1EGXA

Solution structure of the ena-vasp homology 1 (evh1) domain of human vasodilator-stimulated phosphoprotein (vasp)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
115
structure length
115
Chain Sequence
MSETVICSSRATVMLYDDGNKRWLPAGTGPQAFSRVQIYHNPTANSFRVVGRKMQPDQQVVINCAIVRGVKYNQATPNFHQWRDARQVWGLNFGSKEDAAQFAAGMASALEALEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dual epitope recognition by the VASP EVH1 domain modulates polyproline ligand specificity and binding affinity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords VASODILATOR-STIMULATED PHOSPHOPROTEIN
total genus 21
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2000-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1egxA00
1DROA 1OMWA 2I5FA 1EGXA 1U5GA 1DYNA 3X23A 1GG3A 4HAUB 4GZUA 1UPRA 2DHKA 1BTNA 4MK0A 2M14A 4CYEA 3P6AA 2Y8GA 2HTHB 1NU2A 2CY4A 2D9ZA 2MWNB 2DX5A 3PG7A 2Q13A 3NSUA 2DKPA 1FB8A 1EVHA 3OANA 1KI1B 1DDWA 1J19A 5D3YA 2I1JA 4KVGB 1PMSA 3SO6A 3V5WA 1ZC4B 1K5GB 1WGUA 3MPXA 1RJ2A 2DHIA 2LG1A 2BCJA 3FM8C 1DDMA 2PZ1A 5FI0A 2VSZA 4YL8A 2DLWA 4B6HA 4H8SA 1U5DA 3DXCA 1WJMA 2CY5A 3TVVA 2P0HA 2YSZA 4IAPA 4KAXB 2OTXA 3IVFA 3N7CA 4ZRKA 1X11A 3TO1A 2DHJA 2EC1A 3O96A 2DFKA 2KUPA 1EF1A 4GMXB 2COCA 2P0DA 4WJ7A 1ZM0A 1J0WA 3DXDA 3AU4A 1PLSA 1X86A 1DDVA 3QBVB 2GS0A 5L81A 5HE2A 2J59M 1P6SA 1U29A 3GYOA 1I2HA 4A6KA 3A98B 1H10A 2L1CA 1ZSQA 1TQZA 3AU5A 1UNPA 5C6RA 2ELAA 2RNRB 2D2QA 1QC6A 5LONB 2KCJA 3KZ1A 5LOPB 4HAVB 4K2PA 1SGHA 3KRWA 1XD4A 5EFXA 2QKMA 3A8QA 5HE1A 2RSGA 2HE7A 2YS5A 2LYDA 1WJ1A 4HDQA 3VOQA 2DTCA 3PVWA 2D11A 1I7AA 4D0NB 1ISNA 2I5CA 2COFA 1MIXA 4L6EA 4NSWA 2D9VA 1FHXA 2ADZA 2VRWB 2RLOA 4A6FB 4HHVA 5DHAB 1Q67A 1V88A 2YVCA 4K2OA 1EAZA 4Z2MB 2D9XA 4HAWB 4EJNA 4GXBA 4HB0B 1P3RA 1ZVRA 4GPTB 1UEFA 2R09A 2N0YA 1X05A 3TW1A 1V5UA 1ZC3B 4Z2NA 1AWEA 1XR0B 1U5EA 1Y19B 4F7UP 4MT7A 3ODWA 3F5RA 5C5BA 5DH9B 1QQGA 4ZRJA 4HB3B 1P5TA 2LKOA 5JHHA 4EMOA 5JLJB 2VKIA 3LJUX 2H7DA 1MPHA 3ML4A 5DHFB 5FI1A 1MK9B 1FHOA 1MAIA 3G9WA 1XCGA 4PQ0A 4GMVA 3F0WA 4HATB 3M1IB 3TFMA 3ULBA 2J0MA 4IOYX 3VIAA 4ZRIA 2K2UA 5C16A 2X18A 3ODXA 3QIJA 5KCVA 2YT0A 3HK0A 3ULCA 1IRSA 4HDOA 4YONA 1MIZB 1FAOA 1U27A 1U5FA 2NMBA 4KHAA 2FJLA 2YRYA 3RCPA 1V89A 2YS3A 4KHBB 4A6FA 2N23A 2DX1A 2OQBA 1H4RA 2RUKB 1FOEA 4GN1A 2ELBA 2P0FA 2NZ8B 5KQ4A 2H7EA 2XQNM 2DYNA 2RGNB 2IYBA 2COAA 1PFJA 3T06A 3SYXA 1KZGA 2GCJA 1SHCA 4HB2B 4PNKA 3P7ZA 1U2BA 1WG7A 2V76A 1XODA 2LOZA 3SUZA 1Z87A 3D8DA 1GC7A 2Y8FA 3MDBC 5GOWB 5J3YA 1FHWA 2W2XC 2IFSA 3KY9A 2YT1A 2Z0PA 3TCAA 2Z0OA 4HB4B 2MKRA 2MFQA 2K2JA 3GYPA 3D8EA 2UZRA 2GCLA 3HW2B 1GC6A 3HQCA 4F7GA 1UNRA 5DIFB 1BAKA 2LULA 5HE0A 2UVMA 4NY0A 5HE3A 2R0DA 2DKQA 1MK7B 1V5MA 1NTVA 2YS1A 1TJ6A 2AEHA 2D9YA 4K81A 1X1FA 2AL6A 2DN6A 1N3HA 3A8PA 5C5BB 2I1KA 2Y7BA 1Y5OA 2YF0A 4Y94A 1BWNA 1TXDA 1BTKA 4K17A 1LW3A 3BINA 3PVLA 3WA0A 2P8VA 3AJ4A 5D3XA 1WVHA 3KRXA 1NI2A 2Z0QA 4HAYB 2DYQA 3KSYA 2LOXA 2K00A 3U7DA 3PVUA 