5JHHA 2VSZA 4BBKA 4EKUA 1WGUA 4K81A 5KQ4A 2COCA 2BCJA 3ML4A 5D3VA 2AEHA 4EJNA 4CHMA 2P0HA 2EC1A 4A5KA 4GN1A 1U2BA 3ODXA 4H8SA 1XX0A 1DDMA 2V76A 3IVFA 3VIAA 4F7HA 1BTKA 1BAKA 1J19A 1E5WA 2YF0A 3TO1A 1FOEA 2DTCA 1ZC4B 2HE7A 4DXAB 2MWNB 1FGZA 1UNPA 1X05A 4GXBA 3HQCA 3DXCA 3KRXA 4WVFB 5HE1A 1DYNA 1GC7A 2Z0QA 3F5RA 2QKMA 3PVUA 1P5TA 2YS3A 4EMOA 3SNHA 4TYZA 5D3XA 2JP2A 1BTNA 2X18A 3D8EA 1DDWA 3A98B 4F7GA 3WA0A 4Z2NA 1X1GA 3SV1A 1GG3A 2LKOA 1I2HA 1FHOA 4MT7A 4HAUB 2COAA 1J0WA 4ZRIA 2I5CA 3KRWA 1TJ6A 4MK0A 2D10A 5L81A 3PZDA 1MAIA 1V88A 1XD4A 3OANA 3SYXA 2P0FA 2ELBA 1FHXA 2OTXA 2CAYA 4C0AA 3TW1A 4CHJA 1FAOA 2M38A 2D11A 1NTYA 1EVHA 1RJ2A 2H7DA 4GMVA 5J3TA 3SO6A 4F7UP 5D3WA 4YL8A 5C6RA 2DKPA 3D8FA 2K00A 1Y19B 1TXDA 1KI1B 2HTHB 3KSYA 1EAZA 2COFA 4MY6A 2K2JA 3G9WA 1GC6A 2N0YA 3ZVRA 4IAPA 3MDBC 1V5UA 4HATB 4HHVA 1MPHA 2P0DA 3ODWA 3O96A 4B6HA 3BJIA 2RLOA 4CYEA 4ZRJA 2RVBB 4KHAA 1V61A 2DKQA 2R0DA 2PZ1A 2J0KA 2YS5A 1U5GA 1FGYA 1U27A 2AL6A 2ADZA 2CY4A 2Y8FA 4GMXB 4WSFA 3P6AA 3FSSA 4K17A 1ZSQA 2I1KA 1NU2A 2QKLA 2D2QA 2YVCA 3FM8C 3ODOA 2ELAA 5LOPB 1W1HA 2DHIA 1B55A 1LW3A 1WGQA 1V89A 3TFMA 4GPTB 2W2XD 2D9ZA 4K2OA 3M1IB 2DA0A 1PFJA 2R09A 1MK7B 2RNRB 1H4RA 3DXDA 5DIFB 2LYDA 1XODA 3QWMA 3QIJA 5FI0A 1I7AA 1ZC3B 1WI1A 1QQGA 2LG1A 4HB4B 1Z87A 1TQZA 2GJYA 2MFQA 1XR0B 5D27A 2DFKA 2RSGA 1P3RA 2I1JA 4XWXA 2GS0A 1M7EA 5HE3A 1N3HA 2KGXB 2J0JA 2DN6A 2IYBA 2GCJA 2W2WA 1P6SA 3X23A 3TCAA 5CLQB 3CXBB 2DHJA 1OQNA 4YONA 1KZGA 1M7RA 3NSUA 3MPXA 4PNKA 2EMSA
chains in the Genus database with same CATH superfamily
3DXEA 3PEGA 1AQCA 3SUZA 3P7ZA 2KUQA 2N23A 2MKRA 2E2XA 5KCVA 3A8PA 4L1RA 1OY2A 1X11A 2OQBA 2VRWB 4PQ0A 1DDVA 4HAWB 4HAYB 5JP4A 1H10A 4HB0B 5I2MA 2J59M 4HDOA 1MK9B 2CY5A 5DH9B 5DHFB 1WVHA 1NI2A 3AU5A 2D9YA 3KZ1A 1K5GB 3HIEA 4HB2B 1FB8A 3PG7A 2RUKB 1U5DA 5DHAB 3GYPA 1XCGA 4HAZB 2FJUB 3U8ZA 2CODA 4DIXA 4KHOA 5C79A 2UZSA 4Y94A 5J3QA 4DBBA 1W1DA 2D9VA 4ZRKA 4DX90 4HDQA 2KIEA 1U5FA 5DI9B 3WYFB 5GOWB 2DX1A 1Q67A 3DCXA 3TVVA 4TKNA 1K5DB 3AU4A 2D4QA 2D9XA 2UZRA 4HSIA 4GZUA 2IFSA 5KQ1A 3PVWA 3BINA 2FJLA 2NZ8B 4A6FA 2VKIA 5C16A 1U29A 3U7DA 2K49A 2DHKA 4GOUA 3KY9A 1LB1A 2NMBA 2J0MA 3ZDTA 2UVMA 2KUPA 2LOXA 2YT1A 4KHBB 4NY0A 1BWNA 5JLJB 2Z59A 4A6HA 1WJMA 4Z2MB 2L2IA 2ROVA 4KHBA 2GCLA 2YT0A 2Y7BA 2Z0PA 2R2YA 3QBVB 4A6KA 3F0WA 2H7EA 3PP2A 5JHGA 1PLSA 4IFSA 5EFXA 5M4YB 5HE2A 1U5EA 2MDXA 5J3YA 5FI1A 2YRYA 3RCPA 2D9WA 2KCJA 1FHWA 2Z0OA 4HAVB 1KZ7A 2K8EA 3A8QA 1ZVRA 2KR0A 4L6EA 1WG7A 1QC6A 1MIXA 3LJUX 4QXAB 2YT2A 2EMTA 1MIZB 2W2XC 2M14A 3UZTA 1UEFA 2ZPYA 4HB3B 1X1FA 1X86A 2P8VA 3AJ4A 3CIKA 2Z4DA 1PMSA 1V5PA 3HW2B 2YS1A 2GUMA 2XQNM 2Y8GA 2Q13A 2L1CA 1SHCA 1RRPB 