3AJ4A

Crystal structure of the ph domain of evectin-2 from human complexed with o-phospho-l-serine
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
112
structure length
112
Chain Sequence
GSMAFVKSGWLLRQSTILKRWKKNWFDLWSDGHLIYYDDQTRQNIEDKVHMPMDCINIRTGQECRDTQPPDGKSKDCMLQIVCRDGKTISLCAESTDDCLAWKFTLQDSRTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Intracellular phosphatidylserine is essential for retrograde membrane traffic through endosomes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Pleckstrin homology domain-containing family B member 2
total genus 31
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3aj4A00
1V89A 1W1HA 2LKOA 4IAPA 4HDOA 2RGNB 1AWEA 2I5FA 2Z0PA 1X86A 1U27A 5D3VA 1EVHA 3OANA 4GMVA 1GC7A 2IYBA 4B6HA 3PVLA 2P0DA 3M1IB 4NY0A 3TVVA 2DHIA 1WG7A 5J3QA 1FHOA 4ZRIA 5CLQB 1H4RA 4HAUB 3UZTA 1OY2A 1X11A 2RNRB 3O96A 1V61A 4HB4B 1FAOA 4MY6A 5LOPB 5J3YA 2M38A 3PVWA 3FEHA 4EMOA 2CY4A 1PMSA 3SV1A 4KHOA 4GZUA 2V76A 3D8DA 2DX1A 1P3RA 1BTNA 1Q67A 2DFKA 5JLJB 2I1KA 1WGQA 1PLSA 2D9WA 3FM8C 3FSSA 1MK7B 2J59M 4HHVA 1UNQA 2XQNM 5JHHA 1I2HA 2DA0A 2LOZA 3F5RA 2YS5A 3A8PA 2D9XA 4ZRJA 5D3YA 4Z2MB 3HW2B 4CHJA 2VRWB 1TXDA 1MKEA 3HK0A 4YL8A 3VOQA 2QKMA 2K00A 1UPQA 3ODWA 1WJ1A 1DYNA 2I1JA 5LONB 3SNHA 4HAXB 3U8ZA 1U5EA 4C0AA 3DXDA 2RLOA 5C16A 4GXBA 4DXAB 1B55A 2EMSA 4XWXA 1EGXA 1IRSA 2HE7A 3P7ZA 1QC6A 4H8SA 4A6HA 2KCJA 4HATB 2GJYA 1P6SA 1V5UA 2RUKB 1OQNA 3A98B 3KY9A 2BCJA 4PQ0A 2CRFA 2RVBB 2I5CA 3D8FA 3ZVRA 2LOXA 5HE1A 1W1GA 4P7IA 2CAYA 2DYQA 2J0KA 5C5BB 2DYNA 3HQCA 2KUPA 1FGYA 1XODA 2CY5A 1DDWA 4GN1A 1UEFA 1H10A 3CIKA 3U7DA 2K2JA 2D10A 1KZ7A 4EKUA 2DN6A 2COAA 5KQ1A 3N7CA 1E5WA 1N3HA 4K2OA 5JP4A 1EF1A 2Y8GA 1EAZA 2EC1A 2UZSA 4IOYX 1WVHA 2MWNB 3DXCA 4MT7A 5KQ4A 1V5PA 5C6RA 4HB2B 2E2XA 2GCLA 4BBKA 3KSYA 1PFJA 4PNKA 1UPRA 1U5GA 1K5DB 2PZ1A 3WYFB 2OQBA 2IFSA 2D2QA 5HE3A 4CYEA 4ZRKA 2Z0QA 3MPXA 3X23A 1Y19B 2ROZB 1QQGA 2VKIA 1SHCA 1X1GA 4A6KA 3PP2A 3ML4A 4A5KA 2UZRA 1J0WA 2DX5A 3AU5A 3KRXA 3LJUX 5GOWB 3G9WA 4F7GA 4HAZB 2Y8FA 2ZPYA 1GC6A 1FB8A 3SO6A 3PSCA 4HDQA 1DROA 1DBHA 2ADZA 4HB3B 3QIJA 5C5BA 5C79A 1AQCA 3T06A 2D11A 2W2XC 4GMXB 1FHXA 1U5FA 2YF0A 4K2PA 1M7RA 3D8EA 4K81A 2YS1A 4YONA 4HAVB 3KZ1A 3GYPA 1BWNA 1XCGA 1MIZB 2OTXA 2LULA 2P8VA 1Y5OA 1UNRA 4IFSA 3ZDTA 1U29A 4NSWA 2H7DA 3AU4A 2D4QA 3RCPA 3MDBC 4DX8A 2AEHA 2P0FA 1ZSQA 3KRWA 1BAKA 2DHKA 3QWMA 2ELAA 1DDMA 5JHGA 2NZ8B 5DH9B 2KGXB 2DKQA 1TJ6A 2W2WA 1RRPB 2W2XD 2JP2A 1Z87A 4L6EA 4A6FB 1U5DA 1W1DA 5DHAB 1X05A 1LW3A 3PEGA 1WGUA 1V5MA 3PZDA 3BINA 4DBBA 1MAIA 5DIFB 1UNPA 4WSFA 2MDXA 2N23A 1FGZA 1XR0B 5DI9B 2J0JA 5J3TA 2EMTA 5KCVA 2GS0A 2P0HA 1BTKA 1SGHA 3P6AA 2M14A 5D27A 4HB0B 5HE2A 3TO1A 2YT1A 5L81A 3F0WA 1RJ2A 2HTHB 1P5TA 5EFXA 3QBVB 1LB1A 4KHAA 2LYDA 3WA0A 2N0YA 2QKLA 1MIXA 5HE0A 1NTYA 2NMBA 3VIAA 2DTCA 3GYOA 3PG7A 1KZGA 3A8QA 5D3WA 1XX0A 3TCAA 4F7UP 2H7EA 3PVUA 2DLWA 3ODXA 2L1CA 1GG3A 2D9YA 1J19A 