1B55A

Ph domain from bruton's tyrosine kinase in complex with inositol 1,3,4,5-tetrakisphosphate
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
169
structure length
163
Chain Sequence
AAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQIPRRMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords TYROSINE-PROTEIN KINASE BTK
publication title Structure of the PH domain from Bruton's tyrosine kinase in complex with inositol 1,3,4,5-tetrakisphosphate.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 163
sequence length 169
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1999-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00779 BTK BTK motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1b55A00
2MKRA 3ODXA 5GOWB 4IOYX 2KCJA 5CLLB 2J0KA 2E2XA 4DX8A 4KAXB 3NSUA 5C5BA 2N0YA 5J3QA 2CAYA 4WSFA 2DLWA 1MIZB 2LYDA 2COAA 3CIKA 1BTKA 3O96A 1UPRA 2N23A 1EAZA 4YONA 3A8PA 4MK0A 1X05A 5JHHA 4HAVB 4B6HA 4DBBA 2IFSA 3A8QA 1W1HA 2CRFA 2YRYA 4F7UP 4EJNA 2I1KA 5EFXA 2ZPYA 1GC6A 2EC1A 1KZ7A 2CODA 2XQNM 5KCVA 2IYBA 2K00A 3GYOA 3LJUX 4HATB 3SNHA 4CHJA 4DX90 3TO1A 2L1CA 4HB3B 5C79A 2AL6A 5DI9B 1UEFA 1V5PA 2NZ8B 1U5EA 1UNPA 4HDQA 1WI1A 3VIAA 2QKMA 2H7EA 2RGNB 3DXCA 4GZUA 2D9YA 3PVLA 1FAOA 1FHXA 1UNRA 2Z0OA 3PVWA 1V88A 2VRWB 4HHVA 1W1DA 2M14A 1EGXA 3KRXA 2YS5A 3PVUA 5KQ4A 3QWMA 2D2QA 3ODOA 1UNQA 2J0MA 2CY5A 4BBKA 2P0FA 3U7DA 3PP2A 2ELBA 1E5WA 2MDXA 3ZVRA 4GPTB 2GCJA 3V5WA 2D9WA 1DYNA 5D3XA 4KVGB 1ISNA 1MPHA 1Z87A 2JP2A 3HW2B 5J3YA 1DDMA 4YL8A 3TVVA 2MWNB 4A6FB 2CY4A 2W2XC 4KHOA 1EVHA 1SGHA 1QQGA 4Y94A 1U5GA 2HE7A 3FSSA 4F7HA 1W1GA 2OQBA 2OTXA 3A98B 4HB0B 2D11A 1X1GA 1XR0B 4K2OA 2DA0A 1I7AA 3P6AA 2DYNA 5D3WA 3UZTA 2LKOA 3N7CA 4HAWB 2DN6A 4IAPA 2J0JA 4TYZA 1X11A 1SHCA 3GYPA 2DKPA 4GXBA 1U5DA 3KY9A 1DDVA 1GC7A 2Y8FA 2P0DA 5DIFB 2X18A 3D8DA 3TCAA 1U29A 4GN1A 5C6RA 1RRPB 3MPXA 3SV1A 5D3YA 5DH9B 5HE0A 1U5FA 1XD4A 2LULA 3ULBA 2BCJA 4K2PA 1WG7A 1LW3A 2COFA 2ROZB 1Y19B 2YF0A 1BTNA 1V89A 4XWXA 1BWNA 4P7IA 1V61A 3KZ1A 2NMBA 2D4QA 4A6HA 3G9WA 3M1IB 1KZGA 5FI1A 1ZSQA 1MK7B 3DXDA 3AU5A 1FHOA 2RSGA 3FM8C 3ULCA 1WVHA 1P3RA 1PMSA 2J59M 3PG7A 2H7DA 5L81A 5LOPB 2VSZA 3QBVB 2Y7BA 3X23A 3PSCA 2YT1A 1H4RA 2Z0QA 1NI2A 4ZRJA 4Z2MB 2R09A 1ZVRA 3PZDA 1DDWA 4EMOA 2EMSA 1V5UA 3DXEA 3WYFB 1FHWA 3CXBB 2DFKA 4HAYB 2LOXA 2ROVA 3BINA 5DHAB 3HK0A 1M7RA 3OANA 4H8SA 5KQ1A 1PLSA 5D3VA 1OMWA 2K2UA 5FI0A 3SO6A 3ML4A 1XKEA 3P7ZA 2K2JA 4HAZB 3F5RA 3TFMA 4DXAB 2ELAA 1OQNA 2QKLA 1FB8A 4C0AA 4HAXB 1FGYA 2D9VA 1LB1A 2DTCA 1QC6A 2D9XA 1EF1A 2UVMA 4A6FA 1WGUA 2DKQA 5JP4A 1PFJA 2MFQA 3PEGA 2Z0PA 2W2WA 2PZ1A 3QIJA 2DHIA 3T06A 2LOZA 1K5GB 1B55A 2W2XD 2RVBB 2YS1A 1N3HA 2P8VA 2D9ZA 2DHJA 1UPQA 2EMTA 2Y8GA 4A6KA 4GMXB 3SUZA 2DX1A 4CYEA 2DX5A 2YSZA 3SYXA 1ZM0A 2I1JA 1GG3A 3AJ4A 2YT0A 1X86A 2G35A 4HAUB 4L6EA 2GCLA 1RJ2A 2GS0A 1P6SA 1TJ6A 1XODA 3U8ZA 1V5MA 1M7EA 2P0HA 1NTVA 2M38A 3ZDTA 4EKUA 2R0DA 5J3TA 2RLOA 