3CXBB 2CODA 2W2WA 2DA0A 4WSFA 3SV1A 3BJIA 3U8ZA 5CLQB 2EMSA 1V61A 1X1GA 4F7HA 1M7RA 1UPQA 2J0JA 3DXEA 4A6HA 4MY6A 1MKEA 2J0KA 3SNHA 5KQ1A 5DI9B 1W1DA 3ZDTA 4P7IA 5CLLB 3D8FA 5J3QA 4KHOA 2ZPYA 2MDXA 1OQNA 4HAXB 4CHJA 2RVBB 4XWXA 1XX0A 2KGXB 1M7EA 5J3TA 2EJ8A 1RRPB 3PZDA 2CRFA 3FEHA 2G35A 3WYFB 4DBBA 1UNQA 1OY2A 2ROVA 4TKNA 1WI1A 3UZTA 5JHGA 2CAYA 1WGQA 1W1GA 4WVFB 2L2IA 2W2XD 3QWMA 2D9WA 1K5DB 4IFSA 5C79A 4CHMA 2UZSA 4C0AA 2ROZB 5JP4A 1B55A 4DX8A 1FGYA 1XKEA 1AQCA 3PSCA 2GJYA 2E2XA 4EKUA 2D10A 2M38A 3PEGA 5D27A 4A5KA 2JP2A 3ZVRA 4DXAB 1V5PA 1NTYA 5D3WA 4HAZB 3CIKA 2D4QA 1DBHA 3PP2A 4DX90 1LB1A 4TYZA 2EMTA 1E5WA 2QKLA 1W1HA 1KZ7A 4BBKA 5D3VA 1FGZA 3FSSA 3ODOA
chains in the Genus database with same CATH superfamily
1DROA 1OMWA 2I5FA 1EGXA 1U5GA 1DYNA 3X23A 1GG3A 4HAUB 4GZUA 1UPRA 2DHKA 1BTNA 4MK0A 2M14A 4CYEA 3P6AA 3OHMB 2Y8GA 2HTHB 1NU2A 2CY4A 2D9ZA 2MWNB 2DX5A 3PG7A 2Q13A 3NSUA 2DKPA 1FB8A 1EVHA 3OANA 4HSIA 1KI1B 1DDWA 1J19A 5D3YA 2I1JA 4KVGB 4QJ4B 1PMSA 3SO6A 3V5WA 1ZC4B 1K5GB 4QJ5B 1WGUA 3MPXA 1RJ2A 2DHIA 2LG1A 2BCJA 3FM8C 1DDMA 2PZ1A 5FI0A 2VSZA 4YL8A 2DLWA 4B6HA 4QXAB 4H8SA 1U5DA 3DXCA 1WJMA 2CY5A 3TVVA 2P0HA 2YSZA 4IAPA 4KAXB 3HSAA 2OTXA 3IVFA 3N7CA 4ZRKA 1X11A 3TO1A 2DHJA 2EC1A 3O96A 2DFKA 2KUPA 1EF1A 4GMXB 2COCA 2P0DA 4WJ7A 1ZM0A 1J0WA 3DXDA 3AU4A 1PLSA 1X86A 1DDVA 3QBVB 2GS0A 5L81A 5HE2A 2J59M 1P6SA 1U29A 3GYOA 1I2HA 4A6KA 3A98B 1H10A 2L1CA 1ZSQA 1TQZA 3AU5A 1UNPA 5C6RA 5M4YB 2Z59A 2ELAA 2RNRB 3NWAA 2D2QA 1QC6A 5LONB 2KCJA 3KZ1A 5LOPB 4HAVB 4K2PA 1SGHA 3KRWA 1XD4A 5EFXA 2QKMA 3A8QA 5HE1A 2RSGA 2Z14A 2HE7A 2YS5A 2LYDA 1WJ1A 4HDQA 3VOQA 2DTCA 3PVWA 2D11A 1I7AA 4D0NB 1ISNA 2I5CA 2COFA 2Z13A 1MIXA 4L6EA 4NSWA 2D9VA 5I2MA 1FHXA 2ADZA 2VRWB 2RLOA 4A6FB 4HHVA 5DHAB 1Q67A 1V88A 2YVCA 4K2OA 1EAZA 2ZKMX 4Z2MB 2D9XA 4HAWB 4EJNA 4GXBA 4HB0B 1P3RA 1ZVRA 4GPTB 1UEFA 2R09A 4KHBA 2N0YA 1X05A 3TW1A 2R2YA 1V5UA 1ZC3B 4Z2NA 1AWEA 1XR0B 1U5EA 1Y19B 2K8EA 4F7UP 3DCXA 4MT7A 3ODWA 3F5RA 5C5BA 5DH9B 3A58A 1QQGA 4ZRJA 4HB3B 1P5TA 2LKOA 5JHHA 4EMOA 5JLJB 2VKIA 3LJUX 2H7DA 2RRFA 1MPHA 3ML4A 5DHFB 5FI1A 1MK9B 1FHOA 4GOUA 1MAIA 3G9WA 1XCGA 4PQ0A 4GMVA 3F0WA 4HATB 3M1IB 3TFMA 3ULBA 3B77A 2KIEA 2J0MA 4IOYX 3VIAA 4ZRIA 2K2UA 5C16A 1ZYIA 2X18A 3ODXA 2KUQA 3QIJA 5KCVA 2YT0A 3HK0A 3ULCA 4DIXA 1IRSA 4HDOA 4YONA 1MIZB 1FAOA 1U27A 1U5FA 2NMBA 4KHAA 2FJLA 3NWDA 2YRYA 3RCPA 1V89A 2YS3A 4KHBB 4A6FA 2N23A 3FVCA 2DX1A 2OQBA 1H4RA 2RUKB 1FOEA 4GN1A 2ELBA 2P0FA 2NZ8B 5KQ4A 2H7EA 2XQNM 2DYNA 2RGNB 2IYBA 2COAA 4L1RA 2YT2A 1PFJA 3T06A 3SYXA 1KZGA 2GCJA 1SHCA 4HB2B 2K49A 4PNKA 3P7ZA 1U2BA 1WG7A 2V76A 1XODA 2LOZA 3SUZA 1Z87A 2GUMA 3D8DA 1GC7A 2Y8FA 3MDBC 5GOWB 5I2SA 5J3YA 1FHWA 2W2XC 3HIEA 2IFSA 3KY9A 2YT1A 2Z0PA 3TCAA 2Z0OA 4HB4B 2MKRA 2MFQA 2K2JA 2Z4DA 3GYPA 3D8EA 2UZRA 2GCLA 3HW2B 1GC6A 3HQCA 4F7GA 1UNRA 5DIFB 1BAKA 2LULA 5HE0A 2UVMA 4NY0A 5HE3A 2R0DA 2DKQA 1MK7B 1V5MA 1NTVA 2YS1A 1TJ6A 2AEHA 