3TFMA 4TKNA 3ULCA 1FOEA 2ELBA 2ROVA 1I7AA 2GCJA 1NI2A 2D9ZA 1KI1B 1K5GB 1M7EA 1XD4A 2DHJA 2YSZA 2YRYA 5FI1A 1WI1A 1U2BA 1DDVA 4KVGB 1X1FA 2EJ8A 1TQZA 1MPHA 2RSGA 2FJLA 2AL6A 1NTVA 2CODA 1ZC4B 2DKPA 4WJ7A 4CHMA 1ZC3B 2J0MA 2R09A 3DXEA 3ODOA 4HAWB 2Z0OA 3ULBA 2LG1A 3BJIA 3AJ4A 1V88A 4GPTB 4KHBB 3IVFA 4WVFB 2UVMA 1ZM0A 2YVCA 5DHFB 1WJMA 4HAYB 4Z2NA 4EJNA 1MK9B 2L2IA 4A6FA 2X18A 3SYXA 2R0DA 3TW1A 2YS3A 3V5WA 2G35A 1OMWA 4DX90 1FHWA 2VSZA 2YT0A 2K2UA 1ISNA 2COCA 1XKEA 4K17A 1NU2A 2D9VA 2Y7BA 4MK0A 5D3XA 4Y94A 2MFQA 3NSUA 3CXBB 4TYZA 2COFA 4F7HA 2Q13A 3SUZA 4KAXB 5FI0A 1ZVRA 2MKRA 4D0NB 5CLLB
chains in the Genus database with same CATH superfamily
1V89A 1W1HA 2LKOA 4IAPA 1T77A 4HDOA 2RGNB 1AWEA 2I5FA 2Z0PA 2Z14A 1X86A 1U27A 5D3VA 1EVHA 3OANA 4GMVA 5I2SA 1GC7A 2IYBA 4B6HA 3PVLA 2P0DA 3M1IB 4NY0A 3TVVA 2DHIA 1WG7A 5J3QA 1FHOA 4ZRIA 5CLQB 1MI1A 4GOUA 1H4RA 4HAUB 3UZTA 1OY2A 1X11A 2RNRB 3O96A 3HIEA 1V61A 2Z4DA 4HB4B 1FAOA 4MY6A 5LOPB 3A58A 5J3YA 4GNKB 4L1RA 2M38A 3PVWA 3FEHA 4EMOA 2CY4A 1PMSA 3SV1A 4KHOA 4GZUA 2V76A 2NBVA 3D8DA 2DX1A 1P3RA 1BTNA 1Q67A 2DFKA 5JLJB 3B77A 2I1KA 1WGQA 1PLSA 2D9WA 3FM8C 3FSSA 1MK7B 2J59M 4HHVA 1UNQA 2Z59A 2XQNM 2KIGA 5JHHA 3NWDA 1I2HA 2DA0A 2LOZA 3F5RA 2YS5A 3A8PA 2D9XA 3DCXA 4ZRJA 5D3YA 4Z2MB 3HW2B 4CHJA 2VRWB 1TXDA 1MKEA 3HK0A 4YL8A 3VOQA 2QKMA 2K00A 1UPQA 3ODWA 1WJ1A 1DYNA 2I1JA 5LONB 3SNHA 4HAXB 3U8ZA 1U5EA 4C0AA 3DXDA 2RLOA 5C16A 4GXBA 4DXAB 1B55A 3U12A 2EMSA 4XWXA 1EGXA 1IRSA 2HE7A 3P7ZA 1QC6A 3HSAA 4H8SA 4A6HA 2KCJA 4HATB 2GJYA 1P6SA 1V5UA 2RUKB 1OQNA 3A98B 3KY9A 2BCJA 4PQ0A 2CRFA 2RVBB 2I5CA 3D8FA 3ZVRA 2LOXA 5HE1A 1W1GA 1ZYIA 4P7IA 2CAYA 2DYQA 2J0KA 5C5BB 2DYNA 3HQCA 2KUPA 1FGYA 1XODA 2CY5A 1DDWA 4GN1A 1UEFA 1H10A 3CIKA 3U7DA 2K2JA 2D10A 1KZ7A 4EKUA 2DN6A 2COAA 4QJ3B 5KQ1A 3FVCA 3N7CA 1E5WA 1N3HA 4K2OA 5JP4A 1EF1A 2Y8GA 1EAZA 2EC1A 2UZSA 4IOYX 1WVHA 4HSIA 2MWNB 3DXCA 4OT1A 4MT7A 5KQ4A 1V5PA 5IRSA 5C6RA 4HB2B 2E2XA 2RRFA 2GCLA 4BBKA 3KSYA 5LG4B 1PFJA 4PNKA 1UPRA 1U5GA 1K5DB 2PZ1A 3WYFB 2OQBA 2IFSA 2D2QA 4QJ4B 5HE3A 4CYEA 4ZRKA 2Z0QA 3MPXA 3X23A 1Y19B 2ROZB 1QQGA 2VKIA 1SHCA 1X1GA 4A6KA 3PP2A 3ML4A 4A5KA 2R2YA 2UZRA 1J0WA 2DX5A 3AU5A 3KRXA 3LJUX 5GOWB 3G9WA 4F7GA 5M4YB 4HAZB 2Y8FA 2ZPYA 1GC6A 1FB8A 2KR0A 3SO6A 3PSCA 4HDQA 1DROA 1DBHA 2ADZA 4HB3B 3QIJA 5C5BA 5C79A 1AQCA 3T06A 2D11A 2W2XC 5I2MA 4DIXA 3OHMB 4GMXB 1FHXA 1U5FA 2YF0A 4K2PA 1M7RA 3D8EA 4K81A 2YS1A 4YONA 4HAVB 3KZ1A 3GYPA 1BWNA 2K8EA 1XCGA 1MIZB 2OTXA 2LULA 2P8VA 1Y5OA 1UNRA 4IFSA 4KHBA 3ZDTA 1U29A 4NSWA 2H7DA 3AU4A 2D4QA 2K49A 3MDBC 3RCPA 4DX8A 2AEHA 2P0FA 1ZSQA 3KRWA 1BAKA 2DHKA 2KIEA 3QWMA 2ELAA 1DDMA 5JHGA 2NZ8B 5DH9B 2KGXB 2DKQA 1TJ6A 2W2WA 3NWAA 1RRPB 2W2XD 2JP2A 1Z87A 4L6EA 4A6FB 1U5DA 1W1DA 5DHAB 1X05A 1LW3A 3PEGA 1WGUA 1V5MA 3PZDA 3BINA 4DBBA 1MAIA 5DIFB 1UNPA 4WSFA 2MDXA 2N23A 3NW8A 1FGZA 4CSQA 1XR0B 5DI9B 2J0JA 5J3TA 2EMTA 5KCVA 2GS0A 2P0HA 1BTKA 1SGHA 