1B55A

Ph domain from bruton's tyrosine kinase in complex with inositol 1,3,4,5-tetrakisphosphate
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
169
structure length
163
Chain Sequence
AAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQIPRRMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYROSINE-PROTEIN KINASE BTK
publication title Structure of the PH domain from Bruton's tyrosine kinase in complex with inositol 1,3,4,5-tetrakisphosphate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 33
structure length 163
sequence length 169
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1999-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00779 BTK BTK motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1b55A00
3M1IB 3A8PA 2YSZA 2W2XC 2DKQA 3TW1A 4A6FB 4A5KA 2DX1A 4MK0A 4HAVB 4EKUA 2DHKA 1P3RA 1KZGA 2YS5A 4K81A 1DDMA 1EF1A 3WA0A 3ODWA 2D9YA 4ZRIA 2K00A 3HK0A 3MPXA 2D4QA 3TFMA 1K5GB 2DHIA 3UZTA 1XCGA 4ZRKA 1U5DA 1QC6A 1TQZA 5CLQB 2J0JA 1ZC3B 2R0DA 2LYDA 1MPHA 2GS0A 4DX8A 2EMSA 1X1GA 2FJLA 2JP2A 1UEFA 2CRFA 5DHAB 3V5WA 3P6AA 2CY4A 2D11A 1FB8A 1M7EA 4K17A 1V61A 2ZPYA 2UVMA 4HB3B 4HAYB 1X11A 4F7HA 2LULA 4DXAB 3D8EA 1U29A 2QKLA 4YL8A 1Q67A 3O96A 3KY9A 1DDVA 1FHXA 2RLOA 1X1FA 4IAPA 1N3HA 5LOPB 2PZ1A 2MWNB 3X23A 2XQNM 3PP2A 4CHJA 1MKEA 5GOWB 2GCJA 3SYXA 4HDOA 1BTNA 2D10A 4L6EA 2EC1A 1V5MA 2LOXA 2K2JA 2YT1A 4F7UP 3AU4A 5HE0A 1ISNA 4NY0A 2DKPA 3F0WA 3VIAA 2MDXA 4B6HA 2H7EA 2Y8GA 1DYNA 2HE7A 3DXEA 1J0WA 4K2OA 1QQGA 4K2PA 2KCJA 3GYPA 1XD4A 2I1JA 3LJUX 4MY6A 5L81A 1P6SA 5D27A 3NSUA 2UZSA 3AJ4A 4KHBB 1V88A 1WVHA 1RRPB 5J3QA 5D3XA 1SHCA 2COAA 2ROVA 1MIXA 2AL6A 2H7DA 3A98B 3SUZA 1WJMA 1BTKA 3PVUA 5HE2A 1J19A 1M7RA 2L2IA 2OQBA 3ULBA 3WYFB 2M38A 2GCLA 5C5BA 3SO6A 1WI1A 2P0DA 3HW2B 1W1GA 2I5CA 4WVFB 4EJNA 1MAIA 4GN1A 1KI1B 3HQCA 2Z0QA 4GZUA 2DYNA 4P7IA 2N23A 5C6RA 3FM8C 4DBBA 2I1KA 5D3VA 2W2XD 1LW3A 4XWXA 4TKNA 2M14A 1NU2A 2IYBA 4PQ0A 1Z87A 2YF0A 3PZDA 2D9VA 2MKRA 3KRWA 1Y19B 2YT0A 3QIJA 2DX5A 5D3YA 3TCAA 2R09A 3N7CA 4GMVA 3ML4A 1W1HA 1DBHA 2DA0A 4CYEA 2Q13A 1WGQA 5FI0A 1OY2A 1MK9B 1I2HA 4PNKA 2RVBB 4KHAA 1UNQA 5D3WA 5DHFB 1XODA 1FGZA 2Y8FA 1XR0B 3P7ZA 1X05A 1ZSQA 4C0AA 1KZ7A 4BBKA 1V5PA 1NTYA 2NMBA 1H10A 3FSSA 1P5TA 3T06A 5LONB 5FI1A 4HAZB 3D8FA 2EJ8A 1E5WA 4CHMA 4KVGB 5C5BB 2J0MA 5DH9B 3OANA 2DN6A 2D9XA 1GG3A 2I5FA 5CLLB 2Z0PA 3DXDA 4EMOA 1NTVA 1XKEA 5HE3A 2BCJA 1FHWA 1XX0A 4HB0B 4Z2NA 2J0KA 2MFQA 2D9WA 1UPRA 4GXBA 3BJIA 2VRWB 2CODA 1GC6A 2V76A 4HB2B 2AEHA 1EVHA 3BINA 3AU5A 4ZRJA 3PEGA 1FAOA 3A8QA 4TYZA 2RUKB 4IFSA 2L1CA 2Y7BA 4WJ7A 5J3TA 3PVLA 1RJ2A 2DHJA 2YS1A 3PSCA 3MDBC 3PG7A 5EFXA 3CIKA 1ZVRA 1MK7B 1BWNA 2X18A 3F5RA 3ULCA 2OTXA 5HE1A 5DIFB 4IOYX 2YRYA 3KSYA 2COCA 1FOEA 1B55A 1ZC4B 3TO1A 2ELBA 2ROZB 1H4RA 1X86A 2CAYA 2COFA 2D2QA 3SV1A 4HHVA 2J59M 1U5FA 1V89A 2QKMA 1U27A 4KHOA 1U5GA 1U2BA 4WSFA 4F7GA 2KGXB 3U8ZA 5KCVA 4KAXB 1GC7A 4NSWA 1LB1A 4A6KA 