1NU2A 4NSWA 1ZC4B 3F0WA 4PQ0A 2EJ8A 3FEHA 1I2HA 2D10A 4WJ7A 4KHAA 1P5TA 2KGXB 1NTYA 5C16A 2UZSA 2DHKA 1WJ1A 4D0NB 4NY0A 5HE3A 2LG1A 5LONB 3VOQA 1WJMA 2VKIA 3KRWA 1Q67A 1XX0A 1BAKA 2RNRB 1TQZA 2ADZA 4TKNA 2HTHB 3D8FA 3TW1A 1ZC3B 2YVCA 4KHBB 4MT7A 5JHGA 1OY2A 2DYQA 3RCPA 2I5FA 3WA0A 1X1FA 4HDOA 4K17A 5JLJB 5D27A 2AEHA 4ZRKA 1FOEA 1IRSA 2V76A 3AU4A 1Y5OA 1MK9B 2I5CA 2RUKB 3MDBC 2Q13A 1K5DB 4HB4B 1WGQA 4MY6A 1TXDA 4HB2B 1MAIA 4GMVA 2FJLA 1FGZA 4K81A 1H10A 3IVFA 4IFSA 1AQCA 1J19A 4CHMA 2KUPA 1AWEA 1MKEA 4PNKA 1DBHA 2GJYA 3KSYA 4F7GA 3D8EA 2L2IA 1DROA 5DHFB 1U2BA 1J0WA 5HE2A 4Z2NA 5HE1A 3HQCA 3ODWA 1MIXA 1U27A 5CLQB 4WVFB 2UZRA 2YS3A 1KI1B 3BJIA 4ZRIA 1XCGA 2COCA 5C5BB 4A5KA
chains in the Genus database with same CATH superfamily
2MKRA 3ODXA 5GOWB 4IOYX 2KCJA 5CLLB 3DCXA 1MI1A 2J0KA 2E2XA 4DX8A 5LG4B 4KAXB 3NSUA 5C5BA 2N0YA 5J3QA 2CAYA 2K49A 4WSFA 2DLWA 1MIZB 2LYDA 2COAA 3CIKA 1BTKA 3O96A 1UPRA 2N23A 1EAZA 4YONA 3A8PA 4MK0A 1X05A 5JHHA 4HAVB 4B6HA 4DBBA 2IFSA 3A8QA 1W1HA 2CRFA 2YRYA 4F7UP 4EJNA 2I1KA 5EFXA 2ZPYA 1GC6A 2EC1A 1KZ7A 2CODA 2XQNM 5KCVA 2IYBA 2K00A 3GYOA 3LJUX 4HATB 3SNHA 4CHJA 4DX90 3TO1A 2L1CA 4HB3B 5C79A 2ZKMX 2AL6A 5DI9B 1UEFA 1T77A 1V5PA 2NZ8B 1U5EA 2KR0A 1UNPA 4HDQA 1WI1A 3VIAA 2QKMA 2H7EA 2RGNB 3DXCA 4GZUA 2D9YA 3PVLA 1FAOA 1FHXA 1UNRA 2Z0OA 3PVWA 1V88A 2VRWB 4HHVA 4KHBA 1W1DA 2M14A 1EGXA 3KRXA 2YS5A 4OSNA 3PVUA 3HIEA 5KQ4A 3QWMA 2D2QA 3ODOA 2GUMA 1UNQA 2J0MA 2CY5A 4QJ4B 4BBKA 2P0FA 3U7DA 3PP2A 2ELBA 1E5WA 2MDXA 3ZVRA 4GPTB 2GCJA 3V5WA 2D9WA 1DYNA 5D3XA 3NWFA 4KVGB 1ISNA 1MPHA 1Z87A 2JP2A 3HW2B 5J3YA 4D6WA 1DDMA 4YL8A 3TVVA 2MWNB 4A6FB 3B77A 2CY4A 2W2XC 4KHOA 1EVHA 1SGHA 1QQGA 4Y94A 1U5GA 2HE7A 3FSSA 4F7HA 1W1GA 2OQBA 4QXAB 2OTXA 3A98B 3HSAA 4HB0B 2D11A 1X1GA 1XR0B 4K2OA 2DA0A 1I7AA 3P6AA 2DYNA 5D3WA 3UZTA 2LKOA 3N7CA 4HAWB 2DN6A 4IAPA 2Z59A 2J0JA 4TYZA 1X11A 1SHCA 3GYPA 2DKPA 2YT2A 4QJ3B 4GXBA 1U5DA 3KY9A 1DDVA 1GC7A 2Y8FA 2P0DA 5DIFB 2X18A 3D8DA 3TCAA 1U29A 4GN1A 5C6RA 1RRPB 2Z4DA 3MPXA 3SV1A 5D3YA 5DH9B 5HE0A 1U5FA 1XD4A 3NW8A 4GOUA 2LULA 3ULBA 2BCJA 4K2PA 1WG7A 1LW3A 2COFA 2ROZB 1Y19B 2YF0A 1BTNA 1V89A 4XWXA 1BWNA 4P7IA 1V61A 3KZ1A 2NMBA 2D4QA 4A6HA 3G9WA 3M1IB 1KZGA 2K8EA 5FI1A 1ZSQA 1MK7B 3DXDA 3AU5A 1FHOA 2RSGA 3FM8C 3ULCA 1WVHA 1P3RA 1PMSA 2J59M 3PG7A 2H7DA 5L81A 5LOPB 2VSZA 3QBVB 2Y7BA 3U12A 4L1RA 3X23A 3PSCA 2YT1A 1H4RA 2Z0QA 1NI2A 4ZRJA 4Z2MB 2R09A 1ZVRA 3PZDA 1DDWA 4EMOA 2EMSA 1V5UA 3DXEA 3WYFB 1FHWA 3CXBB 2DFKA 4HAYB 2KUQA 2LOXA 2ROVA 3BINA 5DHAB 4DIXA 3HK0A 1M7RA 3OANA 4H8SA 2RRFA 5KQ1A 1PLSA 5D3VA 1OMWA 2K2UA 5FI0A 3SO6A 3ML4A 1XKEA 3P7ZA 2K2JA 4HAZB 3F5RA 3TFMA 4DXAB 2ELAA 4CSQA 1OQNA 2QKLA 1FB8A 4C0AA 2KIEA 4HAXB 1FGYA 2D9VA 1LB1A 2DTCA 1QC6A 2D9XA 1EF1A 2UVMA 4A6FA 4QJ5B 2R2YA 1WGUA 2DKQA 5JP4A 1PFJA 2MFQA 3PEGA 2Z0PA 2W2WA 2PZ1A 3OHMB 3QIJA 2DHIA 3T06A 2LOZA 1K5GB 3A58A 1B55A 2W2XD 2RVBB 2YS1A 1N3HA 2P8VA 2D9ZA 2NBVA 2DHJA 1UPQA 