1EGXA

Solution structure of the ena-vasp homology 1 (evh1) domain of human vasodilator-stimulated phosphoprotein (vasp)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
115
structure length
115
Chain Sequence
MSETVICSSRATVMLYDDGNKRWLPAGTGPQAFSRVQIYHNPTANSFRVVGRKMQPDQQVVINCAIVRGVKYNQATPNFHQWRDARQVWGLNFGSKEDAAQFAAGMASALEALEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VASODILATOR-STIMULATED PHOSPHOPROTEIN
publication title Dual epitope recognition by the VASP EVH1 domain modulates polyproline ligand specificity and binding affinity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 21
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2000-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1egxA00
2D10A 1U5DA 2H7EA 2M38A 2DTCA 4MT7A 2DFKA 3GYPA 1Q67A 2ADZA 2Z0QA 1V89A 2CRFA 1ZSQA 1U29A 4HAXB 1EF1A 2H7DA 1AQCA 2DYQA 4HAZB 4MK0A 1V88A 1QQGA 1DDMA 1N3HA 2COAA 5GOWB 2DHIA 5J3TA 5CLLB 4F7GA 1FOEA 1OY2A 1MPHA 5C16A 2RLOA 3M1IB 4NY0A 4A6FA 2RNRB 2LYDA 2MWNB 1GC7A 1BTKA 4ZRKA 1WI1A 2MFQA 1PFJA 1FHWA 4GN1A 2HE7A 2DKQA 2YT0A 5D3YA 4HB0B 2BCJA 1MK7B 1GC6A 2YS5A 1ZVRA 3SNHA 4IOYX 3GYOA 1DYNA 2GS0A 4CHMA 5D3XA 3SO6A 2XQNM 3P6AA 3DXDA 1UPQA 3UZTA 2JP2A 4HATB 2NZ8B 3X23A 2VSZA 3TFMA 3KRXA 4IFSA 2UZRA 4L6EA 2COCA 5D27A 3U7DA 3KY9A 2MKRA 1PMSA 3QBVB 4DX8A 2Z0PA 4HB3B 2OQBA 1UNPA 4H8SA 4HHVA 5L81A 2D9VA 1TJ6A 3ODOA 1LW3A 2ROVA 3SYXA 1WVHA 4HDOA 1V5MA 3IVFA 1U2BA 2P0FA 2K2UA 5D3WA 2J59M 3ULCA 3ML4A 2ELAA 1I7AA 2P0DA 3HW2B 2CODA 2YRYA 2IYBA 2Y8FA 1U5GA 5D3VA 4GXBA 4GZUA 1X1GA 3TCAA 5DHFB 4WSFA 1WGQA 3KRWA 5HE2A 5JLJB 5LONB 4Z2NA 3A8PA 2KCJA 1BWNA 1SGHA 1XCGA 3VIAA 2Y7BA 4XWXA 2I5FA 2RGNB 1EVHA 1H10A 2E2XA 5DI9B 4KVGB 1ISNA 1RRPB 5JHHA 2DX1A 1MIZB 3MPXA 1TXDA 2VRWB 3N7CA 3WYFB 3MDBC 1DROA 2D9ZA 1W1DA 2KGXB 4ZRIA 5HE3A 4GMXB 3HK0A 1RJ2A 1V5UA 2D9WA 1Y19B 2NMBA 2D11A 1EAZA 1H4RA 4YL8A 4C0AA 4F7UP 3PEGA 3CXBB 2DKPA 3AU5A 2YVCA 2UZSA 2GJYA 3TO1A 5FI0A 2RVBB 1WG7A 5C5BB 3A8QA 1P5TA 4PNKA 2J0MA 4PQ0A 3HQCA 1FHOA 4P7IA 3FEHA 5JHGA 2P0HA 1XD4A 3PP2A 1EGXA 2YSZA 3ODXA 4K81A 4WJ7A 1W1GA 1Z87A 2YF0A 3BJIA 5LOPB 1WJ1A 2J0KA 4NSWA 3DXCA 3A98B 1ZC3B 4HAUB 5HE0A 2I5CA 1XR0B 1FAOA 1WJMA 2QKLA 2EJ8A 2M14A 1SHCA 1Y5OA 4A5KA 2V76A 5CLQB 1MAIA 2K2JA 3D8DA 4K2OA 1B55A 2PZ1A 3U8ZA 3CIKA 1XODA 3ODWA 3D8EA 4B6HA 2J0JA 5C5BA 4EKUA 3D8FA 5KCVA 2EMTA 4A6KA 2EMSA 3SV1A 4A6HA 3FM8C 1DDVA 2P8VA 5DIFB 1X86A 4Z2MB 3ZDTA 1FGZA 3PZDA 1ZM0A 2L2IA 2VKIA 3P7ZA 2DA0A 5FI1A 1NTVA 3FSSA 2K00A 2W2XC 2QKMA 3T06A 5DHAB 2GCJA 1J0WA 1XKEA 4HDQA 4ZRJA 3QWMA 1K5DB 2FJLA 2DYNA 3BINA 4GMVA 1AWEA 1U5EA 4EJNA 2N0YA 2LKOA 3NSUA 1GG3A 2W2XD 2AL6A 3TW1A 1BTNA 4TYZA 2COFA 1V5PA 4KHAA 1FHXA 2HTHB 2LOZA 3DXEA 1X05A 1FB8A 3AJ4A 1U5FA 3PG7A 4MY6A 4EMOA 2R0DA 3SUZA 2ROZB 1UEFA 2UVMA 3O96A 1MIXA 1XX0A 2CY4A 1OMWA 3OANA 5KQ4A 2KUPA 1M7EA 2R09A 4KHBB 1LB1A 2D2QA 3PVWA 2DLWA 1NI2A 1I2HA 2W2WA 4HB2B 1UPRA 2YS3A 1QC6A 3VOQA 