1EGXA

Solution structure of the ena-vasp homology 1 (evh1) domain of human vasodilator-stimulated phosphoprotein (vasp)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
115
structure length
115
Chain Sequence
MSETVICSSRATVMLYDDGNKRWLPAGTGPQAFSRVQIYHNPTANSFRVVGRKMQPDQQVVINCAIVRGVKYNQATPNFHQWRDARQVWGLNFGSKEDAAQFAAGMASALEALEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords VASODILATOR-STIMULATED PHOSPHOPROTEIN
publication title Dual epitope recognition by the VASP EVH1 domain modulates polyproline ligand specificity and binding affinity.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2000-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1egxA00
1DBHA 4DBBA 2W2XD 3TW1A 1WGUA 3VOQA 3DXDA 3TO1A 5KQ4A 2J59M 5KQ1A 4MK0A 1NTVA 5GOWB 1V61A 5J3YA 2CY5A 4YL8A 1EGXA 1BAKA 1AQCA 2YT0A 2YS5A 2YF0A 1ZSQA 4GN1A 3SUZA 1GC6A 3D8FA 2AEHA 3ML4A 1WVHA 4KHAA 3ULBA 5EFXA 4L6EA 4Z2NA 3VIAA 1I2HA 1KI1B 2KUPA 1UNQA 2EMSA 2D9XA 1DDWA 3KRWA 3PEGA 4MY6A 5FI0A 2D11A 4WSFA 3O96A 3ODXA 3A98B 3F0WA 3P6AA 4GPTB 5FI1A 2LULA 2LOXA 1TQZA 2J0JA 2K2JA 1WG7A 3OANA 1PMSA 1QC6A 2OQBA 2RLOA 2BCJA 1V5PA 3MPXA 4PNKA 3PVWA 2W2XC 2D4QA 5JHGA 1U5FA 2N23A 4C0AA 2M14A 4WJ7A 2CRFA 2DX1A 5L81A 3PVUA 4P7IA 3TFMA 2RUKB 1DYNA 1X1FA 1V89A 4CHMA 2I1JA 1XD4A 3LJUX 3X23A 1OMWA 1FGZA 1FHXA 5LONB 4Y94A 1P6SA 1Z87A 4CHJA 4DX90 2QKMA 4GMXB 5D3YA 2DYQA 2IYBA 2DHKA 3ZDTA 4Z2MB 2EMTA 3T06A 3PZDA 2DA0A 1PFJA 2DTCA 4GMVA 3ZVRA 2Z0PA 1U2BA 2D9ZA 1MK9B 4TKNA 3D8EA 3DXCA 2AL6A 2LKOA 5JP4A 4KAXB 2Y7BA 1MAIA 2DN6A 4K2PA 2GS0A 1GC7A 2DLWA 3FM8C 4HAYB 3AU5A 1FHWA 1X11A 3FSSA 1LW3A 2OTXA 1QQGA 3WA0A 1ZM0A 5HE2A 2VRWB 5CLLB 2ROVA 4KVGB 4B6HA 1I7AA 2YSZA 3CIKA 3PG7A 2I5FA 1V88A 1W1DA 1XCGA 1M7RA 2RNRB 2X18A 3ODWA 4H8SA 1UPRA 2YT1A 3QWMA 3D8DA 4BBKA 2P8VA 1IRSA 4NY0A 2D2QA 4KHOA 4PQ0A 1U5EA 3KRXA 1FGYA 5D3XA 4ZRJA 2HTHB 1KZ7A 2DHIA 2J0KA 1MIZB 3UZTA 4DXAB 2MDXA 2CODA 1Y5OA 3BJIA 4ZRIA 5J3TA 1SHCA 4IAPA 1X05A 4HB3B 1MK7B 1EVHA 1XX0A 4ZRKA 2COCA 3SO6A 2M38A 4DX8A 2RVBB 2Y8FA 3AJ4A 4IOYX 4WVFB 2Y8GA 2MFQA 1XKEA 1OY2A 1XR0B 3GYOA 1P5TA 2NMBA 3A8QA 5D3VA 3GYPA 2LOZA 2MWNB 3TCAA 2LG1A 1ISNA 1H10A 1K5DB 2K00A 1J19A 1WJMA 1Y19B 2D9VA 1U27A 3N7CA 1H4RA 1B55A 3HW2B 5KCVA 5D27A 4IFSA 5JHHA 3PVLA 2H7DA 2P0FA 4A6KA 4EJNA 2UZRA 