4HAXB 2RGNB 2CRFA 1EGXA 5D3YA 1NTVA 1W1GA 3N7CA 1UNQA 3VOQA 4P7IA 2K2UA 1UNRA 4KAXB 5C5BB 1IRSA 4D0NB 3ULCA 1WJ1A 3PSCA 3FEHA 5C5BA 3NW8A 1OMWA 1UPRA 2ROZB 2DYQA 3V5WA 1MKEA 3PVLA 4NSWA 2EJ8A 3FVCA 2I5FA 4WJ7A 1T77A 1AWEA 1DROA 4K2PA 1EF1A 1V5MA 5LONB 5I2SA 1XKEA 2DX5A 3GYOA 1ISNA 4DX8A 3NWFA 4IOYX 2DYNA 3HK0A 1ZM0A 3ULBA 3D8DA 1UPQA 2DLWA 3NWDA 2Z13A 5HE0A 4QJ3B 3T06A 4A6FB 2G35A 4KVGB 2LULA 1Y5OA 2YSZA 2LOZA 5CLLB 1SGHA 1DBHA 5JHHA 2VSZA 4BBKA 4EKUA 1WGUA 4K81A 5KQ4A 2COCA 2BCJA 3ML4A 5D3VA 2AEHA 4EJNA 4CHMA 2P0HA 2EC1A 4A5KA 4GN1A 1U2BA 3U12A 3ODXA 4H8SA 1XX0A 1DDMA 2V76A 3IVFA 3VIAA 4F7HA 1BTKA 1BAKA 1J19A 1E5WA 2YF0A 3TO1A 1FOEA 4OSNA 2DTCA 1ZC4B 2HE7A 4DXAB 2MWNB 1FGZA 1UNPA 1X05A 4GXBA 3HQCA 3DXCA 3KRXA 4WVFB 5HE1A 1DYNA 1GC7A 2Z0QA 3F5RA 2QKMA 3PVUA 3OHMB 1P5TA 2YS3A 4EMOA 3SNHA 4TYZA 5D3XA 2JP2A 2RRFA 1BTNA 2X18A 3D8EA 1DDWA 3A98B 4F7GA 3WA0A 4Z2NA 1X1GA 3NWAA 3SV1A 4GNKB 1GG3A 2LKOA 4OT1A 1I2HA 1FHOA 5LG4B 4MT7A 4HAUB 2COAA 1J0WA 4ZRIA 2I5CA 3KRWA 1TJ6A 4MK0A 2D10A 2KIGA 5L81A 3PZDA 1MAIA 1V88A 1XD4A 3OANA 3SYXA 2P0FA 2ELBA 1FHXA 2OTXA 2CAYA 4C0AA 3TW1A 4CHJA 1FAOA 2M38A 2D11A 1NTYA 1EVHA 1RJ2A 2H7DA 4GMVA 5J3TA 3SO6A 4F7UP 5D3WA 4YL8A 2NBVA 4QJ5B 5C6RA 2DKPA 3D8FA 2K00A 1Y19B 1TXDA 1KI1B 2HTHB 3KSYA 1EAZA 2COFA 4MY6A 2K2JA 3G9WA 1GC6A 2N0YA 3ZVRA 4IAPA 1V5UA 3MDBC 4HATB 4HHVA 1MPHA 4D6WA 2P0DA 3ODWA 3O96A 4B6HA 3BJIA 2RLOA 4CYEA 4ZRJA 2RVBB 4KHAA 1V61A 2DKQA 2R0DA 2PZ1A 2J0KA 2YS5A 3A58A 1U5GA 1FGYA 1U27A 2AL6A 4CSQA 2ADZA 2CY4A 2Y8FA 5IRSA 3HSAA 4GMXB 4WSFA 3P6AA 3FSSA 4K17A 1ZSQA 2I1KA 1NU2A 2QKLA 2D2QA 2YVCA 3FM8C 3ODOA 2ELAA 4QJ4B 5LOPB 1W1HA 2DHIA 1B55A 1LW3A 1WGQA 1V89A 3TFMA 2Z14A 4GPTB 2W2XD 2D9ZA 4K2OA 3M1IB 2DA0A 1PFJA 2R09A 1MK7B 2RNRB 1H4RA 3DXDA 5DIFB 2LYDA 1MI1A 1XODA 1ZYIA 3QWMA 3QIJA 5FI0A 1I7AA 1ZC3B 1WI1A 1QQGA 2LG1A 4HB4B 1Z87A 1TQZA 2GJYA 2ZKMX 2MFQA 1XR0B 5D27A 2DFKA 2RSGA 1P3RA 2I1JA 4XWXA 2GS0A 1M7EA 5HE3A 1N3HA 2KGXB 2J0JA 2DN6A 2IYBA 2GCJA 2W2WA 1P6SA 3B77A 3X23A 3TCAA 5CLQB 3CXBB 2DHJA 1OQNA 4YONA 1KZGA 1M7RA 3NSUA 3MPXA 4PNKA 2EMSA
chains in the Genus database with same CATH topology
3DXEA 3PEGA 1AQCA 3SUZA 3P7ZA 2N23A 2MKRA 2E2XA 5KCVA 3A8PA 1OY2A 1X11A 2OQBA 2VRWB 4PQ0A 1DDVA 4HAWB 4HAYB 5JP4A 1H10A 4HB0B 2J59M 4HDOA 1MK9B 2CY5A 5DH9B 5DHFB 1WVHA 1NI2A 3AU5A 2D9YA 3KZ1A 1K5GB 4HB2B 1FB8A 3PG7A 2RUKB 1U5DA 5DHAB 3GYPA 1XCGA 4HAZB 3U8ZA 2CODA 4KHOA 5C79A 2UZSA 4Y94A 5J3QA 4DBBA 1W1DA 2D9VA 4ZRKA 4DX90 4HDQA 1U5FA 5DI9B 3WYFB 5GOWB 2DX1A 1Q67A 3TVVA 4TKNA 1K5DB 3AU4A 2D4QA 2D9XA 2UZRA 4GZUA 2IFSA 5KQ1A 3PVWA 3BINA 2FJLA 2NZ8B 4A6FA 2VKIA 5C16A 1U29A 3U7DA 2DHKA 3KY9A 1LB1A 