3QBVB 4YONA 1MIZB 1WGUA 5C79A 4HATB 3CXBB 1UNRA 1WJ1A 4D0NB 1EAZA 1U5EA 2P8VA 2VKIA 4Z2MB 1FHOA 2YS3A 3U7DA 2E2XA 4GPTB 1SGHA 3QWMA 4HAUB 5JHHA 3ZVRA 3SNHA 3PVWA 1UPQA 4DX90 2DFKA 1I7AA 2KUPA 4A6HA 3DXCA 2EMTA 2ELAA 5DI9B 5KQ4A 2LOZA 4HAWB 4MT7A 3G9WA 4Y94A 1IRSA 1DROA 2HTHB 2W2WA 3VOQA 3KZ1A 1FGYA 2GJYA 3ODXA 4A6FA 2UZRA 2P0FA 2RNRB 1OQNA 2RSGA 1AQCA 2DLWA 2G35A 2RGNB 1Y5OA 4GMXB 1ZM0A 3FEHA 2K2UA 2N0YA 1PLSA 3IVFA 2D9ZA 4HDQA 3ZDTA 2NZ8B 1V5UA 3ODOA 2ADZA 1UNPA 5JP4A 5KQ1A 2YVCA 1BAKA 1EGXA 4HAXB 1OMWA 2IFSA 1PMSA 2LKOA 2P0HA 5JLJB 2VSZA 1NI2A 3RCPA 2CY5A 2Z0OA 1WG7A 5C16A 1K5DB 2LG1A 2DTCA 1TJ6A 3GYOA 1TXDA 1DDWA 5J3YA 1PFJA 3TVVA 1AWEA 1W1DA 4HB4B 5JHGA 4H8SA 3D8DA 3KRXA 2DYQA
chains in the Genus database with same CATH superfamily
3M1IB 3A8PA 2YSZA 2W2XC 2DKQA 3TW1A 4A6FB 2K49A 4A5KA 2DX1A 4MK0A 4HAVB 4EKUA 2DHKA 1P3RA 1KZGA 2KIGA 2YS5A 4K81A 1DDMA 1EF1A 3WA0A 3ODWA 2D9YA 4ZRIA 2K00A 3HK0A 3MPXA 2D4QA 3TFMA 1K5GB 2DHIA 3NWAA 3UZTA 1XCGA 4ZRKA 1U5DA 1QC6A 1TQZA 4KHBA 5CLQB 2J0JA 1ZC3B 2R0DA 2LYDA 1MPHA 2GS0A 4DX8A 2EMSA 1X1GA 2FJLA 2JP2A 1UEFA 2CRFA 5DHAB 3V5WA 3P6AA 2CY4A 2D11A 1FB8A 1M7EA 4K17A 1V61A 2ZPYA 5LG4B 2UVMA 4HB3B 4HAYB 1X11A 4F7HA 3B77A 2RRFA 2LULA 4DXAB 3D8EA 1U29A 2QKLA 4YL8A 1Q67A 3O96A 3KY9A 1DDVA 1FHXA 2RLOA 1X1FA 3NWDA 4IAPA 4QJ5B 1N3HA 5LOPB 2PZ1A 2MWNB 3X23A 2XQNM 3PP2A 4CHJA 1MKEA 5GOWB 2GCJA 3SYXA 4HDOA 1BTNA 2D10A 4L6EA 2R2YA 2EC1A 1V5MA 2LOXA 2K2JA 2YT1A 4F7UP 3AU4A 5HE0A 1ISNA 3NW8A 2DKPA 4NY0A 3F0WA 3VIAA 2MDXA 3HIEA 4B6HA 2H7EA 2Y8GA 1DYNA 2HE7A 3DXEA 1J0WA 4K2OA 1QQGA 4K2PA 2KCJA 3GYPA 1XD4A 2I1JA 3LJUX 4MY6A 5L81A 1P6SA 5D27A 3NSUA 3HSAA 2UZSA 3AJ4A 4KHBB 1V88A 1WVHA 1RRPB 2Z13A 5J3QA 5D3XA 1SHCA 2COAA 2GUMA 2ROVA 4CSQA 1MIXA 2AL6A 2H7DA 3A98B 3SUZA 1WJMA 1BTKA 3PVUA 5HE2A 1J19A 1M7RA 2K8EA 2L2IA 2OQBA 3ULBA 3WYFB 2M38A 2GCLA 5C5BA 3SO6A 1WI1A 2P0DA 3HW2B 1W1GA 2I5CA 4WVFB 4EJNA 2NBVA 1MAIA 4GN1A 1KI1B 3HQCA 2Z0QA 4GZUA 2DYNA 4P7IA 2N23A 5C6RA 3FM8C 4DBBA 2I1KA 5D3VA 2W2XD 1LW3A 4XWXA 4TKNA 2M14A 1NU2A 2IYBA 4PQ0A 1Z87A 2YF0A 3PZDA 2FJUB 2D9VA 2MKRA 3KRWA 1Y19B 2YT0A 3QIJA 2DX5A 1MI1A 5D3YA 3TCAA 2R09A 3N7CA 4GMVA 3ML4A 1W1HA 1DBHA 2DA0A 4CYEA 2Q13A 1WGQA 5FI0A 1OY2A 1MK9B 1I2HA 4PNKA 2RVBB 4KHAA 5M4YB 1UNQA 5D3WA 5DHFB 1XODA 1FGZA 2Y8FA 1XR0B 3P7ZA 1X05A 1ZSQA 4C0AA 1KZ7A 4BBKA 1V5PA 1NTYA 4QJ3B 2NMBA 1H10A 3FSSA 2ZKMX 1P5TA 2Z14A 3T06A 5LONB 5FI1A 4HAZB 3D8FA 2EJ8A 1E5WA 4CHMA 4KVGB 5C5BB 2J0MA 3DCXA 5DH9B 3OANA 2DN6A 2D9XA 1T77A 1GG3A 2I5FA 5CLLB 2Z0PA 3DXDA 4EMOA 1NTVA 1XKEA 5HE3A 2BCJA 3U12A 1FHWA 1XX0A 4HB0B 4Z2NA 2J0KA 2MFQA 2D9WA 1UPRA 4GXBA 3BJIA 4OSNA 2VRWB 2CODA 1GC6A 2V76A 4HB2B 2AEHA 1EVHA 3BINA 4D6WA 3AU5A 4ZRJA 3PEGA 1FAOA 2Z4DA 3A8QA 4TYZA 2RUKB 4IFSA 2L1CA 3A58A 2Y7BA 4WJ7A 5J3TA 3PVLA 1RJ2A 2DHJA 3FVCA 2YS1A 3PSCA 5I2SA 4GOUA 3MDBC 3PG7A 5EFXA 2Z59A 3CIKA 1ZVRA 1MK7B 1BWNA 2X18A 3F5RA 3ULCA 2OTXA 5HE1A 5DIFB 