4TYZA 5DH9B 4HHVA 1V5MA 2D9YA 1TJ6A 4GZUA 3P7ZA 1P3RA 2ROZB 3U8ZA 1DDVA 1WJ1A 4HB0B 2COAA 1MPHA 4KHBB 2DFKA 2ELAA 1NI2A 4NSWA 1UNPA 3SNHA 5HE3A 1W1GA 2W2WA 2DKQA 1Q67A 1BTKA 2EJ8A 2LYDA 4HB4B 2COFA 3BINA 1KZGA 1FOEA 1ZC3B 2PZ1A 1NTYA 4GXBA 4F7GA 3SYXA 2E2XA 1DDMA 3KSYA 1ZC4B 1E5WA 1AWEA 1K5GB 2R0DA 5D3WA 1WGQA 3HK0A 5LOPB 2D9WA 2R09A 3KY9A 2JP2A 1U29A 5DHAB 4HAVB 5HE0A 1J0WA 2D10A 4A6HA 1BTNA 4HDQA 3RCPA 1BWNA 1M7EA 2VKIA 2P0HA 2I1KA 2YVCA 4MT7A 2IFSA 3AU4A 4HAUB 2CAYA 1RRPB 2I5CA 4EMOA 1FB8A 2CY4A 4YONA 1U5DA 2XQNM 2KCJA 4F7HA 1FHOA 4K17A 2H7EA 1FAOA 2V76A 2ZPYA 1OQNA 5CLQB 3HQCA 2RGNB 4K2OA 2ADZA 2YS3A 3SV1A 1EAZA 2YRYA 3TVVA 2P0DA 3KZ1A 3M1IB 4D0NB 4HDOA 4HAWB 1N3HA 1UNRA 3ODOA 2DYNA 1V5UA 1X86A 2L2IA 3V5WA 2FJLA 3NSUA 4HAXB 4EKUA 3F5RA 4A5KA 3QIJA 2KGXB 4CYEA 2DKPA 4XWXA 1NU2A 5DHFB 2VSZA 1SGHA 2RSGA 3CXBB 5DIFB 2DHJA 5C16A 5JLJB 1DROA 1XODA 2ELBA 3WYFB 2L1CA 4HATB 4K81A 2GCJA 5C5BB 3PP2A 4HB2B 1X1GA 5C5BA 1MKEA 2EC1A 2NZ8B 2UZSA 3A8PA 2K2UA 1LB1A 4F7UP 2G35A 3IVFA 3ULCA 3G9WA 1U5GA 2HE7A 3DXEA 2Z0OA 1GG3A 2QKLA 3PSCA 1WI1A 1UEFA 5HE1A 2GCLA 2J0MA 3QBVB 5C6RA 1UPQA 3MDBC 2MKRA 3U7DA 2Z0QA 2N0YA 2UVMA 5DI9B 2GJYA 4HAZB 2YS1A 1RJ2A 4A6FB 1ZVRA 4A6FA 3FEHA 5J3QA 1EF1A 1MIXA 1PLSA 2Q13A 5C79A 1TXDA 1W1HA 2DX5A
chains in the Genus database with same CATH superfamily
1DBHA 4DBBA 2W2XD 3TW1A 1WGUA 3VOQA 4GOUA 3DXDA 3TO1A 5KQ4A 2J59M 5KQ1A 3A58A 1NTVA 4MK0A 5GOWB 1MI1A 1V61A 5J3YA 2CY5A 4YL8A 1EGXA 1BAKA 5I2MA 1AQCA 2YT0A 2YS5A 2YF0A 3NWAA 1ZSQA 4GN1A 3SUZA 1GC6A 4D6WA 3D8FA 2AEHA 3ML4A 1WVHA 4KHAA 3ULBA 5EFXA 4L6EA 4Z2NA 3VIAA 1I2HA 1KI1B 2KUPA 1UNQA 2EMSA 3NWFA 2D9XA 1DDWA 3KRWA 3PEGA 4MY6A 5FI0A 2GUMA 2D11A 4WSFA 3O96A 3ODXA 3A98B 3F0WA 3P6AA 3OHMB 4GPTB 5FI1A 2LULA 2LOXA 1TQZA 2J0JA 2K2JA 1WG7A 5IRSA 3OANA 1PMSA 1QC6A 2OQBA 2RLOA 2BCJA 1V5PA 3MPXA 4PNKA 3PVWA 2K8EA 2W2XC 2D4QA 5JHGA 1U5FA 2N23A 4C0AA 2M14A 4WJ7A 2CRFA 2DX1A 5L81A 3PVUA 4P7IA 3TFMA 2RUKB 1DYNA 1X1FA 1V89A 4CHMA 2I1JA 1XD4A 4HSIA 3LJUX 3X23A 4QJ3B 1OMWA 1FGZA 1FHXA 5LONB 2R2YA 4Y94A 1P6SA 1Z87A 4CHJA 4DX90 2QKMA 4OSNA 4GMXB 2KIEA 5D3YA 2DYQA 2IYBA 2DHKA 3ZDTA 4Z2MB 2EMTA 3T06A 3PZDA 2DA0A 1PFJA 2DTCA 4GMVA 3ZVRA 2Z0PA 1U2BA 2D9ZA 1MK9B 4TKNA 3D8EA 3DXCA 2AL6A 3NWDA 2LKOA 5JP4A 4KAXB 2Y7BA 4DIXA 