2D9YA 4K81A 1X1FA 2AL6A 2DN6A 1N3HA 4QJ3B 3A8PA 5C5BB 2I1KA 2Y7BA 1Y5OA 2YF0A 4Y94A 1BWNA 1TXDA 1BTKA 4K17A 1LW3A 3BINA 3PVLA 3WA0A 2P8VA 3AJ4A 4GNKB 1WVHA 3KRXA 5D3XA 1NI2A 2Z0QA 4CSQA 2DYQA 3KSYA 4HAYB 3U12A 2LOXA 2K00A 3U7DA 3PVUA 3CXBB 2CODA 2W2WA 2DA0A 4WSFA 3SV1A 3BJIA 3U8ZA 5CLQB 2EMSA 1V61A 1X1GA 4F7HA 1M7RA 2KIGA 1UPQA 2J0JA 1MI1A 3DXEA 4A6HA 4MY6A 1MKEA 2J0KA 3NW8A 3SNHA 5KQ1A 5DI9B 1W1DA 3ZDTA 4P7IA 5CLLB 3D8FA 5J3QA 4KHOA 2ZPYA 2MDXA 1T77A 5LG4B 1OQNA 2FJUB 4HAXB 4CHJA 2RVBB 4XWXA 1XX0A 2NBVA 4OT1A 2KGXB 1M7EA 5J3TA 2EJ8A 4D6WA 1RRPB 3PZDA 5IRSA 2CRFA 3FEHA 2G35A 3WYFB 4DBBA 1UNQA 1OY2A 2ROVA 4TKNA 1WI1A 3UZTA 5JHGA 2CAYA 1WGQA 1W1GA 4WVFB 2L2IA 2W2XD 3QWMA 2D9WA 1K5DB 4IFSA 2KR0A 5C79A 4CHMA 2UZSA 4OSNA 4C0AA 2ROZB 5JP4A 1B55A 4DX8A 1FGYA 1XKEA 1AQCA 3PSCA 2GJYA 2E2XA 4EKUA 2D10A 2M38A 3PEGA 5D27A 4A5KA 2JP2A 3ZVRA 4DXAB 1V5PA 1NTYA 5D3WA 4HAZB 3CIKA 2D4QA 1DBHA 3PP2A 3NWFA 4DX90 1LB1A 4TYZA 2EMTA 1E5WA 2QKLA 1W1HA 1KZ7A 4BBKA 5D3VA 1FGZA 3FSSA 3ODOA
chains in the Genus database with same CATH topology
1DROA 1OMWA 2I5FA 1EGXA 1U5GA 1DYNA 3X23A 1GG3A 4HAUB 4GZUA 1UPRA 2DHKA 1BTNA 4MK0A 2M14A 4CYEA 3P6AA 2Y8GA 2HTHB 1NU2A 2CY4A 2D9ZA 2MWNB 2DX5A 3PG7A 2Q13A 3NSUA 2DKPA 1FB8A 1EVHA 3OANA 1KI1B 1DDWA 1J19A 5D3YA 2I1JA 4KVGB 1PMSA 3SO6A 3V5WA 1ZC4B 1K5GB 1WGUA 3MPXA 1RJ2A 2DHIA 2LG1A 2BCJA 3FM8C 1DDMA 2PZ1A 5FI0A 2VSZA 4YL8A 2DLWA 4B6HA 4H8SA 1U5DA 3DXCA 1WJMA 2CY5A 3TVVA 2P0HA 2YSZA 4IAPA 4KAXB 2OTXA 3IVFA 3N7CA 4ZRKA 1X11A 3TO1A 2DHJA 2EC1A 3O96A 2DFKA 2KUPA 1EF1A 4GMXB 2COCA 2P0DA 4WJ7A 1ZM0A 1J0WA 3DXDA 3AU4A 1PLSA 1X86A 1DDVA 3QBVB 2GS0A 5L81A 5HE2A 2J59M 1P6SA 1U29A 3GYOA 1I2HA 4A6KA 3A98B 1H10A 2L1CA 1ZSQA 1TQZA 3AU5A 1UNPA 5C6RA 2ELAA 2RNRB 2D2QA 1QC6A 5LONB 2KCJA 3KZ1A 5LOPB 4HAVB 4K2PA 1SGHA 3KRWA 1XD4A 5EFXA 2QKMA 3A8QA 5HE1A 2RSGA 2HE7A 2YS5A 2LYDA 1WJ1A 4HDQA 3VOQA 2DTCA 3PVWA 2D11A 1I7AA 4D0NB 1ISNA 2I5CA 2COFA 1MIXA 4L6EA 4NSWA 2D9VA 1FHXA 2ADZA 2VRWB 2RLOA 4A6FB 4HHVA 5DHAB 1Q67A 1V88A 2YVCA 4K2OA 1EAZA 4Z2MB 2D9XA 4HAWB 4EJNA 4GXBA 4HB0B 1P3RA 1ZVRA 4GPTB 1UEFA 2R09A 2N0YA 1X05A 3TW1A 1V5UA 1ZC3B 4Z2NA 1AWEA 1XR0B 1U5EA 1Y19B 4F7UP 4MT7A 3ODWA 3F5RA 5C5BA 5DH9B 1QQGA 4ZRJA 4HB3B 1P5TA 2LKOA 5JHHA 4EMOA 5JLJB 2VKIA 3LJUX 2H7DA 1MPHA 3ML4A 5DHFB 5FI1A 1MK9B 1FHOA 1MAIA 3G9WA 1XCGA 4PQ0A 4GMVA 3F0WA 4HATB 3M1IB 3TFMA 3ULBA 2J0MA 4IOYX 3VIAA 4ZRIA 2K2UA 5C16A 2X18A 3ODXA 3QIJA 5KCVA 2YT0A 3HK0A 3ULCA 1IRSA 4HDOA 4YONA 1MIZB 1FAOA 1U27A 1U5FA 2NMBA 4KHAA 2FJLA 2YRYA 3RCPA 1V89A 2YS3A 4KHBB 4A6FA 2N23A 2DX1A 2OQBA 1H4RA 2RUKB 1FOEA 4GN1A 2ELBA 2P0FA 2NZ8B 5KQ4A 2H7EA 2XQNM 2DYNA 2RGNB 2IYBA 2COAA 1PFJA 3T06A 3SYXA 1KZGA 2GCJA 1SHCA 4HB2B 4PNKA 3P7ZA 1U2BA 1WG7A 2V76A 1XODA 2LOZA 3SUZA 1Z87A 3D8DA 1GC7A 2Y8FA 3MDBC 5GOWB 5J3YA 1FHWA 2W2XC 2IFSA 3KY9A 2YT1A 2Z0PA 3TCAA 2Z0OA 4HB4B 2MKRA 2MFQA 2K2JA 3GYPA 3D8EA 2UZRA 2GCLA 3HW2B 1GC6A 3HQCA 