2EMTA 2Y8GA 4A6KA 4GMXB 3SUZA 2DX1A 4CYEA 2DX5A 2YSZA 3SYXA 1ZM0A 2I1JA 1GG3A 3AJ4A 2YT0A 1X86A 2G35A 4HAUB 4L6EA 2GCLA 1RJ2A 2GS0A 1P6SA 1TJ6A 2FJUB 1XODA 3U8ZA 1V5MA 1M7EA 2P0HA 1NTVA 2M38A 3NWDA 3ZDTA 4EKUA 2R0DA 5J3TA 2RLOA 1NU2A 4NSWA 1ZC4B 3F0WA 4PQ0A 2EJ8A 3FEHA 1I2HA 3NWAA 2D10A 4WJ7A 4KHAA 1P5TA 2KGXB 1NTYA 5C16A 2UZSA 2DHKA 1WJ1A 4D0NB 4NY0A 5HE3A 2LG1A 5LONB 3VOQA 1WJMA 2VKIA 3FVCA 3KRWA 1Q67A 1XX0A 1BAKA 2RNRB 1TQZA 2ADZA 4TKNA 2HTHB 3D8FA 3TW1A 1ZC3B 2YVCA 4KHBB 4MT7A 4HSIA 5JHGA 1OY2A 1ZYIA 2DYQA 3RCPA 2I5FA 3WA0A 5M4YB 1X1FA 4HDOA 4K17A 5JLJB 5D27A 2AEHA 4ZRKA 1FOEA 1IRSA 2V76A 3AU4A 1Y5OA 1MK9B 2I5CA 2RUKB 3MDBC 5IRSA 2Q13A 1K5DB 4HB4B 1WGQA 4MY6A 1TXDA 4HB2B 1MAIA 4GMVA 2FJLA 1FGZA 4K81A 4GNKB 1H10A 2KIGA 3IVFA 4IFSA 1AQCA 1J19A 4CHMA 2KUPA 1AWEA 2Z14A 1MKEA 4PNKA 1DBHA 2GJYA 3KSYA 4F7GA 2Z13A 3D8EA 2L2IA 1DROA 5DHFB 1U2BA 1J0WA 5HE2A 4Z2NA 5HE1A 3HQCA 3ODWA 1MIXA 1U27A 5I2MA 5CLQB 4WVFB 2UZRA 2YS3A 5I2SA 1KI1B 3BJIA 4ZRIA 1XCGA 2COCA 5C5BB 4A5KA 4OT1A
chains in the Genus database with same CATH topology
2MKRA 3ODXA 5GOWB 4IOYX 2KCJA 5CLLB 2J0KA 2E2XA 4DX8A 4KAXB 3NSUA 5C5BA 2N0YA 5J3QA 2CAYA 4WSFA 2DLWA 1MIZB 2LYDA 2COAA 3CIKA 1BTKA 3O96A 1UPRA 2N23A 1EAZA 4YONA 3A8PA 4MK0A 1X05A 5JHHA 4HAVB 4B6HA 4DBBA 2IFSA 3A8QA 1W1HA 2CRFA 2YRYA 4F7UP 4EJNA 2I1KA 5EFXA 2ZPYA 1GC6A 2EC1A 1KZ7A 2CODA 2XQNM 5KCVA 2IYBA 2K00A 3GYOA 3LJUX 4HATB 3SNHA 4CHJA 4DX90 3TO1A 2L1CA 4HB3B 5C79A 2AL6A 5DI9B 1UEFA 1V5PA 2NZ8B 1U5EA 1UNPA 4HDQA 1WI1A 3VIAA 2QKMA 2H7EA 2RGNB 3DXCA 4GZUA 2D9YA 3PVLA 1FAOA 1FHXA 1UNRA 2Z0OA 3PVWA 1V88A 2VRWB 4HHVA 1W1DA 2M14A 1EGXA 3KRXA 2YS5A 3PVUA 5KQ4A 3QWMA 2D2QA 3ODOA 1UNQA 2J0MA 2CY5A 4BBKA 2P0FA 3U7DA 3PP2A 2ELBA 1E5WA 2MDXA 3ZVRA 4GPTB 2GCJA 3V5WA 2D9WA 1DYNA 5D3XA 4KVGB 1ISNA 1MPHA 1Z87A 2JP2A 3HW2B 5J3YA 1DDMA 4YL8A 3TVVA 2MWNB 4A6FB 2CY4A 2W2XC 4KHOA 1EVHA 1SGHA 1QQGA 4Y94A 1U5GA 2HE7A 3FSSA 4F7HA 1W1GA 2OQBA 2OTXA 3A98B 4HB0B 2D11A 1X1GA 1XR0B 4K2OA 2DA0A 1I7AA 3P6AA 2DYNA 5D3WA 3UZTA 2LKOA 3N7CA 4HAWB 2DN6A 4IAPA 2J0JA 4TYZA 1X11A 1SHCA 3GYPA 2DKPA 4GXBA 1U5DA 3KY9A 1DDVA 1GC7A 2Y8FA 2P0DA 5DIFB 2X18A 3D8DA 3TCAA 1U29A 4GN1A 5C6RA 1RRPB 3MPXA 3SV1A 5D3YA 5DH9B 5HE0A 1U5FA 1XD4A 2LULA 3ULBA 2BCJA 4K2PA 1WG7A 1LW3A 2COFA 2ROZB 1Y19B 2YF0A 1BTNA 1V89A 4XWXA 1BWNA 4P7IA 1V61A 3KZ1A 2NMBA 2D4QA 4A6HA 3G9WA 3M1IB 1KZGA 5FI1A 1ZSQA 1MK7B 3DXDA 3AU5A 1FHOA 2RSGA 3FM8C 3ULCA 1WVHA 1P3RA 1PMSA 2J59M 3PG7A 2H7DA 5L81A 5LOPB 2VSZA 3QBVB 2Y7BA 3X23A 3PSCA 2YT1A 1H4RA 2Z0QA 1NI2A 4ZRJA 4Z2MB 2R09A 1ZVRA 3PZDA 1DDWA 4EMOA 2EMSA 1V5UA 3DXEA 3WYFB 1FHWA 3CXBB 2DFKA 4HAYB 2LOXA 2ROVA 3BINA 5DHAB 3HK0A 1M7RA 3OANA 4H8SA 5KQ1A 1PLSA 5D3VA 1OMWA 2K2UA 5FI0A 3SO6A 3ML4A 1XKEA 3P7ZA 2K2JA 4HAZB 3F5RA 3TFMA 4DXAB 2ELAA 1OQNA 2QKLA 1FB8A 4C0AA 4HAXB 1FGYA 2D9VA 1LB1A 2DTCA 1QC6A 2D9XA 1EF1A 2UVMA 4A6FA 1WGUA 2DKQA 5JP4A 1PFJA 2MFQA 3PEGA 2Z0PA 2W2WA 