1MAIA 2DN6A 4K2PA 2GS0A 1GC7A 2DLWA 3FM8C 4HAYB 3AU5A 1FHWA 1X11A 3FSSA 1LW3A 2OTXA 1QQGA 3WA0A 1ZM0A 5HE2A 2VRWB 5CLLB 2ROVA 4KVGB 4B6HA 1I7AA 2YSZA 3CIKA 3PG7A 2I5FA 1V88A 1W1DA 1XCGA 1M7RA 2RNRB 2X18A 3ODWA 4H8SA 1UPRA 2YT1A 3QWMA 3D8DA 4BBKA 2P8VA 1IRSA 4NY0A 2D2QA 4KHOA 4PQ0A 1U5EA 3KRXA 1FGYA 5D3XA 4ZRJA 2HTHB 1KZ7A 2DHIA 2J0KA 1MIZB 4QJ4B 3UZTA 4DXAB 2MDXA 2CODA 1Y5OA 3BJIA 5LG4B 4ZRIA 5J3TA 1SHCA 4IAPA 1X05A 1ZYIA 4HB3B 1MK7B 5M4YB 1EVHA 1XX0A 4ZRKA 2COCA 3SO6A 2M38A 4DX8A 2KIGA 2RVBB 2Y8FA 3AJ4A 4IOYX 4WVFB 2Y8GA 2MFQA 1XKEA 1OY2A 1XR0B 3GYOA 1P5TA 2NMBA 3A8QA 5D3VA 3GYPA 4L1RA 2LOZA 2MWNB 3TCAA 2LG1A 1ISNA 1H10A 1K5DB 2K00A 1J19A 1WJMA 1Y19B 2D9VA 1U27A 3N7CA 1H4RA 1B55A 3HW2B 5KCVA 5D27A 4IFSA 5JHHA 3PVLA 2Z4DA 3U12A 2H7DA 2P0FA 4A6KA 4EJNA 2UZRA 4TYZA 5DH9B 4HHVA 1V5MA 2D9YA 1TJ6A 4GZUA 3P7ZA 1P3RA 2ROZB 3B77A 3U8ZA 1DDVA 1WJ1A 4HB0B 2COAA 1MPHA 4KHBB 2DFKA 4KHBA 2ELAA 1NI2A 4NSWA 1UNPA 3SNHA 5HE3A 1W1GA 2W2WA 4OT1A 2DKQA 1Q67A 1BTKA 2EJ8A 2K49A 2LYDA 4HB4B 2COFA 3BINA 1KZGA 1FOEA 1ZC3B 2PZ1A 1NTYA 4GXBA 4F7GA 3SYXA 2E2XA 1DDMA 3KSYA 1ZC4B 1E5WA 1AWEA 1K5GB 2R0DA 5D3WA 1WGQA 3HK0A 5LOPB 2D9WA 2KUQA 2R09A 3KY9A 2JP2A 1U29A 5DHAB 4HAVB 5HE0A 1J0WA 2D10A 4A6HA 1BTNA 4HDQA 3RCPA 1BWNA 1M7EA 1T77A 2VKIA 2P0HA 2I1KA 2YVCA 4MT7A 2IFSA 3AU4A 4HAUB 2CAYA 1RRPB 2I5CA 4EMOA 3FVCA 1FB8A 2CY4A 4YONA 1U5DA 2XQNM 2KCJA 2YT2A 4F7HA 1FHOA 4K17A 2H7EA 1FAOA 2V76A 2ZPYA 1OQNA 5CLQB 3HQCA 2RGNB 4K2OA 3NW8A 2ADZA 2YS3A 3SV1A 1EAZA 2YRYA 3TVVA 2P0DA 2FJUB 3KZ1A 3M1IB 4D0NB 4HDOA 4HAWB 1N3HA 1UNRA 3ODOA 2DYNA 2Z13A 1V5UA 3HSAA 1X86A 2L2IA 3V5WA 2FJLA 3NSUA 4HAXB 4EKUA 3F5RA 4A5KA 3QIJA 2KGXB 2RRFA 4CYEA 2DKPA 4XWXA 1NU2A 5DHFB 2VSZA 4GNKB 1SGHA 2RSGA 3CXBB 5DIFB 2DHJA 5C16A 2NBVA 5JLJB 1DROA 1XODA 2ELBA 3WYFB 2L1CA 4HATB 4K81A 2GCJA 5C5BB 3PP2A 4HB2B 1X1GA 5C5BA 1MKEA 2EC1A 2NZ8B 2UZSA 3A8PA 2K2UA 1LB1A 4F7UP 2G35A 3IVFA 2KR0A 3ULCA 3G9WA 4CSQA 4QJ5B 1U5GA 2HE7A 3DXEA 2Z0OA 1GG3A 2QKLA 3PSCA 1WI1A 1UEFA 5HE1A 2Z14A 2GCLA 2J0MA 3QBVB 5C6RA 1UPQA 3MDBC 2MKRA 3U7DA 2Z0QA 5I2SA 2N0YA 2UVMA 5DI9B 3DCXA 2GJYA 4HAZB 2YS1A 1RJ2A 4A6FB 1ZVRA 4A6FA 3FEHA 4QXAB 5J3QA 1EF1A 1MIXA 1PLSA 2Q13A 5C79A 1TXDA 1W1HA 2Z59A 2DX5A 2ZKMX 3HIEA
chains in the Genus database with same CATH topology