2X18A 1IRSA 3G9WA 4HAWB 3V5WA 3PVUA 2YS1A 2LG1A 4CHJA 2Y8GA 2MDXA 4YONA 2IFSA 4HAYB 4BBKA 3F5RA 4KHOA 2YT1A 1E5WA 2I1KA 2LULA 2RUKB 2CAYA 1BAKA 5C6RA 5DH9B 1P6SA 4DBBA 4CYEA 1W1HA 1OQNA 3RCPA 4K2PA 1ZC4B 4GPTB 1TQZA 5JP4A 1MK9B 3WA0A 1UNRA 1PLSA 3AU4A 5KQ1A 4HAVB 3TVVA 2N23A 4F7HA 1NU2A 2G35A 1KZGA 2Z0OA 1DBHA 2DHJA 5J3YA 2ELBA 2D4QA 3F0WA 4DXAB 1X1FA 3ULBA 4TKNA 4KAXB 1K5GB 3ZVRA 2L1CA 1DDWA 2Q13A 3LJUX 3PSCA 4D0NB 4Y94A 1V61A 1NTYA 3KZ1A 4K17A 2DN6A 1P3RA 2I1JA 1KZ7A 1J19A 5HE1A 4IAPA 4WVFB 3PVLA 1U27A 2DX5A 5C79A 1WGUA 1KI1B 2D9XA 2D9YA 2EC1A 2DHKA 1X11A 1FGYA 5EFXA 2CY5A 3QIJA 4A6FB 1MKEA 5J3QA 1M7RA 3KSYA 2ZPYA 2GCLA 1UNQA 2AEHA 2LOXA 4HB4B 2OTXA 4DX90 2RSGA
chains in the Genus database with same CATH superfamily
2D10A 1U5DA 2H7EA 3HIEA 2M38A 2DTCA 4MT7A 3HSAA 2DFKA 3GYPA 1Q67A 2ADZA 2Z0QA 1V89A 2CRFA 1ZSQA 1U29A 4HAXB 1EF1A 2H7DA 1AQCA 2DYQA 4HAZB 2R2YA 4MK0A 1V88A 1QQGA 1DDMA 1N3HA 2COAA 5GOWB 2DHIA 5J3TA 5CLLB 4F7GA 1FOEA 1OY2A 1MPHA 5C16A 2RLOA 3M1IB 4NY0A 4A6FA 2RNRB 2LYDA 4HSIA 2MWNB 1GC7A 1BTKA 4ZRKA 1WI1A 2MFQA 1PFJA 1FHWA 4GN1A 2HE7A 2DKQA 2YT0A 5D3YA 4HB0B 2BCJA 1MK7B 1GC6A 2YS5A 1ZVRA 3SNHA 4IOYX 3GYOA 1DYNA 4DIXA 2GS0A 4CHMA 2Z4DA 5D3XA 4KHBA 3SO6A 2XQNM 3P6AA 3DXDA 3NW8A 2KIGA 1UPQA 3UZTA 2JP2A 4HATB 3NWAA 2NZ8B 3X23A 2VSZA 3TFMA 3KRXA 4IFSA 2UZRA 4L6EA 4QXAB 2COCA 5D27A 3U7DA 3KY9A 4D6WA 2MKRA 1PMSA 3QBVB 4DX8A 2Z0PA 4HB3B 2OQBA 4OSNA 1UNPA 4H8SA 3OHMB 4HHVA 5L81A 2D9VA 3FVCA 2FJUB 1TJ6A 3ODOA 4QJ4B 1LW3A 2ROVA 1ZYIA 3SYXA 1WVHA 4HDOA 1V5MA 3IVFA 1U2BA 2P0FA 2K2UA 5D3WA 2J59M 3ULCA 2KIEA 3ML4A 2ELAA 2K8EA 1I7AA 2P0DA 4OT1A 3HW2B 4QJ5B 2CODA 2YRYA 2IYBA 2Y8FA 1U5GA 5D3VA 4GXBA 4GZUA 1X1GA 3TCAA 5DHFB 4WSFA 1WGQA 3KRWA 5HE2A 5JLJB 5LONB 4Z2NA 3A8PA 2KCJA 1BWNA 1SGHA 1XCGA 3VIAA 2Y7BA 4XWXA 2I5FA 2RGNB 1EVHA 1H10A 2E2XA 5DI9B 4KVGB 1ISNA 1RRPB 5JHHA 2DX1A 1MIZB 3MPXA 1TXDA 2VRWB 3N7CA 2Z59A 3WYFB 3MDBC 1DROA 2D9ZA 1W1DA 2KGXB 4ZRIA 5HE3A 4GMXB 3HK0A 2Z13A 1RJ2A 5M4YB 1V5UA 2D9WA 1Y19B 2NMBA 2D11A 1EAZA 1H4RA 4YL8A 4C0AA 4F7UP 3PEGA 3CXBB 2DKPA 3AU5A 2YVCA 2UZSA 2GJYA 3TO1A 5FI0A 2RVBB 2ZKMX 1WG7A 5C5BB 3A8QA 1P5TA 4PNKA 2J0MA 4PQ0A 3HQCA 1FHOA 4P7IA 3FEHA 5JHGA 2P0HA 1XD4A 3PP2A 1EGXA 2YSZA 3ODXA 4K81A 4WJ7A 1W1GA 1Z87A 2YF0A 3BJIA 5LOPB 1WJ1A 2J0KA 4NSWA 3DXCA 3A98B 1ZC3B 4HAUB 3A58A 5HE0A 2I5CA 1XR0B 1FAOA 1WJMA 2QKLA 2EJ8A 2M14A 1SHCA 1Y5OA 4A5KA 2V76A 5CLQB 5I2SA 1MAIA 2K2JA 3D8DA 4K2OA 1B55A 2PZ1A 3U8ZA 3CIKA 5LG4B 1XODA 3ODWA 3D8EA 4B6HA 2J0JA 5C5BA 4EKUA 3D8FA 3NWDA 5KCVA 3NWFA 2EMTA 4A6KA 2EMSA 3SV1A 3DCXA 4A6HA 3FM8C 1DDVA 2P8VA 5DIFB 1X86A 4Z2MB 3ZDTA 1FGZA 3PZDA 1ZM0A 2L2IA 2KR0A 2VKIA 4GOUA 3P7ZA 2DA0A 1MI1A 5FI1A 1NTVA 3FSSA 2K00A 2W2XC 2QKMA 3T06A 5DHAB 2GCJA 1J0WA 1XKEA 4HDQA 4ZRJA 3QWMA 2YT2A 1K5DB 2FJLA 2DYNA 3BINA 4GMVA 1AWEA 1U5EA 4L1RA 4EJNA 2N0YA 2LKOA 3NSUA 1GG3A 2W2XD 2AL6A 3TW1A 1BTNA 4GNKB 2GUMA 4TYZA 2COFA 1V5PA 4KHAA 