2PZ1A 3QIJA 2DHIA 3T06A 2LOZA 1K5GB 1B55A 2W2XD 2RVBB 2YS1A 1N3HA 2P8VA 2D9ZA 2DHJA 1UPQA 2EMTA 2Y8GA 4A6KA 4GMXB 3SUZA 2DX1A 4CYEA 2DX5A 2YSZA 3SYXA 1ZM0A 2I1JA 1GG3A 3AJ4A 2YT0A 1X86A 2G35A 4HAUB 4L6EA 2GCLA 1RJ2A 2GS0A 1P6SA 1TJ6A 1XODA 3U8ZA 1V5MA 1M7EA 2P0HA 1NTVA 2M38A 3ZDTA 4EKUA 2R0DA 5J3TA 2RLOA 1NU2A 4NSWA 1ZC4B 3F0WA 4PQ0A 2EJ8A 3FEHA 1I2HA 2D10A 4WJ7A 4KHAA 1P5TA 2KGXB 1NTYA 5C16A 2UZSA 2DHKA 1WJ1A 4D0NB 4NY0A 5HE3A 2LG1A 5LONB 3VOQA 1WJMA 2VKIA 3KRWA 1Q67A 1XX0A 1BAKA 2RNRB 1TQZA 2ADZA 4TKNA 2HTHB 3D8FA 3TW1A 1ZC3B 2YVCA 4KHBB 4MT7A 5JHGA 1OY2A 2DYQA 3RCPA 2I5FA 3WA0A 1X1FA 4HDOA 4K17A 5JLJB 5D27A 2AEHA 4ZRKA 1FOEA 1IRSA 2V76A 3AU4A 1Y5OA 1MK9B 2I5CA 2RUKB 3MDBC 2Q13A 1K5DB 4HB4B 1WGQA 4MY6A 1TXDA 4HB2B 1MAIA 4GMVA 2FJLA 1FGZA 4K81A 1H10A 3IVFA 4IFSA 1AQCA 1J19A 4CHMA 2KUPA 1AWEA 1MKEA 4PNKA 1DBHA 2GJYA 3KSYA 4F7GA 3D8EA 2L2IA 1DROA 5DHFB 1U2BA 1J0WA 5HE2A 4Z2NA 5HE1A 3HQCA 3ODWA 1MIXA 1U27A 5CLQB 4WVFB 2UZRA 2YS3A 1KI1B 3BJIA 4ZRIA 1XCGA 2COCA 5C5BB 4A5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MKR A;  3ODX A;  5GOW B;  4IOY X;  2KCJ A;  5CLL B;  2J0K A;  2E2X A;  4DX8 A;  4KAX B;  3NSU A;  5C5B A;  2N0Y A;  5J3Q A;  2CAY A;  4WSF A;  2DLW A;  1MIZ B;  2LYD A;  2COA A;  3CIK A;  1BTK A;  3O96 A;  1UPR A;  2N23 A;  1EAZ A;  4YON A;  3A8P A;  4MK0 A;  1X05 A;  5JHH A;  4HAV B;  4B6H A;  4DBB A;  2IFS A;  3A8Q A;  1W1H A;  2CRF A;  2YRY A;  4F7U P;  4EJN A;  2I1K A;  5EFX A;  2ZPY A;  1GC6 A;  2EC1 A;  1KZ7 A;  2COD A;  2XQN M;  5KCV A;  2IYB A;  2K00 A;  3GYO A;  3LJU X;  4HAT B;  3SNH A;  4CHJ A;  4DX9 0;  3TO1 A;  2L1C A;  4HB3 B;  5C79 A;  2AL6 A;  5DI9 B;  1UEF A;  1V5P A;  2NZ8 B;  1U5E A;  1UNP A;  4HDQ A;  1WI1 A;  3VIA A;  2QKM A;  2H7E A;  2RGN B;  3DXC A;  4GZU A;  2D9Y A;  3PVL A;  1FAO A;  1FHX A;  1UNR A;  2Z0O A;  3PVW A;  1V88 A;  2VRW B;  4HHV A;  1W1D A;  2M14 A;  1EGX A;  3KRX A;  2YS5 A;  3PVU A;  5KQ4 A;  3QWM A;  2D2Q A;  3ODO A;  1UNQ A;  2J0M A;  2CY5 A;  4BBK A;  2P0F A;  3U7D A;  3PP2 A;  2ELB A;  1E5W A;  2MDX A;  3ZVR A;  4GPT B;  2GCJ A;  3V5W A;  2D9W A;  1DYN A;  5D3X A;  4KVG B;  1ISN A;  1MPH A;  1Z87 A;  2JP2 A;  3HW2 B;  5J3Y A;  1DDM A;  4YL8 A;  3TVV A;  2MWN B;  4A6F B;  2CY4 A;  2W2X C;  4KHO A;  1EVH A;  1SGH A;  1QQG A;  4Y94 A;  1U5G A;  2HE7 A;  3FSS A;  4F7H A;  1W1G A;  2OQB A;  2OTX A;  3A98 B;  4HB0 B;  2D11 A;  1X1G A;  1XR0 B;  4K2O A;  2DA0 A;  1I7A A;  3P6A A;  2DYN A;  5D3W A;  3UZT A;  2LKO A;  3N7C A;  4HAW B;  2DN6 A;  4IAP A;  2J0J A;  4TYZ A;  1X11 A;  1SHC A;  3GYP A;  2DKP A;  4GXB A;  1U5D A;  3KY9 A;  1DDV A;  1GC7 A;  2Y8F A;  2P0D A;  5DIF B;  2X18 A;  3D8D A;  3TCA A;  1U29 A;  4GN1 A;  5C6R A;  1RRP B;  3MPX A;  3SV1 A;  5D3Y A;  5DH9 B;  5HE0 A;  1U5F A;  1XD4 A;  2LUL A;  3ULB A;  2BCJ A;  4K2P A;  1WG7 A;  1LW3 A;  2COF A;  2ROZ B;  1Y19 B;  2YF0 A;  1BTN A;  1V89 A;  4XWX