2NMBA 2J0MA 3ZDTA 2UVMA 2KUPA 2LOXA 2YT1A 4KHBB 4NY0A 1BWNA 5JLJB 4A6HA 1WJMA 4Z2MB 2L2IA 2ROVA 2GCLA 2YT0A 2Y7BA 2Z0PA 3QBVB 4A6KA 3F0WA 2H7EA 3PP2A 5JHGA 1PLSA 4IFSA 5EFXA 5HE2A 1U5EA 2MDXA 5J3YA 5FI1A 2YRYA 3RCPA 2D9WA 2KCJA 1FHWA 2Z0OA 4HAVB 1KZ7A 3A8QA 1ZVRA 4L6EA 1WG7A 1QC6A 1MIXA 3LJUX 2EMTA 1MIZB 2W2XC 2M14A 3UZTA 1UEFA 2ZPYA 4HB3B 1X1FA 1X86A 2P8VA 3AJ4A 3CIKA 1PMSA 1V5PA 3HW2B 2YS1A 2XQNM 2Y8GA 2Q13A 2L1CA 1SHCA 1RRPB 4HAXB 2RGNB 2CRFA 1EGXA 5D3YA 1NTVA 1W1GA 3N7CA 1UNQA 3VOQA 4P7IA 2K2UA 1UNRA 4KAXB 5C5BB 1IRSA 4D0NB 3ULCA 1WJ1A 3PSCA 3FEHA 5C5BA 1OMWA 1UPRA 2ROZB 2DYQA 3V5WA 1MKEA 3PVLA 4NSWA 2EJ8A 2I5FA 4WJ7A 1AWEA 1DROA 4K2PA 1EF1A 1V5MA 5LONB 1XKEA 2DX5A 3GYOA 1ISNA 4DX8A 4IOYX 2DYNA 3HK0A 1ZM0A 3ULBA 3D8DA 1UPQA 2DLWA 5HE0A 3T06A 4A6FB 2G35A 4KVGB 2LULA 1Y5OA 2YSZA 2LOZA 5CLLB 1SGHA 1DBHA 5JHHA 2VSZA 4BBKA 4EKUA 1WGUA 4K81A 5KQ4A 2COCA 2BCJA 3ML4A 5D3VA 2AEHA 4EJNA 4CHMA 2P0HA 2EC1A 4A5KA 4GN1A 1U2BA 3ODXA 4H8SA 1XX0A 1DDMA 2V76A 3IVFA 3VIAA 4F7HA 1BTKA 1BAKA 1J19A 1E5WA 2YF0A 3TO1A 1FOEA 2DTCA 1ZC4B 2HE7A 4DXAB 2MWNB 1FGZA 1UNPA 1X05A 4GXBA 3HQCA 3DXCA 3KRXA 4WVFB 5HE1A 1DYNA 1GC7A 2Z0QA 3F5RA 2QKMA 3PVUA 1P5TA 2YS3A 4EMOA 3SNHA 4TYZA 5D3XA 2JP2A 1BTNA 2X18A 3D8EA 1DDWA 3A98B 4F7GA 3WA0A 4Z2NA 1X1GA 3SV1A 1GG3A 2LKOA 1I2HA 1FHOA 4MT7A 4HAUB 2COAA 1J0WA 4ZRIA 2I5CA 3KRWA 1TJ6A 4MK0A 2D10A 5L81A 3PZDA 1MAIA 1V88A 1XD4A 3OANA 3SYXA 2P0FA 2ELBA 1FHXA 2OTXA 2CAYA 4C0AA 3TW1A 4CHJA 1FAOA 2M38A 2D11A 1NTYA 1EVHA 1RJ2A 2H7DA 4GMVA 5J3TA 3SO6A 4F7UP 5D3WA 4YL8A 5C6RA 2DKPA 3D8FA 2K00A 1Y19B 1TXDA 1KI1B 2HTHB 3KSYA 1EAZA 2COFA 4MY6A 2K2JA 3G9WA 1GC6A 2N0YA 3ZVRA 4IAPA 3MDBC 1V5UA 4HATB 4HHVA 1MPHA 2P0DA 3ODWA 3O96A 4B6HA 3BJIA 2RLOA 4CYEA 4ZRJA 2RVBB 4KHAA 1V61A 2DKQA 2R0DA 2PZ1A 2J0KA 2YS5A 1U5GA 1FGYA 1U27A 2AL6A 2ADZA 2CY4A 2Y8FA 4GMXB 4WSFA 3P6AA 3FSSA 4K17A 1ZSQA 2I1KA 1NU2A 2QKLA 2D2QA 2YVCA 3FM8C 3ODOA 2ELAA 5LOPB 1W1HA 2DHIA 1B55A 1LW3A 1WGQA 1V89A 3TFMA 4GPTB 2W2XD 2D9ZA 4K2OA 3M1IB 2DA0A 1PFJA 2R09A 1MK7B 2RNRB 1H4RA 3DXDA 5DIFB 2LYDA 1XODA 3QWMA 3QIJA 5FI0A 1I7AA 1ZC3B 1WI1A 1QQGA 2LG1A 4HB4B 1Z87A 1TQZA 2GJYA 2MFQA 1XR0B 5D27A 2DFKA 2RSGA 1P3RA 2I1JA 4XWXA 2GS0A 1M7EA 5HE3A 1N3HA 2KGXB 2J0JA 2DN6A 2IYBA 2GCJA 2W2WA 1P6SA 3X23A 3TCAA 5CLQB 3CXBB 2DHJA 1OQNA 4YONA 1KZGA 1M7RA 3NSUA 3MPXA 4PNKA 2EMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXE A;  3PEG A;  1AQC A;  3SUZ A;  3P7Z A;  2N23 A;  2MKR A;  2E2X A;  5KCV A;  3A8P A;  1OY2 A;  1X11 A;  2OQB A;  2VRW B;  4PQ0 A;  1DDV A;  4HAW B;  4HAY B;  5JP4 A;  1H10 A;  4HB0 B;  2J59 M;  4HDO A;  1MK9 B;  2CY5 A;  5DH9 B;  5DHF B;  1WVH