2K49A 1FHXA 2HTHB 2LOZA 3DXEA 1X05A 1FB8A 3AJ4A 1U5FA 3PG7A 4MY6A 4EMOA 2R0DA 3SUZA 2ROZB 1UEFA 3U12A 3B77A 2UVMA 3O96A 1MIXA 1XX0A 2CY4A 1OMWA 3OANA 5KQ4A 2KUPA 1M7EA 2R09A 4KHBB 1LB1A 2RRFA 2D2QA 3PVWA 2DLWA 1NI2A 1I2HA 2W2WA 4HB2B 5I2MA 1UPRA 2YS3A 1QC6A 3VOQA 2X18A 1IRSA 3G9WA 4HAWB 3V5WA 2KUQA 3PVUA 2YS1A 2LG1A 2Z14A 4CHJA 2Y8GA 2MDXA 4YONA 2IFSA 4HAYB 4BBKA 3F5RA 4KHOA 2YT1A 1E5WA 4CSQA 2I1KA 2LULA 2RUKB 2CAYA 1BAKA 5C6RA 5DH9B 1P6SA 4DBBA 4CYEA 1W1HA 1OQNA 3RCPA 4K2PA 1ZC4B 4GPTB 5IRSA 1TQZA 5JP4A 1MK9B 3WA0A 1UNRA 1PLSA 4QJ3B 3AU4A 5KQ1A 4HAVB 3TVVA 2NBVA 2N23A 4F7HA 1NU2A 2G35A 1KZGA 2Z0OA 1DBHA 2DHJA 5J3YA 2ELBA 2D4QA 3F0WA 4DXAB 1X1FA 3ULBA 4TKNA 4KAXB 1K5GB 3ZVRA 2L1CA 1DDWA 2Q13A 3LJUX 3PSCA 4D0NB 4Y94A 1V61A 1NTYA 3KZ1A 4K17A 1T77A 2DN6A 1P3RA 2I1JA 1KZ7A 1J19A 5HE1A 4IAPA 4WVFB 3PVLA 1U27A 2DX5A 5C79A 1WGUA 1KI1B 2D9XA 2D9YA 2EC1A 2DHKA 1X11A 1FGYA 5EFXA 2CY5A 3QIJA 4A6FB 1MKEA 5J3QA 1M7RA 3KSYA 2ZPYA 2GCLA 1UNQA 2AEHA 2LOXA 4HB4B 2OTXA 4DX90 2RSGA
chains in the Genus database with same CATH topology
2D10A 1U5DA 2H7EA 2M38A 2DTCA 4MT7A 2DFKA 3GYPA 1Q67A 2ADZA 2Z0QA 1V89A 2CRFA 1ZSQA 1U29A 4HAXB 1EF1A 2H7DA 1AQCA 2DYQA 4HAZB 4MK0A 1V88A 1QQGA 1DDMA 1N3HA 2COAA 5GOWB 2DHIA 5J3TA 5CLLB 4F7GA 1FOEA 1OY2A 1MPHA 5C16A 2RLOA 3M1IB 4NY0A 4A6FA 2RNRB 2LYDA 2MWNB 1GC7A 1BTKA 4ZRKA 1WI1A 2MFQA 1PFJA 1FHWA 4GN1A 2HE7A 2DKQA 2YT0A 5D3YA 4HB0B 2BCJA 1MK7B 1GC6A 2YS5A 1ZVRA 3SNHA 4IOYX 3GYOA 1DYNA 2GS0A 4CHMA 5D3XA 3SO6A 2XQNM 3P6AA 3DXDA 1UPQA 3UZTA 2JP2A 4HATB 2NZ8B 3X23A 2VSZA 3TFMA 3KRXA 4IFSA 2UZRA 4L6EA 2COCA 5D27A 3U7DA 3KY9A 2MKRA 1PMSA 3QBVB 4DX8A 2Z0PA 4HB3B 2OQBA 1UNPA 4H8SA 4HHVA 5L81A 2D9VA 1TJ6A 3ODOA 1LW3A 2ROVA 3SYXA 1WVHA 4HDOA 1V5MA 3IVFA 1U2BA 2P0FA 2K2UA 5D3WA 2J59M 3ULCA 3ML4A 2ELAA 1I7AA 2P0DA 3HW2B 2CODA 2YRYA 2IYBA 2Y8FA 1U5GA 5D3VA 4GXBA 4GZUA 1X1GA 3TCAA 5DHFB 4WSFA 1WGQA 3KRWA 5HE2A 5JLJB 5LONB 4Z2NA 3A8PA 2KCJA 1BWNA 1SGHA 1XCGA 3VIAA 2Y7BA 4XWXA 2I5FA 2RGNB 1EVHA 1H10A 2E2XA 5DI9B 4KVGB 1ISNA 1RRPB 5JHHA 2DX1A 1MIZB 3MPXA 1TXDA 2VRWB 3N7CA 3WYFB 3MDBC 1DROA 2D9ZA 1W1DA 2KGXB 4ZRIA 5HE3A 4GMXB 3HK0A 1RJ2A 1V5UA 2D9WA 1Y19B 2NMBA 2D11A 1EAZA 1H4RA 4YL8A 4C0AA 4F7UP 3PEGA 3CXBB 2DKPA 3AU5A 2YVCA 2UZSA 2GJYA 3TO1A 5FI0A 2RVBB 1WG7A 5C5BB 3A8QA 1P5TA 4PNKA 2J0MA 4PQ0A 3HQCA 1FHOA 4P7IA 3FEHA 5JHGA 2P0HA 1XD4A 3PP2A 1EGXA 2YSZA 3ODXA 4K81A 4WJ7A 1W1GA 1Z87A 2YF0A 3BJIA 5LOPB 1WJ1A 2J0KA 4NSWA 3DXCA 3A98B 1ZC3B 4HAUB 5HE0A 2I5CA 1XR0B 1FAOA 1WJMA 2QKLA 2EJ8A 2M14A 1SHCA 1Y5OA 4A5KA 2V76A 5CLQB 1MAIA 2K2JA 3D8DA 4K2OA 1B55A 2PZ1A 3U8ZA 3CIKA 1XODA 3ODWA 3D8EA 4B6HA 2J0JA 5C5BA 4EKUA 3D8FA 5KCVA 2EMTA 4A6KA 2EMSA 3SV1A 4A6HA 3FM8C 1DDVA 2P8VA 5DIFB 1X86A 4Z2MB 3ZDTA 1FGZA 3PZDA 1ZM0A 2L2IA 2VKIA 3P7ZA 2DA0A 5FI1A 1NTVA 3FSSA 2K00A 2W2XC 2QKMA 3T06A 5DHAB 2GCJA 1J0WA 1XKEA 4HDQA 4ZRJA 3QWMA 1K5DB 2FJLA 2DYNA 3BINA 4GMVA 1AWEA 1U5EA 4EJNA 