A;  1BWN A;  4P7I A;  1V61 A;  3KZ1 A;  2NMB A;  2D4Q A;  4A6H A;  3G9W A;  3M1I B;  1KZG A;  5FI1 A;  1ZSQ A;  1MK7 B;  3DXD A;  3AU5 A;  1FHO A;  2RSG A;  3FM8 C;  3ULC A;  1WVH A;  1P3R A;  1PMS A;  2J59 M;  3PG7 A;  2H7D A;  5L81 A;  5LOP B;  2VSZ A;  3QBV B;  2Y7B A;  3X23 A;  3PSC A;  2YT1 A;  1H4R A;  2Z0Q A;  1NI2 A;  4ZRJ A;  4Z2M B;  2R09 A;  1ZVR A;  3PZD A;  1DDW A;  4EMO A;  2EMS A;  1V5U A;  3DXE A;  3WYF B;  1FHW A;  3CXB B;  2DFK A;  4HAY B;  2LOX A;  2ROV A;  3BIN A;  5DHA B;  3HK0 A;  1M7R A;  3OAN A;  4H8S A;  5KQ1 A;  1PLS A;  5D3V A;  1OMW A;  2K2U A;  5FI0 A;  3SO6 A;  3ML4 A;  1XKE A;  3P7Z A;  2K2J A;  4HAZ B;  3F5R A;  3TFM A;  4DXA B;  2ELA A;  1OQN A;  2QKL A;  1FB8 A;  4C0A A;  4HAX B;  1FGY A;  2D9V A;  1LB1 A;  2DTC A;  1QC6 A;  2D9X A;  1EF1 A;  2UVM A;  4A6F A;  1WGU A;  2DKQ A;  5JP4 A;  1PFJ A;  2MFQ A;  3PEG A;  2Z0P A;  2W2W A;  2PZ1 A;  3QIJ A;  2DHI A;  3T06 A;  2LOZ A;  1K5G B;  1B55 A;  2W2X D;  2RVB B;  2YS1 A;  1N3H A;  2P8V A;  2D9Z A;  2DHJ A;  1UPQ A;  2EMT A;  2Y8G A;  4A6K A;  4GMX B;  3SUZ A;  2DX1 A;  4CYE A;  2DX5 A;  2YSZ A;  3SYX A;  1ZM0 A;  2I1J A;  1GG3 A;  3AJ4 A;  2YT0 A;  1X86 A;  2G35 A;  4HAU B;  4L6E A;  2GCL A;  1RJ2 A;  2GS0 A;  1P6S A;  1TJ6 A;  1XOD A;  3U8Z A;  1V5M A;  1M7E A;  2P0H A;  1NTV A;  2M38 A;  3ZDT A;  4EKU A;  2R0D A;  5J3T A;  2RLO A;  1NU2 A;  4NSW A;  1ZC4 B;  3F0W A;  4PQ0 A;  2EJ8 A;  3FEH A;  1I2H A;  2D10 A;  4WJ7 A;  4KHA A;  1P5T A;  2KGX B;  1NTY A;  5C16 A;  2UZS A;  2DHK A;  1WJ1 A;  4D0N B;  4NY0 A;  5HE3 A;  2LG1 A;  5LON B;  3VOQ A;  1WJM A;  2VKI A;  3KRW A;  1Q67 A;  1XX0 A;  1BAK A;  2RNR B;  1TQZ A;  2ADZ A;  4TKN A;  2HTH B;  3D8F A;  3TW1 A;  1ZC3 B;  2YVC A;  4KHB B;  4MT7 A;  5JHG A;  1OY2 A;  2DYQ A;  3RCP A;  2I5F A;  3WA0 A;  1X1F A;  4HDO A;  4K17 A;  5JLJ B;  5D27 A;  2AEH A;  4ZRK A;  1FOE A;  1IRS A;  2V76 A;  3AU4 A;  1Y5O A;  1MK9 B;  2I5C A;  2RUK B;  3MDB C;  2Q13 A;  1K5D B;  4HB4 B;  1WGQ A;  4MY6 A;  1TXD A;  4HB2 B;  1MAI A;  4GMV A;  2FJL A;  1FGZ A;  4K81 A;  1H10 A;  3IVF A;  4IFS A;  1AQC A;  1J19 A;  4CHM A;  2KUP A;  1AWE A;  1MKE A;  4PNK A;  1DBH A;  2GJY A;  3KSY A;  4F7G A;  3D8E A;  2L2I A;  1DRO A;  5DHF B;  1U2B A;  1J0W A;  5HE2 A;  4Z2N A;  5HE1 A;  3HQC A;  3ODW A;  1MIX A;  1U27 A;  5CLQ B;  4WVF B;  2UZR A;  2YS3 A;  1KI1 B;  3BJI A;  4ZRI A;  1XCG A;  2COC A;  5C5B B;  4A5K A; 
#chains in the Genus database with same CATH topology