3P6AA 2M14A 5D27A 4HB0B 5HE2A 3TO1A 2YT1A 5L81A 3F0WA 1RJ2A 2HTHB 1P5TA 5EFXA 3NWFA 3QBVB 1LB1A 4KHAA 2YT2A 2LYDA 3WA0A 2N0YA 2QKLA 4OSNA 1MIXA 5HE0A 1NTYA 2NMBA 3VIAA 2DTCA 3GYOA 3PG7A 1KZGA 3A8QA 5D3WA 1XX0A 3TCAA 4F7UP 2H7EA 3PVUA 2DLWA 3ODXA 2L1CA 1GG3A 2D9YA 1J19A 3TFMA 4TKNA 3ULCA 1FOEA 2ELBA 2ROVA 4QJ5B 1I7AA 2GCJA 1NI2A 2D9ZA 1KI1B 1K5GB 1M7EA 1XD4A 2DHJA 2YSZA 2YRYA 5FI1A 4QXAB 1WI1A 1U2BA 1DDVA 4KVGB 1X1FA 2EJ8A 2Z13A 1TQZA 1MPHA 2RSGA 2FJLA 2AL6A 2KUQA 1NTVA 2CODA 1ZC4B 2DKPA 4WJ7A 4CHMA 1ZC3B 2J0MA 2R09A 3DXEA 3ODOA 4HAWB 2Z0OA 3ULBA 2LG1A 3BJIA 3AJ4A 1V88A 4GPTB 4KHBB 2ZKMX 3IVFA 4WVFB 2UVMA 1ZM0A 2YVCA 5DHFB 1WJMA 4HAYB 4Z2NA 4EJNA 1MK9B 2L2IA 4A6FA 2X18A 3SYXA 2R0DA 3TW1A 2YS3A 3V5WA 2FJUB 2G35A 1OMWA 4DX90 1FHWA 2VSZA 2YT0A 2K2UA 1ISNA 2COCA 1XKEA 4D6WA 4K17A 2GUMA 1NU2A 2D9VA 2Y7BA 4MK0A 5D3XA 4Y94A 2MFQA 3NSUA 3CXBB 4TYZA 2COFA 4F7HA 2Q13A 3SUZA 4KAXB 5FI0A 1ZVRA 2MKRA 4D0NB 5CLLB
chains in the Genus database with same CATH topology
1V89A 1W1HA 2LKOA 4IAPA 4HDOA 2RGNB 1AWEA 2I5FA 2Z0PA 1X86A 1U27A 5D3VA 1EVHA 3OANA 4GMVA 1GC7A 2IYBA 4B6HA 3PVLA 2P0DA 3M1IB 4NY0A 3TVVA 2DHIA 1WG7A 5J3QA 1FHOA 4ZRIA 5CLQB 1H4RA 4HAUB 3UZTA 1OY2A 1X11A 2RNRB 3O96A 1V61A 4HB4B 1FAOA 4MY6A 5LOPB 5J3YA 2M38A 3PVWA 3FEHA 4EMOA 2CY4A 1PMSA 3SV1A 4KHOA 4GZUA 2V76A 3D8DA 2DX1A 1P3RA 1BTNA 1Q67A 2DFKA 5JLJB 2I1KA 1WGQA 1PLSA 2D9WA 3FM8C 3FSSA 1MK7B 2J59M 4HHVA 1UNQA 2XQNM 5JHHA 1I2HA 2DA0A 2LOZA 3F5RA 2YS5A 3A8PA 2D9XA 4ZRJA 5D3YA 4Z2MB 3HW2B 4CHJA 2VRWB 1TXDA 1MKEA 3HK0A 4YL8A 3VOQA 2QKMA 2K00A 1UPQA 3ODWA 1WJ1A 1DYNA 2I1JA 5LONB 3SNHA 4HAXB 3U8ZA 1U5EA 4C0AA 3DXDA 2RLOA 5C16A 4GXBA 4DXAB 1B55A 2EMSA 4XWXA 1EGXA 1IRSA 2HE7A 3P7ZA 1QC6A 4H8SA 4A6HA 2KCJA 4HATB 2GJYA 1P6SA 1V5UA 2RUKB 1OQNA 3A98B 3KY9A 2BCJA 4PQ0A 2CRFA 2RVBB 2I5CA 3D8FA 3ZVRA 2LOXA 5HE1A 1W1GA 4P7IA 2CAYA 2DYQA 2J0KA 5C5BB 2DYNA 3HQCA 2KUPA 1FGYA 1XODA 2CY5A 1DDWA 4GN1A 1UEFA 1H10A 3CIKA 3U7DA 2K2JA 2D10A 1KZ7A 4EKUA 2DN6A 2COAA 5KQ1A 3N7CA 1E5WA 1N3HA 4K2OA 5JP4A 1EF1A 2Y8GA 1EAZA 2EC1A 2UZSA 4IOYX 1WVHA 2MWNB 3DXCA 4MT7A 5KQ4A 1V5PA 5C6RA 4HB2B 2E2XA 2GCLA 4BBKA 3KSYA 1PFJA 4PNKA 1UPRA 1U5GA 1K5DB 2PZ1A 3WYFB 2OQBA 2IFSA 2D2QA 5HE3A 4CYEA 4ZRKA 2Z0QA 3MPXA 3X23A 1Y19B 2ROZB 1QQGA 2VKIA 1SHCA 1X1GA 4A6KA 3PP2A 3ML4A 4A5KA 2UZRA 1J0WA 2DX5A 3AU5A 3KRXA 3LJUX 5GOWB 3G9WA 4F7GA 4HAZB 2Y8FA 2ZPYA 1GC6A 1FB8A 3SO6A 3PSCA 4HDQA 1DROA 1DBHA 2ADZA 4HB3B 3QIJA 5C5BA 5C79A 1AQCA 3T06A 2D11A 2W2XC 4GMXB 1FHXA 1U5FA 2YF0A 4K2PA 1M7RA 3D8EA 4K81A 2YS1A 4YONA 4HAVB 3KZ1A 3GYPA 1BWNA 1XCGA 1MIZB 2OTXA 2LULA 2P8VA 1Y5OA 1UNRA 4IFSA 3ZDTA 1U29A 4NSWA 2H7DA 3AU4A 2D4QA 3RCPA 3MDBC 4DX8A 2AEHA 2P0FA 1ZSQA 3KRWA 1BAKA 2DHKA 3QWMA 2ELAA 1DDMA 5JHGA 2NZ8B 5DH9B 2KGXB 2DKQA 1TJ6A 2W2WA 1RRPB 2W2XD 2JP2A 1Z87A 4L6EA 4A6FB 1U5DA 1W1DA 5DHAB 1X05A 1LW3A 3PEGA 1WGUA 1V5MA 3PZDA 3BINA 4DBBA 1MAIA 5DIFB 1UNPA 4WSFA 