3AJ4A

Crystal structure of the ph domain of evectin-2 from human complexed with o-phospho-l-serine
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
112
structure length
112
Chain Sequence
GSMAFVKSGWLLRQSTILKRWKKNWFDLWSDGHLIYYDDQTRQNIEDKVHMPMDCINIRTGQECRDTQPPDGKSKDCMLQIVCRDGKTISLCAESTDDCLAWKFTLQDSRTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pleckstrin homology domain-containing family B member 2
publication title Intracellular phosphatidylserine is essential for retrograde membrane traffic through endosomes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 31
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3aj4A00
1ZVRA 2G35A 1B55A 3WYFB 3UZTA 5C16A 4ZRJA 3PP2A 4HB4B 4F7UP 1WJMA 1DYNA 1X86A 1DDMA 1MK7B 1UNPA 5C5BA 2HTHB 2J0JA 3P6AA 3FEHA 1FHWA 4ZRIA 4PNKA 2LG1A 2UVMA 4L6EA 1FAOA 4DXAB 2J59M 1MIZB 2RVBB 1V5MA 5KQ1A 2W2XC 1W1GA 4HB3B 5JHGA 1Y5OA 3FM8C 1BWNA 4Z2NA 4ZRKA 3PVLA 1AWEA 3DXDA 2W2WA 2IYBA 2Y8FA 1SGHA 2KGXB 2CY4A 2N0YA 4Y94A 3TO1A 1M7EA 3SO6A 4GMVA 2EMTA 2K2JA 1X1GA 1XD4A 1ZC3B 2LOZA 4IAPA 3CXBB 5J3YA 4HB0B 2ELAA 2FJLA 1WJ1A 2MFQA 3HQCA 5HE1A 3SUZA 5DI9B 1WI1A 2JP2A 2EJ8A 4PQ0A 3SV1A 1DDVA 2Y7BA 3N7CA 2MDXA 1ISNA 1BAKA 5DH9B 4HDOA 3FSSA 3D8FA 3TW1A 2QKLA 2I5FA 3WA0A 4BBKA 2COCA 1WGUA 2KCJA 2D9YA 2MWNB 1J0WA 3M1IB 3SNHA 4K17A 5EFXA 5FI0A 5C6RA 4GMXB 1I7AA 2P0DA 1RJ2A 4MT7A 2D10A 1BTNA 5D3YA 1XODA 2AL6A 2OTXA 3A98B 1K5DB 2YVCA 4HHVA 3T06A 2HE7A 4HAYB 4HAXB 5C79A 1P5TA 4TKNA 3A8QA 1FGZA 3DXCA 4EMOA 1GC6A 1ZC4B 4A6HA 2DHJA 5D3VA 5JHHA 2D9WA 3GYPA 5D27A 2YS3A 1E5WA 2YT1A 4CHJA 5L81A 1FHXA 4EJNA 3KRXA 1H10A 2NZ8B 2GCLA 3AU4A 1RRPB 2UZSA 4D0NB 2BCJA 4KHOA 5FI1A 2I5CA 1IRSA 4GPTB 1WGQA 4GZUA 4K2PA 4XWXA 3ML4A 2M14A 1X05A 2EC1A 2R0DA 1X11A 2COAA 2DYQA 2W2XD 3D8EA 5D3XA 1KZ7A 4HAUB 1WG7A 4B6HA 3G9WA 5HE2A 1NTYA 1U27A 1QQGA 2XQNM 2J0MA 1ZSQA 1AQCA 3PZDA 1K5GB 2D4QA 4KHBB 3X23A 3HK0A 1Q67A 1V5PA 1P6SA 2ROZB 3PVUA 2Y8GA 1UNRA 3PEGA 1TXDA 2N23A 1W1DA 3BINA 1XKEA 1U2BA 4IFSA 2D9ZA 3D8DA 2R09A 1BTKA 3KRWA 1PFJA 2GS0A 3RCPA 4WSFA 2DYNA 5LONB 5JLJB 1MK9B 3GYOA 4DX90 5CLLB 1U29A 2LYDA 4WJ7A 1WVHA 2YS1A 1XCGA 3QBVB 1OY2A 5DHFB 1DBHA 3KSYA 3ODWA 1TJ6A 3PG7A 2D9XA 1MAIA 2EMSA 4A6FB 5JP4A 2H7DA 2VSZA 2H7EA 1UEFA 3ZDTA 1EF1A 2DX1A 3SYXA 1OQNA 3LJUX 2OQBA 2ADZA 3CIKA 1DDWA 1W1HA 4DBBA 1V89A 2I1KA 2YT0A 4HAVB 1GC7A 1J19A 4A6FA 1FOEA 4CHMA 1MPHA 2YSZA 1NU2A 3TVVA 4KAXB 2DHKA 5CLQB 2AEHA 3QIJA 2IFSA 1NI2A 4K81A 1EGXA 2GCJA 2ELBA 4K2OA 2RSGA 1KZGA 2MKRA 3IVFA 5GOWB 5C5BB 1GG3A 2Q13A 1P3RA 3O96A 1MIXA 3ODOA 4YONA 2YF0A 4GN1A 4H8SA 2KUPA 4EKUA 2ROVA 1H4RA 2L2IA 3F0WA 2DTCA 4KHAA 5LOPB 2VKIA 4F7HA 1NTVA 4F7GA 1Y19B 2LULA 2V76A 4KVGB 2P8VA 3KY9A 1U5DA 5KQ4A 2D2QA 4MY6A 3HW2B 1FHOA 2DA0A 3ULBA 1LB1A 1N3HA 3VIAA 1XX0A 2DKPA 2GJYA 2P0FA 4HAZB 2D9VA 4MK0A 2DLWA 1U5GA 2PZ1A 5HE0A 1FGYA 1UNQA 4YL8A 4NSWA 3U8ZA 4GXBA 3V5WA 2YS5A 1OMWA 2D11A 5D3WA 4A5KA 3KZ1A 