 2MKR A;  3ODX A;  5GOW B;  4IOY X;  2KCJ A;  5CLL B;  3DCX A;  1MI1 A;  2J0K A;  2E2X A;  4DX8 A;  5LG4 B;  4KAX B;  3NSU A;  5C5B A;  2N0Y A;  5J3Q A;  2CAY A;  2K49 A;  4WSF A;  2DLW A;  1MIZ B;  2LYD A;  2COA A;  3CIK A;  1BTK A;  3O96 A;  1UPR A;  2N23 A;  1EAZ A;  4YON A;  3A8P A;  4MK0 A;  1X05 A;  5JHH A;  4HAV B;  4B6H A;  4DBB A;  2IFS A;  3A8Q A;  1W1H A;  2CRF A;  2YRY A;  4F7U P;  4EJN A;  2I1K A;  5EFX A;  2ZPY A;  1GC6 A;  2EC1 A;  1KZ7 A;  2COD A;  2XQN M;  5KCV A;  2IYB A;  2K00 A;  3GYO A;  3LJU X;  4HAT B;  3SNH A;  4CHJ A;  4DX9 0;  3TO1 A;  2L1C A;  4HB3 B;  5C79 A;  2ZKM X;  2AL6 A;  5DI9 B;  1UEF A;  1T77 A;  1V5P A;  2NZ8 B;  1U5E A;  2KR0 A;  1UNP A;  4HDQ A;  1WI1 A;  3VIA A;  2QKM A;  2H7E A;  2RGN B;  3DXC A;  4GZU A;  2D9Y A;  3PVL A;  1FAO A;  1FHX A;  1UNR A;  2Z0O A;  3PVW A;  1V88 A;  2VRW B;  4HHV A;  4KHB A;  1W1D A;  2M14 A;  1EGX A;  3KRX A;  2YS5 A;  4OSN A;  3PVU A;  3HIE A;  5KQ4 A;  3QWM A;  2D2Q A;  3ODO A;  2GUM A;  1UNQ A;  2J0M A;  2CY5 A;  4QJ4 B;  4BBK A;  2P0F A;  3U7D A;  3PP2 A;  2ELB A;  1E5W A;  2MDX A;  3ZVR A;  4GPT B;  2GCJ A;  3V5W A;  2D9W A;  1DYN A;  5D3X A;  3NWF A;  4KVG B;  1ISN A;  1MPH A;  1Z87 A;  2JP2 A;  3HW2 B;  5J3Y A;  4D6W A;  1DDM A;  4YL8 A;  3TVV A;  2MWN B;  4A6F B;  3B77 A;  2CY4 A;  2W2X C;  4KHO A;  1EVH A;  1SGH A;  1QQG A;  4Y94 A;  1U5G A;  2HE7 A;  3FSS A;  4F7H A;  1W1G A;  2OQB A;  4QXA B;  2OTX A;  3A98 B;  3HSA A;  4HB0 B;  2D11 A;  1X1G A;  1XR0 B;  4K2O A;  2DA0 A;  1I7A A;  3P6A A;  2DYN A;  5D3W A;  3UZT A;  2LKO A;  3N7C A;  4HAW B;  2DN6 A;  4IAP A;  2Z59 A;  2J0J A;  4TYZ A;  1X11 A;  1SHC A;  3GYP A;  2DKP A;  2YT2 A;  4QJ3 B;  4GXB A;  1U5D A;  3KY9 A;  1DDV A;  1GC7 A;  2Y8F A;  2P0D A;  5DIF B;  2X18 A;  3D8D A;  3TCA A;  1U29 A;  4GN1 A;  5C6R A;  1RRP B;  2Z4D A;  3MPX A;  3SV1 A;  5D3Y A;  5DH9 B;  5HE0 A;  1U5F A;  1XD4 A;  3NW8 A;  4GOU A;  2LUL A;  3ULB A;  2BCJ A;  4K2P A;  1WG7 A;  1LW3 A;  2COF A;  2ROZ B;  1Y19 B;  2YF0 A;  1BTN A;  1V89 A;  4XWX A;  1BWN A;  4P7I A;  1V61 A;  3KZ1 A;  2NMB A;  2D4Q A;  4A6H A;  3G9W A;  3M1I B;  1KZG A;  2K8E A;  5FI1 A;  1ZSQ A;  1MK7 B;  3DXD A;  3AU5 A;  1FHO A;  2RSG A;  3FM8 C;  3ULC A;  1WVH A;  1P3R A;  1PMS A;  2J59 M;  3PG7 A;  2H7D A;  5L81 A;  5LOP B;  2VSZ A;  3QBV B;  2Y7B A;  3U12 A;  4L1R A;  3X23 A;  3PSC A;  2YT1 A;  1H4R A;  2Z0Q A;  1NI2 A;  4ZRJ A;  4Z2M B;  2R09 A;  1ZVR A;  3PZD A;  1DDW A;  4EMO A;  2EMS A;  1V5U A;  3DXE A;  3WYF B;  1FHW A;  3CXB B;  2DFK A;  4HAY B;  2KUQ A;  2LOX A;  2ROV A;  3BIN A;  5DHA B;  4DIX A;  3HK0 A;  1M7R A;  3OAN A;  4H8S A;  2RRF A;  5KQ1 A;  1PLS A;  5D3V A;  1OMW A;  2K2U A;  5FI0 A;  3SO6 A;  3ML4 A;  1XKE A;  3P7Z A;  2K2J A;  4HAZ B;  3F5R A;  3TFM A;  4DXA B;  2ELA A;  4CSQ A;  1OQN A;  2QKL A;  1FB8 A;  4C0A A;  2KIE A;  4HAX B;  1FGY A;  2D9V A;  1LB1 A;  2DTC A;  1QC6 A;  2D9X A;  1EF1 A;  2UVM A;  4A6F A;  4QJ5 B;  2R2Y A;  1WGU A;  2DKQ A;  5JP4 A;  1PFJ A;  2MFQ A;  3PEG A;  2Z0P A;  2W2W A;  2PZ1 A;  3OHM B;  3QIJ A;  2DHI A;  3T06 A;  2LOZ A;  1K5G B;  3A58 A;  1B55 A;  2W2X D;  2RVB B;  2YS1 A;  1N3H A;  2P8V A;  2D9Z A;  2NBV A;  2DHJ A;  1UPQ A;  2EMT A;  2Y8G A;  4A6K A;  4GMX B;  3SUZ A;  2DX1 A;  4CYE A;  2DX5 A;  2YSZ A;  3SYX A;  1ZM0 