4F7GA 1UNRA 5DIFB 1BAKA 2LULA 5HE0A 2UVMA 4NY0A 5HE3A 2R0DA 2DKQA 1MK7B 1V5MA 1NTVA 2YS1A 1TJ6A 2AEHA 2D9YA 4K81A 1X1FA 2AL6A 2DN6A 1N3HA 3A8PA 5C5BB 2I1KA 2Y7BA 1Y5OA 2YF0A 4Y94A 1BWNA 1TXDA 1BTKA 4K17A 1LW3A 3BINA 3PVLA 3WA0A 2P8VA 3AJ4A 5D3XA 1WVHA 3KRXA 1NI2A 2Z0QA 4HAYB 2DYQA 3KSYA 2LOXA 2K00A 3U7DA 3PVUA 3CXBB 2CODA 2W2WA 2DA0A 4WSFA 3SV1A 3BJIA 3U8ZA 5CLQB 2EMSA 1V61A 1X1GA 4F7HA 1M7RA 1UPQA 2J0JA 3DXEA 4A6HA 4MY6A 1MKEA 2J0KA 3SNHA 5KQ1A 5DI9B 1W1DA 3ZDTA 4P7IA 5CLLB 3D8FA 5J3QA 4KHOA 2ZPYA 2MDXA 1OQNA 4HAXB 4CHJA 2RVBB 4XWXA 1XX0A 2KGXB 1M7EA 5J3TA 2EJ8A 1RRPB 3PZDA 2CRFA 3FEHA 2G35A 3WYFB 4DBBA 1UNQA 1OY2A 2ROVA 4TKNA 1WI1A 3UZTA 5JHGA 2CAYA 1WGQA 1W1GA 4WVFB 2L2IA 2W2XD 3QWMA 2D9WA 1K5DB 4IFSA 5C79A 4CHMA 2UZSA 4C0AA 2ROZB 5JP4A 1B55A 4DX8A 1FGYA 1XKEA 1AQCA 3PSCA 2GJYA 2E2XA 4EKUA 2D10A 2M38A 3PEGA 5D27A 4A5KA 2JP2A 3ZVRA 4DXAB 1V5PA 1NTYA 5D3WA 4HAZB 3CIKA 2D4QA 1DBHA 3PP2A 4DX90 1LB1A 4TYZA 2EMTA 1E5WA 2QKLA 1W1HA 1KZ7A 4BBKA 5D3VA 1FGZA 3FSSA 3ODOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DRO A;  1OMW A;  2I5F A;  1EGX A;  1U5G A;  1DYN A;  3X23 A;  1GG3 A;  4HAU B;  4GZU A;  1UPR A;  2DHK A;  1BTN A;  4MK0 A;  2M14 A;  4CYE A;  3P6A A;  2Y8G A;  2HTH B;  1NU2 A;  2CY4 A;  2D9Z A;  2MWN B;  2DX5 A;  3PG7 A;  2Q13 A;  3NSU A;  2DKP A;  1FB8 A;  1EVH A;  3OAN A;  1KI1 B;  1DDW A;  1J19 A;  5D3Y A;  2I1J A;  4KVG B;  1PMS A;  3SO6 A;  3V5W A;  1ZC4 B;  1K5G B;  1WGU A;  3MPX A;  1RJ2 A;  2DHI A;  2LG1 A;  2BCJ A;  3FM8 C;  1DDM A;  2PZ1 A;  5FI0 A;  2VSZ A;  4YL8 A;  2DLW A;  4B6H A;  4H8S A;  1U5D A;  3DXC A;  1WJM A;  2CY5 A;  3TVV A;  2P0H A;  2YSZ A;  4IAP A;  4KAX B;  2OTX A;  3IVF A;  3N7C A;  4ZRK A;  1X11 A;  3TO1 A;  2DHJ A;  2EC1 A;  3O96 A;  2DFK A;  2KUP A;  1EF1 A;  4GMX B;  2COC A;  2P0D A;  4WJ7 A;  1ZM0 A;  1J0W A;  3DXD A;  3AU4 A;  1PLS A;  1X86 A;  1DDV A;  3QBV B;  2GS0 A;  5L81 A;  5HE2 A;  2J59 M;  1P6S A;  1U29 A;  3GYO A;  1I2H A;  4A6K A;  3A98 B;  1H10 A;  2L1C A;  1ZSQ A;  1TQZ A;  3AU5 A;  1UNP A;  5C6R A;  2ELA A;  2RNR B;  2D2Q A;  1QC6 A;  5LON B;  2KCJ A;  3KZ1 A;  5LOP B;  4HAV B;  4K2P A;  1SGH A;  3KRW A;  1XD4 A;  5EFX A;  2QKM A;  3A8Q A;  5HE1 A;  2RSG A;  2HE7 A;  2YS5 A;  2LYD A;  1WJ1 A;  4HDQ A;  3VOQ A;  2DTC A;  3PVW A;  2D11 A;  1I7A A;  4D0N B;  1ISN A;  2I5C A;  2COF A;  1MIX A;  4L6E A;  4NSW A;  2D9V A;  1FHX A;  2ADZ A;  2VRW B;  2RLO A;  4A6F B;  4HHV A;  5DHA B;  1Q67 A;  1V88 A;  2YVC A;  4K2O A;  1EAZ A;  4Z2M B;  2D9X A;  4HAW B;  4EJN A;  4GXB A;  4HB0 B;  1P3R A;  1ZVR A;  4GPT B;  1UEF A;  2R09 A;  2N0Y A;  1X05 A;  3TW1 A;  1V5U A;  1ZC3 B;  4Z2N A;  1AWE A;  1XR0 B;  1U5E A;  1Y19 B;  4F7U P;  4MT7 A;  3ODW A;  3F5R A;  5C5B A;  5DH9 B;  1QQG A;  4ZRJ A;  4HB3 B;  1P5T A;  2LKO A;  5JHH A;  4EMO A;  5JLJ B;  2VKI A;  3LJU X;  2H7D A;  1MPH A;  3ML4 A;  5DHF B;  5FI1 A;  1MK9 B;  