A;  1NI2 A;  3AU5 A;  2D9Y A;  3KZ1 A;  1K5G B;  4HB2 B;  1FB8 A;  3PG7 A;  2RUK B;  1U5D A;  5DHA B;  3GYP A;  1XCG A;  4HAZ B;  3U8Z A;  2COD A;  4KHO A;  5C79 A;  2UZS A;  4Y94 A;  5J3Q A;  4DBB A;  1W1D A;  2D9V A;  4ZRK A;  4DX9 0;  4HDQ A;  1U5F A;  5DI9 B;  3WYF B;  5GOW B;  2DX1 A;  1Q67 A;  3TVV A;  4TKN A;  1K5D B;  3AU4 A;  2D4Q A;  2D9X A;  2UZR A;  4GZU A;  2IFS A;  5KQ1 A;  3PVW A;  3BIN A;  2FJL A;  2NZ8 B;  4A6F A;  2VKI A;  5C16 A;  1U29 A;  3U7D A;  2DHK A;  3KY9 A;  1LB1 A;  2NMB A;  2J0M A;  3ZDT A;  2UVM A;  2KUP A;  2LOX A;  2YT1 A;  4KHB B;  4NY0 A;  1BWN A;  5JLJ B;  4A6H A;  1WJM A;  4Z2M B;  2L2I A;  2ROV A;  2GCL A;  2YT0 A;  2Y7B A;  2Z0P A;  3QBV B;  4A6K A;  3F0W A;  2H7E A;  3PP2 A;  5JHG A;  1PLS A;  4IFS A;  5EFX A;  5HE2 A;  1U5E A;  2MDX A;  5J3Y A;  5FI1 A;  2YRY A;  3RCP A;  2D9W A;  2KCJ A;  1FHW A;  2Z0O A;  4HAV B;  1KZ7 A;  3A8Q A;  1ZVR A;  4L6E A;  1WG7 A;  1QC6 A;  1MIX A;  3LJU X;  2EMT A;  1MIZ B;  2W2X C;  2M14 A;  3UZT A;  1UEF A;  2ZPY A;  4HB3 B;  1X1F A;  1X86 A;  2P8V A;  3AJ4 A;  3CIK A;  1PMS A;  1V5P A;  3HW2 B;  2YS1 A;  2XQN M;  2Y8G A;  2Q13 A;  2L1C A;  1SHC A;  1RRP B;  4HAX B;  2RGN B;  2CRF A;  1EGX A;  5D3Y A;  1NTV A;  1W1G A;  3N7C A;  1UNQ A;  3VOQ A;  4P7I A;  2K2U A;  1UNR A;  4KAX B;  5C5B B;  1IRS A;  4D0N B;  3ULC A;  1WJ1 A;  3PSC A;  3FEH A;  5C5B A;  1OMW A;  1UPR A;  2ROZ B;  2DYQ A;  3V5W A;  1MKE A;  3PVL A;  4NSW A;  2EJ8 A;  2I5F A;  4WJ7 A;  1AWE A;  1DRO A;  4K2P A;  1EF1 A;  1V5M A;  5LON B;  1XKE A;  2DX5 A;  3GYO A;  1ISN A;  4DX8 A;  4IOY X;  2DYN A;  3HK0 A;  1ZM0 A;  3ULB A;  3D8D A;  1UPQ A;  2DLW A;  5HE0 A;  3T06 A;  4A6F B;  2G35 A;  4KVG B;  2LUL A;  1Y5O A;  2YSZ A;  2LOZ A;  5CLL B;  1SGH A;  1DBH A;  5JHH A;  2VSZ A;  4BBK A;  4EKU A;  1WGU A;  4K81 A;  5KQ4 A;  2COC A;  2BCJ A;  3ML4 A;  5D3V A;  2AEH A;  4EJN A;  4CHM A;  2P0H A;  2EC1 A;  4A5K A;  4GN1 A;  1U2B A;  3ODX A;  4H8S A;  1XX0 A;  1DDM A;  2V76 A;  3IVF A;  3VIA A;  4F7H A;  1BTK A;  1BAK A;  1J19 A;  1E5W A;  2YF0 A;  3TO1 A;  1FOE A;  2DTC A;  1ZC4 B;  2HE7 A;  4DXA B;  2MWN B;  1FGZ A;  1UNP A;  1X05 A;  4GXB A;  3HQC A;  3DXC A;  3KRX A;  4WVF B;  5HE1 A;  1DYN A;  1GC7 A;  2Z0Q A;  3F5R A;  2QKM A;  3PVU A;  1P5T A;  2YS3 A;  4EMO A;  3SNH A;  4TYZ A;  5D3X A;  2JP2 A;  1BTN A;  2X18 A;  3D8E A;  1DDW A;  3A98 B;  4F7G A;  3WA0 A;  4Z2N A;  1X1G A;  3SV1 A;  1GG3 A;  2LKO A;  1I2H A;  1FHO A;  4MT7 A;  4HAU B;  2COA A;  1J0W A;  4ZRI A;  2I5C A;  3KRW A;  1TJ6 A;  4MK0 A;  2D10 A;  5L81 A;  3PZD A;  1MAI A;  1V88 A;  1XD4 A;  3OAN A;  3SYX A;  