2N0YA 2LKOA 3NSUA 1GG3A 2W2XD 2AL6A 3TW1A 1BTNA 4TYZA 2COFA 1V5PA 4KHAA 1FHXA 2HTHB 2LOZA 3DXEA 1X05A 1FB8A 3AJ4A 1U5FA 3PG7A 4MY6A 4EMOA 2R0DA 3SUZA 2ROZB 1UEFA 2UVMA 3O96A 1MIXA 1XX0A 2CY4A 1OMWA 3OANA 5KQ4A 2KUPA 1M7EA 2R09A 4KHBB 1LB1A 2D2QA 3PVWA 2DLWA 1NI2A 1I2HA 2W2WA 4HB2B 1UPRA 2YS3A 1QC6A 3VOQA 2X18A 1IRSA 3G9WA 4HAWB 3V5WA 3PVUA 2YS1A 2LG1A 4CHJA 2Y8GA 2MDXA 4YONA 2IFSA 4HAYB 4BBKA 3F5RA 4KHOA 2YT1A 1E5WA 2I1KA 2LULA 2RUKB 2CAYA 1BAKA 5C6RA 5DH9B 1P6SA 4DBBA 4CYEA 1W1HA 1OQNA 3RCPA 4K2PA 1ZC4B 4GPTB 1TQZA 5JP4A 1MK9B 3WA0A 1UNRA 1PLSA 3AU4A 5KQ1A 4HAVB 3TVVA 2N23A 4F7HA 1NU2A 2G35A 1KZGA 2Z0OA 1DBHA 2DHJA 5J3YA 2ELBA 2D4QA 3F0WA 4DXAB 1X1FA 3ULBA 4TKNA 4KAXB 1K5GB 3ZVRA 2L1CA 1DDWA 2Q13A 3LJUX 3PSCA 4D0NB 4Y94A 1V61A 1NTYA 3KZ1A 4K17A 2DN6A 1P3RA 2I1JA 1KZ7A 1J19A 5HE1A 4IAPA 4WVFB 3PVLA 1U27A 2DX5A 5C79A 1WGUA 1KI1B 2D9XA 2D9YA 2EC1A 2DHKA 1X11A 1FGYA 5EFXA 2CY5A 3QIJA 4A6FB 1MKEA 5J3QA 1M7RA 3KSYA 2ZPYA 2GCLA 1UNQA 2AEHA 2LOXA 4HB4B 2OTXA 4DX90 2RSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D10 A;  1U5D A;  2H7E A;  2M38 A;  2DTC A;  4MT7 A;  2DFK A;  3GYP A;  1Q67 A;  2ADZ A;  2Z0Q A;  1V89 A;  2CRF A;  1ZSQ A;  1U29 A;  4HAX B;  1EF1 A;  2H7D A;  1AQC A;  2DYQ A;  4HAZ B;  4MK0 A;  1V88 A;  1QQG A;  1DDM A;  1N3H A;  2COA A;  5GOW B;  2DHI A;  5J3T A;  5CLL B;  4F7G A;  1FOE A;  1OY2 A;  1MPH A;  5C16 A;  2RLO A;  3M1I B;  4NY0 A;  4A6F A;  2RNR B;  2LYD A;  2MWN B;  1GC7 A;  1BTK A;  4ZRK A;  1WI1 A;  2MFQ A;  1PFJ A;  1FHW A;  4GN1 A;  2HE7 A;  2DKQ A;  2YT0 A;  5D3Y A;  4HB0 B;  2BCJ A;  1MK7 B;  1GC6 A;  2YS5 A;  1ZVR A;  3SNH A;  4IOY X;  3GYO A;  1DYN A;  2GS0 A;  4CHM A;  5D3X A;  3SO6 A;  2XQN M;  3P6A A;  3DXD A;  1UPQ A;  3UZT A;  2JP2 A;  4HAT B;  2NZ8 B;  3X23 A;  2VSZ A;  3TFM A;  3KRX A;  4IFS A;  2UZR A;  4L6E A;  2COC A;  5D27 A;  3U7D A;  3KY9 A;  2MKR A;  1PMS A;  3QBV B;  4DX8 A;  2Z0P A;  4HB3 B;  2OQB A;  1UNP A;  4H8S A;  4HHV A;  5L81 A;  2D9V A;  1TJ6 A;  3ODO A;  1LW3 A;  2ROV A;  3SYX A;  1WVH A;  4HDO A;  1V5M A;  3IVF A;  1U2B A;  2P0F A;  2K2U A;  5D3W A;  2J59 M;  3ULC A;  3ML4 A;  2ELA A;  1I7A A;  2P0D A;  3HW2 B;  2COD A;  2YRY A;  2IYB A;  2Y8F A;  1U5G A;  5D3V A;  4GXB A;  4GZU A;  1X1G A;  3TCA A;  5DHF B;  4WSF A;  1WGQ A;  3KRW A;  5HE2 A;  5JLJ B;  5LON B;  4Z2N A;  3A8P A;  2KCJ A;  1BWN A;  1SGH A;  1XCG A;  3VIA A;  2Y7B A;  4XWX A;  2I5F A;  2RGN B;  1EVH A;  1H10 A;  2E2X A;  5DI9 B;  4KVG B;  1ISN A;  1RRP B;  5JHH A;  2DX1 A;  1MIZ B;  3MPX A;  1TXD A;  2VRW B;  3N7C A;  3WYF B;  3MDB C;  1DRO A;  2D9Z A;  1W1D A;  2KGX B;  4ZRI A;  5HE3 A;  4GMX B;  3HK0 A;  1RJ2 A;  1V5U A;  2D9W A;  1Y19 B;  2NMB A;  2D11 A;  1EAZ A;  1H4R A;  4YL8 A;  4C0A A;  4F7U P;  3PEG A;  3CXB B;  2DKP A;  3AU5 A;  2YVC A;  2UZS A;  2GJY A;  3TO1 A;  5FI0 A;  2RVB B;  1WG7 A;  5C5B B;  3A8Q A;  1P5T A;  4PNK A;  