2MDXA 2N23A 1FGZA 1XR0B 5DI9B 2J0JA 5J3TA 2EMTA 5KCVA 2GS0A 2P0HA 1BTKA 1SGHA 3P6AA 2M14A 5D27A 4HB0B 5HE2A 3TO1A 2YT1A 5L81A 3F0WA 1RJ2A 2HTHB 1P5TA 5EFXA 3QBVB 1LB1A 4KHAA 2LYDA 3WA0A 2N0YA 2QKLA 1MIXA 5HE0A 1NTYA 2NMBA 3VIAA 2DTCA 3GYOA 3PG7A 1KZGA 3A8QA 5D3WA 1XX0A 3TCAA 4F7UP 2H7EA 3PVUA 2DLWA 3ODXA 2L1CA 1GG3A 2D9YA 1J19A 3TFMA 4TKNA 3ULCA 1FOEA 2ELBA 2ROVA 1I7AA 2GCJA 1NI2A 2D9ZA 1KI1B 1K5GB 1M7EA 1XD4A 2DHJA 2YSZA 2YRYA 5FI1A 1WI1A 1U2BA 1DDVA 4KVGB 1X1FA 2EJ8A 1TQZA 1MPHA 2RSGA 2FJLA 2AL6A 1NTVA 2CODA 1ZC4B 2DKPA 4WJ7A 4CHMA 1ZC3B 2J0MA 2R09A 3DXEA 3ODOA 4HAWB 2Z0OA 3ULBA 2LG1A 3BJIA 3AJ4A 1V88A 4GPTB 4KHBB 3IVFA 4WVFB 2UVMA 1ZM0A 2YVCA 5DHFB 1WJMA 4HAYB 4Z2NA 4EJNA 1MK9B 2L2IA 4A6FA 2X18A 3SYXA 2R0DA 3TW1A 2YS3A 3V5WA 2G35A 1OMWA 4DX90 1FHWA 2VSZA 2YT0A 2K2UA 1ISNA 2COCA 1XKEA 4K17A 1NU2A 2D9VA 2Y7BA 4MK0A 5D3XA 4Y94A 2MFQA 3NSUA 3CXBB 4TYZA 2COFA 4F7HA 2Q13A 3SUZA 4KAXB 5FI0A 1ZVRA 2MKRA 4D0NB 5CLLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V89 A;  1W1H A;  2LKO A;  4IAP A;  4HDO A;  2RGN B;  1AWE A;  2I5F A;  2Z0P A;  1X86 A;  1U27 A;  5D3V A;  1EVH A;  3OAN A;  4GMV A;  1GC7 A;  2IYB A;  4B6H A;  3PVL A;  2P0D A;  3M1I B;  4NY0 A;  3TVV A;  2DHI A;  1WG7 A;  5J3Q A;  1FHO A;  4ZRI A;  5CLQ B;  1H4R A;  4HAU B;  3UZT A;  1OY2 A;  1X11 A;  2RNR B;  3O96 A;  1V61 A;  4HB4 B;  1FAO A;  4MY6 A;  5LOP B;  5J3Y A;  2M38 A;  3PVW A;  3FEH A;  4EMO A;  2CY4 A;  1PMS A;  3SV1 A;  4KHO A;  4GZU A;  2V76 A;  3D8D A;  2DX1 A;  1P3R A;  1BTN A;  1Q67 A;  2DFK A;  5JLJ B;  2I1K A;  1WGQ A;  1PLS A;  2D9W A;  3FM8 C;  3FSS A;  1MK7 B;  2J59 M;  4HHV A;  1UNQ A;  2XQN M;  5JHH A;  1I2H A;  2DA0 A;  2LOZ A;  3F5R A;  2YS5 A;  3A8P A;  2D9X A;  4ZRJ A;  5D3Y A;  4Z2M B;  3HW2 B;  4CHJ A;  2VRW B;  1TXD A;  1MKE A;  3HK0 A;  4YL8 A;  3VOQ A;  2QKM A;  2K00 A;  1UPQ A;  3ODW A;  1WJ1 A;  1DYN A;  2I1J A;  5LON B;  3SNH A;  4HAX B;  3U8Z A;  1U5E A;  4C0A A;  3DXD A;  2RLO A;  5C16 A;  4GXB A;  4DXA B;  1B55 A;  2EMS A;  4XWX A;  1EGX A;  1IRS A;  2HE7 A;  3P7Z A;  1QC6 A;  4H8S A;  4A6H A;  2KCJ A;  4HAT B;  2GJY A;  1P6S A;  1V5U A;  2RUK B;  1OQN A;  3A98 B;  3KY9 A;  2BCJ A;  4PQ0 A;  2CRF A;  2RVB B;  2I5C A;  3D8F A;  3ZVR A;  2LOX A;  5HE1 A;  1W1G A;  4P7I A;  2CAY A;  2DYQ A;  2J0K A;  5C5B B;  2DYN A;  3HQC A;  2KUP A;  1FGY A;  1XOD A;  2CY5 A;  1DDW A;  4GN1 A;  1UEF A;  1H10 A;  3CIK A;  3U7D A;  2K2J A;  2D10 A;  1KZ7 A;  4EKU A;  2DN6 A;  2COA A;  5KQ1 A;  3N7C A;  1E5W A;  1N3H A;  4K2O A;  5JP4 A;  1EF1 A;  2Y8G A;  1EAZ A;  2EC1 A;  2UZS A;  4IOY X;  1WVH A;  2MWN B;  3DXC A;  4MT7 A;  5KQ4 A;  1V5P A;  5C6R A;  4HB2 B;  2E2X A;  2GCL A;  4BBK A;  3KSY A;  1PFJ A;  4PNK A;  1UPR A;  1U5G A;  1K5D B;  2PZ1 A;  3WYF B;  2OQB A;  2IFS A;  2D2Q A;  5HE3 A;  4CYE A;  4ZRK A;  2Z0Q A;  3MPX A;  3X23 A;  1Y19 B;  2ROZ B;  1QQG A;  2VKI