4L1RA 4IOYX 2YRYA 3KSYA 2COCA 1FOEA 1B55A 1ZC4B 5IRSA 3TO1A 2ELBA 2ROZB 1H4RA 1X86A 2CAYA 2COFA 2D2QA 3SV1A 3OHMB 4HHVA 2J59M 1U5FA 1V89A 2QKMA 1U27A 4KHOA 1U5GA 1U2BA 4WSFA 4F7GA 2KGXB 3U8ZA 5KCVA 4KAXB 4DIXA 1GC7A 4QJ4B 4NSWA 1LB1A 4A6KA 3QBVB 4YONA 1MIZB 1WGUA 5C79A 2KIEA 4HATB 3CXBB 1UNRA 5I2MA 1WJ1A 4D0NB 1EAZA 1U5EA 2P8VA 2VKIA 4Z2MB 1FHOA 2YS3A 3U7DA 2E2XA 4GPTB 1SGHA 3QWMA 4HAUB 5JHHA 3ZVRA 3SNHA 3PVWA 1UPQA 4DX90 2DFKA 1I7AA 2KUPA 4A6HA 3DXCA 2EMTA 2ELAA 5DI9B 5KQ4A 2LOZA 4HAWB 4MT7A 4GNKB 4HSIA 3G9WA 2KR0A 4Y94A 1IRSA 1DROA 2HTHB 2W2WA 3VOQA 3KZ1A 1FGYA 2GJYA 3ODXA 4A6FA 2UZRA 2P0FA 2RNRB 1OQNA 2RSGA 1AQCA 4QXAB 2DLWA 2G35A 2RGNB 1Y5OA 4GMXB 1ZM0A 3NWFA 4OT1A 3FEHA 2K2UA 2N0YA 1PLSA 3IVFA 2D9ZA 4HDQA 3ZDTA 2YT2A 2NZ8B 1V5UA 3ODOA 2ADZA 1UNPA 5JP4A 5KQ1A 2YVCA 2KUQA 1BAKA 1EGXA 4HAXB 1OMWA 2IFSA 1PMSA 2LKOA 2P0HA 5JLJB 2VSZA 1NI2A 3RCPA 2CY5A 2Z0OA 1WG7A 5C16A 1K5DB 2LG1A 2DTCA 1TJ6A 1ZYIA 3GYOA 1TXDA 1DDWA 5J3YA 1PFJA 3TVVA 1AWEA 1W1DA 4HB4B 5JHGA 4H8SA 3D8DA 3KRXA 2DYQA
chains in the Genus database with same CATH topology
3M1IB 3A8PA 2YSZA 2W2XC 2DKQA 3TW1A 4A6FB 4A5KA 2DX1A 4MK0A 4HAVB 4EKUA 2DHKA 1P3RA 1KZGA 2YS5A 4K81A 1DDMA 1EF1A 3WA0A 3ODWA 2D9YA 4ZRIA 2K00A 3HK0A 3MPXA 2D4QA 3TFMA 1K5GB 2DHIA 3UZTA 1XCGA 4ZRKA 1U5DA 1QC6A 1TQZA 5CLQB 2J0JA 1ZC3B 2R0DA 2LYDA 1MPHA 2GS0A 4DX8A 2EMSA 1X1GA 2FJLA 2JP2A 1UEFA 2CRFA 5DHAB 3V5WA 3P6AA 2CY4A 2D11A 1FB8A 1M7EA 4K17A 1V61A 2ZPYA 2UVMA 4HB3B 4HAYB 1X11A 4F7HA 2LULA 4DXAB 3D8EA 1U29A 2QKLA 4YL8A 1Q67A 3O96A 3KY9A 1DDVA 1FHXA 2RLOA 1X1FA 4IAPA 1N3HA 5LOPB 2PZ1A 2MWNB 3X23A 2XQNM 3PP2A 4CHJA 1MKEA 5GOWB 2GCJA 3SYXA 4HDOA 1BTNA 2D10A 4L6EA 2EC1A 1V5MA 2LOXA 2K2JA 2YT1A 4F7UP 3AU4A 5HE0A 1ISNA 4NY0A 2DKPA 3F0WA 3VIAA 2MDXA 4B6HA 2H7EA 2Y8GA 1DYNA 2HE7A 3DXEA 1J0WA 4K2OA 1QQGA 4K2PA 2KCJA 3GYPA 1XD4A 2I1JA 3LJUX 4MY6A 5L81A 1P6SA 5D27A 3NSUA 2UZSA 3AJ4A 4KHBB 1V88A 1WVHA 1RRPB 5J3QA 5D3XA 1SHCA 2COAA 2ROVA 1MIXA 2AL6A 2H7DA 3A98B 3SUZA 1WJMA 1BTKA 3PVUA 5HE2A 1J19A 1M7RA 2L2IA 2OQBA 3ULBA 3WYFB 2M38A 2GCLA 5C5BA 3SO6A 1WI1A 2P0DA 3HW2B 1W1GA 2I5CA 4WVFB 4EJNA 1MAIA 4GN1A 1KI1B 3HQCA 2Z0QA 4GZUA 2DYNA 4P7IA 2N23A 5C6RA 3FM8C 4DBBA 2I1KA 5D3VA 2W2XD 1LW3A 4XWXA 4TKNA 2M14A 1NU2A 2IYBA 4PQ0A 1Z87A 2YF0A 3PZDA 2D9VA 2MKRA 3KRWA 1Y19B 2YT0A 3QIJA 2DX5A 5D3YA 3TCAA 2R09A 3N7CA 4GMVA 3ML4A 1W1HA 1DBHA 2DA0A 4CYEA 2Q13A 1WGQA 5FI0A 1OY2A 1MK9B 1I2HA 4PNKA 2RVBB 4KHAA 1UNQA 5D3WA 5DHFB 1XODA 1FGZA 2Y8FA 1XR0B 3P7ZA 1X05A 1ZSQA 4C0AA 1KZ7A 4BBKA 1V5PA 1NTYA 2NMBA 1H10A 3FSSA 1P5TA 3T06A 5LONB 5FI1A 4HAZB 3D8FA 2EJ8A 1E5WA 4CHMA 4KVGB 5C5BB 2J0MA 5DH9B 3OANA 2DN6A 2D9XA 1GG3A 2I5FA 5CLLB 2Z0PA 3DXDA 4EMOA 1NTVA 1XKEA 5HE3A 2BCJA 1FHWA 1XX0A 4HB0B 4Z2NA 2J0KA 2MFQA 2D9WA 1UPRA 4GXBA 3BJIA 2VRWB 2CODA 1GC6A 2V76A 4HB2B 2AEHA 1EVHA 3BINA 3AU5A 4ZRJA 3PEGA 1FAOA 3A8QA 4TYZA 2RUKB 4IFSA 2L1CA 2Y7BA 4WJ7A 5J3TA 3PVLA 1RJ2A 2DHJA 