1FHO A;  1MAI A;  3G9W A;  1XCG A;  4PQ0 A;  4GMV A;  3F0W A;  4HAT B;  3M1I B;  3TFM A;  3ULB A;  2J0M A;  4IOY X;  3VIA A;  4ZRI A;  2K2U A;  5C16 A;  2X18 A;  3ODX A;  3QIJ A;  5KCV A;  2YT0 A;  3HK0 A;  3ULC A;  1IRS A;  4HDO A;  4YON A;  1MIZ B;  1FAO A;  1U27 A;  1U5F A;  2NMB A;  4KHA A;  2FJL A;  2YRY A;  3RCP A;  1V89 A;  2YS3 A;  4KHB B;  4A6F A;  2N23 A;  2DX1 A;  2OQB A;  1H4R A;  2RUK B;  1FOE A;  4GN1 A;  2ELB A;  2P0F A;  2NZ8 B;  5KQ4 A;  2H7E A;  2XQN M;  2DYN A;  2RGN B;  2IYB A;  2COA A;  1PFJ A;  3T06 A;  3SYX A;  1KZG A;  2GCJ A;  1SHC A;  4HB2 B;  4PNK A;  3P7Z A;  1U2B A;  1WG7 A;  2V76 A;  1XOD A;  2LOZ A;  3SUZ A;  1Z87 A;  3D8D A;  1GC7 A;  2Y8F A;  3MDB C;  5GOW B;  5J3Y A;  1FHW A;  2W2X C;  2IFS A;  3KY9 A;  2YT1 A;  2Z0P A;  3TCA A;  2Z0O A;  4HB4 B;  2MKR A;  2MFQ A;  2K2J A;  3GYP A;  3D8E A;  2UZR A;  2GCL A;  3HW2 B;  1GC6 A;  3HQC A;  4F7G A;  1UNR A;  5DIF B;  1BAK A;  2LUL A;  5HE0 A;  2UVM A;  4NY0 A;  5HE3 A;  2R0D A;  2DKQ A;  1MK7 B;  1V5M A;  1NTV A;  2YS1 A;  1TJ6 A;  2AEH A;  2D9Y A;  4K81 A;  1X1F A;  2AL6 A;  2DN6 A;  1N3H A;  3A8P A;  5C5B B;  2I1K A;  2Y7B A;  1Y5O A;  2YF0 A;  4Y94 A;  1BWN A;  1TXD A;  1BTK A;  4K17 A;  1LW3 A;  3BIN A;  3PVL A;  3WA0 A;  2P8V A;  3AJ4 A;  5D3X A;  1WVH A;  3KRX A;  1NI2 A;  2Z0Q A;  4HAY B;  2DYQ A;  3KSY A;  2LOX A;  2K00 A;  3U7D A;  3PVU A;  3CXB B;  2COD A;  2W2W A;  2DA0 A;  4WSF A;  3SV1 A;  3BJI A;  3U8Z A;  5CLQ B;  2EMS A;  1V61 A;  1X1G A;  4F7H A;  1M7R A;  1UPQ A;  2J0J A;  3DXE A;  4A6H A;  4MY6 A;  1MKE A;  2J0K A;  3SNH A;  5KQ1 A;  5DI9 B;  1W1D A;  3ZDT A;  4P7I A;  5CLL B;  3D8F A;  5J3Q A;  4KHO A;  2ZPY A;  2MDX A;  1OQN A;  4HAX B;  4CHJ A;  2RVB B;  4XWX A;  1XX0 A;  2KGX B;  1M7E A;  5J3T A;  2EJ8 A;  1RRP B;  3PZD A;  2CRF A;  3FEH A;  2G35 A;  3WYF B;  4DBB A;  1UNQ A;  1OY2 A;  2ROV A;  4TKN A;  1WI1 A;  3UZT A;  5JHG A;  2CAY A;  1WGQ A;  1W1G A;  4WVF B;  2L2I A;  2W2X D;  3QWM A;  2D9W A;  1K5D B;  4IFS A;  5C79 A;  4CHM A;  2UZS A;  4C0A A;  2ROZ B;  5JP4 A;  1B55 A;  4DX8 A;  1FGY A;  1XKE A;  1AQC A;  3PSC A;  2GJY A;  2E2X A;  4EKU A;  2D10 A;  2M38 A;  3PEG A;  5D27 A;  4A5K A;  2JP2 A;  3ZVR A;  4DXA B;  1V5P A;  1NTY A;  5D3W A;  4HAZ B;  3CIK A;  2D4Q A;  1DBH A;  3PP2 A;  4DX9 0;  1LB1 A;  4TYZ A;  2EMT A;  1E5W A;  2QKL A;  1W1H A;  1KZ7 A;  4BBK A;  5D3V A;  1FGZ A;  3FSS A;  3ODO A; 
#chains in the Genus database with same CATH topology