1DBHA 4DBBA 2W2XD 3TW1A 1WGUA 3VOQA 3DXDA 3TO1A 5KQ4A 2J59M 5KQ1A 4MK0A 1NTVA 5GOWB 1V61A 5J3YA 2CY5A 4YL8A 1EGXA 1BAKA 1AQCA 2YT0A 2YS5A 2YF0A 1ZSQA 4GN1A 3SUZA 1GC6A 3D8FA 2AEHA 3ML4A 1WVHA 4KHAA 3ULBA 5EFXA 4L6EA 4Z2NA 3VIAA 1I2HA 1KI1B 2KUPA 1UNQA 2EMSA 2D9XA 1DDWA 3KRWA 3PEGA 4MY6A 5FI0A 2D11A 4WSFA 3O96A 3ODXA 3A98B 3F0WA 3P6AA 4GPTB 5FI1A 2LULA 2LOXA 1TQZA 2J0JA 2K2JA 1WG7A 3OANA 1PMSA 1QC6A 2OQBA 2RLOA 2BCJA 1V5PA 3MPXA 4PNKA 3PVWA 2W2XC 2D4QA 5JHGA 1U5FA 2N23A 4C0AA 2M14A 4WJ7A 2CRFA 2DX1A 5L81A 3PVUA 4P7IA 3TFMA 2RUKB 1DYNA 1X1FA 1V89A 4CHMA 2I1JA 1XD4A 3LJUX 3X23A 1OMWA 1FGZA 1FHXA 5LONB 4Y94A 1P6SA 1Z87A 4CHJA 4DX90 2QKMA 4GMXB 5D3YA 2DYQA 2IYBA 2DHKA 3ZDTA 4Z2MB 2EMTA 3T06A 3PZDA 2DA0A 1PFJA 2DTCA 4GMVA 3ZVRA 2Z0PA 1U2BA 2D9ZA 1MK9B 4TKNA 3D8EA 3DXCA 2AL6A 2LKOA 5JP4A 4KAXB 2Y7BA 1MAIA 2DN6A 4K2PA 2GS0A 1GC7A 2DLWA 3FM8C 4HAYB 3AU5A 1FHWA 1X11A 3FSSA 1LW3A 2OTXA 1QQGA 3WA0A 1ZM0A 5HE2A 2VRWB 5CLLB 2ROVA 4KVGB 4B6HA 1I7AA 2YSZA 3CIKA 3PG7A 2I5FA 1V88A 1W1DA 1XCGA 1M7RA 2RNRB 2X18A 3ODWA 4H8SA 1UPRA 2YT1A 3QWMA 3D8DA 4BBKA 2P8VA 1IRSA 4NY0A 2D2QA 4KHOA 4PQ0A 1U5EA 3KRXA 1FGYA 5D3XA 4ZRJA 2HTHB 1KZ7A 2DHIA 2J0KA 1MIZB 3UZTA 4DXAB 2MDXA 2CODA 1Y5OA 3BJIA 4ZRIA 5J3TA 1SHCA 4IAPA 1X05A 4HB3B 1MK7B 1EVHA 1XX0A 4ZRKA 2COCA 3SO6A 2M38A 4DX8A 2RVBB 2Y8FA 3AJ4A 4IOYX 4WVFB 2Y8GA 2MFQA 1XKEA 1OY2A 1XR0B 3GYOA 1P5TA 2NMBA 3A8QA 5D3VA 3GYPA 2LOZA 2MWNB 3TCAA 2LG1A 1ISNA 1H10A 1K5DB 2K00A 1J19A 1WJMA 1Y19B 2D9VA 1U27A 3N7CA 1H4RA 1B55A 3HW2B 5KCVA 5D27A 4IFSA 5JHHA 3PVLA 2H7DA 2P0FA 4A6KA 4EJNA 2UZRA 4TYZA 5DH9B 4HHVA 1V5MA 2D9YA 1TJ6A 4GZUA 3P7ZA 1P3RA 2ROZB 3U8ZA 1DDVA 1WJ1A 4HB0B 2COAA 1MPHA 4KHBB 2DFKA 2ELAA 1NI2A 4NSWA 1UNPA 3SNHA 5HE3A 1W1GA 2W2WA 2DKQA 1Q67A 1BTKA 2EJ8A 2LYDA 4HB4B 2COFA 3BINA 1KZGA 1FOEA 1ZC3B 2PZ1A 1NTYA 4GXBA 4F7GA 3SYXA 2E2XA 1DDMA 3KSYA 1ZC4B 1E5WA 1AWEA 1K5GB 2R0DA 5D3WA 1WGQA 3HK0A 5LOPB 2D9WA 2R09A 3KY9A 2JP2A 1U29A 5DHAB 4HAVB 5HE0A 1J0WA 2D10A 4A6HA 1BTNA 4HDQA 3RCPA 1BWNA 1M7EA 2VKIA 2P0HA 2I1KA 2YVCA 4MT7A 2IFSA 3AU4A 4HAUB 2CAYA 1RRPB 2I5CA 4EMOA 1FB8A 2CY4A 4YONA 1U5DA 2XQNM 2KCJA 4F7HA 1FHOA 4K17A 2H7EA 1FAOA 2V76A 2ZPYA 1OQNA 5CLQB 3HQCA 2RGNB 4K2OA 2ADZA 2YS3A 3SV1A 1EAZA 2YRYA 3TVVA 2P0DA 3KZ1A 3M1IB 4D0NB 4HDOA 