2YS1A 3PSCA 3MDBC 3PG7A 5EFXA 3CIKA 1ZVRA 1MK7B 1BWNA 2X18A 3F5RA 3ULCA 2OTXA 5HE1A 5DIFB 4IOYX 2YRYA 3KSYA 2COCA 1FOEA 1B55A 1ZC4B 3TO1A 2ELBA 2ROZB 1H4RA 1X86A 2CAYA 2COFA 2D2QA 3SV1A 4HHVA 2J59M 1U5FA 1V89A 2QKMA 1U27A 4KHOA 1U5GA 1U2BA 4WSFA 4F7GA 2KGXB 3U8ZA 5KCVA 4KAXB 1GC7A 4NSWA 1LB1A 4A6KA 3QBVB 4YONA 1MIZB 1WGUA 5C79A 4HATB 3CXBB 1UNRA 1WJ1A 4D0NB 1EAZA 1U5EA 2P8VA 2VKIA 4Z2MB 1FHOA 2YS3A 3U7DA 2E2XA 4GPTB 1SGHA 3QWMA 4HAUB 5JHHA 3ZVRA 3SNHA 3PVWA 1UPQA 4DX90 2DFKA 1I7AA 2KUPA 4A6HA 3DXCA 2EMTA 2ELAA 5DI9B 5KQ4A 2LOZA 4HAWB 4MT7A 3G9WA 4Y94A 1IRSA 1DROA 2HTHB 2W2WA 3VOQA 3KZ1A 1FGYA 2GJYA 3ODXA 4A6FA 2UZRA 2P0FA 2RNRB 1OQNA 2RSGA 1AQCA 2DLWA 2G35A 2RGNB 1Y5OA 4GMXB 1ZM0A 3FEHA 2K2UA 2N0YA 1PLSA 3IVFA 2D9ZA 4HDQA 3ZDTA 2NZ8B 1V5UA 3ODOA 2ADZA 1UNPA 5JP4A 5KQ1A 2YVCA 1BAKA 1EGXA 4HAXB 1OMWA 2IFSA 1PMSA 2LKOA 2P0HA 5JLJB 2VSZA 1NI2A 3RCPA 2CY5A 2Z0OA 1WG7A 5C16A 1K5DB 2LG1A 2DTCA 1TJ6A 3GYOA 1TXDA 1DDWA 5J3YA 1PFJA 3TVVA 1AWEA 1W1DA 4HB4B 5JHGA 4H8SA 3D8DA 3KRXA 2DYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M1I B;  3A8P A;  2YSZ A;  2W2X C;  2DKQ A;  3TW1 A;  4A6F B;  4A5K A;  2DX1 A;  4MK0 A;  4HAV B;  4EKU A;  2DHK A;  1P3R A;  1KZG A;  2YS5 A;  4K81 A;  1DDM A;  1EF1 A;  3WA0 A;  3ODW A;  2D9Y A;  4ZRI A;  2K00 A;  3HK0 A;  3MPX A;  2D4Q A;  3TFM A;  1K5G B;  2DHI A;  3UZT A;  1XCG A;  4ZRK A;  1U5D A;  1QC6 A;  1TQZ A;  5CLQ B;  2J0J A;  1ZC3 B;  2R0D A;  2LYD A;  1MPH A;  2GS0 A;  4DX8 A;  2EMS A;  1X1G A;  2FJL A;  2JP2 A;  1UEF A;  2CRF A;  5DHA B;  3V5W A;  3P6A A;  2CY4 A;  2D11 A;  1FB8 A;  1M7E A;  4K17 A;  1V61 A;  2ZPY A;  2UVM A;  4HB3 B;  4HAY B;  1X11 A;  4F7H A;  2LUL A;  4DXA B;  3D8E A;  1U29 A;  2QKL A;  4YL8 A;  1Q67 A;  3O96 A;  3KY9 A;  1DDV A;  1FHX A;  2RLO A;  1X1F A;  4IAP A;  1N3H A;  5LOP B;  2PZ1 A;  2MWN B;  3X23 A;  2XQN M;  3PP2 A;  4CHJ A;  1MKE A;  5GOW B;  2GCJ A;  3SYX A;  4HDO A;  1BTN A;  2D10 A;  4L6E A;  2EC1 A;  1V5M A;  2LOX A;  2K2J A;  2YT1 A;  4F7U P;  3AU4 A;  5HE0 A;  1ISN A;  4NY0 A;  2DKP A;  3F0W A;  3VIA A;  2MDX A;  4B6H A;  2H7E A;  2Y8G A;  1DYN A;  2HE7 A;  3DXE A;  1J0W A;  4K2O A;  1QQG A;  4K2P A;  2KCJ A;  3GYP A;  1XD4 A;  2I1J A;  3LJU X;  4MY6 A;  5L81 A;  1P6S A;  5D27 A;  3NSU A;  2UZS A;  3AJ4 A;  4KHB B;  1V88 A;  1WVH A;  1RRP B;  5J3Q A;  5D3X A;  1SHC A;  2COA A;  2ROV A;  1MIX A;  2AL6 A;  2H7D A;  3A98 B;  3SUZ A;  1WJM A;  1BTK A;  3PVU A;  5HE2 A;  1J19 A;  1M7R A;  2L2I A;  2OQB A;  3ULB A;  3WYF B;  2M38 A;  2GCL A;  5C5B A;  3SO6 A;  1WI1 A;  2P0D A;  3HW2 B;  1W1G A;  2I5C A;  4WVF B;  4EJN A;  1MAI A;  4GN1 A;  1KI1 B;  3HQC A;  2Z0Q A;  4GZU A;  2DYN A;  4P7I A;  2N23 A;  5C6R A;  3FM8 C;  4DBB A;  2I1K A;  5D3V A;  2W2X D;  1LW3 A;  4XWX A;  4TKN A;  2M14 A;  1NU2 A;  2IYB A;  4PQ0 A;  1Z87 A;  2YF0 A;  3PZD A;  2D9V A;  2MKR A;  3KRW A;  1Y19 B;  2YT0 A;  3QIJ A;  2DX5 A;  5D3Y A;  3TCA A;  2R09 A;  3N7C A;  4GMV A;  3ML4 A;  1W1H A;  1DBH A;  2DA0 A;  4CYE A;  2Q13 A;  1WGQ A;  5FI0 A;  1OY2 A;  1MK9 B;  1I2H A;  4PNK A;  2RVB B;  4KHA A;  1UNQ A;  5D3W A;  5DHF B;  1XOD A;  1FGZ A;  2Y8F A;  1XR0 B;  3P7Z A;  1X05 A;  1ZSQ A;  4C0A A;  1KZ7 A;  4BBK A;  1V5P A;  1NTY A;  2NMB A;  1H10 A;  3FSS A;  1P5T A;  3T06 A;  5LON B;  5FI1 A;  4HAZ B;  3D8F A;  2EJ8 A;  1E5W A;  4CHM A;  4KVG B;  5C5B B;  2J0M A;  5DH9 B;  3OAN A;  2DN6 A;  2D9X A;  1GG3 A;  2I5F A;  5CLL B;  2Z0P A;  3DXD A;  4EMO A;  1NTV A;  1XKE A;  5HE3 A;  2BCJ A;  1FHW A;  1XX0 A;  4HB0 B;  4Z2N A;  2J0K A;  2MFQ A;  2D9W A;  1UPR A;  4GXB A;  3BJI A;  2VRW B;  2COD A;  1GC6 A;  2V76 A;  4HB2 B;  2AEH A;  1EVH A;  3BIN A;  3AU5 A;  4ZRJ A;  3PEG A;  1FAO A;  3A8Q A;  4TYZ A;  2RUK B;  4IFS A;  2L1C A;  2Y7B A;  4WJ7 A;  5J3T A;  3PVL A;  1RJ2 A;  2DHJ A;  2YS1 A;  3PSC A;  3MDB C;  3PG7 A;  5EFX A;  3CIK A;  1ZVR A;  1MK7 B;  1BWN A;  2X18 A;  3F5R A;  3ULC A;  2OTX A;  5HE1 A;  5DIF B;  4IOY X;  2YRY A;  3KSY A;  2COC A;  1FOE A;  1B55 A;  1ZC4 B;  3TO1 A;  2ELB A;  2ROZ B;  1H4R A;  1X86 A;  2CAY A;  2COF A;  2D2Q A;  3SV1 A;  4HHV A;  2J59 M;  1U5F A;  1V89 A;  2QKM A;  1U27 A;  4KHO A;  1U5G A;  1U2B A;  4WSF A;  4F7G A;  2KGX B;  3U8Z A;  5KCV A;  4KAX B;  1GC7 A;  4NSW A;  1LB1 A;  4A6K A;  3QBV B;  4YON A;  1MIZ B;  1WGU A;  5C79 A;  4HAT B;  3CXB B;  1UNR A;  1WJ1 A;  4D0N B;  1EAZ A;  1U5E A;  2P8V A;  2VKI A;  4Z2M B;  1FHO A;  2YS3 A;  3U7D A;  2E2X A;  4GPT B;  1SGH A;  3QWM A;  4HAU B;  5JHH A;  3ZVR A;  3SNH A;  3PVW A;  1UPQ A;  4DX9 0;  2DFK A;  1I7A A;  2KUP A;  4A6H A;  3DXC A;  2EMT A;  2ELA A;  5DI9 B;  5KQ4 A;  2LOZ A;  4HAW B;  4MT7 A;  3G9W A;  4Y94 A;  1IRS A;  1DRO A;  2HTH B;  2W2W A;  3VOQ A;  3KZ1 A;  1FGY A;  2GJY A;  3ODX A;  4A6F A;  2UZR A;  2P0F A;  2RNR B;  1OQN A;  2RSG A;  1AQC A;  2DLW A;  2G35 A;  2RGN B;  1Y5O A;  4GMX B;  1ZM0 A;  3FEH A;  2K2U A;  2N0Y A;  1PLS A;  3IVF A;  2D9Z A;  4HDQ A;  3ZDT A;  2NZ8 B;  1V5U A;  3ODO A;  2ADZ A;  1UNP A;  5JP4 A;  5KQ1 A;  2YVC A;  1BAK A;  1EGX A;  4HAX B;  1OMW A;  2IFS A;  1PMS A;  2LKO A;  2P0H A;  5JLJ B;  2VSZ A;  1NI2 A;  3RCP A;  2CY5 A;  2Z0O A;  1WG7 A;  5C16 A;  1K5D B;  2LG1 A;  2DTC A;  1TJ6 A;  3GYO A;  1TXD A;  1DDW A;  5J3Y A;  1PFJ A;  3TVV A;  1AWE A;  1W1D A;  4HB4 B;  5JHG A;  4H8S A;  3D8D A;  3KRX A;  2DYQ A; 
#chains in the Genus database with same CATH topology