 1DRO A;  1OMW A;  2I5F A;  1EGX A;  1U5G A;  1DYN A;  3X23 A;  1GG3 A;  4HAU B;  4GZU A;  1UPR A;  2DHK A;  1BTN A;  4MK0 A;  2M14 A;  4CYE A;  3P6A A;  3OHM B;  2Y8G A;  2HTH B;  1NU2 A;  2CY4 A;  2D9Z A;  2MWN B;  2DX5 A;  3PG7 A;  2Q13 A;  3NSU A;  2DKP A;  1FB8 A;  1EVH A;  3OAN A;  4HSI A;  1KI1 B;  1DDW A;  1J19 A;  5D3Y A;  2I1J A;  4KVG B;  4QJ4 B;  1PMS A;  3SO6 A;  3V5W A;  1ZC4 B;  1K5G B;  4QJ5 B;  1WGU A;  3MPX A;  1RJ2 A;  2DHI A;  2LG1 A;  2BCJ A;  3FM8 C;  1DDM A;  2PZ1 A;  5FI0 A;  2VSZ A;  4YL8 A;  2DLW A;  4B6H A;  4QXA B;  4H8S A;  1U5D A;  3DXC A;  1WJM A;  2CY5 A;  3TVV A;  2P0H A;  2YSZ A;  4IAP A;  4KAX B;  3HSA A;  2OTX A;  3IVF A;  3N7C A;  4ZRK A;  1X11 A;  3TO1 A;  2DHJ A;  2EC1 A;  3O96 A;  2DFK A;  2KUP A;  1EF1 A;  4GMX B;  2COC A;  2P0D A;  4WJ7 A;  1ZM0 A;  1J0W A;  3DXD A;  3AU4 A;  1PLS A;  1X86 A;  1DDV A;  3QBV B;  2GS0 A;  5L81 A;  5HE2 A;  2J59 M;  1P6S A;  1U29 A;  3GYO A;  1I2H A;  4A6K A;  3A98 B;  1H10 A;  2L1C A;  1ZSQ A;  1TQZ A;  3AU5 A;  1UNP A;  5C6R A;  5M4Y B;  2Z59 A;  2ELA A;  2RNR B;  3NWA A;  2D2Q A;  1QC6 A;  5LON B;  2KCJ A;  3KZ1 A;  5LOP B;  4HAV B;  4K2P A;  1SGH A;  3KRW A;  1XD4 A;  5EFX A;  2QKM A;  3A8Q A;  5HE1 A;  2RSG A;  2Z14 A;  2HE7 A;  2YS5 A;  2LYD A;  1WJ1 A;  4HDQ A;  3VOQ A;  2DTC A;  3PVW A;  2D11 A;  1I7A A;  4D0N B;  1ISN A;  2I5C A;  2COF A;  2Z13 A;  1MIX A;  4L6E A;  4NSW A;  2D9V A;  5I2M A;  1FHX A;  2ADZ A;  2VRW B;  2RLO A;  4A6F B;  4HHV A;  5DHA B;  1Q67 A;  1V88 A;  2YVC A;  4K2O A;  1EAZ A;  2ZKM X;  4Z2M B;  2D9X A;  4HAW B;  4EJN A;  4GXB A;  4HB0 B;  1P3R A;  1ZVR A;  4GPT B;  1UEF A;  2R09 A;  4KHB A;  2N0Y A;  1X05 A;  3TW1 A;  2R2Y A;  1V5U A;  1ZC3 B;  4Z2N A;  1AWE A;  1XR0 B;  1U5E A;  1Y19 B;  2K8E A;  4F7U P;  3DCX A;  4MT7 A;  3ODW A;  3F5R A;  5C5B A;  5DH9 B;  3A58 A;  1QQG A;  4ZRJ A;  4HB3 B;  1P5T A;  2LKO A;  5JHH A;  4EMO A;  5JLJ B;  2VKI A;  3LJU X;  2H7D A;  2RRF A;  1MPH A;  3ML4 A;  5DHF B;  5FI1 A;  1MK9 B;  1FHO A;  4GOU A;  1MAI A;  3G9W A;  1XCG A;  4PQ0 A;  4GMV A;  3F0W A;  4HAT B;  3M1I B;  3TFM A;  3ULB A;  3B77 A;  2KIE A;  2J0M A;  4IOY X;  3VIA A;  4ZRI A;  2K2U A;  5C16 A;  1ZYI A;  2X18 A;  3ODX A;  2KUQ A;  3QIJ A;  5KCV A;  2YT0 A;  3HK0 A;  3ULC A;  4DIX A;  1IRS A;  4HDO A;  4YON A;  1MIZ B;  1FAO A;  1U27 A;  1U5F A;  2NMB A;  4KHA A;  2FJL A;  3NWD A;  2YRY A;  3RCP A;  1V89 A;  2YS3 A;  4KHB B;  4A6F A;  2N23 A;  3FVC A;  2DX1 A;  2OQB A;  1H4R A;  2RUK B;  1FOE A;  4GN1 A;  2ELB A;  2P0F A;  2NZ8 B;  5KQ4 A;  2H7E A;  2XQN M;  2DYN A;  2RGN B;  2IYB A;  2COA A;  4L1R A;  2YT2 A;  1PFJ A;  3T06 A;  3SYX A;  1KZG A;  2GCJ A;  1SHC A;  4HB2 B;  2K49 A;  4PNK A;  3P7Z A;  1U2B A;  1WG7 A;  2V76 A;  1XOD A;  2LOZ A;  3SUZ A;  1Z87 A;  2GUM A;  3D8D A;  1GC7 A;  2Y8F A;  3MDB C;  5GOW B;  5I2S A;  5J3Y A;  1FHW A;  2W2X C;  3HIE A;  2IFS A;  3KY9 A;  2YT1 A;  2Z0P A;  3TCA A;  2Z0O A;  4HB4 B;  2MKR A;  2MFQ A;  2K2J A;  2Z4D A;  3GYP A;  3D8E A;  2UZR A;  2GCL A;  3HW2 B;  1GC6 A;  3HQC A;  4F7G A;  1UNR A;  5DIF B;  1BAK A;  2LUL A;  5HE0 A;  2UVM A;  4NY0 A;  5HE3 A;  2R0D A;  2DKQ A;  1MK7 B;  1V5M A;  1NTV A;  2YS1 A;  1TJ6 A;  2AEH A;  2D9Y A;  4K81 A;  1X1F A;  2AL6 A;  2DN6 A;  1N3H A;  4QJ3 B;  3A8P A;  5C5B B;  2I1K A;  