4HAWB 1N3HA 1UNRA 3ODOA 2DYNA 1V5UA 1X86A 2L2IA 3V5WA 2FJLA 3NSUA 4HAXB 4EKUA 3F5RA 4A5KA 3QIJA 2KGXB 4CYEA 2DKPA 4XWXA 1NU2A 5DHFB 2VSZA 1SGHA 2RSGA 3CXBB 5DIFB 2DHJA 5C16A 5JLJB 1DROA 1XODA 2ELBA 3WYFB 2L1CA 4HATB 4K81A 2GCJA 5C5BB 3PP2A 4HB2B 1X1GA 5C5BA 1MKEA 2EC1A 2NZ8B 2UZSA 3A8PA 2K2UA 1LB1A 4F7UP 2G35A 3IVFA 3ULCA 3G9WA 1U5GA 2HE7A 3DXEA 2Z0OA 1GG3A 2QKLA 3PSCA 1WI1A 1UEFA 5HE1A 2GCLA 2J0MA 3QBVB 5C6RA 1UPQA 3MDBC 2MKRA 3U7DA 2Z0QA 2N0YA 2UVMA 5DI9B 2GJYA 4HAZB 2YS1A 1RJ2A 4A6FB 1ZVRA 4A6FA 3FEHA 5J3QA 1EF1A 1MIXA 1PLSA 2Q13A 5C79A 1TXDA 1W1HA 2DX5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DBH A;  4DBB A;  2W2X D;  3TW1 A;  1WGU A;  3VOQ A;  3DXD A;  3TO1 A;  5KQ4 A;  2J59 M;  5KQ1 A;  4MK0 A;  1NTV A;  5GOW B;  1V61 A;  5J3Y A;  2CY5 A;  4YL8 A;  1EGX A;  1BAK A;  1AQC A;  2YT0 A;  2YS5 A;  2YF0 A;  1ZSQ A;  4GN1 A;  3SUZ A;  1GC6 A;  3D8F A;  2AEH A;  3ML4 A;  1WVH A;  4KHA A;  3ULB A;  5EFX A;  4L6E A;  4Z2N A;  3VIA A;  1I2H A;  1KI1 B;  2KUP A;  1UNQ A;  2EMS A;  2D9X A;  1DDW A;  3KRW A;  3PEG A;  4MY6 A;  5FI0 A;  2D11 A;  4WSF A;  3O96 A;  3ODX A;  3A98 B;  3F0W A;  3P6A A;  4GPT B;  5FI1 A;  2LUL A;  2LOX A;  1TQZ A;  2J0J A;  2K2J A;  1WG7 A;  3OAN A;  1PMS A;  1QC6 A;  2OQB A;  2RLO A;  2BCJ A;  1V5P A;  3MPX A;  4PNK A;  3PVW A;  2W2X C;  2D4Q A;  5JHG A;  1U5F A;  2N23 A;  4C0A A;  2M14 A;  4WJ7 A;  2CRF A;  2DX1 A;  5L81 A;  3PVU A;  4P7I A;  3TFM A;  2RUK B;  1DYN A;  1X1F A;  1V89 A;  4CHM A;  2I1J A;  1XD4 A;  3LJU X;  3X23 A;  1OMW A;  1FGZ A;  1FHX A;  5LON B;  4Y94 A;  1P6S A;  1Z87 A;  4CHJ A;  4DX9 0;  2QKM A;  4GMX B;  5D3Y A;  2DYQ A;  2IYB A;  2DHK A;  3ZDT A;  4Z2M B;  2EMT A;  3T06 A;  3PZD A;  2DA0 A;  1PFJ A;  2DTC A;  4GMV A;  3ZVR A;  2Z0P A;  1U2B A;  2D9Z A;  1MK9 B;  4TKN A;  3D8E A;  3DXC A;  2AL6 A;  2LKO A;  5JP4 A;  4KAX B;  2Y7B A;  1MAI A;  2DN6 A;  4K2P A;  2GS0 A;  1GC7 A;  2DLW A;  3FM8 C;  4HAY B;  3AU5 A;  1FHW A;  1X11 A;  3FSS A;  1LW3 A;  2OTX A;  1QQG A;  3WA0 A;  1ZM0 A;  5HE2 A;  2VRW B;  5CLL B;  2ROV A;  4KVG B;  4B6H A;  1I7A A;  2YSZ A;  3CIK A;  3PG7 A;  2I5F A;  1V88 A;  1W1D A;  1XCG A;  1M7R A;  2RNR B;  2X18 A;  3ODW A;  4H8S A;  1UPR A;  2YT1 A;  3QWM A;  3D8D A;  4BBK A;  2P8V