1PLSA 3VOQA 1M7RA 3AJ4A 3U7DA 4DX8A 5J3TA 3MPXA 3ULCA 1SHCA 1V61A 2Z0QA 4HDQA 1EAZA 2Z0PA 3ODXA 1MKEA 1V88A 2LKOA 3OANA 4HAWB 2UZRA 4P7IA 2LOXA 2P0HA 4HATB 3ZVRA 3A8PA 1QC6A 2K00A 3BJIA 3F5RA 2CRFA 4WVFB 1KI1B 1I2HA 4C0AA 2RGNB 2DFKA 4TYZA 3P7ZA 1V5UA 2DHIA 2Z0OA 5DHAB 3MDBC 1U5FA 1XR0B 3PVWA 1UPQA 1LW3A 3QWMA 1UPRA 2RNRB 1EVHA 2CAYA 2QKMA 2COFA 1X1FA 5DIFB 2DKQA 4HB2B 3AU5A 1PMSA 2J0KA 2I1JA 4Z2MB 2M38A 1DROA 1TQZA 2E2XA 2CODA 2K2UA 2RLOA 2CY5A 3PSCA 4A6KA 1U5EA 2RUKB 1Z87A 1ZM0A 2YRYA 4CYEA 5HE3A 5J3QA 2X18A 3DXEA 2DN6A 3NSUA 3TCAA 1FB8A 3TFMA 2DX5A 5KCVA 2ZPYA 4IOYX 2VRWB 4NY0A 2NMBA 2L1CA
chains in the Genus database with same CATH superfamily
1ZVRA 2G35A 1B55A 3WYFB 3UZTA 5C16A 4ZRJA 3PP2A 4HB4B 4F7UP 1WJMA 1DYNA 3FVCA 1X86A 1DDMA 1MK7B 4HSIA 1UNPA 5C5BA 2HTHB 2J0JA 3P6AA 3FEHA 1FHWA 4ZRIA 4PNKA 5M4YB 2LG1A 2UVMA 4L6EA 1FAOA 4DXAB 2J59M 3B77A 1MIZB 2RVBB 1V5MA 5KQ1A 2W2XC 1W1GA 4HB3B 5JHGA 1Y5OA 3FM8C 2K8EA 1BWNA 4Z2NA 4ZRKA 3PVLA 1AWEA 3DXDA 2W2WA 2IYBA 2Y8FA 1SGHA 2KGXB 2CY4A 2N0YA 4Y94A 3TO1A 1M7EA 3SO6A 2KIEA 4GMVA 2EMTA 2K2JA 1X1GA 1XD4A 4L1RA 1ZC3B 2LOZA 4IAPA 3CXBB 5J3YA 4HB0B 2ELAA 2FJLA 1WJ1A 2MFQA 3HQCA 5HE1A 3SUZA 5DI9B 1WI1A 2JP2A 2EJ8A 4PQ0A 3SV1A 3OHMB 1DDVA 2Y7BA 3N7CA 2MDXA 4QJ4B 1ISNA 1BAKA 5DH9B 4HDOA 3FSSA 3D8FA 3TW1A 2QKLA 2I5FA 1ZYIA 3WA0A 4BBKA 2COCA 1WGUA 2KCJA 2D9YA 2MWNB 1J0WA 2GUMA 3M1IB 3SNHA 4K17A 1MI1A 5EFXA 5FI0A 5C6RA 4GMXB 3NW8A 1I7AA 2P0DA 1RJ2A 2Z59A 4MT7A 5LG4B 2D10A 1BTNA 5D3YA 4QXAB 1XODA 2AL6A 2NBVA 2OTXA 2KR0A 3A98B 1K5DB 2YVCA 4HHVA 3HIEA 3T06A 2HE7A 4HAYB 4HAXB 5C79A 1P5TA 4TKNA 3A8QA 1FGZA 3DXCA 4EMOA 4QJ3B 1GC6A 1ZC4B 4A6HA 2DHJA 5D3VA 5JHHA 2D9WA 3GYPA 5D27A 2YS3A 1E5WA 2YT1A 4CHJA 5L81A 1FHXA 4EJNA 3NWDA 3KRXA 1H10A 2NZ8B 2GCLA 3AU4A 1RRPB 2UZSA 4D0NB 2BCJA 4KHOA 5FI1A 2I5CA 1IRSA 4GPTB 1WGQA 4GZUA 4K2PA 4XWXA 3ML4A 2M14A 3NWAA 1X05A 2EC1A 2R0DA 1X11A 2COAA 2DYQA 2W2XD 3D8EA 5D3XA 1KZ7A 4HAUB 1WG7A 4B6HA 3G9WA 5IRSA 5HE2A 1NTYA 1U27A 1QQGA 2XQNM 2J0MA 1ZSQA 1AQCA 3PZDA 1K5GB 2D4QA 4KHBB 3X23A 3HK0A 1Q67A 1V5PA 5I2SA 1P6SA 2ROZB 3PVUA 2Y8GA 1UNRA 3PEGA 1TXDA 2N23A 1W1DA 3BINA 1XKEA 1U2BA 4IFSA 2D9ZA 3NWFA 3A58A 3D8DA 2R09A 1BTKA 3KRWA 1PFJA 2GS0A 3RCPA 4WSFA 2DYNA 2R2YA 5LONB 5JLJB 2Z14A 1MK9B 3GYOA 4DX90 5CLLB 1U29A 2LYDA 4WJ7A 1WVHA 2YS1A 1XCGA 3QBVB 1OY2A 5DHFB 1DBHA 3KSYA 2K49A 3ODWA 1TJ6A 3PG7A 2D9XA 1MAIA 2EMSA 4A6FB 5JP4A 2H7DA 2VSZA 2H7EA 1UEFA 3ZDTA 2ZKMX 1EF1A 2DX1A 3SYXA 1OQNA 3LJUX 2OQBA 2ADZA 3CIKA 1DDWA 1W1HA 4DBBA 1V89A 2I1KA 2YT0A 4D6WA 4HAVB 1GC7A 2KUQA 1J19A 4A6FA 1FOEA 4CHMA 1MPHA 2YSZA 1NU2A 3TVVA 4KAXB 2DHKA 5CLQB 2AEHA 3QIJA 2IFSA 1NI2A 4K81A 1EGXA 2GCJA 3DCXA 3U12A 2ELBA 4K2OA 2RSGA 1KZGA 2MKRA 3IVFA 5GOWB 3HSAA 4OT1A 5C5BB 1GG3A 2Q13A 1P3RA 3O96A 1MIXA 3ODOA 2RRFA 4YONA 2YF0A 4GN1A 4H8SA 2KUPA 4EKUA 2ROVA 1H4RA 4QJ5B 2L2IA 3F0WA 2DTCA 4KHAA 5LOPB 2VKIA 4F7HA 1NTVA 4F7GA 1Y19B 