A;  2I1J A;  1GG3 A;  3AJ4 A;  2YT0 A;  1X86 A;  2G35 A;  4HAU B;  4L6E A;  2GCL A;  1RJ2 A;  2GS0 A;  1P6S A;  1TJ6 A;  2FJU B;  1XOD A;  3U8Z A;  1V5M A;  1M7E A;  2P0H A;  1NTV A;  2M38 A;  3NWD A;  3ZDT A;  4EKU A;  2R0D A;  5J3T A;  2RLO A;  1NU2 A;  4NSW A;  1ZC4 B;  3F0W A;  4PQ0 A;  2EJ8 A;  3FEH A;  1I2H A;  3NWA A;  2D10 A;  4WJ7 A;  4KHA A;  1P5T A;  2KGX B;  1NTY A;  5C16 A;  2UZS A;  2DHK A;  1WJ1 A;  4D0N B;  4NY0 A;  5HE3 A;  2LG1 A;  5LON B;  3VOQ A;  1WJM A;  2VKI A;  3FVC A;  3KRW A;  1Q67 A;  1XX0 A;  1BAK A;  2RNR B;  1TQZ A;  2ADZ A;  4TKN A;  2HTH B;  3D8F A;  3TW1 A;  1ZC3 B;  2YVC A;  4KHB B;  4MT7 A;  4HSI A;  5JHG A;  1OY2 A;  1ZYI A;  2DYQ A;  3RCP A;  2I5F A;  3WA0 A;  5M4Y B;  1X1F A;  4HDO A;  4K17 A;  5JLJ B;  5D27 A;  2AEH A;  4ZRK A;  1FOE A;  1IRS A;  2V76 A;  3AU4 A;  1Y5O A;  1MK9 B;  2I5C A;  2RUK B;  3MDB C;  5IRS A;  2Q13 A;  1K5D B;  4HB4 B;  1WGQ A;  4MY6 A;  1TXD A;  4HB2 B;  1MAI A;  4GMV A;  2FJL A;  1FGZ A;  4K81 A;  4GNK B;  1H10 A;  2KIG A;  3IVF A;  4IFS A;  1AQC A;  1J19 A;  4CHM A;  2KUP A;  1AWE A;  2Z14 A;  1MKE A;  4PNK A;  1DBH A;  2GJY A;  3KSY A;  4F7G A;  2Z13 A;  3D8E A;  2L2I A;  1DRO A;  5DHF B;  1U2B A;  1J0W A;  5HE2 A;  4Z2N A;  5HE1 A;  3HQC A;  3ODW A;  1MIX A;  1U27 A;  5I2M A;  5CLQ B;  4WVF B;  2UZR A;  2YS3 A;  5I2S A;  1KI1 B;  3BJI A;  4ZRI A;  1XCG A;  2COC A;  5C5B B;  4A5K A;  4OT1 A; 
#chains in the Genus database with same CATH homology
 2MKR A;  3ODX A;  5GOW B;  4IOY X;  2KCJ A;  5CLL B;  2J0K A;  2E2X A;  4DX8 A;  4KAX B;  3NSU A;  5C5B A;  2N0Y A;  5J3Q A;  2CAY A;  4WSF A;  2DLW A;  1MIZ B;  2LYD A;  2COA A;  3CIK A;  1BTK A;  3O96 A;  1UPR A;  2N23 A;  1EAZ A;  4YON A;  3A8P A;  4MK0 A;  1X05 A;  5JHH A;  4HAV B;  4B6H A;  4DBB A;  2IFS A;  3A8Q A;  1W1H A;  2CRF A;  2YRY A;  4F7U P;  4EJN A;  2I1K A;  5EFX A;  2ZPY A;  1GC6 A;  2EC1 A;  1KZ7 A;  2COD A;  2XQN M;  5KCV A;  2IYB A;  2K00 A;  3GYO A;  3LJU X;  4HAT B;  3SNH A;  4CHJ A;  4DX9 0;  3TO1 A;  2L1C A;  4HB3 B;  5C79 A;  2AL6 A;  5DI9 B;  1UEF A;  1V5P A;  2NZ8 B;  1U5E A;  1UNP A;  4HDQ A;  1WI1 A;  3VIA A;  2QKM A;  2H7E A;  2RGN B;  3DXC A;  4GZU A;  2D9Y A;  3PVL A;  1FAO A;  1FHX A;  1UNR A;  2Z0O A;  3PVW A;  1V88 A;  2VRW B;  4HHV A;  1W1D A;  2M14 A;  1EGX A;  3KRX A;  2YS5 A;  3PVU A;  5KQ4 A;  3QWM A;  2D2Q A;  3ODO A;  1UNQ A;  2J0M A;  2CY5 A;  4BBK A;  2P0F A;  3U7D A;  3PP2 A;  2ELB A;  1E5W A;  2MDX A;  3ZVR A;  4GPT B;  2GCJ A;  3V5W A;  2D9W A;  1DYN A;  5D3X A;  4KVG B;  1ISN A;  1MPH A;  1Z87 A;  2JP2 A;  3HW2 B;  5J3Y A;  1DDM A;  4YL8 A;  3TVV A;  2MWN B;  4A6F B;  2CY4 A;  2W2X C;  4KHO A;  1EVH A;  1SGH A;  1QQG A;  4Y94 A;  1U5G A;  2HE7 A;  3FSS A;  4F7H A;  1W1G A;  2OQB A;  2OTX A;  3A98 B;  4HB0 B;  2D11 A;  1X1G A;  1XR0 B;  4K2O A;  2DA0 A;  1I7A A;  3P6A A;  2DYN A;  5D3W A;  3UZT A;  2LKO