A;  1IRS A;  4NY0 A;  2D2Q A;  4KHO A;  4PQ0 A;  1U5E A;  3KRX A;  1FGY A;  5D3X A;  4ZRJ A;  2HTH B;  1KZ7 A;  2DHI A;  2J0K A;  1MIZ B;  3UZT A;  4DXA B;  2MDX A;  2COD A;  1Y5O A;  3BJI A;  4ZRI A;  5J3T A;  1SHC A;  4IAP A;  1X05 A;  4HB3 B;  1MK7 B;  1EVH A;  1XX0 A;  4ZRK A;  2COC A;  3SO6 A;  2M38 A;  4DX8 A;  2RVB B;  2Y8F A;  3AJ4 A;  4IOY X;  4WVF B;  2Y8G A;  2MFQ A;  1XKE A;  1OY2 A;  1XR0 B;  3GYO A;  1P5T A;  2NMB A;  3A8Q A;  5D3V A;  3GYP A;  2LOZ A;  2MWN B;  3TCA A;  2LG1 A;  1ISN A;  1H10 A;  1K5D B;  2K00 A;  1J19 A;  1WJM A;  1Y19 B;  2D9V A;  1U27 A;  3N7C A;  1H4R A;  1B55 A;  3HW2 B;  5KCV A;  5D27 A;  4IFS A;  5JHH A;  3PVL A;  2H7D A;  2P0F A;  4A6K A;  4EJN A;  2UZR A;  4TYZ A;  5DH9 B;  4HHV A;  1V5M A;  2D9Y A;  1TJ6 A;  4GZU A;  3P7Z A;  1P3R A;  2ROZ B;  3U8Z A;  1DDV A;  1WJ1 A;  4HB0 B;  2COA A;  1MPH A;  4KHB B;  2DFK A;  2ELA A;  1NI2 A;  4NSW A;  1UNP A;  3SNH A;  5HE3 A;  1W1G A;  2W2W A;  2DKQ A;  1Q67 A;  1BTK A;  2EJ8 A;  2LYD A;  4HB4 B;  2COF A;  3BIN A;  1KZG A;  1FOE A;  1ZC3 B;  2PZ1 A;  1NTY A;  4GXB A;  4F7G A;  3SYX A;  2E2X A;  1DDM A;  3KSY A;  1ZC4 B;  1E5W A;  1AWE A;  1K5G B;  2R0D A;  5D3W A;  1WGQ A;  3HK0 A;  5LOP B;  2D9W A;  2R09 A;  3KY9 A;  2JP2 A;  1U29 A;  5DHA B;  4HAV B;  5HE0 A;  1J0W A;  2D10 A;  4A6H A;  1BTN A;  4HDQ A;  3RCP A;  1BWN A;  1M7E A;  2VKI A;  2P0H A;  2I1K A;  2YVC A;  4MT7 A;  2IFS A;  3AU4 A;  4HAU B;  2CAY A;  1RRP B;  2I5C A;  4EMO A;  1FB8 A;  2CY4 A;  4YON A;  1U5D A;  2XQN M;  2KCJ A;  4F7H A;  1FHO A;  4K17 A;  2H7E A;  1FAO A;  2V76 A;  2ZPY A;  1OQN A;  5CLQ B;  3HQC A;  2RGN B;  4K2O A;  2ADZ A;  2YS3 A;  3SV1 A;  1EAZ A;  2YRY A;  3TVV A;  2P0D A;  3KZ1 A;  3M1I B;  4D0N B;  4HDO A;  4HAW B;  1N3H A;  1UNR A;  3ODO A;  2DYN A;  1V5U A;  1X86 A;  2L2I A;  3V5W A;  2FJL A;  3NSU A;  4HAX B;  4EKU A;  3F5R A;  4A5K A;  3QIJ A;  2KGX B;  4CYE A;  2DKP A;  4XWX A;  1NU2 A;  5DHF B;  2VSZ A;  1SGH A;  2RSG A;  3CXB B;  5DIF B;  2DHJ A;  5C16 A;  5JLJ B;  1DRO A;  1XOD A;  2ELB A;  3WYF B;  2L1C A;  4HAT B;  4K81 A;  2GCJ A;  5C5B B;  3PP2 A;  4HB2 B;  1X1G A;  5C5B A;  1MKE A;  2EC1 A;  2NZ8 B;  2UZS A;  3A8P A;  2K2U A;  1LB1 A;  4F7U P;  2G35 A;  3IVF A;  3ULC A;  3G9W