2LULA 2V76A 4KVGB 2P8VA 3KY9A 1U5DA 2KIGA 5KQ4A 2D2QA 4MY6A 3HW2B 1FHOA 2DA0A 3ULBA 1LB1A 1N3HA 3VIAA 1XX0A 2DKPA 2GJYA 2P0FA 4HAZB 2D9VA 4MK0A 2DLWA 1U5GA 2PZ1A 5HE0A 1FGYA 1UNQA 4YL8A 4NSWA 3U8ZA 4GXBA 3V5WA 2YS5A 1OMWA 2D11A 2Z4DA 5D3WA 4A5KA 3KZ1A 2Z13A 1PLSA 3VOQA 1M7RA 4OSNA 3AJ4A 3U7DA 2FJUB 4DX8A 5J3TA 4KHBA 3MPXA 3ULCA 1SHCA 1V61A 2Z0QA 4HDQA 1EAZA 2Z0PA 3ODXA 1MKEA 1V88A 2LKOA 3OANA 4HAWB 2UZRA 4P7IA 2LOXA 2P0HA 4HATB 3ZVRA 3A8PA 1QC6A 2K00A 3BJIA 3F5RA 2CRFA 4WVFB 1KI1B 1I2HA 4C0AA 2RGNB 2DFKA 4TYZA 3P7ZA 1V5UA 2DHIA 2Z0OA 5DHAB 3MDBC 1U5FA 1XR0B 3PVWA 1UPQA 4GNKB 1LW3A 2YT2A 3QWMA 1UPRA 2RNRB 1EVHA 2CAYA 2QKMA 2COFA 1X1FA 5DIFB 2DKQA 4HB2B 3AU5A 1PMSA 2J0KA 2I1JA 4Z2MB 2M38A 1DROA 1TQZA 2E2XA 2CODA 2K2UA 4DIXA 2RLOA 1T77A 2CY5A 3PSCA 4A6KA 1U5EA 2RUKB 4GOUA 1Z87A 1ZM0A 2YRYA 4CYEA 5HE3A 5J3QA 2X18A 3DXEA 2DN6A 3NSUA 3TCAA 1FB8A 3TFMA 2DX5A 5KCVA 2ZPYA 4CSQA 5I2MA 4IOYX 2VRWB 4NY0A 2NMBA 2L1CA
chains in the Genus database with same CATH topology
1ZVRA 2G35A 1B55A 3WYFB 3UZTA 5C16A 4ZRJA 3PP2A 4HB4B 4F7UP 1WJMA 1DYNA 1X86A 1DDMA 1MK7B 1UNPA 5C5BA 2HTHB 2J0JA 3P6AA 3FEHA 1FHWA 4ZRIA 4PNKA 2LG1A 2UVMA 4L6EA 1FAOA 4DXAB 2J59M 1MIZB 2RVBB 1V5MA 5KQ1A 2W2XC 1W1GA 4HB3B 5JHGA 1Y5OA 3FM8C 1BWNA 4Z2NA 4ZRKA 3PVLA 1AWEA 3DXDA 2W2WA 2IYBA 2Y8FA 1SGHA 2KGXB 2CY4A 2N0YA 4Y94A 3TO1A 1M7EA 3SO6A 4GMVA 2EMTA 2K2JA 1X1GA 1XD4A 1ZC3B 2LOZA 4IAPA 3CXBB 5J3YA 4HB0B 2ELAA 2FJLA 1WJ1A 2MFQA 3HQCA 5HE1A 3SUZA 5DI9B 1WI1A 2JP2A 2EJ8A 4PQ0A 3SV1A 1DDVA 2Y7BA 3N7CA 2MDXA 1ISNA 1BAKA 5DH9B 4HDOA 3FSSA 3D8FA 3TW1A 2QKLA 2I5FA 3WA0A 4BBKA 2COCA 1WGUA 2KCJA 2D9YA 2MWNB 1J0WA 3M1IB 3SNHA 4K17A 5EFXA 5FI0A 5C6RA 4GMXB 1I7AA 2P0DA 1RJ2A 4MT7A 2D10A 1BTNA 5D3YA 1XODA 2AL6A 2OTXA 3A98B 1K5DB 2YVCA 4HHVA 3T06A 2HE7A 4HAYB 4HAXB 5C79A 1P5TA 4TKNA 3A8QA 1FGZA 3DXCA 4EMOA 1GC6A 1ZC4B 4A6HA 2DHJA 5D3VA 5JHHA 2D9WA 3GYPA 5D27A 2YS3A 1E5WA 2YT1A 4CHJA 5L81A 1FHXA 4EJNA 3KRXA 1H10A 2NZ8B 2GCLA 3AU4A 1RRPB 2UZSA 4D0NB 2BCJA 4KHOA 5FI1A 2I5CA 1IRSA 4GPTB 1WGQA 4GZUA 4K2PA 4XWXA 3ML4A 2M14A 1X05A 2EC1A 2R0DA 1X11A 2COAA 2DYQA 2W2XD 3D8EA 5D3XA 1KZ7A 4HAUB 1WG7A 4B6HA 3G9WA 5HE2A 1NTYA 1U27A 1QQGA 2XQNM 2J0MA 1ZSQA 1AQCA 3PZDA 1K5GB 2D4QA 4KHBB 3X23A 3HK0A 1Q67A 1V5PA 1P6SA 2ROZB 3PVUA 2Y8GA 1UNRA 3PEGA 1TXDA 2N23A 1W1DA 3BINA 1XKEA 1U2BA 4IFSA 2D9ZA 3D8DA 2R09A 1BTKA 3KRWA 1PFJA 2GS0A 3RCPA 4WSFA 2DYNA 5LONB 5JLJB 1MK9B 3GYOA 4DX90 5CLLB 1U29A 2LYDA 4WJ7A 1WVHA 2YS1A 1XCGA 3QBVB 1OY2A 5DHFB 1DBHA 3KSYA 3ODWA 1TJ6A 3PG7A 2D9XA 1MAIA 2EMSA 4A6FB 5JP4A 2H7DA 2VSZA 2H7EA 1UEFA 3ZDTA 1EF1A 2DX1A 3SYXA 1OQNA 3LJUX 2OQBA 2ADZA 3CIKA 1DDWA 1W1HA 4DBBA 1V89A 2I1KA 2YT0A 4HAVB 1GC7A 1J19A 4A6FA 1FOEA 4CHMA 1MPHA 2YSZA 1NU2A 3TVVA 4KAXB 2DHKA 5CLQB 2AEHA 3QIJA 2IFSA 1NI2A 4K81A 1EGXA 2GCJA 2ELBA 4K2OA 2RSGA 1KZGA 2MKRA 3IVFA 5GOWB 5C5BB 1GG3A 2Q13A 1P3RA 3O96A 1MIXA 3ODOA 4YONA 2YF0A 4GN1A 