2P0F A;  2ELB A;  1FHX A;  2OTX A;  2CAY A;  4C0A A;  3TW1 A;  4CHJ A;  1FAO A;  2M38 A;  2D11 A;  1NTY A;  1EVH A;  1RJ2 A;  2H7D A;  4GMV A;  5J3T A;  3SO6 A;  4F7U P;  5D3W A;  4YL8 A;  5C6R A;  2DKP A;  3D8F A;  2K00 A;  1Y19 B;  1TXD A;  1KI1 B;  2HTH B;  3KSY A;  1EAZ A;  2COF A;  4MY6 A;  2K2J A;  3G9W A;  1GC6 A;  2N0Y A;  3ZVR A;  4IAP A;  3MDB C;  1V5U A;  4HAT B;  4HHV A;  1MPH A;  2P0D A;  3ODW A;  3O96 A;  4B6H A;  3BJI A;  2RLO A;  4CYE A;  4ZRJ A;  2RVB B;  4KHA A;  1V61 A;  2DKQ A;  2R0D A;  2PZ1 A;  2J0K A;  2YS5 A;  1U5G A;  1FGY A;  1U27 A;  2AL6 A;  2ADZ A;  2CY4 A;  2Y8F A;  4GMX B;  4WSF A;  3P6A A;  3FSS A;  4K17 A;  1ZSQ A;  2I1K A;  1NU2 A;  2QKL A;  2D2Q A;  2YVC A;  3FM8 C;  3ODO A;  2ELA A;  5LOP B;  1W1H A;  2DHI A;  1B55 A;  1LW3 A;  1WGQ A;  1V89 A;  3TFM A;  4GPT B;  2W2X D;  2D9Z A;  4K2O A;  3M1I B;  2DA0 A;  1PFJ A;  2R09 A;  1MK7 B;  2RNR B;  1H4R A;  3DXD A;  5DIF B;  2LYD A;  1XOD A;  3QWM A;  3QIJ A;  5FI0 A;  1I7A A;  1ZC3 B;  1WI1 A;  1QQG A;  2LG1 A;  4HB4 B;  1Z87 A;  1TQZ A;  2GJY A;  2MFQ A;  1XR0 B;  5D27 A;  2DFK A;  2RSG A;  1P3R A;  2I1J A;  4XWX A;  2GS0 A;  1M7E A;  5HE3 A;  1N3H A;  2KGX B;  2J0J A;  2DN6 A;  2IYB A;  2GCJ A;  2W2W A;  1P6S A;  3X23 A;  3TCA A;  5CLQ B;  3CXB B;  2DHJ A;  1OQN A;  4YON A;  1KZG A;  1M7R A;  3NSU A;  3MPX A;  4PNK A;  2EMS A; 
#chains in the Genus database with same CATH topology
 3DXE A;  3PEG A;  1AQC A;  3SUZ A;  3P7Z A;  2KUQ A;  2N23 A;  2MKR A;  2E2X A;  5KCV A;  3A8P A;  4L1R A;  1OY2 A;  1X11 A;  2OQB A;  2VRW B;  4PQ0 A;  1DDV A;  4HAW B;  4HAY B;  5JP4 A;  1H10 A;  4HB0 B;  5I2M A;  2J59 M;  4HDO A;  1MK9 B;  2CY5 A;  5DH9 B;  5DHF B;  1WVH A;  1NI2 A;  3AU5 A;  2D9Y A;  3KZ1 A;  1K5G B;  3HIE A;  4HB2 B;  1FB8 A;  3PG7 A;  2RUK B;  1U5D A;  5DHA B;  3GYP A;  1XCG A;  4HAZ B;  2FJU B;  3U8Z A;  2COD A;  4DIX A;  4KHO A;  5C79 A;  2UZS A;  4Y94 A;  5J3Q A;  4DBB A;  1W1D A;  2D9V A;  4ZRK A;  4DX9 0;  4HDQ A;  2KIE A;  1U5F A;  5DI9 B;  3WYF B;  5GOW B;  2DX1 A;  1Q67 A;  3DCX A;  3TVV A;  4TKN A;  1K5D B;  3AU4 A;  2D4Q A;  2D9X A;  2UZR A;  4HSI A;  4GZU A;  2IFS A;  5KQ1 A;  3PVW A;  3BIN A;  2FJL A;  2NZ8 B;  4A6F A;  2VKI A;  5C16 A;  1U29 A;  3U7D A;  2K49 A;  2DHK A;  4GOU A;  3KY9 A;  1LB1 A;  2NMB A;  2J0M A;  3ZDT A;  2UVM A;  2KUP A;  2LOX A;  2YT1 A;  4KHB B;  4NY0 A;  1BWN A;  5JLJ B;  2Z59 A;  4A6H A;  1WJM A;  4Z2M B;  2L2I A;  2ROV A;  4KHB A;  2GCL A;  2YT0 A;  2Y7B A;  2Z0P A;  2R2Y A;  3QBV B;  4A6K A;  3F0W A;  2H7E A;  3PP2 A;  5JHG A;  1PLS A;  4IFS A;  5EFX A;  5M4Y B;  5HE2 A;  1U5E A;  2MDX