A;  1U5G A;  2HE7 A;  3DXE A;  2Z0O A;  1GG3 A;  2QKL A;  3PSC A;  1WI1 A;  1UEF A;  5HE1 A;  2GCL A;  2J0M A;  3QBV B;  5C6R A;  1UPQ A;  3MDB C;  2MKR A;  3U7D A;  2Z0Q A;  2N0Y A;  2UVM A;  5DI9 B;  2GJY A;  4HAZ B;  2YS1 A;  1RJ2 A;  4A6F B;  1ZVR A;  4A6F A;  3FEH A;  5J3Q A;  1EF1 A;  1MIX A;  1PLS A;  2Q13 A;  5C79 A;  1TXD A;  1W1H A;  2DX5 A; 
#chains in the Genus database with same CATH topology
 1DBH A;  4DBB A;  2W2X D;  3TW1 A;  1WGU A;  3VOQ A;  4GOU A;  3DXD A;  3TO1 A;  5KQ4 A;  2J59 M;  5KQ1 A;  3A58 A;  1NTV A;  4MK0 A;  5GOW B;  1MI1 A;  1V61 A;  5J3Y A;  2CY5 A;  4YL8 A;  1EGX A;  1BAK A;  5I2M A;  1AQC A;  2YT0 A;  2YS5 A;  2YF0 A;  3NWA A;  1ZSQ A;  4GN1 A;  3SUZ A;  1GC6 A;  4D6W A;  3D8F A;  2AEH A;  3ML4 A;  1WVH A;  4KHA A;  3ULB A;  5EFX A;  4L6E A;  4Z2N A;  3VIA A;  1I2H A;  1KI1 B;  2KUP A;  1UNQ A;  2EMS A;  3NWF A;  2D9X A;  1DDW A;  3KRW A;  3PEG A;  4MY6 A;  5FI0 A;  2GUM A;  2D11 A;  4WSF A;  3O96 A;  3ODX A;  3A98 B;  3F0W A;  3P6A A;  3OHM B;  4GPT B;  5FI1 A;  2LUL A;  2LOX A;  1TQZ A;  2J0J A;  2K2J A;  1WG7 A;  5IRS A;  3OAN A;  1PMS A;  1QC6 A;  2OQB A;  2RLO A;  2BCJ A;  1V5P A;  3MPX A;  4PNK A;  3PVW A;  2K8E A;  2W2X C;  2D4Q A;  5JHG A;  1U5F A;  2N23 A;  4C0A A;  2M14 A;  4WJ7 A;  2CRF A;  2DX1 A;  5L81 A;  3PVU A;  4P7I A;  3TFM A;  2RUK B;  1DYN A;  1X1F A;  1V89 A;  4CHM A;  2I1J A;  1XD4 A;  4HSI A;  3LJU X;  3X23 A;  4QJ3 B;  1OMW A;  1FGZ A;  1FHX A;  5LON B;  2R2Y A;  4Y94 A;  1P6S A;  1Z87 A;  4CHJ A;  4DX9 0;  2QKM A;  4OSN A;  4GMX B;  2KIE A;  5D3Y A;  2DYQ A;  2IYB A;  2DHK A;  3ZDT A;  4Z2M B;  2EMT A;  3T06 A;  3PZD A;  2DA0 A;  1PFJ A;  2DTC A;  4GMV A;  3ZVR A;  2Z0P A;  1U2B A;  2D9Z A;  1MK9 B;  4TKN A;  3D8E A;  3DXC A;  2AL6 A;  3NWD A;  2LKO A;  5JP4 A;  4KAX B;  2Y7B A;  4DIX A;  1MAI A;  2DN6 A;  4K2P A;  2GS0 A;  1GC7 A;  2DLW A;  3FM8 C;  4HAY B;  3AU5 A;  1FHW A;  1X11 A;  3FSS A;  1LW3 A;  2OTX A;  1QQG A;  3WA0 A;  1ZM0 A;  5HE2 A;  2VRW B;  5CLL B;  2ROV A;  4KVG B;  4B6H A;  1I7A A;  2YSZ A;  3CIK A;  3PG7 A;  2I5F A;  1V88 A;  1W1D A;  1XCG A;  1M7R A;  2RNR B;  2X18 A;  3ODW A;  4H8S A;  1UPR A;  2YT1 A;  3QWM A;  3D8D A;  4BBK A;  2P8V A;  1IRS A;  4NY0 A;  2D2Q A;  4KHO A;  4PQ0 