4H8SA 2KUPA 4EKUA 2ROVA 1H4RA 2L2IA 3F0WA 2DTCA 4KHAA 5LOPB 2VKIA 4F7HA 1NTVA 4F7GA 1Y19B 2LULA 2V76A 4KVGB 2P8VA 3KY9A 1U5DA 5KQ4A 2D2QA 4MY6A 3HW2B 1FHOA 2DA0A 3ULBA 1LB1A 1N3HA 3VIAA 1XX0A 2DKPA 2GJYA 2P0FA 4HAZB 2D9VA 4MK0A 2DLWA 1U5GA 2PZ1A 5HE0A 1FGYA 1UNQA 4YL8A 4NSWA 3U8ZA 4GXBA 3V5WA 2YS5A 1OMWA 2D11A 5D3WA 4A5KA 3KZ1A 1PLSA 3VOQA 1M7RA 3AJ4A 3U7DA 4DX8A 5J3TA 3MPXA 3ULCA 1SHCA 1V61A 2Z0QA 4HDQA 1EAZA 2Z0PA 3ODXA 1MKEA 1V88A 2LKOA 3OANA 4HAWB 2UZRA 4P7IA 2LOXA 2P0HA 4HATB 3ZVRA 3A8PA 1QC6A 2K00A 3BJIA 3F5RA 2CRFA 4WVFB 1KI1B 1I2HA 4C0AA 2RGNB 2DFKA 4TYZA 3P7ZA 1V5UA 2DHIA 2Z0OA 5DHAB 3MDBC 1U5FA 1XR0B 3PVWA 1UPQA 1LW3A 3QWMA 1UPRA 2RNRB 1EVHA 2CAYA 2QKMA 2COFA 1X1FA 5DIFB 2DKQA 4HB2B 3AU5A 1PMSA 2J0KA 2I1JA 4Z2MB 2M38A 1DROA 1TQZA 2E2XA 2CODA 2K2UA 2RLOA 2CY5A 3PSCA 4A6KA 1U5EA 2RUKB 1Z87A 1ZM0A 2YRYA 4CYEA 5HE3A 5J3QA 2X18A 3DXEA 2DN6A 3NSUA 3TCAA 1FB8A 3TFMA 2DX5A 5KCVA 2ZPYA 4IOYX 2VRWB 4NY0A 2NMBA 2L1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZVR A;  2G35 A;  1B55 A;  3WYF B;  3UZT A;  5C16 A;  4ZRJ A;  3PP2 A;  4HB4 B;  4F7U P;  1WJM A;  1DYN A;  1X86 A;  1DDM A;  1MK7 B;  1UNP A;  5C5B A;  2HTH B;  2J0J A;  3P6A A;  3FEH A;  1FHW A;  4ZRI A;  4PNK A;  2LG1 A;  2UVM A;  4L6E A;  1FAO A;  4DXA B;  2J59 M;  1MIZ B;  2RVB B;  1V5M A;  5KQ1 A;  2W2X C;  1W1G A;  4HB3 B;  5JHG A;  1Y5O A;  3FM8 C;  1BWN A;  4Z2N A;  4ZRK A;  3PVL A;  1AWE A;  3DXD A;  2W2W A;  2IYB A;  2Y8F A;  1SGH A;  2KGX B;  2CY4 A;  2N0Y A;  4Y94 A;  3TO1 A;  1M7E A;  3SO6 A;  4GMV A;  2EMT A;  2K2J A;  1X1G A;  1XD4 A;  1ZC3 B;  2LOZ A;  4IAP A;  3CXB B;  5J3Y A;  4HB0 B;  2ELA A;  2FJL A;  1WJ1 A;  2MFQ A;  3HQC A;  5HE1 A;  3SUZ A;  5DI9 B;  1WI1 A;  2JP2 A;  2EJ8 A;  4PQ0 A;  3SV1 A;  1DDV A;  2Y7B A;  3N7C A;  2MDX A;  1ISN A;  1BAK A;  5DH9 B;  4HDO A;  3FSS A;  3D8F A;  3TW1 A;  2QKL A;  2I5F A;  3WA0 A;  4BBK A;  2COC A;  1WGU A;  2KCJ A;  2D9Y A;  2MWN B;  1J0W A;  3M1I B;  3SNH A;  4K17 A;  5EFX A;  5FI0 A;  5C6R A;  4GMX B;  1I7A A;  2P0D A;  1RJ2 A;  4MT7 A;  2D10 A;  1BTN A;  5D3Y A;  1XOD A;  2AL6 A;  2OTX A;  3A98 B;  1K5D B;  2YVC A;  4HHV A;  3T06 A;  2HE7 A;  4HAY B;  4HAX B;  5C79 A;  1P5T A;  4TKN A;  3A8Q A;  1FGZ A;  3DXC A;  4EMO A;  1GC6 A;  1ZC4 B;  4A6H A;  2DHJ A;  5D3V A;  5JHH A;  2D9W A;  3GYP A;  5D27 A;  2YS3 A;  1E5W A;  2YT1 A;  4CHJ A;  5L81 A;  1FHX A;  4EJN A;  3KRX A;  1H10 A;  2NZ8 B;  2GCL A;  3AU4 A;  1RRP B;  2UZS A;  4D0N B;  2BCJ A;  4KHO A;  5FI1 A;  2I5C A;  1IRS A;  4GPT B;  1WGQ A;  4GZU A;  4K2P A;  4XWX A;  3ML4 A;  2M14 A;  1X05 A;  2EC1 A;  2R0D A;  1X11 A;  2COA A;  2DYQ A;  2W2X D;  3D8E A;  5D3X A;  1KZ7 A;  4HAU B;  1WG7 A;  4B6H A;  3G9W A;  5HE2 A;  1NTY A;  1U27 A;  1QQG A;  2XQN M;  2J0M A;  1ZSQ A;  1AQC A;  3PZD A;  1K5G B;  2D4Q A;  4KHB B;  3X23 A;  3HK0 A;  1Q67 A;  1V5P A;  1P6S A;  2ROZ B;  