2J0M A;  4PQ0 A;  3HQC A;  1FHO A;  4P7I A;  3FEH A;  5JHG A;  2P0H A;  1XD4 A;  3PP2 A;  1EGX A;  2YSZ A;  3ODX A;  4K81 A;  4WJ7 A;  1W1G A;  1Z87 A;  2YF0 A;  3BJI A;  5LOP B;  1WJ1 A;  2J0K A;  4NSW A;  3DXC A;  3A98 B;  1ZC3 B;  4HAU B;  5HE0 A;  2I5C A;  1XR0 B;  1FAO A;  1WJM A;  2QKL A;  2EJ8 A;  2M14 A;  1SHC A;  1Y5O A;  4A5K A;  2V76 A;  5CLQ B;  1MAI A;  2K2J A;  3D8D A;  4K2O A;  1B55 A;  2PZ1 A;  3U8Z A;  3CIK A;  1XOD A;  3ODW A;  3D8E A;  4B6H A;  2J0J A;  5C5B A;  4EKU A;  3D8F A;  5KCV A;  2EMT A;  4A6K A;  2EMS A;  3SV1 A;  4A6H A;  3FM8 C;  1DDV A;  2P8V A;  5DIF B;  1X86 A;  4Z2M B;  3ZDT A;  1FGZ A;  3PZD A;  1ZM0 A;  2L2I A;  2VKI A;  3P7Z A;  2DA0 A;  5FI1 A;  1NTV A;  3FSS A;  2K00 A;  2W2X C;  2QKM A;  3T06 A;  5DHA B;  2GCJ A;  1J0W A;  1XKE A;  4HDQ A;  4ZRJ A;  3QWM A;  1K5D B;  2FJL A;  2DYN A;  3BIN A;  4GMV A;  1AWE A;  1U5E A;  4EJN A;  2N0Y A;  2LKO A;  3NSU A;  1GG3 A;  2W2X D;  2AL6 A;  3TW1 A;  1BTN A;  4TYZ A;  2COF A;  1V5P A;  4KHA A;  1FHX A;  2HTH B;  2LOZ A;  3DXE A;  1X05 A;  1FB8 A;  3AJ4 A;  1U5F A;  3PG7 A;  4MY6 A;  4EMO A;  2R0D A;  3SUZ A;  2ROZ B;  1UEF A;  2UVM A;  3O96 A;  1MIX A;  1XX0 A;  2CY4 A;  1OMW A;  3OAN A;  5KQ4 A;  2KUP A;  1M7E A;  2R09 A;  4KHB B;  1LB1 A;  2D2Q A;  3PVW A;  2DLW A;  1NI2 A;  1I2H A;  2W2W A;  4HB2 B;  1UPR A;  2YS3 A;  1QC6 A;  3VOQ A;  2X18 A;  1IRS A;  3G9W A;  4HAW B;  3V5W A;  3PVU A;  2YS1 A;  2LG1 A;  4CHJ A;  2Y8G A;  2MDX A;  4YON A;  2IFS A;  4HAY B;  4BBK A;  3F5R A;  4KHO A;  2YT1 A;  1E5W A;  2I1K A;  2LUL A;  2RUK B;  2CAY A;  1BAK A;  5C6R A;  5DH9 B;  1P6S A;  4DBB A;  4CYE A;  1W1H A;  1OQN A;  3RCP A;  4K2P A;  1ZC4 B;  4GPT B;  1TQZ A;  5JP4 A;  1MK9 B;  3WA0 A;  1UNR A;  1PLS A;  3AU4 A;  5KQ1 A;  4HAV B;  3TVV A;  2N23 A;  4F7H A;  1NU2 A;  2G35 A;  1KZG A;  2Z0O A;  1DBH A;  2DHJ A;  5J3Y A;  2ELB A;  2D4Q A;  3F0W A;  4DXA B;  1X1F A;  3ULB A;  4TKN A;  4KAX B;  1K5G B;  3ZVR A;  2L1C A;  1DDW A;  2Q13 A;  3LJU X;  3PSC A;  4D0N B;  4Y94 A;  1V61 A;  1NTY A;  3KZ1 A;  4K17 A;  2DN6 A;  1P3R A;  2I1J A;  1KZ7 A;  1J19 A;  5HE1 A;  4IAP A;  4WVF B;  3PVL A;  1U27 A;  2DX5 A;  5C79 A;  1WGU A;  1KI1 B;  2D9X A;  2D9Y A;  2EC1 A;  2DHK A;  1X11 A;  1FGY A;  5EFX A;  2CY5 A;  3QIJ A;  4A6F B;  1MKE A;  5J3Q A;  1M7R A;  3KSY A;  2ZPY A;  2GCL A;  1UNQ A;  2AEH A;  2LOX A;  4HB4 B;  2OTX A;  4DX9 0;  2RSG A; 
#chains in the Genus database with same CATH topology