 3M1I B;  3A8P A;  2YSZ A;  2W2X C;  2DKQ A;  3TW1 A;  4A6F B;  2K49 A;  4A5K A;  2DX1 A;  4MK0 A;  4HAV B;  4EKU A;  2DHK A;  1P3R A;  1KZG A;  2KIG A;  2YS5 A;  4K81 A;  1DDM A;  1EF1 A;  3WA0 A;  3ODW A;  2D9Y A;  4ZRI A;  2K00 A;  3HK0 A;  3MPX A;  2D4Q A;  3TFM A;  1K5G B;  2DHI A;  3NWA A;  3UZT A;  1XCG A;  4ZRK A;  1U5D A;  1QC6 A;  1TQZ A;  4KHB A;  5CLQ B;  2J0J A;  1ZC3 B;  2R0D A;  2LYD A;  1MPH A;  2GS0 A;  4DX8 A;  2EMS A;  1X1G A;  2FJL A;  2JP2 A;  1UEF A;  2CRF A;  5DHA B;  3V5W A;  3P6A A;  2CY4 A;  2D11 A;  1FB8 A;  1M7E A;  4K17 A;  1V61 A;  2ZPY A;  5LG4 B;  2UVM A;  4HB3 B;  4HAY B;  1X11 A;  4F7H A;  3B77 A;  2RRF A;  2LUL A;  4DXA B;  3D8E A;  1U29 A;  2QKL A;  4YL8 A;  1Q67 A;  3O96 A;  3KY9 A;  1DDV A;  1FHX A;  2RLO A;  1X1F A;  3NWD A;  4IAP A;  4QJ5 B;  1N3H A;  5LOP B;  2PZ1 A;  2MWN B;  3X23 A;  2XQN M;  3PP2 A;  4CHJ A;  1MKE A;  5GOW B;  2GCJ A;  3SYX A;  4HDO A;  1BTN A;  2D10 A;  4L6E A;  2R2Y A;  2EC1 A;  1V5M A;  2LOX A;  2K2J A;  2YT1 A;  4F7U P;  3AU4 A;  5HE0 A;  1ISN A;  3NW8 A;  2DKP A;  4NY0 A;  3F0W A;  3VIA A;  2MDX A;  3HIE A;  4B6H A;  2H7E A;  2Y8G A;  1DYN A;  2HE7 A;  3DXE A;  1J0W A;  4K2O A;  1QQG A;  4K2P A;  2KCJ A;  3GYP A;  1XD4 A;  2I1J A;  3LJU X;  4MY6 A;  5L81 A;  1P6S A;  5D27 A;  3NSU A;  3HSA A;  2UZS A;  3AJ4 A;  4KHB B;  1V88 A;  1WVH A;  1RRP B;  2Z13 A;  5J3Q A;  5D3X A;  1SHC A;  2COA A;  2GUM A;  2ROV A;  4CSQ A;  1MIX A;  2AL6 A;  2H7D A;  3A98 B;  3SUZ A;  1WJM A;  1BTK A;  3PVU A;  5HE2 A;  1J19 A;  1M7R A;  2K8E A;  2L2I A;  2OQB A;  3ULB A;  3WYF B;  2M38 A;  2GCL A;  5C5B A;  3SO6 A;  1WI1 A;  2P0D A;  3HW2 B;  1W1G A;  2I5C A;  4WVF B;  4EJN A;  2NBV A;  1MAI A;  4GN1 A;  1KI1 B;  3HQC A;  2Z0Q A;  4GZU A;  2DYN A;  4P7I A;  2N23 A;  5C6R A;  3FM8 C;  4DBB A;  2I1K A;  5D3V A;  2W2X D;  1LW3 A;  4XWX A;  4TKN A;  2M14 A;  1NU2 A;  2IYB A;  4PQ0 A;  1Z87 A;  2YF0 A;  3PZD A;  2FJU B;  2D9V A;  2MKR A;  3KRW A;  1Y19 B;  2YT0 A;  3QIJ A;  2DX5 A;  1MI1 A;  5D3Y A;  3TCA A;  2R09 A;  3N7C A;  4GMV A;  3ML4 A;  1W1H A;  1DBH A;  2DA0 A;  4CYE A;  2Q13 A;  1WGQ A;  5FI0 A;  1OY2 A;  1MK9 B;  1I2H A;  4PNK A;  2RVB B;  4KHA A;  5M4Y B;  1UNQ A;  5D3W A;  5DHF B;  1XOD A;  1FGZ A;  2Y8F A;  1XR0 B;  3P7Z A;  1X05 A;  1ZSQ A;  4C0A A;  1KZ7 A;  4BBK A;  1V5P A;  1NTY A;  4QJ3 B;  2NMB A;  1H10 A;  3FSS A;  2ZKM X;  1P5T A;  2Z14 A;  3T06 A;  5LON B;  5FI1 A;  4HAZ B;  3D8F A;  2EJ8 A;  1E5W A;  4CHM A;  4KVG B;  5C5B B;  2J0M A;  3DCX A;  5DH9 B;  3OAN A;  2DN6 A;  2D9X A;  1T77 A;  1GG3 A;  2I5F A;  5CLL B;  2Z0P A;  3DXD A;  4EMO A;  1NTV A;  1XKE A;  5HE3 A;  2BCJ A;  3U12 A;  1FHW A;  1XX0 A;  4HB0 B;  4Z2N A;  2J0K A;  2MFQ A;  2D9W A;  1UPR A;  4GXB A;  3BJI A;  4OSN A;  2VRW B;  2COD A;  1GC6 A;  2V76 A;  4HB2 B;  2AEH A;  1EVH A;  3BIN A;  4D6W A;  3AU5 A;  4ZRJ A;  3PEG A;  1FAO A;  2Z4D A;  3A8Q A;  4TYZ A;  2RUK B;  4IFS A;  2L1C A;  3A58 A;  2Y7B A;  4WJ7 A;  5J3T A;  3PVL A;  1RJ2 A;  2DHJ A;  3FVC A;  2YS1 A;  3PSC A;  5I2S A;  4GOU A;  3MDB C;  3PG7 A;  5EFX A;  2Z59 A;  3CIK A;  1ZVR A;  1MK7 B;  1BWN A;  2X18 A;  3F5R A;  3ULC A;  2OTX A;  5HE1 A;  5DIF B;  4L1R A;  4IOY X;  2YRY A;  3KSY A;  2COC A;  1FOE A;  1B55 A;  1ZC4 B;  5IRS A;  3TO1 A;  2ELB A;  2ROZ B;  