A;  5J3Y A;  5FI1 A;  2YRY A;  3RCP A;  2D9W A;  2KCJ A;  1FHW A;  2Z0O A;  4HAV B;  1KZ7 A;  2K8E A;  3A8Q A;  1ZVR A;  2KR0 A;  4L6E A;  1WG7 A;  1QC6 A;  1MIX A;  3LJU X;  4QXA B;  2YT2 A;  2EMT A;  1MIZ B;  2W2X C;  2M14 A;  3UZT A;  1UEF A;  2ZPY A;  4HB3 B;  1X1F A;  1X86 A;  2P8V A;  3AJ4 A;  3CIK A;  2Z4D A;  1PMS A;  1V5P A;  3HW2 B;  2YS1 A;  2GUM A;  2XQN M;  2Y8G A;  2Q13 A;  2L1C A;  1SHC A;  1RRP B;  4HAX B;  2RGN B;  2CRF A;  1EGX A;  5D3Y A;  1NTV A;  1W1G A;  3N7C A;  1UNQ A;  3VOQ A;  4P7I A;  2K2U A;  1UNR A;  4KAX B;  5C5B B;  1IRS A;  4D0N B;  3ULC A;  1WJ1 A;  3PSC A;  3FEH A;  5C5B A;  3NW8 A;  1OMW A;  1UPR A;  2ROZ B;  2DYQ A;  3V5W A;  1MKE A;  3PVL A;  4NSW A;  2EJ8 A;  3FVC A;  2I5F A;  4WJ7 A;  1T77 A;  1AWE A;  1DRO A;  4K2P A;  1EF1 A;  1V5M A;  5LON B;  5I2S A;  1XKE A;  2DX5 A;  3GYO A;  1ISN A;  4DX8 A;  3NWF A;  4IOY X;  2DYN A;  3HK0 A;  1ZM0 A;  3ULB A;  3D8D A;  1UPQ A;  2DLW A;  3NWD A;  2Z13 A;  5HE0 A;  4QJ3 B;  3T06 A;  4A6F B;  2G35 A;  4KVG B;  2LUL A;  1Y5O A;  2YSZ A;  2LOZ A;  5CLL B;  1SGH A;  1DBH A;  5JHH A;  2VSZ A;  4BBK A;  4EKU A;  1WGU A;  4K81 A;  5KQ4 A;  2COC A;  2BCJ A;  3ML4 A;  5D3V A;  2AEH A;  4EJN A;  4CHM A;  2P0H A;  2EC1 A;  4A5K A;  4GN1 A;  1U2B A;  3U12 A;  3ODX A;  4H8S A;  1XX0 A;  1DDM A;  2V76 A;  3IVF A;  3VIA A;  4F7H A;  1BTK A;  1BAK A;  1J19 A;  1E5W A;  2YF0 A;  3TO1 A;  1FOE A;  4OSN A;  2DTC A;  1ZC4 B;  2HE7 A;  4DXA B;  2MWN B;  1FGZ A;  1UNP A;  1X05 A;  4GXB A;  3HQC A;  3DXC A;  3KRX A;  4WVF B;  5HE1 A;  1DYN A;  1GC7 A;  2Z0Q A;  3F5R A;  2QKM A;  3PVU A;  3OHM B;  1P5T A;  2YS3 A;  4EMO A;  3SNH A;  4TYZ A;  5D3X A;  2JP2 A;  2RRF A;  1BTN A;  2X18 A;  3D8E A;  1DDW A;  3A98 B;  4F7G A;  3WA0 A;  4Z2N A;  1X1G A;  3NWA A;  3SV1 A;  4GNK B;  1GG3 A;  2LKO A;  4OT1 A;  1I2H A;  1FHO A;  5LG4 B;  4MT7 A;  4HAU B;  2COA A;  1J0W A;  4ZRI A;  2I5C A;  3KRW A;  1TJ6 A;  4MK0 A;  2D10 A;  2KIG A;  5L81 A;  3PZD A;  1MAI A;  1V88 A;  1XD4 A;  3OAN A;  3SYX A;  2P0F A;  2ELB A;  1FHX A;  2OTX A;  2CAY A;  4C0A A;  3TW1 A;  4CHJ A;  1FAO A;  2M38 A;  2D11 A;  1NTY A;  1EVH A;  1RJ2 A;  2H7D A;  4GMV A;  5J3T A;  3SO6 A;  4F7U P;  5D3W A;  4YL8 A;  2NBV A;  4QJ5 B;  5C6R A;  2DKP A;  3D8F A;  2K00 A;  1Y19 B;  1TXD A;  1KI1 B;  2HTH B;  3KSY A;  1EAZ A;  2COF A;  4MY6 A;  2K2J A;  3G9W A;  1GC6 A;  2N0Y A;  3ZVR A;  4IAP A;  1V5U A;  3MDB C;  4HAT B;  4HHV A;  1MPH A;  4D6W A;  2P0D A;  3ODW A;  3O96 A;  4B6H A;  3BJI A;  2RLO A;  4CYE A;  4ZRJ A;  2RVB B;  4KHA A;  1V61 A;  2DKQ A;  2R0D A;  2PZ1 A;  2J0K A;  2YS5 A;  3A58 A;  1U5G