A;  1SHC A;  1X1G A;  4A6K A;  3PP2 A;  3ML4 A;  4A5K A;  2UZR A;  1J0W A;  2DX5 A;  3AU5 A;  3KRX A;  3LJU X;  5GOW B;  3G9W A;  4F7G A;  4HAZ B;  2Y8F A;  2ZPY A;  1GC6 A;  1FB8 A;  3SO6 A;  3PSC A;  4HDQ A;  1DRO A;  1DBH A;  2ADZ A;  4HB3 B;  3QIJ A;  5C5B A;  5C79 A;  1AQC A;  3T06 A;  2D11 A;  2W2X C;  4GMX B;  1FHX A;  1U5F A;  2YF0 A;  4K2P A;  1M7R A;  3D8E A;  4K81 A;  2YS1 A;  4YON A;  4HAV B;  3KZ1 A;  3GYP A;  1BWN A;  1XCG A;  1MIZ B;  2OTX A;  2LUL A;  2P8V A;  1Y5O A;  1UNR A;  4IFS A;  3ZDT A;  1U29 A;  4NSW A;  2H7D A;  3AU4 A;  2D4Q A;  3RCP A;  3MDB C;  4DX8 A;  2AEH A;  2P0F A;  1ZSQ A;  3KRW A;  1BAK A;  2DHK A;  3QWM A;  2ELA A;  1DDM A;  5JHG A;  2NZ8 B;  5DH9 B;  2KGX B;  2DKQ A;  1TJ6 A;  2W2W A;  1RRP B;  2W2X D;  2JP2 A;  1Z87 A;  4L6E A;  4A6F B;  1U5D A;  1W1D A;  5DHA B;  1X05 A;  1LW3 A;  3PEG A;  1WGU A;  1V5M A;  3PZD A;  3BIN A;  4DBB A;  1MAI A;  5DIF B;  1UNP A;  4WSF A;  2MDX A;  2N23 A;  1FGZ A;  1XR0 B;  5DI9 B;  2J0J A;  5J3T A;  2EMT A;  5KCV A;  2GS0 A;  2P0H A;  1BTK A;  1SGH A;  3P6A A;  2M14 A;  5D27 A;  4HB0 B;  5HE2 A;  3TO1 A;  2YT1 A;  5L81 A;  3F0W A;  1RJ2 A;  2HTH B;  1P5T A;  5EFX A;  3QBV B;  1LB1 A;  4KHA A;  2LYD A;  3WA0 A;  2N0Y A;  2QKL A;  1MIX A;  5HE0 A;  1NTY A;  2NMB A;  3VIA A;  2DTC A;  3GYO A;  3PG7 A;  1KZG A;  3A8Q A;  5D3W A;  1XX0 A;  3TCA A;  4F7U P;  2H7E A;  3PVU A;  2DLW A;  3ODX A;  2L1C A;  1GG3 A;  2D9Y A;  1J19 A;  3TFM A;  4TKN A;  3ULC A;  1FOE A;  2ELB A;  2ROV A;  1I7A A;  2GCJ A;  1NI2 A;  2D9Z A;  1KI1 B;  1K5G B;  1M7E A;  1XD4 A;  2DHJ A;  2YSZ A;  2YRY A;  5FI1 A;  1WI1 A;  1U2B A;  1DDV A;  4KVG B;  1X1F A;  2EJ8 A;  1TQZ A;  1MPH A;  2RSG A;  2FJL A;  2AL6 A;  1NTV A;  2COD A;  1ZC4 B;  2DKP A;  4WJ7 A;  4CHM A;  1ZC3 B;  2J0M A;  2R09 A;  3DXE A;  3ODO A;  4HAW B;  2Z0O A;  3ULB A;  2LG1 A;  3BJI A;  3AJ4 A;  1V88 A;  4GPT B;  4KHB B;  3IVF A;  4WVF B;  2UVM A;  1ZM0 A;  2YVC A;  5DHF B;  1WJM A;  4HAY B;  4Z2N A;  4EJN A;  1MK9 B;  2L2I A;  4A6F A;  2X18 A;  3SYX A;  2R0D A;  3TW1 A;  2YS3 A;  3V5W A;  2G35 A;  1OMW A;  4DX9 0;  1FHW A;  2VSZ A;  2YT0 A;  2K2U A;  1ISN A;  2COC A;  1XKE A;  4K17 A;  1NU2 A;  2D9V A;  2Y7B A;  4MK0 A;  5D3X A;  4Y94 A;  2MFQ A;  3NSU A;  3CXB B;  4TYZ A;  2COF A;  4F7H A;  2Q13 A;  3SUZ A;  4KAX B;  5FI0 A;  1ZVR A;  2MKR A;  4D0N B;  5CLL B; 
#chains in the Genus database with same CATH topology
 1V89 A;  1W1H A;  2LKO A;  4IAP A;  1T77 A;  4HDO A;  2RGN B;  1AWE A;  2I5F A;  2Z0P A;  2Z14 A;  1X86 A;  1U27 A;  5D3V A;  1EVH A;  3OAN A;  4GMV A;  5I2S A;  1GC7 A;  2IYB A;  4B6H A;  3PVL A;  2P0D A;  3M1I B;  4NY0 A;  3TVV A;  2DHI A;  1WG7 A;  5J3Q A;  1FHO A;  4ZRI A;  5CLQ B;  1MI1 A;  4GOU A;  1H4R A;  4HAU B;  3UZT A;  1OY2 A;  1X11 A;  2RNR B;  3O96 A;  3HIE A;  1V61 A;  2Z4D A;  4HB4 B;  1FAO A;  4MY6 A;  5LOP B;  3A58 