3PVU A;  2Y8G A;  1UNR A;  3PEG A;  1TXD A;  2N23 A;  1W1D A;  3BIN A;  1XKE A;  1U2B A;  4IFS A;  2D9Z A;  3D8D A;  2R09 A;  1BTK A;  3KRW A;  1PFJ A;  2GS0 A;  3RCP A;  4WSF A;  2DYN A;  5LON B;  5JLJ B;  1MK9 B;  3GYO A;  4DX9 0;  5CLL B;  1U29 A;  2LYD A;  4WJ7 A;  1WVH A;  2YS1 A;  1XCG A;  3QBV B;  1OY2 A;  5DHF B;  1DBH A;  3KSY A;  3ODW A;  1TJ6 A;  3PG7 A;  2D9X A;  1MAI A;  2EMS A;  4A6F B;  5JP4 A;  2H7D A;  2VSZ A;  2H7E A;  1UEF A;  3ZDT A;  1EF1 A;  2DX1 A;  3SYX A;  1OQN A;  3LJU X;  2OQB A;  2ADZ A;  3CIK A;  1DDW A;  1W1H A;  4DBB A;  1V89 A;  2I1K A;  2YT0 A;  4HAV B;  1GC7 A;  1J19 A;  4A6F A;  1FOE A;  4CHM A;  1MPH A;  2YSZ A;  1NU2 A;  3TVV A;  4KAX B;  2DHK A;  5CLQ B;  2AEH A;  3QIJ A;  2IFS A;  1NI2 A;  4K81 A;  1EGX A;  2GCJ A;  2ELB A;  4K2O A;  2RSG A;  1KZG A;  2MKR A;  3IVF A;  5GOW B;  5C5B B;  1GG3 A;  2Q13 A;  1P3R A;  3O96 A;  1MIX A;  3ODO A;  4YON A;  2YF0 A;  4GN1 A;  4H8S A;  2KUP A;  4EKU A;  2ROV A;  1H4R A;  2L2I A;  3F0W A;  2DTC A;  4KHA A;  5LOP B;  2VKI A;  4F7H A;  1NTV A;  4F7G A;  1Y19 B;  2LUL A;  2V76 A;  4KVG B;  2P8V A;  3KY9 A;  1U5D A;  5KQ4 A;  2D2Q A;  4MY6 A;  3HW2 B;  1FHO A;  2DA0 A;  3ULB A;  1LB1 A;  1N3H A;  3VIA A;  1XX0 A;  2DKP A;  2GJY A;  2P0F A;  4HAZ B;  2D9V A;  4MK0 A;  2DLW A;  1U5G A;  2PZ1 A;  5HE0 A;  1FGY A;  1UNQ A;  4YL8 A;  4NSW A;  3U8Z A;  4GXB A;  3V5W A;  2YS5 A;  1OMW A;  2D11 A;  5D3W A;  4A5K A;  3KZ1 A;  1PLS A;  3VOQ A;  1M7R A;  3AJ4 A;  3U7D A;  4DX8 A;  5J3T A;  3MPX A;  3ULC A;  1SHC A;  1V61 A;  2Z0Q A;  4HDQ A;  1EAZ A;  2Z0P A;  3ODX A;  1MKE A;  1V88 A;  2LKO A;  3OAN A;  4HAW B;  2UZR A;  4P7I A;  2LOX A;  2P0H A;  4HAT B;  3ZVR A;  3A8P A;  1QC6 A;  2K00 A;  3BJI A;  3F5R A;  2CRF A;  4WVF B;  1KI1 B;  1I2H A;  4C0A A;  2RGN B;  2DFK A;  4TYZ A;  3P7Z A;  1V5U A;  2DHI A;  2Z0O A;  5DHA B;  3MDB C;  1U5F A;  1XR0 B;  3PVW A;  1UPQ A;  1LW3 A;  3QWM A;  1UPR A;  2RNR B;  1EVH A;  2CAY A;  2QKM A;  2COF A;  1X1F A;  5DIF B;  2DKQ A;  4HB2 B;  3AU5 A;  1PMS A;  2J0K A;  2I1J A;  4Z2M B;  2M38 A;  1DRO A;  1TQZ A;  2E2X A;  2COD A;  2K2U A;  2RLO A;  2CY5 A;  3PSC A;  4A6K A;  1U5E A;  2RUK B;  1Z87 A;  1ZM0 A;  2YRY A;  4CYE A;  5HE3 A;  5J3Q A;  2X18 A;  3DXE A;  2DN6 A;  3NSU A;  3TCA A;  1FB8 A;  3TFM A;  2DX5 A;  5KCV A;  2ZPY A;  4IOY X;  2VRW B;  4NY0 A;  2NMB A;  2L1C A; 
#chains in the Genus database with same CATH topology
 1ZVR A;  2G35 A;  1B55 A;  3WYF B;  3UZT A;  5C16 A;  4ZRJ A;  3PP2 A;  4HB4 B;  4F7U P;  1WJM A;  1DYN A;  3FVC A;  1X86 A;  1DDM A;  1MK7 B;  4HSI A;  1UNP A;  5C5B A;  2HTH B;  2J0J A;  3P6A A;  3FEH A;  1FHW A;  4ZRI A;  4PNK A;  5M4Y B;  2LG1 A;  2UVM A;  4L6E A;  1FAO A;  4DXA B;  2J59 M;  3B77 A;  1MIZ B;  2RVB B;  1V5M A;  5KQ1 A;  2W2X C;  1W1G A;  4HB3 B;  5JHG A;  1Y5O A;  3FM8 C;  2K8E A;  1BWN A;  4Z2N A;  4ZRK A;  