2Y7B A;  1Y5O A;  2YF0 A;  4Y94 A;  1BWN A;  1TXD A;  1BTK A;  4K17 A;  1LW3 A;  3BIN A;  3PVL A;  3WA0 A;  2P8V A;  3AJ4 A;  4GNK B;  1WVH A;  3KRX A;  5D3X A;  1NI2 A;  2Z0Q A;  4CSQ A;  2DYQ A;  3KSY A;  4HAY B;  3U12 A;  2LOX A;  2K00 A;  3U7D A;  3PVU A;  3CXB B;  2COD A;  2W2W A;  2DA0 A;  4WSF A;  3SV1 A;  3BJI A;  3U8Z A;  5CLQ B;  2EMS A;  1V61 A;  1X1G A;  4F7H A;  1M7R A;  2KIG A;  1UPQ A;  2J0J A;  1MI1 A;  3DXE A;  4A6H A;  4MY6 A;  1MKE A;  2J0K A;  3NW8 A;  3SNH A;  5KQ1 A;  5DI9 B;  1W1D A;  3ZDT A;  4P7I A;  5CLL B;  3D8F A;  5J3Q A;  4KHO A;  2ZPY A;  2MDX A;  1T77 A;  5LG4 B;  1OQN A;  2FJU B;  4HAX B;  4CHJ A;  2RVB B;  4XWX A;  1XX0 A;  2NBV A;  4OT1 A;  2KGX B;  1M7E A;  5J3T A;  2EJ8 A;  4D6W A;  1RRP B;  3PZD A;  5IRS A;  2CRF A;  3FEH A;  2G35 A;  3WYF B;  4DBB A;  1UNQ A;  1OY2 A;  2ROV A;  4TKN A;  1WI1 A;  3UZT A;  5JHG A;  2CAY A;  1WGQ A;  1W1G A;  4WVF B;  2L2I A;  2W2X D;  3QWM A;  2D9W A;  1K5D B;  4IFS A;  2KR0 A;  5C79 A;  4CHM A;  2UZS A;  4OSN A;  4C0A A;  2ROZ B;  5JP4 A;  1B55 A;  4DX8 A;  1FGY A;  1XKE A;  1AQC A;  3PSC A;  2GJY A;  2E2X A;  4EKU A;  2D10 A;  2M38 A;  3PEG A;  5D27 A;  4A5K A;  2JP2 A;  3ZVR A;  4DXA B;  1V5P A;  1NTY A;  5D3W A;  4HAZ B;  3CIK A;  2D4Q A;  1DBH A;  3PP2 A;  3NWF A;  4DX9 0;  1LB1 A;  4TYZ A;  2EMT A;  1E5W A;  2QKL A;  1W1H A;  1KZ7 A;  4BBK A;  5D3V A;  1FGZ A;  3FSS A;  3ODO A; 
#chains in the Genus database with same CATH homology
 1DRO A;  1OMW A;  2I5F A;  1EGX A;  1U5G A;  1DYN A;  3X23 A;  1GG3 A;  4HAU B;  4GZU A;  1UPR A;  2DHK A;  1BTN A;  4MK0 A;  2M14 A;  4CYE A;  3P6A A;  2Y8G A;  2HTH B;  1NU2 A;  2CY4 A;  2D9Z A;  2MWN B;  2DX5 A;  3PG7 A;  2Q13 A;  3NSU A;  2DKP A;  1FB8 A;  1EVH A;  3OAN A;  1KI1 B;  1DDW A;  1J19 A;  5D3Y A;  2I1J A;  4KVG B;  1PMS A;  3SO6 A;  3V5W A;  1ZC4 B;  1K5G B;  1WGU A;  3MPX A;  1RJ2 A;  2DHI A;  2LG1 A;  2BCJ A;  3FM8 C;  1DDM A;  2PZ1 A;  5FI0 A;  2VSZ A;  4YL8 A;  2DLW A;  4B6H A;  4H8S A;  1U5D A;  3DXC A;  1WJM A;  2CY5 A;  3TVV A;  2P0H A;  2YSZ A;  4IAP A;  4KAX B;  2OTX A;  3IVF A;  3N7C A;  4ZRK A;  1X11 A;  3TO1 A;  2DHJ A;  2EC1 A;  3O96 A;  2DFK A;  2KUP A;  1EF1 A;  4GMX B;  2COC A;  2P0D A;  4WJ7 A;  1ZM0 A;  1J0W A;  3DXD A;  3AU4 A;  1PLS A;  1X86 A;  1DDV A;  3QBV B;  2GS0 A;  5L81 A;  5HE2 A;  2J59 M;  1P6S A;  1U29 A;  3GYO A;  1I2H A;  4A6K A;  3A98 B;  1H10 A;  2L1C A;  1ZSQ A;  1TQZ A;  3AU5 A;  1UNP A;  5C6R A;  2ELA A;  2RNR B;  2D2Q A;  1QC6 A;  5LON B;  2KCJ A;  3KZ1 A;  5LOP B;  4HAV B;  4K2P A;  1SGH A;  3KRW A;  1XD4 A;  5EFX A;  2QKM A;  3A8Q A;  5HE1 A;  2RSG A;  2HE7 A;  2YS5 A;  2LYD A;  1WJ1 A;  4HDQ A;  3VOQ A;  2DTC A;  3PVW A;  2D11 A;  1I7A A;  4D0N B;  1ISN A;  2I5C A;  2COF A;  1MIX A;  4L6E A;  4NSW A;  2D9V A;  1FHX A;  2ADZ A;  2VRW B;  2RLO A;  4A6F B;  4HHV A;  5DHA B;  1Q67 A;  1V88 A;  2YVC