A;  5J3Y A;  4GNK B;  4L1R A;  2M38 A;  3PVW A;  3FEH A;  4EMO A;  2CY4 A;  1PMS A;  3SV1 A;  4KHO A;  4GZU A;  2V76 A;  2NBV A;  3D8D A;  2DX1 A;  1P3R A;  1BTN A;  1Q67 A;  2DFK A;  5JLJ B;  3B77 A;  2I1K A;  1WGQ A;  1PLS A;  2D9W A;  3FM8 C;  3FSS A;  1MK7 B;  2J59 M;  4HHV A;  1UNQ A;  2Z59 A;  2XQN M;  2KIG A;  5JHH A;  3NWD A;  1I2H A;  2DA0 A;  2LOZ A;  3F5R A;  2YS5 A;  3A8P A;  2D9X A;  3DCX A;  4ZRJ A;  5D3Y A;  4Z2M B;  3HW2 B;  4CHJ A;  2VRW B;  1TXD A;  1MKE A;  3HK0 A;  4YL8 A;  3VOQ A;  2QKM A;  2K00 A;  1UPQ A;  3ODW A;  1WJ1 A;  1DYN A;  2I1J A;  5LON B;  3SNH A;  4HAX B;  3U8Z A;  1U5E A;  4C0A A;  3DXD A;  2RLO A;  5C16 A;  4GXB A;  4DXA B;  1B55 A;  3U12 A;  2EMS A;  4XWX A;  1EGX A;  1IRS A;  2HE7 A;  3P7Z A;  1QC6 A;  3HSA A;  4H8S A;  4A6H A;  2KCJ A;  4HAT B;  2GJY A;  1P6S A;  1V5U A;  2RUK B;  1OQN A;  3A98 B;  3KY9 A;  2BCJ A;  4PQ0 A;  2CRF A;  2RVB B;  2I5C A;  3D8F A;  3ZVR A;  2LOX A;  5HE1 A;  1W1G A;  1ZYI A;  4P7I A;  2CAY A;  2DYQ A;  2J0K A;  5C5B B;  2DYN A;  3HQC A;  2KUP A;  1FGY A;  1XOD A;  2CY5 A;  1DDW A;  4GN1 A;  1UEF A;  1H10 A;  3CIK A;  3U7D A;  2K2J A;  2D10 A;  1KZ7 A;  4EKU A;  2DN6 A;  2COA A;  4QJ3 B;  5KQ1 A;  3FVC A;  3N7C A;  1E5W A;  1N3H A;  4K2O A;  5JP4 A;  1EF1 A;  2Y8G A;  1EAZ A;  2EC1 A;  2UZS A;  4IOY X;  1WVH A;  4HSI A;  2MWN B;  3DXC A;  4OT1 A;  4MT7 A;  5KQ4 A;  1V5P A;  5IRS A;  5C6R A;  4HB2 B;  2E2X A;  2RRF A;  2GCL A;  4BBK A;  3KSY A;  5LG4 B;  1PFJ A;  4PNK A;  1UPR A;  1U5G A;  1K5D B;  2PZ1 A;  3WYF B;  2OQB A;  2IFS A;  2D2Q A;  4QJ4 B;  5HE3 A;  4CYE A;  4ZRK A;  2Z0Q A;  3MPX A;  3X23 A;  1Y19 B;  2ROZ B;  1QQG A;  2VKI A;  1SHC A;  1X1G A;  4A6K A;  3PP2 A;  3ML4 A;  4A5K A;  2R2Y A;  2UZR A;  1J0W A;  2DX5 A;  3AU5 A;  3KRX A;  3LJU X;  5GOW B;  3G9W A;  4F7G A;  5M4Y B;  4HAZ B;  2Y8F A;  2ZPY A;  1GC6 A;  1FB8 A;  2KR0 A;  3SO6 A;  3PSC A;  4HDQ A;  1DRO A;  1DBH A;  2ADZ A;  4HB3 B;  3QIJ A;  5C5B A;  5C79 A;  1AQC A;  3T06 A;  2D11 A;  2W2X C;  5I2M A;  4DIX A;  3OHM B;  4GMX B;  1FHX A;  1U5F A;  2YF0 A;  4K2P A;  1M7R A;  3D8E A;  4K81 A;  2YS1 A;  4YON A;  4HAV B;  3KZ1 A;  3GYP A;  1BWN A;  2K8E A;  1XCG A;  1MIZ B;  2OTX A;  2LUL A;  2P8V A;  1Y5O A;  1UNR A;  4IFS A;  4KHB A;  3ZDT A;  1U29 A;  4NSW A;  2H7D A;  3AU4 A;  2D4Q A;  2K49 A;  3MDB C;  3RCP A;  4DX8 A;  2AEH A;  2P0F A;  1ZSQ A;  3KRW A;  1BAK A;  2DHK A;  2KIE A;  3QWM A;  2ELA A;  1DDM A;  5JHG A;  2NZ8 B;  5DH9 B;  2KGX B;  2DKQ A;  1TJ6 A;  2W2W A;  3NWA A;  1RRP B;  2W2X D;  2JP2 A;  1Z87 A;  4L6E A;  4A6F B;  1U5D A;  1W1D A;  5DHA B;  1X05 A;  1LW3 A;  3PEG A;  1WGU A;  1V5M A;  3PZD A;  3BIN A;  4DBB A;  1MAI A;  5DIF B;  1UNP A;  4WSF A;  2MDX A;  2N23 A;  3NW8 A;  1FGZ A;  4CSQ A;  1XR0 B;  5DI9 B;  2J0J A;  5J3T A;  2EMT A;  5KCV A;  2GS0 A;  2P0H A;  1BTK A;  1SGH A;  3P6A A;  