1H4R A;  1X86 A;  2CAY A;  2COF A;  2D2Q A;  3SV1 A;  3OHM B;  4HHV A;  2J59 M;  1U5F A;  1V89 A;  2QKM A;  1U27 A;  4KHO A;  1U5G A;  1U2B A;  4WSF A;  4F7G A;  2KGX B;  3U8Z A;  5KCV A;  4KAX B;  4DIX A;  1GC7 A;  4QJ4 B;  4NSW A;  1LB1 A;  4A6K A;  3QBV B;  4YON A;  1MIZ B;  1WGU A;  5C79 A;  2KIE A;  4HAT B;  3CXB B;  1UNR A;  5I2M A;  1WJ1 A;  4D0N B;  1EAZ A;  1U5E A;  2P8V A;  2VKI A;  4Z2M B;  1FHO A;  2YS3 A;  3U7D A;  2E2X A;  4GPT B;  1SGH A;  3QWM A;  4HAU B;  5JHH A;  3ZVR A;  3SNH A;  3PVW A;  1UPQ A;  4DX9 0;  2DFK A;  1I7A A;  2KUP A;  4A6H A;  3DXC A;  2EMT A;  2ELA A;  5DI9 B;  5KQ4 A;  2LOZ A;  4HAW B;  4MT7 A;  4GNK B;  4HSI A;  3G9W A;  2KR0 A;  4Y94 A;  1IRS A;  1DRO A;  2HTH B;  2W2W A;  3VOQ A;  3KZ1 A;  1FGY A;  2GJY A;  3ODX A;  4A6F A;  2UZR A;  2P0F A;  2RNR B;  1OQN A;  2RSG A;  1AQC A;  4QXA B;  2DLW A;  2G35 A;  2RGN B;  1Y5O A;  4GMX B;  1ZM0 A;  3NWF A;  4OT1 A;  3FEH A;  2K2U A;  2N0Y A;  1PLS A;  3IVF A;  2D9Z A;  4HDQ A;  3ZDT A;  2YT2 A;  2NZ8 B;  1V5U A;  3ODO A;  2ADZ A;  1UNP A;  5JP4 A;  5KQ1 A;  2YVC A;  2KUQ A;  1BAK A;  1EGX A;  4HAX B;  1OMW A;  2IFS A;  1PMS A;  2LKO A;  2P0H A;  5JLJ B;  2VSZ A;  1NI2 A;  3RCP A;  2CY5 A;  2Z0O A;  1WG7 A;  5C16 A;  1K5D B;  2LG1 A;  2DTC A;  1TJ6 A;  1ZYI A;  3GYO A;  1TXD A;  1DDW A;  5J3Y A;  1PFJ A;  3TVV A;  1AWE A;  1W1D A;  4HB4 B;  5JHG A;  4H8S A;  3D8D A;  3KRX A;  2DYQ A; 
#chains in the Genus database with same CATH homology
 3M1I B;  3A8P A;  2YSZ A;  2W2X C;  2DKQ A;  3TW1 A;  4A6F B;  4A5K A;  2DX1 A;  4MK0 A;  4HAV B;  4EKU A;  2DHK A;  1P3R A;  1KZG A;  2YS5 A;  4K81 A;  1DDM A;  1EF1 A;  3WA0 A;  3ODW A;  2D9Y A;  4ZRI A;  2K00 A;  3HK0 A;  3MPX A;  2D4Q A;  3TFM A;  1K5G B;  2DHI A;  3UZT A;  1XCG A;  4ZRK A;  1U5D A;  1QC6 A;  1TQZ A;  5CLQ B;  2J0J A;  1ZC3 B;  2R0D A;  2LYD A;  1MPH A;  2GS0 A;  4DX8 A;  2EMS A;  1X1G A;  2FJL A;  2JP2 A;  1UEF A;  2CRF A;  5DHA B;  3V5W A;  3P6A A;  2CY4 A;  2D11 A;  1FB8 A;  1M7E A;  4K17 A;  1V61 A;  2ZPY A;  2UVM A;  4HB3 B;  4HAY B;  1X11 A;  4F7H A;  2LUL A;  4DXA B;  3D8E A;  1U29 A;  2QKL A;  4YL8 A;  1Q67 A;  3O96 A;  3KY9 A;  1DDV A;  1FHX A;  2RLO A;  1X1F A;  4IAP A;  1N3H A;  5LOP B;  2PZ1 A;  2MWN B;  3X23 A;  2XQN M;  3PP2 A;  4CHJ A;  1MKE A;  5GOW B;  2GCJ A;  3SYX A;  4HDO A;  1BTN A;  2D10 A;  4L6E A;  2EC1 A;  1V5M A;  2LOX A;  2K2J A;  2YT1 A;  4F7U P;  3AU4 A;  5HE0 A;  1ISN A;  4NY0 A;  2DKP A;  3F0W A;  3VIA A;  2MDX A;  4B6H A;  2H7E A;  2Y8G A;  1DYN A;  2HE7 A;  3DXE A;  1J0W A;  4K2O A;  1QQG A;  4K2P A;  2KCJ A;  3GYP A;  1XD4 A;  2I1J A;  3LJU X;  4MY6 A;  5L81 A;  1P6S A;  5D27 A;  3NSU A;  2UZS A;  3AJ4 A;  4KHB B;  1V88 A;  1WVH A;  1RRP B;  5J3Q A;  5D3X A;  1SHC A;  2COA A;  2ROV A;  1MIX A;  2AL6 A;  2H7D A;  3A98 B;  3SUZ A;  1WJM A;  1BTK A;  3PVU A;  5HE2 A;  1J19 A;  1M7R A;  2L2I A;  2OQB