3PVL A;  1AWE A;  3DXD A;  2W2W A;  2IYB A;  2Y8F A;  1SGH A;  2KGX B;  2CY4 A;  2N0Y A;  4Y94 A;  3TO1 A;  1M7E A;  3SO6 A;  2KIE A;  4GMV A;  2EMT A;  2K2J A;  1X1G A;  1XD4 A;  4L1R A;  1ZC3 B;  2LOZ A;  4IAP A;  3CXB B;  5J3Y A;  4HB0 B;  2ELA A;  2FJL A;  1WJ1 A;  2MFQ A;  3HQC A;  5HE1 A;  3SUZ A;  5DI9 B;  1WI1 A;  2JP2 A;  2EJ8 A;  4PQ0 A;  3SV1 A;  3OHM B;  1DDV A;  2Y7B A;  3N7C A;  2MDX A;  4QJ4 B;  1ISN A;  1BAK A;  5DH9 B;  4HDO A;  3FSS A;  3D8F A;  3TW1 A;  2QKL A;  2I5F A;  1ZYI A;  3WA0 A;  4BBK A;  2COC A;  1WGU A;  2KCJ A;  2D9Y A;  2MWN B;  1J0W A;  2GUM A;  3M1I B;  3SNH A;  4K17 A;  1MI1 A;  5EFX A;  5FI0 A;  5C6R A;  4GMX B;  3NW8 A;  1I7A A;  2P0D A;  1RJ2 A;  2Z59 A;  4MT7 A;  5LG4 B;  2D10 A;  1BTN A;  5D3Y A;  4QXA B;  1XOD A;  2AL6 A;  2NBV A;  2OTX A;  2KR0 A;  3A98 B;  1K5D B;  2YVC A;  4HHV A;  3HIE A;  3T06 A;  2HE7 A;  4HAY B;  4HAX B;  5C79 A;  1P5T A;  4TKN A;  3A8Q A;  1FGZ A;  3DXC A;  4EMO A;  4QJ3 B;  1GC6 A;  1ZC4 B;  4A6H A;  2DHJ A;  5D3V A;  5JHH A;  2D9W A;  3GYP A;  5D27 A;  2YS3 A;  1E5W A;  2YT1 A;  4CHJ A;  5L81 A;  1FHX A;  4EJN A;  3NWD A;  3KRX A;  1H10 A;  2NZ8 B;  2GCL A;  3AU4 A;  1RRP B;  2UZS A;  4D0N B;  2BCJ A;  4KHO A;  5FI1 A;  2I5C A;  1IRS A;  4GPT B;  1WGQ A;  4GZU A;  4K2P A;  4XWX A;  3ML4 A;  2M14 A;  3NWA A;  1X05 A;  2EC1 A;  2R0D A;  1X11 A;  2COA A;  2DYQ A;  2W2X D;  3D8E A;  5D3X A;  1KZ7 A;  4HAU B;  1WG7 A;  4B6H A;  3G9W A;  5IRS A;  5HE2 A;  1NTY A;  1U27 A;  1QQG A;  2XQN M;  2J0M A;  1ZSQ A;  1AQC A;  3PZD A;  1K5G B;  2D4Q A;  4KHB B;  3X23 A;  3HK0 A;  1Q67 A;  1V5P A;  5I2S A;  1P6S A;  2ROZ B;  3PVU A;  2Y8G A;  1UNR A;  3PEG A;  1TXD A;  2N23 A;  1W1D A;  3BIN A;  1XKE A;  1U2B A;  4IFS A;  2D9Z A;  3NWF A;  3A58 A;  3D8D A;  2R09 A;  1BTK A;  3KRW A;  1PFJ A;  2GS0 A;  3RCP A;  4WSF A;  2DYN A;  2R2Y A;  5LON B;  5JLJ B;  2Z14 A;  1MK9 B;  3GYO A;  4DX9 0;  5CLL B;  1U29 A;  2LYD A;  4WJ7 A;  1WVH A;  2YS1 A;  1XCG A;  3QBV B;  1OY2 A;  5DHF B;  1DBH A;  3KSY A;  2K49 A;  3ODW A;  1TJ6 A;  3PG7 A;  2D9X A;  1MAI A;  2EMS A;  4A6F B;  5JP4 A;  2H7D A;  2VSZ A;  2H7E A;  1UEF A;  3ZDT A;  2ZKM X;  1EF1 A;  2DX1 A;  3SYX A;  1OQN A;  3LJU X;  2OQB A;  2ADZ A;  3CIK A;  1DDW A;  1W1H A;  4DBB A;  1V89 A;  2I1K A;  2YT0 A;  4D6W A;  4HAV B;  1GC7 A;  2KUQ A;  1J19 A;  4A6F A;  1FOE A;  4CHM A;  1MPH A;  2YSZ A;  1NU2 A;  3TVV A;  4KAX B;  2DHK A;  5CLQ B;  2AEH A;  3QIJ A;  2IFS A;  1NI2 A;  4K81 A;  1EGX A;  2GCJ A;  3DCX A;  3U12 A;  2ELB A;  4K2O A;  2RSG A;  1KZG A;  2MKR A;  3IVF A;  5GOW B;  3HSA A;  4OT1 A;  5C5B B;  1GG3 A;  2Q13 A;  1P3R A;  3O96 A;  1MIX A;  3ODO A;  2RRF A;  4YON A;  2YF0 A;  4GN1 A;  4H8S A;  2KUP A;  4EKU A;  2ROV A;  1H4R A;  4QJ5 B;  2L2I A;  3F0W A;  2DTC A;  4KHA A;  5LOP B;  2VKI A;  4F7H A;  1NTV A;  4F7G A;  1Y19 B;  2LUL A;  2V76 A;  4KVG B;  2P8V A;  3KY9 A;  1U5D A;  2KIG A;  5KQ4 A;  2D2Q A;  4MY6 A;  3HW2 B;  1FHO A;  2DA0 A;  3ULB A;  1LB1 A;  1N3H A;  3VIA A;  1XX0 A;  2DKP A;  2GJY A;  2P0F A;  4HAZ B;  2D9V A;  4MK0 A;  2DLW A;  1U5G A;  2PZ1 A;  5HE0 A;  1FGY A;  1UNQ A;  4YL8 A;  4NSW A;  3U8Z A;  4GXB A;  3V5W A;  2YS5 A;  1OMW A;  2D11 A;  2Z4D A;  5D3W A;  4A5K A;  3KZ1 A;  2Z13 A;  1PLS A;  3VOQ A;  1M7R A;  4OSN A;  3AJ4 A;  3U7D A;  2FJU B;  4DX8 A;  5J3T A;  4KHB A;  3MPX A;  3ULC A;  1SHC A;  1V61 A;  2Z0Q A;  4HDQ A;  1EAZ A;  2Z0P A;  3ODX A;  1MKE A;  1V88 A;  2LKO A;  3OAN A;  4HAW B;  2UZR A;  4P7I A;  2LOX A;  2P0H A;  4HAT B;  3ZVR A;  3A8P A;  1QC6 A;  2K00 A;  3BJI A;  3F5R A;  2CRF A;  4WVF B;  1KI1 B;  1I2H A;  4C0A A;  2RGN B;  2DFK A;  4TYZ A;  3P7Z A;  1V5U A;  2DHI A;  2Z0O A;  5DHA B;  3MDB C;  1U5F A;  1XR0 B;  3PVW A;  1UPQ A;  4GNK B;  1LW3 A;  2YT2 A;  3QWM A;  1UPR A;  2RNR B;  1EVH A;  2CAY A;  2QKM A;  2COF A;  1X1F A;  5DIF B;  2DKQ A;  4HB2 B;  3AU5 A;  1PMS A;  2J0K A;  2I1J A;  4Z2M B;  2M38 A;  1DRO A;  1TQZ A;  2E2X A;  2COD A;  2K2U A;  4DIX A;  2RLO A;  1T77 A;  2CY5 A;  3PSC A;  4A6K A;  1U5E A;  2RUK B;  4GOU A;  1Z87 A;  1ZM0 A;  2YRY A;  4CYE A;  5HE3 A;  5J3Q A;  2X18 A;  3DXE A;  2DN6 A;  3NSU A;  3TCA A;  1FB8 A;  3TFM A;  2DX5 A;  5KCV A;  2ZPY A;  4CSQ A;  5I2M A;  4IOY X;  2VRW B;  4NY0 A;  2NMB A;  2L1C A; 
#chains in the Genus database with same CATH homology
 1ZVR A;  2G35 A;  1B55 A;  3WYF B;  3UZT A;  5C16 A;  4ZRJ A;  3PP2 A;  4HB4 B;  4F7U P;  1WJM A;  1DYN A;  1X86 A;  1DDM A;  1MK7 B;  1UNP A;  5C5B A;  2HTH B;  2J0J A;  3P6A A;  3FEH A;  1FHW A;  4ZRI A;  4PNK A;  2LG1 A;  2UVM A;  4L6E A;  1FAO A;  4DXA B;  2J59 M;  1MIZ B;  2RVB B;  1V5M A;  5KQ1 A;  2W2X C;  1W1G A;  4HB3 B;  5JHG A;  1Y5O A;  3FM8 C;  1BWN A;  4Z2N A;  4ZRK A;  3PVL A;  1AWE A;  3DXD A;  2W2W A;  2IYB A;  2Y8F A;  1SGH A;  2KGX B;  2CY4 A;  2N0Y A;  4Y94 A;  3TO1 A;  1M7E A;  3SO6 A;  4GMV A;  2EMT A;  2K2J A;  1X1G A;  1XD4 A;  1ZC3 B;  2LOZ A;  4IAP A;  3CXB B;  5J3Y A;  4HB0 B;  2ELA A;  2FJL A;  1WJ1 A;  2MFQ A;  3HQC A;  5HE1 A;  3SUZ A;  5DI9 B;  1WI1 A;  2JP2 A;  2EJ8 A;  4PQ0 A;  3SV1 A;  1DDV A;  2Y7B A;  3N7C A;  2MDX A;  1ISN A;  1BAK A;  5DH9 B;  4HDO A;  3FSS A;  3D8F A;  3TW1 A;  2QKL A;  2I5F A;  3WA0 A;  4BBK A;  2COC A;  1WGU A;  2KCJ A;  2D9Y A;  2MWN B;  1J0W A;  3M1I B;  3SNH A;  4K17 A;  5EFX A;  5FI0 A;  5C6R A;  4GMX B;  1I7A A;  2P0D A;  1RJ2 A;  4MT7 A;  2D10 A;  1BTN A;  5D3Y A;  1XOD A;  2AL6 A;  2OTX A;  3A98 B;  1K5D B;  2YVC A;  4HHV A;  3T06 A;  2HE7 A;  4HAY B;  4HAX B;  5C79 A;  1P5T A;  4TKN A;  3A8Q A;  1FGZ A;  3DXC A;  4EMO A;  1GC6 A;  1ZC4 B;  4A6H A;  2DHJ A;  5D3V A;  5JHH A;  2D9W A;  3GYP A;  5D27 A;  2YS3 A;  1E5W A;  2YT1 A;  4CHJ A;  5L81 A;  1FHX A;  4EJN A;  3KRX A;  1H10 A;  2NZ8 B;  2GCL