A;  4K2O A;  1EAZ A;  4Z2M B;  2D9X A;  4HAW B;  4EJN A;  4GXB A;  4HB0 B;  1P3R A;  1ZVR A;  4GPT B;  1UEF A;  2R09 A;  2N0Y A;  1X05 A;  3TW1 A;  1V5U A;  1ZC3 B;  4Z2N A;  1AWE A;  1XR0 B;  1U5E A;  1Y19 B;  4F7U P;  4MT7 A;  3ODW A;  3F5R A;  5C5B A;  5DH9 B;  1QQG A;  4ZRJ A;  4HB3 B;  1P5T A;  2LKO A;  5JHH A;  4EMO A;  5JLJ B;  2VKI A;  3LJU X;  2H7D A;  1MPH A;  3ML4 A;  5DHF B;  5FI1 A;  1MK9 B;  1FHO A;  1MAI A;  3G9W A;  1XCG A;  4PQ0 A;  4GMV A;  3F0W A;  4HAT B;  3M1I B;  3TFM A;  3ULB A;  2J0M A;  4IOY X;  3VIA A;  4ZRI A;  2K2U A;  5C16 A;  2X18 A;  3ODX A;  3QIJ A;  5KCV A;  2YT0 A;  3HK0 A;  3ULC A;  1IRS A;  4HDO A;  4YON A;  1MIZ B;  1FAO A;  1U27 A;  1U5F A;  2NMB A;  4KHA A;  2FJL A;  2YRY A;  3RCP A;  1V89 A;  2YS3 A;  4KHB B;  4A6F A;  2N23 A;  2DX1 A;  2OQB A;  1H4R A;  2RUK B;  1FOE A;  4GN1 A;  2ELB A;  2P0F A;  2NZ8 B;  5KQ4 A;  2H7E A;  2XQN M;  2DYN A;  2RGN B;  2IYB A;  2COA A;  1PFJ A;  3T06 A;  3SYX A;  1KZG A;  2GCJ A;  1SHC A;  4HB2 B;  4PNK A;  3P7Z A;  1U2B A;  1WG7 A;  2V76 A;  1XOD A;  2LOZ A;  3SUZ A;  1Z87 A;  3D8D A;  1GC7 A;  2Y8F A;  3MDB C;  5GOW B;  5J3Y A;  1FHW A;  2W2X C;  2IFS A;  3KY9 A;  2YT1 A;  2Z0P A;  3TCA A;  2Z0O A;  4HB4 B;  2MKR A;  2MFQ A;  2K2J A;  3GYP A;  3D8E A;  2UZR A;  2GCL A;  3HW2 B;  1GC6 A;  3HQC A;  4F7G A;  1UNR A;  5DIF B;  1BAK A;  2LUL A;  5HE0 A;  2UVM A;  4NY0 A;  5HE3 A;  2R0D A;  2DKQ A;  1MK7 B;  1V5M A;  1NTV A;  2YS1 A;  1TJ6 A;  2AEH A;  2D9Y A;  4K81 A;  1X1F A;  2AL6 A;  2DN6 A;  1N3H A;  3A8P A;  5C5B B;  2I1K A;  2Y7B A;  1Y5O A;  2YF0 A;  4Y94 A;  1BWN A;  1TXD A;  1BTK A;  4K17 A;  1LW3 A;  3BIN A;  3PVL A;  3WA0 A;  2P8V A;  3AJ4 A;  5D3X A;  1WVH A;  3KRX A;  1NI2 A;  2Z0Q A;  4HAY B;  2DYQ A;  3KSY A;  2LOX A;  2K00 A;  3U7D A;  3PVU A;  3CXB B;  2COD A;  2W2W A;  2DA0 A;  4WSF A;  3SV1 A;  3BJI A;  3U8Z A;  5CLQ B;  2EMS A;  1V61 A;  1X1G A;  4F7H A;  1M7R A;  1UPQ A;  2J0J A;  3DXE A;  4A6H A;  4MY6 A;  1MKE A;  2J0K A;  3SNH A;  5KQ1 A;  5DI9 B;  1W1D A;  3ZDT A;  4P7I A;  5CLL B;  3D8F A;  5J3Q A;  4KHO A;  2ZPY A;  2MDX A;  1OQN A;  4HAX B;  4CHJ A;  2RVB B;  4XWX A;  1XX0 A;  2KGX B;  1M7E A;  5J3T A;  2EJ8 A;  1RRP B;  3PZD A;  2CRF A;  3FEH A;  2G35 A;  3WYF B;  4DBB A;  1UNQ A;  1OY2 A;  2ROV A;  4TKN A;  1WI1 A;  3UZT A;  5JHG A;  2CAY A;  1WGQ A;  1W1G A;  4WVF B;  2L2I A;  2W2X D;  3QWM A;  2D9W A;  1K5D B;  4IFS A;  5C79 A;  4CHM A;  2UZS A;  4C0A A;  2ROZ B;  5JP4 A;  1B55 A;  4DX8 A;  1FGY A;  1XKE A;  1AQC A;  3PSC A;  2GJY A;  2E2X A;  4EKU A;  2D10 A;  2M38 A;  3PEG A;  5D27 A;  4A5K A;  2JP2 A;  3ZVR A;  4DXA B;  1V5P A;  1NTY A;  5D3W A;  4HAZ B;  3CIK A;  2D4Q A;  1DBH A;  3PP2 A;  4DX9 0;  1LB1 A;  4TYZ A;  2EMT A;  1E5W A;  2QKL A;  1W1H A;  1KZ7 A;  4BBK A;  5D3V A;  1FGZ A;  3FSS A;  3ODO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...