A;  3ULB A;  3WYF B;  2M38 A;  2GCL A;  5C5B A;  3SO6 A;  1WI1 A;  2P0D A;  3HW2 B;  1W1G A;  2I5C A;  4WVF B;  4EJN A;  1MAI A;  4GN1 A;  1KI1 B;  3HQC A;  2Z0Q A;  4GZU A;  2DYN A;  4P7I A;  2N23 A;  5C6R A;  3FM8 C;  4DBB A;  2I1K A;  5D3V A;  2W2X D;  1LW3 A;  4XWX A;  4TKN A;  2M14 A;  1NU2 A;  2IYB A;  4PQ0 A;  1Z87 A;  2YF0 A;  3PZD A;  2D9V A;  2MKR A;  3KRW A;  1Y19 B;  2YT0 A;  3QIJ A;  2DX5 A;  5D3Y A;  3TCA A;  2R09 A;  3N7C A;  4GMV A;  3ML4 A;  1W1H A;  1DBH A;  2DA0 A;  4CYE A;  2Q13 A;  1WGQ A;  5FI0 A;  1OY2 A;  1MK9 B;  1I2H A;  4PNK A;  2RVB B;  4KHA A;  1UNQ A;  5D3W A;  5DHF B;  1XOD A;  1FGZ A;  2Y8F A;  1XR0 B;  3P7Z A;  1X05 A;  1ZSQ A;  4C0A A;  1KZ7 A;  4BBK A;  1V5P A;  1NTY A;  2NMB A;  1H10 A;  3FSS A;  1P5T A;  3T06 A;  5LON B;  5FI1 A;  4HAZ B;  3D8F A;  2EJ8 A;  1E5W A;  4CHM A;  4KVG B;  5C5B B;  2J0M A;  5DH9 B;  3OAN A;  2DN6 A;  2D9X A;  1GG3 A;  2I5F A;  5CLL B;  2Z0P A;  3DXD A;  4EMO A;  1NTV A;  1XKE A;  5HE3 A;  2BCJ A;  1FHW A;  1XX0 A;  4HB0 B;  4Z2N A;  2J0K A;  2MFQ A;  2D9W A;  1UPR A;  4GXB A;  3BJI A;  2VRW B;  2COD A;  1GC6 A;  2V76 A;  4HB2 B;  2AEH A;  1EVH A;  3BIN A;  3AU5 A;  4ZRJ A;  3PEG A;  1FAO A;  3A8Q A;  4TYZ A;  2RUK B;  4IFS A;  2L1C A;  2Y7B A;  4WJ7 A;  5J3T A;  3PVL A;  1RJ2 A;  2DHJ A;  2YS1 A;  3PSC A;  3MDB C;  3PG7 A;  5EFX A;  3CIK A;  1ZVR A;  1MK7 B;  1BWN A;  2X18 A;  3F5R A;  3ULC A;  2OTX A;  5HE1 A;  5DIF B;  4IOY X;  2YRY A;  3KSY A;  2COC A;  1FOE A;  1B55 A;  1ZC4 B;  3TO1 A;  2ELB A;  2ROZ B;  1H4R A;  1X86 A;  2CAY A;  2COF A;  2D2Q A;  3SV1 A;  4HHV A;  2J59 M;  1U5F A;  1V89 A;  2QKM A;  1U27 A;  4KHO A;  1U5G A;  1U2B A;  4WSF A;  4F7G A;  2KGX B;  3U8Z A;  5KCV A;  4KAX B;  1GC7 A;  4NSW A;  1LB1 A;  4A6K A;  3QBV B;  4YON A;  1MIZ B;  1WGU A;  5C79 A;  4HAT B;  3CXB B;  1UNR A;  1WJ1 A;  4D0N B;  1EAZ A;  1U5E A;  2P8V A;  2VKI A;  4Z2M B;  1FHO A;  2YS3 A;  3U7D A;  2E2X A;  4GPT B;  1SGH A;  3QWM A;  4HAU B;  5JHH A;  3ZVR A;  3SNH A;  3PVW A;  1UPQ A;  4DX9 0;  2DFK A;  1I7A A;  2KUP A;  4A6H A;  3DXC A;  2EMT A;  2ELA A;  5DI9 B;  5KQ4 A;  2LOZ A;  4HAW B;  4MT7 A;  3G9W A;  4Y94 A;  1IRS A;  1DRO A;  2HTH B;  2W2W A;  3VOQ A;  3KZ1 A;  1FGY A;  2GJY A;  3ODX A;  4A6F A;  2UZR A;  2P0F A;  2RNR B;  1OQN A;  2RSG A;  1AQC A;  2DLW A;  2G35 A;  2RGN B;  1Y5O A;  4GMX B;  1ZM0 A;  3FEH A;  2K2U A;  2N0Y A;  1PLS A;  3IVF A;  2D9Z A;  4HDQ A;  3ZDT A;  2NZ8 B;  1V5U A;  3ODO A;  2ADZ A;  1UNP A;  5JP4 A;  5KQ1 A;  2YVC A;  1BAK A;  1EGX A;  4HAX B;  1OMW A;  2IFS A;  1PMS A;  2LKO A;  2P0H A;  5JLJ B;  2VSZ A;  1NI2 A;  3RCP A;  2CY5 A;  2Z0O A;  1WG7 A;  5C16 A;  1K5D B;  2LG1 A;  2DTC A;  1TJ6 A;  3GYO A;  1TXD A;  1DDW A;  5J3Y A;  1PFJ A;  3TVV A;  1AWE A;  1W1D A;  4HB4 B;  5JHG A;  4H8S A;  3D8D A;  3KRX A;  2DYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...