 2D10 A;  1U5D A;  2H7E A;  3HIE A;  2M38 A;  2DTC A;  4MT7 A;  3HSA A;  2DFK A;  3GYP A;  1Q67 A;  2ADZ A;  2Z0Q A;  1V89 A;  2CRF A;  1ZSQ A;  1U29 A;  4HAX B;  1EF1 A;  2H7D A;  1AQC A;  2DYQ A;  4HAZ B;  2R2Y A;  4MK0 A;  1V88 A;  1QQG A;  1DDM A;  1N3H A;  2COA A;  5GOW B;  2DHI A;  5J3T A;  5CLL B;  4F7G A;  1FOE A;  1OY2 A;  1MPH A;  5C16 A;  2RLO A;  3M1I B;  4NY0 A;  4A6F A;  2RNR B;  2LYD A;  4HSI A;  2MWN B;  1GC7 A;  1BTK A;  4ZRK A;  1WI1 A;  2MFQ A;  1PFJ A;  1FHW A;  4GN1 A;  2HE7 A;  2DKQ A;  2YT0 A;  5D3Y A;  4HB0 B;  2BCJ A;  1MK7 B;  1GC6 A;  2YS5 A;  1ZVR A;  3SNH A;  4IOY X;  3GYO A;  1DYN A;  4DIX A;  2GS0 A;  4CHM A;  2Z4D A;  5D3X A;  4KHB A;  3SO6 A;  2XQN M;  3P6A A;  3DXD A;  3NW8 A;  2KIG A;  1UPQ A;  3UZT A;  2JP2 A;  4HAT B;  3NWA A;  2NZ8 B;  3X23 A;  2VSZ A;  3TFM A;  3KRX A;  4IFS A;  2UZR A;  4L6E A;  4QXA B;  2COC A;  5D27 A;  3U7D A;  3KY9 A;  4D6W A;  2MKR A;  1PMS A;  3QBV B;  4DX8 A;  2Z0P A;  4HB3 B;  2OQB A;  4OSN A;  1UNP A;  4H8S A;  3OHM B;  4HHV A;  5L81 A;  2D9V A;  3FVC A;  2FJU B;  1TJ6 A;  3ODO A;  4QJ4 B;  1LW3 A;  2ROV A;  1ZYI A;  3SYX A;  1WVH A;  4HDO A;  1V5M A;  3IVF A;  1U2B A;  2P0F A;  2K2U A;  5D3W A;  2J59 M;  3ULC A;  2KIE A;  3ML4 A;  2ELA A;  2K8E A;  1I7A A;  2P0D A;  4OT1 A;  3HW2 B;  4QJ5 B;  2COD A;  2YRY A;  2IYB A;  2Y8F A;  1U5G A;  5D3V A;  4GXB A;  4GZU A;  1X1G A;  3TCA A;  5DHF B;  4WSF A;  1WGQ A;  3KRW A;  5HE2 A;  5JLJ B;  5LON B;  4Z2N A;  3A8P A;  2KCJ A;  1BWN A;  1SGH A;  1XCG A;  3VIA A;  2Y7B A;  4XWX A;  2I5F A;  2RGN B;  1EVH A;  1H10 A;  2E2X A;  5DI9 B;  4KVG B;  1ISN A;  1RRP B;  5JHH A;  2DX1 A;  1MIZ B;  3MPX A;  1TXD A;  2VRW B;  3N7C A;  2Z59 A;  3WYF B;  3MDB C;  1DRO A;  2D9Z A;  1W1D A;  2KGX B;  4ZRI A;  5HE3 A;  4GMX B;  3HK0 A;  2Z13 A;  1RJ2 A;  5M4Y B;  1V5U A;  2D9W A;  1Y19 B;  2NMB A;  2D11 A;  1EAZ A;  1H4R A;  4YL8 A;  4C0A A;  4F7U P;  3PEG A;  3CXB B;  2DKP A;  3AU5 A;  2YVC A;  2UZS A;  2GJY A;  3TO1 A;  5FI0 A;  2RVB B;  2ZKM X;  1WG7 A;  5C5B B;  3A8Q A;  1P5T A;  4PNK A;  2J0M A;  4PQ0 A;  3HQC A;  1FHO A;  4P7I A;  3FEH A;  5JHG A;  2P0H A;  1XD4 A;  3PP2 A;  1EGX A;  2YSZ A;  3ODX A;  4K81 A;  4WJ7 A;  1W1G A;  1Z87 A;  2YF0 A;  3BJI A;  5LOP B;  1WJ1 A;  2J0K A;  4NSW A;  3DXC A;  3A98 B;  1ZC3 B;  4HAU B;  3A58 A;  5HE0 A;  2I5C A;  1XR0 B;  1FAO A;  1WJM A;  2QKL A;  2EJ8 A;  2M14 A;  1SHC A;  1Y5O A;  4A5K A;  2V76 A;  5CLQ B;  5I2S A;  1MAI A;  2K2J A;  3D8D A;  4K2O A;  1B55 A;  2PZ1 A;  3U8Z A;  3CIK A;  5LG4 B;  1XOD A;  3ODW A;  3D8E A;  4B6H A;  2J0J A;  5C5B A;  4EKU A;  3D8F A;  3NWD A;  5KCV A;  3NWF A;  2EMT A;  4A6K A;  2EMS A;  3SV1 A;  3DCX A;  4A6H A;  3FM8 C;  1DDV A;  2P8V A;  5DIF B;  1X86 A;  4Z2M B;  3ZDT A;  1FGZ A;  3PZD A;  1ZM0 A;  2L2I A;  2KR0 A;  2VKI A;  4GOU A;  3P7Z A;  2DA0 A;  1MI1 A;  5FI1 A;  1NTV A;  3FSS A;  2K00 A;  2W2X C;  2QKM A;  3T06 A;  5DHA B;  2GCJ A;  1J0W A;  1XKE A;  4HDQ A;  4ZRJ A;  3QWM A;  2YT2 A;  1K5D B;  2FJL A;  2DYN A;  3BIN A;  4GMV A;  1AWE A;  1U5E A;  4L1R A;  4EJN A;  2N0Y A;  2LKO A;  3NSU A;  1GG3 A;  2W2X D;  2AL6 A;  3TW1 A;  1BTN A;  4GNK B;  2GUM A;  4TYZ A;  2COF A;  1V5P A;  4KHA A;  2K49 A;  1FHX A;  2HTH B;  2LOZ A;  3DXE A;  1X05 A;  1FB8 A;  3AJ4 A;  1U5F A;  3PG7 