A;  1FGY A;  1U27 A;  2AL6 A;  4CSQ A;  2ADZ A;  2CY4 A;  2Y8F A;  5IRS A;  3HSA A;  4GMX B;  4WSF A;  3P6A A;  3FSS A;  4K17 A;  1ZSQ A;  2I1K A;  1NU2 A;  2QKL A;  2D2Q A;  2YVC A;  3FM8 C;  3ODO A;  2ELA A;  4QJ4 B;  5LOP B;  1W1H A;  2DHI A;  1B55 A;  1LW3 A;  1WGQ A;  1V89 A;  3TFM A;  2Z14 A;  4GPT B;  2W2X D;  2D9Z A;  4K2O A;  3M1I B;  2DA0 A;  1PFJ A;  2R09 A;  1MK7 B;  2RNR B;  1H4R A;  3DXD A;  5DIF B;  2LYD A;  1MI1 A;  1XOD A;  1ZYI A;  3QWM A;  3QIJ A;  5FI0 A;  1I7A A;  1ZC3 B;  1WI1 A;  1QQG A;  2LG1 A;  4HB4 B;  1Z87 A;  1TQZ A;  2GJY A;  2ZKM X;  2MFQ A;  1XR0 B;  5D27 A;  2DFK A;  2RSG A;  1P3R A;  2I1J A;  4XWX A;  2GS0 A;  1M7E A;  5HE3 A;  1N3H A;  2KGX B;  2J0J A;  2DN6 A;  2IYB A;  2GCJ A;  2W2W A;  1P6S A;  3B77 A;  3X23 A;  3TCA A;  5CLQ B;  3CXB B;  2DHJ A;  1OQN A;  4YON A;  1KZG A;  1M7R A;  3NSU A;  3MPX A;  4PNK A;  2EMS A; 
#chains in the Genus database with same CATH homology
 3DXE A;  3PEG A;  1AQC A;  3SUZ A;  3P7Z A;  2N23 A;  2MKR A;  2E2X A;  5KCV A;  3A8P A;  1OY2 A;  1X11 A;  2OQB A;  2VRW B;  4PQ0 A;  1DDV A;  4HAW B;  4HAY B;  5JP4 A;  1H10 A;  4HB0 B;  2J59 M;  4HDO A;  1MK9 B;  2CY5 A;  5DH9 B;  5DHF B;  1WVH A;  1NI2 A;  3AU5 A;  2D9Y A;  3KZ1 A;  1K5G B;  4HB2 B;  1FB8 A;  3PG7 A;  2RUK B;  1U5D A;  5DHA B;  3GYP A;  1XCG A;  4HAZ B;  3U8Z A;  2COD A;  4KHO A;  5C79 A;  2UZS A;  4Y94 A;  5J3Q A;  4DBB A;  1W1D A;  2D9V A;  4ZRK A;  4DX9 0;  4HDQ A;  1U5F A;  5DI9 B;  3WYF B;  5GOW B;  2DX1 A;  1Q67 A;  3TVV A;  4TKN A;  1K5D B;  3AU4 A;  2D4Q A;  2D9X A;  2UZR A;  4GZU A;  2IFS A;  5KQ1 A;  3PVW A;  3BIN A;  2FJL A;  2NZ8 B;  4A6F A;  2VKI A;  5C16 A;  1U29 A;  3U7D A;  2DHK A;  3KY9 A;  1LB1 A;  2NMB A;  2J0M A;  3ZDT A;  2UVM A;  2KUP A;  2LOX A;  2YT1 A;  4KHB B;  4NY0 A;  1BWN A;  5JLJ B;  4A6H A;  1WJM A;  4Z2M B;  2L2I A;  2ROV A;  2GCL A;  2YT0 A;  2Y7B A;  2Z0P A;  3QBV B;  4A6K A;  3F0W A;  2H7E A;  3PP2 A;  5JHG A;  1PLS A;  4IFS A;  5EFX A;  5HE2 A;  1U5E A;  2MDX A;  5J3Y A;  5FI1 A;  2YRY A;  3RCP A;  2D9W A;  2KCJ A;  1FHW A;  2Z0O A;  4HAV B;  1KZ7 A;  3A8Q A;  1ZVR A;  4L6E A;  1WG7 A;  1QC6 A;  1MIX A;  3LJU X;  2EMT A;  1MIZ B;  2W2X C;  2M14 A;  3UZT A;  1UEF A;  2ZPY A;  4HB3 B;  1X1F A;  1X86 A;  2P8V A;  3AJ4 A;  3CIK A;  1PMS A;  1V5P A;  3HW2 B;  2YS1 A;  2XQN M;  2Y8G A;  2Q13 A;  2L1C A;  1SHC A;  1RRP B;  4HAX B;  2RGN B;  2CRF A;  1EGX A;  5D3Y A;  1NTV A;  1W1G A;  3N7C A;  1UNQ A;  3VOQ A;  4P7I A;  2K2U A;  1UNR A;  4KAX B;  5C5B B;  1IRS A;  4D0N B;  3ULC A;  1WJ1 A;  3PSC A;  3FEH A;  5C5B A;  1OMW A;  1UPR A;  2ROZ B;  2DYQ A;  