A;  3AU4 A;  1RRP B;  2UZS A;  4D0N B;  2BCJ A;  4KHO A;  5FI1 A;  2I5C A;  1IRS A;  4GPT B;  1WGQ A;  4GZU A;  4K2P A;  4XWX A;  3ML4 A;  2M14 A;  1X05 A;  2EC1 A;  2R0D A;  1X11 A;  2COA A;  2DYQ A;  2W2X D;  3D8E A;  5D3X A;  1KZ7 A;  4HAU B;  1WG7 A;  4B6H A;  3G9W A;  5HE2 A;  1NTY A;  1U27 A;  1QQG A;  2XQN M;  2J0M A;  1ZSQ A;  1AQC A;  3PZD A;  1K5G B;  2D4Q A;  4KHB B;  3X23 A;  3HK0 A;  1Q67 A;  1V5P A;  1P6S A;  2ROZ B;  3PVU A;  2Y8G A;  1UNR A;  3PEG A;  1TXD A;  2N23 A;  1W1D A;  3BIN A;  1XKE A;  1U2B A;  4IFS A;  2D9Z A;  3D8D A;  2R09 A;  1BTK A;  3KRW A;  1PFJ A;  2GS0 A;  3RCP A;  4WSF A;  2DYN A;  5LON B;  5JLJ B;  1MK9 B;  3GYO A;  4DX9 0;  5CLL B;  1U29 A;  2LYD A;  4WJ7 A;  1WVH A;  2YS1 A;  1XCG A;  3QBV B;  1OY2 A;  5DHF B;  1DBH A;  3KSY A;  3ODW A;  1TJ6 A;  3PG7 A;  2D9X A;  1MAI A;  2EMS A;  4A6F B;  5JP4 A;  2H7D A;  2VSZ A;  2H7E A;  1UEF A;  3ZDT A;  1EF1 A;  2DX1 A;  3SYX A;  1OQN A;  3LJU X;  2OQB A;  2ADZ A;  3CIK A;  1DDW A;  1W1H A;  4DBB A;  1V89 A;  2I1K A;  2YT0 A;  4HAV B;  1GC7 A;  1J19 A;  4A6F A;  1FOE A;  4CHM A;  1MPH A;  2YSZ A;  1NU2 A;  3TVV A;  4KAX B;  2DHK A;  5CLQ B;  2AEH A;  3QIJ A;  2IFS A;  1NI2 A;  4K81 A;  1EGX A;  2GCJ A;  2ELB A;  4K2O A;  2RSG A;  1KZG A;  2MKR A;  3IVF A;  5GOW B;  5C5B B;  1GG3 A;  2Q13 A;  1P3R A;  3O96 A;  1MIX A;  3ODO A;  4YON A;  2YF0 A;  4GN1 A;  4H8S A;  2KUP A;  4EKU A;  2ROV A;  1H4R A;  2L2I A;  3F0W A;  2DTC A;  4KHA A;  5LOP B;  2VKI A;  4F7H A;  1NTV A;  4F7G A;  1Y19 B;  2LUL A;  2V76 A;  4KVG B;  2P8V A;  3KY9 A;  1U5D A;  5KQ4 A;  2D2Q A;  4MY6 A;  3HW2 B;  1FHO A;  2DA0 A;  3ULB A;  1LB1 A;  1N3H A;  3VIA A;  1XX0 A;  2DKP A;  2GJY A;  2P0F A;  4HAZ B;  2D9V A;  4MK0 A;  2DLW A;  1U5G A;  2PZ1 A;  5HE0 A;  1FGY A;  1UNQ A;  4YL8 A;  4NSW A;  3U8Z A;  4GXB A;  3V5W A;  2YS5 A;  1OMW A;  2D11 A;  5D3W A;  4A5K A;  3KZ1 A;  1PLS A;  3VOQ A;  1M7R A;  3AJ4 A;  3U7D A;  4DX8 A;  5J3T A;  3MPX A;  3ULC A;  1SHC A;  1V61 A;  2Z0Q A;  4HDQ A;  1EAZ A;  2Z0P A;  3ODX A;  1MKE A;  1V88 A;  2LKO A;  3OAN A;  4HAW B;  2UZR A;  4P7I A;  2LOX A;  2P0H A;  4HAT B;  3ZVR A;  3A8P A;  1QC6 A;  2K00 A;  3BJI A;  3F5R A;  2CRF A;  4WVF B;  1KI1 B;  1I2H A;  4C0A A;  2RGN B;  2DFK A;  4TYZ A;  3P7Z A;  1V5U A;  2DHI A;  2Z0O A;  5DHA B;  3MDB C;  1U5F A;  1XR0 B;  3PVW A;  1UPQ A;  1LW3 A;  3QWM A;  1UPR A;  2RNR B;  1EVH A;  2CAY A;  2QKM A;  2COF A;  1X1F A;  5DIF B;  2DKQ A;  4HB2 B;  3AU5 A;  1PMS A;  2J0K A;  2I1J A;  4Z2M B;  2M38 A;  1DRO A;  1TQZ A;  2E2X A;  2COD A;  2K2U A;  2RLO A;  2CY5 A;  3PSC A;  4A6K A;  1U5E A;  2RUK B;  1Z87 A;  1ZM0 A;  2YRY A;  4CYE A;  5HE3 A;  5J3Q A;  2X18 A;  3DXE A;  2DN6 A;  3NSU A;  3TCA A;  1FB8 A;  3TFM A;  2DX5 A;  5KCV A;  2ZPY A;  4IOY X;  2VRW B;  4NY0 A;  2NMB A;  2L1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...