A;  4MY6 A;  4EMO A;  2R0D A;  3SUZ A;  2ROZ B;  1UEF A;  3U12 A;  3B77 A;  2UVM A;  3O96 A;  1MIX A;  1XX0 A;  2CY4 A;  1OMW A;  3OAN A;  5KQ4 A;  2KUP A;  1M7E A;  2R09 A;  4KHB B;  1LB1 A;  2RRF A;  2D2Q A;  3PVW A;  2DLW A;  1NI2 A;  1I2H A;  2W2W A;  4HB2 B;  5I2M A;  1UPR A;  2YS3 A;  1QC6 A;  3VOQ A;  2X18 A;  1IRS A;  3G9W A;  4HAW B;  3V5W A;  2KUQ A;  3PVU A;  2YS1 A;  2LG1 A;  2Z14 A;  4CHJ A;  2Y8G A;  2MDX A;  4YON A;  2IFS A;  4HAY B;  4BBK A;  3F5R A;  4KHO A;  2YT1 A;  1E5W A;  4CSQ A;  2I1K A;  2LUL A;  2RUK B;  2CAY A;  1BAK A;  5C6R A;  5DH9 B;  1P6S A;  4DBB A;  4CYE A;  1W1H A;  1OQN A;  3RCP A;  4K2P A;  1ZC4 B;  4GPT B;  5IRS A;  1TQZ A;  5JP4 A;  1MK9 B;  3WA0 A;  1UNR A;  1PLS A;  4QJ3 B;  3AU4 A;  5KQ1 A;  4HAV B;  3TVV A;  2NBV A;  2N23 A;  4F7H A;  1NU2 A;  2G35 A;  1KZG A;  2Z0O A;  1DBH A;  2DHJ A;  5J3Y A;  2ELB A;  2D4Q A;  3F0W A;  4DXA B;  1X1F A;  3ULB A;  4TKN A;  4KAX B;  1K5G B;  3ZVR A;  2L1C A;  1DDW A;  2Q13 A;  3LJU X;  3PSC A;  4D0N B;  4Y94 A;  1V61 A;  1NTY A;  3KZ1 A;  4K17 A;  1T77 A;  2DN6 A;  1P3R A;  2I1J A;  1KZ7 A;  1J19 A;  5HE1 A;  4IAP A;  4WVF B;  3PVL A;  1U27 A;  2DX5 A;  5C79 A;  1WGU A;  1KI1 B;  2D9X A;  2D9Y A;  2EC1 A;  2DHK A;  1X11 A;  1FGY A;  5EFX A;  2CY5 A;  3QIJ A;  4A6F B;  1MKE A;  5J3Q A;  1M7R A;  3KSY A;  2ZPY A;  2GCL A;  1UNQ A;  2AEH A;  2LOX A;  4HB4 B;  2OTX A;  4DX9 0;  2RSG A; 
#chains in the Genus database with same CATH homology
 2D10 A;  1U5D A;  2H7E A;  2M38 A;  2DTC A;  4MT7 A;  2DFK A;  3GYP A;  1Q67 A;  2ADZ A;  2Z0Q A;  1V89 A;  2CRF A;  1ZSQ A;  1U29 A;  4HAX B;  1EF1 A;  2H7D A;  1AQC A;  2DYQ A;  4HAZ B;  4MK0 A;  1V88 A;  1QQG A;  1DDM A;  1N3H A;  2COA A;  5GOW B;  2DHI A;  5J3T A;  5CLL B;  4F7G A;  1FOE A;  1OY2 A;  1MPH A;  5C16 A;  2RLO A;  3M1I B;  4NY0 A;  4A6F A;  2RNR B;  2LYD A;  2MWN B;  1GC7 A;  1BTK A;  4ZRK A;  1WI1 A;  2MFQ A;  1PFJ A;  1FHW A;  4GN1 A;  2HE7 A;  2DKQ A;  2YT0 A;  5D3Y A;  4HB0 B;  2BCJ A;  1MK7 B;  1GC6 A;  2YS5 A;  1ZVR A;  3SNH A;  4IOY X;  3GYO A;  1DYN A;  2GS0 A;  4CHM A;  5D3X A;  3SO6 A;  2XQN M;  3P6A A;  3DXD A;  1UPQ A;  3UZT A;  2JP2 A;  4HAT B;  2NZ8 B;  3X23 A;  2VSZ A;  3TFM A;  3KRX A;  4IFS A;  2UZR A;  4L6E A;  2COC A;  5D27 A;  3U7D A;  3KY9 A;  2MKR A;  1PMS A;  3QBV B;  4DX8 A;  2Z0P A;  4HB3 B;  2OQB A;  1UNP A;  4H8S A;  4HHV A;  5L81 A;  2D9V A;  1TJ6 A;  3ODO A;  1LW3 A;  2ROV A;  3SYX A;  1WVH A;  4HDO A;  1V5M A;  3IVF A;  1U2B A;  2P0F A;  2K2U A;  5D3W A;  2J59 M;  3ULC A;  3ML4 A;  2ELA A;  1I7A A;  2P0D A;  3HW2 B;  2COD A;  2YRY A;  2IYB A;  2Y8F A;  1U5G A;  5D3V A;  4GXB A;  4GZU A;  1X1G A;  3TCA A;  5DHF B;  4WSF A;  1WGQ A;  3KRW A;  5HE2 A;  5JLJ B;  5LON B;  4Z2N A;  3A8P A;  2KCJ A;  1BWN A;  1SGH A;  1XCG A;  3VIA A;  2Y7B A;  4XWX A;  2I5F A;  2RGN B;  1EVH A;  1H10 A;  2E2X A;  5DI9 B;  4KVG