A;  3N7C A;  4HAW B;  2DN6 A;  4IAP A;  2J0J A;  4TYZ A;  1X11 A;  1SHC A;  3GYP A;  2DKP A;  4GXB A;  1U5D A;  3KY9 A;  1DDV A;  1GC7 A;  2Y8F A;  2P0D A;  5DIF B;  2X18 A;  3D8D A;  3TCA A;  1U29 A;  4GN1 A;  5C6R A;  1RRP B;  3MPX A;  3SV1 A;  5D3Y A;  5DH9 B;  5HE0 A;  1U5F A;  1XD4 A;  2LUL A;  3ULB A;  2BCJ A;  4K2P A;  1WG7 A;  1LW3 A;  2COF A;  2ROZ B;  1Y19 B;  2YF0 A;  1BTN A;  1V89 A;  4XWX A;  1BWN A;  4P7I A;  1V61 A;  3KZ1 A;  2NMB A;  2D4Q A;  4A6H A;  3G9W A;  3M1I B;  1KZG A;  5FI1 A;  1ZSQ A;  1MK7 B;  3DXD A;  3AU5 A;  1FHO A;  2RSG A;  3FM8 C;  3ULC A;  1WVH A;  1P3R A;  1PMS A;  2J59 M;  3PG7 A;  2H7D A;  5L81 A;  5LOP B;  2VSZ A;  3QBV B;  2Y7B A;  3X23 A;  3PSC A;  2YT1 A;  1H4R A;  2Z0Q A;  1NI2 A;  4ZRJ A;  4Z2M B;  2R09 A;  1ZVR A;  3PZD A;  1DDW A;  4EMO A;  2EMS A;  1V5U A;  3DXE A;  3WYF B;  1FHW A;  3CXB B;  2DFK A;  4HAY B;  2LOX A;  2ROV A;  3BIN A;  5DHA B;  3HK0 A;  1M7R A;  3OAN A;  4H8S A;  5KQ1 A;  1PLS A;  5D3V A;  1OMW A;  2K2U A;  5FI0 A;  3SO6 A;  3ML4 A;  1XKE A;  3P7Z A;  2K2J A;  4HAZ B;  3F5R A;  3TFM A;  4DXA B;  2ELA A;  1OQN A;  2QKL A;  1FB8 A;  4C0A A;  4HAX B;  1FGY A;  2D9V A;  1LB1 A;  2DTC A;  1QC6 A;  2D9X A;  1EF1 A;  2UVM A;  4A6F A;  1WGU A;  2DKQ A;  5JP4 A;  1PFJ A;  2MFQ A;  3PEG A;  2Z0P A;  2W2W A;  2PZ1 A;  3QIJ A;  2DHI A;  3T06 A;  2LOZ A;  1K5G B;  1B55 A;  2W2X D;  2RVB B;  2YS1 A;  1N3H A;  2P8V A;  2D9Z A;  2DHJ A;  1UPQ A;  2EMT A;  2Y8G A;  4A6K A;  4GMX B;  3SUZ A;  2DX1 A;  4CYE A;  2DX5 A;  2YSZ A;  3SYX A;  1ZM0 A;  2I1J A;  1GG3 A;  3AJ4 A;  2YT0 A;  1X86 A;  2G35 A;  4HAU B;  4L6E A;  2GCL A;  1RJ2 A;  2GS0 A;  1P6S A;  1TJ6 A;  1XOD A;  3U8Z A;  1V5M A;  1M7E A;  2P0H A;  1NTV A;  2M38 A;  3ZDT A;  4EKU A;  2R0D A;  5J3T A;  2RLO A;  1NU2 A;  4NSW A;  1ZC4 B;  3F0W A;  4PQ0 A;  2EJ8 A;  3FEH A;  1I2H A;  2D10 A;  4WJ7 A;  4KHA A;  1P5T A;  2KGX B;  1NTY A;  5C16 A;  2UZS A;  2DHK A;  1WJ1 A;  4D0N B;  4NY0 A;  5HE3 A;  2LG1 A;  5LON B;  3VOQ A;  1WJM A;  2VKI A;  3KRW A;  1Q67 A;  1XX0 A;  1BAK A;  2RNR B;  1TQZ A;  2ADZ A;  4TKN A;  2HTH B;  3D8F A;  3TW1 A;  1ZC3 B;  2YVC A;  4KHB B;  4MT7 A;  5JHG A;  1OY2 A;  2DYQ A;  3RCP A;  2I5F A;  3WA0 A;  1X1F A;  4HDO A;  4K17 A;  5JLJ B;  5D27 A;  2AEH A;  4ZRK A;  1FOE A;  1IRS A;  2V76 A;  3AU4 A;  1Y5O A;  1MK9 B;  2I5C A;  2RUK B;  3MDB C;  2Q13 A;  1K5D B;  4HB4 B;  1WGQ A;  4MY6 A;  1TXD A;  4HB2 B;  1MAI A;  4GMV A;  2FJL A;  1FGZ A;  4K81 A;  1H10 A;  3IVF A;  4IFS A;  1AQC A;  1J19 A;  4CHM A;  2KUP A;  1AWE A;  1MKE A;  4PNK A;  1DBH A;  2GJY A;  3KSY A;  4F7G A;  3D8E A;  2L2I A;  1DRO A;  5DHF B;  1U2B A;  1J0W A;  5HE2 A;  4Z2N A;  5HE1 A;  3HQC A;  3ODW A;  1MIX A;  1U27 A;  5CLQ B;  4WVF B;  2UZR A;  2YS3 A;  1KI1 B;  3BJI A;  4ZRI A;  1XCG A;  2COC A;  5C5B B;  4A5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...