2M14 A;  5D27 A;  4HB0 B;  5HE2 A;  3TO1 A;  2YT1 A;  5L81 A;  3F0W A;  1RJ2 A;  2HTH B;  1P5T A;  5EFX A;  3NWF A;  3QBV B;  1LB1 A;  4KHA A;  2YT2 A;  2LYD A;  3WA0 A;  2N0Y A;  2QKL A;  4OSN A;  1MIX A;  5HE0 A;  1NTY A;  2NMB A;  3VIA A;  2DTC A;  3GYO A;  3PG7 A;  1KZG A;  3A8Q A;  5D3W A;  1XX0 A;  3TCA A;  4F7U P;  2H7E A;  3PVU A;  2DLW A;  3ODX A;  2L1C A;  1GG3 A;  2D9Y A;  1J19 A;  3TFM A;  4TKN A;  3ULC A;  1FOE A;  2ELB A;  2ROV A;  4QJ5 B;  1I7A A;  2GCJ A;  1NI2 A;  2D9Z A;  1KI1 B;  1K5G B;  1M7E A;  1XD4 A;  2DHJ A;  2YSZ A;  2YRY A;  5FI1 A;  4QXA B;  1WI1 A;  1U2B A;  1DDV A;  4KVG B;  1X1F A;  2EJ8 A;  2Z13 A;  1TQZ A;  1MPH A;  2RSG A;  2FJL A;  2AL6 A;  2KUQ A;  1NTV A;  2COD A;  1ZC4 B;  2DKP A;  4WJ7 A;  4CHM A;  1ZC3 B;  2J0M A;  2R09 A;  3DXE A;  3ODO A;  4HAW B;  2Z0O A;  3ULB A;  2LG1 A;  3BJI A;  3AJ4 A;  1V88 A;  4GPT B;  4KHB B;  2ZKM X;  3IVF A;  4WVF B;  2UVM A;  1ZM0 A;  2YVC A;  5DHF B;  1WJM A;  4HAY B;  4Z2N A;  4EJN A;  1MK9 B;  2L2I A;  4A6F A;  2X18 A;  3SYX A;  2R0D A;  3TW1 A;  2YS3 A;  3V5W A;  2FJU B;  2G35 A;  1OMW A;  4DX9 0;  1FHW A;  2VSZ A;  2YT0 A;  2K2U A;  1ISN A;  2COC A;  1XKE A;  4D6W A;  4K17 A;  2GUM A;  1NU2 A;  2D9V A;  2Y7B A;  4MK0 A;  5D3X A;  4Y94 A;  2MFQ A;  3NSU A;  3CXB B;  4TYZ A;  2COF A;  4F7H A;  2Q13 A;  3SUZ A;  4KAX B;  5FI0 A;  1ZVR A;  2MKR A;  4D0N B;  5CLL B; 
#chains in the Genus database with same CATH homology
 1V89 A;  1W1H A;  2LKO A;  4IAP A;  4HDO A;  2RGN B;  1AWE A;  2I5F A;  2Z0P A;  1X86 A;  1U27 A;  5D3V A;  1EVH A;  3OAN A;  4GMV A;  1GC7 A;  2IYB A;  4B6H A;  3PVL A;  2P0D A;  3M1I B;  4NY0 A;  3TVV A;  2DHI A;  1WG7 A;  5J3Q A;  1FHO A;  4ZRI A;  5CLQ B;  1H4R A;  4HAU B;  3UZT A;  1OY2 A;  1X11 A;  2RNR B;  3O96 A;  1V61 A;  4HB4 B;  1FAO A;  4MY6 A;  5LOP B;  5J3Y A;  2M38 A;  3PVW A;  3FEH A;  4EMO A;  2CY4 A;  1PMS A;  3SV1 A;  4KHO A;  4GZU A;  2V76 A;  3D8D A;  2DX1 A;  1P3R A;  1BTN A;  1Q67 A;  2DFK A;  5JLJ B;  2I1K A;  1WGQ A;  1PLS A;  2D9W A;  3FM8 C;  3FSS A;  1MK7 B;  2J59 M;  4HHV A;  1UNQ A;  2XQN M;  5JHH A;  1I2H A;  2DA0 A;  2LOZ A;  3F5R A;  2YS5 A;  3A8P A;  2D9X A;  4ZRJ A;  5D3Y A;  4Z2M B;  3HW2 B;  4CHJ A;  2VRW B;  1TXD A;  1MKE A;  3HK0 A;  4YL8 A;  3VOQ A;  2QKM A;  2K00 A;  1UPQ A;  3ODW A;  1WJ1 A;  1DYN A;  2I1J A;  5LON B;  3SNH A;  4HAX B;  3U8Z A;  1U5E A;  4C0A A;  3DXD A;  2RLO A;  5C16 A;  4GXB A;  4DXA B;  1B55 A;  2EMS A;  4XWX A;  1EGX A;  1IRS A;  2HE7 A;  3P7Z A;  1QC6 A;  4H8S A;  4A6H A;  2KCJ A;  4HAT B;  2GJY A;  1P6S A;  1V5U A;  2RUK B;  1OQN A;  3A98 B;  3KY9 A;  2BCJ A;  4PQ0 A;  2CRF A;  2RVB B;  2I5C A;  3D8F A;  3ZVR A;  2LOX A;  5HE1 A;  1W1G A;  4P7I A;  2CAY A;  2DYQ A;  2J0K A;  5C5B B;  2DYN A;  3HQC A;  2KUP A;  1FGY A;  1XOD A;  2CY5 A;  1DDW A;  4GN1 A;  1UEF A;  1H10 A;  3CIK A;  3U7D A;  2K2J A;  