3V5W A;  1MKE A;  3PVL A;  4NSW A;  2EJ8 A;  2I5F A;  4WJ7 A;  1AWE A;  1DRO A;  4K2P A;  1EF1 A;  1V5M A;  5LON B;  1XKE A;  2DX5 A;  3GYO A;  1ISN A;  4DX8 A;  4IOY X;  2DYN A;  3HK0 A;  1ZM0 A;  3ULB A;  3D8D A;  1UPQ A;  2DLW A;  5HE0 A;  3T06 A;  4A6F B;  2G35 A;  4KVG B;  2LUL A;  1Y5O A;  2YSZ A;  2LOZ A;  5CLL B;  1SGH A;  1DBH A;  5JHH A;  2VSZ A;  4BBK A;  4EKU A;  1WGU A;  4K81 A;  5KQ4 A;  2COC A;  2BCJ A;  3ML4 A;  5D3V A;  2AEH A;  4EJN A;  4CHM A;  2P0H A;  2EC1 A;  4A5K A;  4GN1 A;  1U2B A;  3ODX A;  4H8S A;  1XX0 A;  1DDM A;  2V76 A;  3IVF A;  3VIA A;  4F7H A;  1BTK A;  1BAK A;  1J19 A;  1E5W A;  2YF0 A;  3TO1 A;  1FOE A;  2DTC A;  1ZC4 B;  2HE7 A;  4DXA B;  2MWN B;  1FGZ A;  1UNP A;  1X05 A;  4GXB A;  3HQC A;  3DXC A;  3KRX A;  4WVF B;  5HE1 A;  1DYN A;  1GC7 A;  2Z0Q A;  3F5R A;  2QKM A;  3PVU A;  1P5T A;  2YS3 A;  4EMO A;  3SNH A;  4TYZ A;  5D3X A;  2JP2 A;  1BTN A;  2X18 A;  3D8E A;  1DDW A;  3A98 B;  4F7G A;  3WA0 A;  4Z2N A;  1X1G A;  3SV1 A;  1GG3 A;  2LKO A;  1I2H A;  1FHO A;  4MT7 A;  4HAU B;  2COA A;  1J0W A;  4ZRI A;  2I5C A;  3KRW A;  1TJ6 A;  4MK0 A;  2D10 A;  5L81 A;  3PZD A;  1MAI A;  1V88 A;  1XD4 A;  3OAN A;  3SYX A;  2P0F A;  2ELB A;  1FHX A;  2OTX A;  2CAY A;  4C0A A;  3TW1 A;  4CHJ A;  1FAO A;  2M38 A;  2D11 A;  1NTY A;  1EVH A;  1RJ2 A;  2H7D A;  4GMV A;  5J3T A;  3SO6 A;  4F7U P;  5D3W A;  4YL8 A;  5C6R A;  2DKP A;  3D8F A;  2K00 A;  1Y19 B;  1TXD A;  1KI1 B;  2HTH B;  3KSY A;  1EAZ A;  2COF A;  4MY6 A;  2K2J A;  3G9W A;  1GC6 A;  2N0Y A;  3ZVR A;  4IAP A;  3MDB C;  1V5U A;  4HAT B;  4HHV A;  1MPH A;  2P0D A;  3ODW A;  3O96 A;  4B6H A;  3BJI A;  2RLO A;  4CYE A;  4ZRJ A;  2RVB B;  4KHA A;  1V61 A;  2DKQ A;  2R0D A;  2PZ1 A;  2J0K A;  2YS5 A;  1U5G A;  1FGY A;  1U27 A;  2AL6 A;  2ADZ A;  2CY4 A;  2Y8F A;  4GMX B;  4WSF A;  3P6A A;  3FSS A;  4K17 A;  1ZSQ A;  2I1K A;  1NU2 A;  2QKL A;  2D2Q A;  2YVC A;  3FM8 C;  3ODO A;  2ELA A;  5LOP B;  1W1H A;  2DHI A;  1B55 A;  1LW3 A;  1WGQ A;  1V89 A;  3TFM A;  4GPT B;  2W2X D;  2D9Z A;  4K2O A;  3M1I B;  2DA0 A;  1PFJ A;  2R09 A;  1MK7 B;  2RNR B;  1H4R A;  3DXD A;  5DIF B;  2LYD A;  1XOD A;  3QWM A;  3QIJ A;  5FI0 A;  1I7A A;  1ZC3 B;  1WI1 A;  1QQG A;  2LG1 A;  4HB4 B;  1Z87 A;  1TQZ A;  2GJY A;  2MFQ A;  1XR0 B;  5D27 A;  2DFK A;  2RSG A;  1P3R A;  2I1J A;  4XWX A;  2GS0 A;  1M7E A;  5HE3 A;  1N3H A;  2KGX B;  2J0J A;  2DN6 A;  2IYB A;  2GCJ A;  2W2W A;  1P6S A;  3X23 A;  3TCA A;  5CLQ B;  3CXB B;  2DHJ A;  1OQN A;  4YON A;  1KZG A;  1M7R A;  3NSU A;  3MPX A;  4PNK A;  2EMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...