B;  1ISN A;  1RRP B;  5JHH A;  2DX1 A;  1MIZ B;  3MPX A;  1TXD A;  2VRW B;  3N7C A;  3WYF B;  3MDB C;  1DRO A;  2D9Z A;  1W1D A;  2KGX B;  4ZRI A;  5HE3 A;  4GMX B;  3HK0 A;  1RJ2 A;  1V5U A;  2D9W A;  1Y19 B;  2NMB A;  2D11 A;  1EAZ A;  1H4R A;  4YL8 A;  4C0A A;  4F7U P;  3PEG A;  3CXB B;  2DKP A;  3AU5 A;  2YVC A;  2UZS A;  2GJY A;  3TO1 A;  5FI0 A;  2RVB B;  1WG7 A;  5C5B B;  3A8Q A;  1P5T A;  4PNK A;  2J0M A;  4PQ0 A;  3HQC A;  1FHO A;  4P7I A;  3FEH A;  5JHG A;  2P0H A;  1XD4 A;  3PP2 A;  1EGX A;  2YSZ A;  3ODX A;  4K81 A;  4WJ7 A;  1W1G A;  1Z87 A;  2YF0 A;  3BJI A;  5LOP B;  1WJ1 A;  2J0K A;  4NSW A;  3DXC A;  3A98 B;  1ZC3 B;  4HAU B;  5HE0 A;  2I5C A;  1XR0 B;  1FAO A;  1WJM A;  2QKL A;  2EJ8 A;  2M14 A;  1SHC A;  1Y5O A;  4A5K A;  2V76 A;  5CLQ B;  1MAI A;  2K2J A;  3D8D A;  4K2O A;  1B55 A;  2PZ1 A;  3U8Z A;  3CIK A;  1XOD A;  3ODW A;  3D8E A;  4B6H A;  2J0J A;  5C5B A;  4EKU A;  3D8F A;  5KCV A;  2EMT A;  4A6K A;  2EMS A;  3SV1 A;  4A6H A;  3FM8 C;  1DDV A;  2P8V A;  5DIF B;  1X86 A;  4Z2M B;  3ZDT A;  1FGZ A;  3PZD A;  1ZM0 A;  2L2I A;  2VKI A;  3P7Z A;  2DA0 A;  5FI1 A;  1NTV A;  3FSS A;  2K00 A;  2W2X C;  2QKM A;  3T06 A;  5DHA B;  2GCJ A;  1J0W A;  1XKE A;  4HDQ A;  4ZRJ A;  3QWM A;  1K5D B;  2FJL A;  2DYN A;  3BIN A;  4GMV A;  1AWE A;  1U5E A;  4EJN A;  2N0Y A;  2LKO A;  3NSU A;  1GG3 A;  2W2X D;  2AL6 A;  3TW1 A;  1BTN A;  4TYZ A;  2COF A;  1V5P A;  4KHA A;  1FHX A;  2HTH B;  2LOZ A;  3DXE A;  1X05 A;  1FB8 A;  3AJ4 A;  1U5F A;  3PG7 A;  4MY6 A;  4EMO A;  2R0D A;  3SUZ A;  2ROZ B;  1UEF A;  2UVM A;  3O96 A;  1MIX A;  1XX0 A;  2CY4 A;  1OMW A;  3OAN A;  5KQ4 A;  2KUP A;  1M7E A;  2R09 A;  4KHB B;  1LB1 A;  2D2Q A;  3PVW A;  2DLW A;  1NI2 A;  1I2H A;  2W2W A;  4HB2 B;  1UPR A;  2YS3 A;  1QC6 A;  3VOQ A;  2X18 A;  1IRS A;  3G9W A;  4HAW B;  3V5W A;  3PVU A;  2YS1 A;  2LG1 A;  4CHJ A;  2Y8G A;  2MDX A;  4YON A;  2IFS A;  4HAY B;  4BBK A;  3F5R A;  4KHO A;  2YT1 A;  1E5W A;  2I1K A;  2LUL A;  2RUK B;  2CAY A;  1BAK A;  5C6R A;  5DH9 B;  1P6S A;  4DBB A;  4CYE A;  1W1H A;  1OQN A;  3RCP A;  4K2P A;  1ZC4 B;  4GPT B;  1TQZ A;  5JP4 A;  1MK9 B;  3WA0 A;  1UNR A;  1PLS A;  3AU4 A;  5KQ1 A;  4HAV B;  3TVV A;  2N23 A;  4F7H A;  1NU2 A;  2G35 A;  1KZG A;  2Z0O A;  1DBH A;  2DHJ A;  5J3Y A;  2ELB A;  2D4Q A;  3F0W A;  4DXA B;  1X1F A;  3ULB A;  4TKN A;  4KAX B;  1K5G B;  3ZVR A;  2L1C A;  1DDW A;  2Q13 A;  3LJU X;  3PSC A;  4D0N B;  4Y94 A;  1V61 A;  1NTY A;  3KZ1 A;  4K17 A;  2DN6 A;  1P3R A;  2I1J A;  1KZ7 A;  1J19 A;  5HE1 A;  4IAP A;  4WVF B;  3PVL A;  1U27 A;  2DX5 A;  5C79 A;  1WGU A;  1KI1 B;  2D9X A;  2D9Y A;  2EC1 A;  2DHK A;  1X11 A;  1FGY A;  5EFX A;  2CY5 A;  3QIJ A;  4A6F B;  1MKE A;  5J3Q A;  1M7R A;  3KSY A;  2ZPY A;  2GCL A;  1UNQ A;  2AEH A;  2LOX A;  4HB4 B;  2OTX A;  4DX9 0;  2RSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...