2D10 A;  1KZ7 A;  4EKU A;  2DN6 A;  2COA A;  5KQ1 A;  3N7C A;  1E5W A;  1N3H A;  4K2O A;  5JP4 A;  1EF1 A;  2Y8G A;  1EAZ A;  2EC1 A;  2UZS A;  4IOY X;  1WVH A;  2MWN B;  3DXC A;  4MT7 A;  5KQ4 A;  1V5P A;  5C6R A;  4HB2 B;  2E2X A;  2GCL A;  4BBK A;  3KSY A;  1PFJ A;  4PNK A;  1UPR A;  1U5G A;  1K5D B;  2PZ1 A;  3WYF B;  2OQB A;  2IFS A;  2D2Q A;  5HE3 A;  4CYE A;  4ZRK A;  2Z0Q A;  3MPX A;  3X23 A;  1Y19 B;  2ROZ B;  1QQG A;  2VKI A;  1SHC A;  1X1G A;  4A6K A;  3PP2 A;  3ML4 A;  4A5K A;  2UZR A;  1J0W A;  2DX5 A;  3AU5 A;  3KRX A;  3LJU X;  5GOW B;  3G9W A;  4F7G A;  4HAZ B;  2Y8F A;  2ZPY A;  1GC6 A;  1FB8 A;  3SO6 A;  3PSC A;  4HDQ A;  1DRO A;  1DBH A;  2ADZ A;  4HB3 B;  3QIJ A;  5C5B A;  5C79 A;  1AQC A;  3T06 A;  2D11 A;  2W2X C;  4GMX B;  1FHX A;  1U5F A;  2YF0 A;  4K2P A;  1M7R A;  3D8E A;  4K81 A;  2YS1 A;  4YON A;  4HAV B;  3KZ1 A;  3GYP A;  1BWN A;  1XCG A;  1MIZ B;  2OTX A;  2LUL A;  2P8V A;  1Y5O A;  1UNR A;  4IFS A;  3ZDT A;  1U29 A;  4NSW A;  2H7D A;  3AU4 A;  2D4Q A;  3RCP A;  3MDB C;  4DX8 A;  2AEH A;  2P0F A;  1ZSQ A;  3KRW A;  1BAK A;  2DHK A;  3QWM A;  2ELA A;  1DDM A;  5JHG A;  2NZ8 B;  5DH9 B;  2KGX B;  2DKQ A;  1TJ6 A;  2W2W A;  1RRP B;  2W2X D;  2JP2 A;  1Z87 A;  4L6E A;  4A6F B;  1U5D A;  1W1D A;  5DHA B;  1X05 A;  1LW3 A;  3PEG A;  1WGU A;  1V5M A;  3PZD A;  3BIN A;  4DBB A;  1MAI A;  5DIF B;  1UNP A;  4WSF A;  2MDX A;  2N23 A;  1FGZ A;  1XR0 B;  5DI9 B;  2J0J A;  5J3T A;  2EMT A;  5KCV A;  2GS0 A;  2P0H A;  1BTK A;  1SGH A;  3P6A A;  2M14 A;  5D27 A;  4HB0 B;  5HE2 A;  3TO1 A;  2YT1 A;  5L81 A;  3F0W A;  1RJ2 A;  2HTH B;  1P5T A;  5EFX A;  3QBV B;  1LB1 A;  4KHA A;  2LYD A;  3WA0 A;  2N0Y A;  2QKL A;  1MIX A;  5HE0 A;  1NTY A;  2NMB A;  3VIA A;  2DTC A;  3GYO A;  3PG7 A;  1KZG A;  3A8Q A;  5D3W A;  1XX0 A;  3TCA A;  4F7U P;  2H7E A;  3PVU A;  2DLW A;  3ODX A;  2L1C A;  1GG3 A;  2D9Y A;  1J19 A;  3TFM A;  4TKN A;  3ULC A;  1FOE A;  2ELB A;  2ROV A;  1I7A A;  2GCJ A;  1NI2 A;  2D9Z A;  1KI1 B;  1K5G B;  1M7E A;  1XD4 A;  2DHJ A;  2YSZ A;  2YRY A;  5FI1 A;  1WI1 A;  1U2B A;  1DDV A;  4KVG B;  1X1F A;  2EJ8 A;  1TQZ A;  1MPH A;  2RSG A;  2FJL A;  2AL6 A;  1NTV A;  2COD A;  1ZC4 B;  2DKP A;  4WJ7 A;  4CHM A;  1ZC3 B;  2J0M A;  2R09 A;  3DXE A;  3ODO A;  4HAW B;  2Z0O A;  3ULB A;  2LG1 A;  3BJI A;  3AJ4 A;  1V88 A;  4GPT B;  4KHB B;  3IVF A;  4WVF B;  2UVM A;  1ZM0 A;  2YVC A;  5DHF B;  1WJM A;  4HAY B;  4Z2N A;  4EJN A;  1MK9 B;  2L2I A;  4A6F A;  2X18 A;  3SYX A;  2R0D A;  3TW1 A;  2YS3 A;  3V5W A;  2G35 A;  1OMW A;  4DX9 0;  1FHW A;  2VSZ A;  2YT0 A;  2K2U A;  1ISN A;  2COC A;  1XKE A;  4K17 A;  1NU2 A;  2D9V A;  2Y7B A;  4MK0 A;  5D3X A;  4Y94 A;  2MFQ A;  3NSU A;  3CXB B;  4TYZ A;  2COF A;  4F7H A;  2Q13 A;  3SUZ A;  4KAX B;  5FI0 A;  1ZVR A;  2MKR A;  4D0N B;  5CLL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...