A;  1U5E A;  3KRX A;  1FGY A;  5D3X A;  4ZRJ A;  2HTH B;  1KZ7 A;  2DHI A;  2J0K A;  1MIZ B;  4QJ4 B;  3UZT A;  4DXA B;  2MDX A;  2COD A;  1Y5O A;  3BJI A;  5LG4 B;  4ZRI A;  5J3T A;  1SHC A;  4IAP A;  1X05 A;  1ZYI A;  4HB3 B;  1MK7 B;  5M4Y B;  1EVH A;  1XX0 A;  4ZRK A;  2COC A;  3SO6 A;  2M38 A;  4DX8 A;  2KIG A;  2RVB B;  2Y8F A;  3AJ4 A;  4IOY X;  4WVF B;  2Y8G A;  2MFQ A;  1XKE A;  1OY2 A;  1XR0 B;  3GYO A;  1P5T A;  2NMB A;  3A8Q A;  5D3V A;  3GYP A;  4L1R A;  2LOZ A;  2MWN B;  3TCA A;  2LG1 A;  1ISN A;  1H10 A;  1K5D B;  2K00 A;  1J19 A;  1WJM A;  1Y19 B;  2D9V A;  1U27 A;  3N7C A;  1H4R A;  1B55 A;  3HW2 B;  5KCV A;  5D27 A;  4IFS A;  5JHH A;  3PVL A;  2Z4D A;  3U12 A;  2H7D A;  2P0F A;  4A6K A;  4EJN A;  2UZR A;  4TYZ A;  5DH9 B;  4HHV A;  1V5M A;  2D9Y A;  1TJ6 A;  4GZU A;  3P7Z A;  1P3R A;  2ROZ B;  3B77 A;  3U8Z A;  1DDV A;  1WJ1 A;  4HB0 B;  2COA A;  1MPH A;  4KHB B;  2DFK A;  4KHB A;  2ELA A;  1NI2 A;  4NSW A;  1UNP A;  3SNH A;  5HE3 A;  1W1G A;  2W2W A;  4OT1 A;  2DKQ A;  1Q67 A;  1BTK A;  2EJ8 A;  2K49 A;  2LYD A;  4HB4 B;  2COF A;  3BIN A;  1KZG A;  1FOE A;  1ZC3 B;  2PZ1 A;  1NTY A;  4GXB A;  4F7G A;  3SYX A;  2E2X A;  1DDM A;  3KSY A;  1ZC4 B;  1E5W A;  1AWE A;  1K5G B;  2R0D A;  5D3W A;  1WGQ A;  3HK0 A;  5LOP B;  2D9W A;  2KUQ A;  2R09 A;  3KY9 A;  2JP2 A;  1U29 A;  5DHA B;  4HAV B;  5HE0 A;  1J0W A;  2D10 A;  4A6H A;  1BTN A;  4HDQ A;  3RCP A;  1BWN A;  1M7E A;  1T77 A;  2VKI A;  2P0H A;  2I1K A;  2YVC A;  4MT7 A;  2IFS A;  3AU4 A;  4HAU B;  2CAY A;  1RRP B;  2I5C A;  4EMO A;  3FVC A;  1FB8 A;  2CY4 A;  4YON A;  1U5D A;  2XQN M;  2KCJ A;  2YT2 A;  4F7H A;  1FHO A;  4K17 A;  2H7E A;  1FAO A;  2V76 A;  2ZPY A;  1OQN A;  5CLQ B;  3HQC A;  2RGN B;  4K2O A;  3NW8 A;  2ADZ A;  2YS3 A;  3SV1 A;  1EAZ A;  2YRY A;  3TVV A;  2P0D A;  2FJU B;  3KZ1 A;  3M1I B;  4D0N B;  4HDO A;  4HAW B;  1N3H A;  1UNR A;  3ODO A;  2DYN A;  2Z13 A;  1V5U A;  3HSA A;  1X86 A;  2L2I A;  3V5W A;  2FJL A;  3NSU A;  4HAX B;  4EKU A;  3F5R A;  4A5K A;  3QIJ A;  2KGX B;  2RRF A;  4CYE A;  2DKP A;  4XWX A;  1NU2 A;  5DHF B;  2VSZ A;  4GNK B;  1SGH A;  2RSG A;  3CXB B;  5DIF B;  2DHJ A;  5C16 A;  2NBV A;  5JLJ B;  1DRO A;  1XOD A;  2ELB A;  3WYF B;  2L1C A;  4HAT B;  4K81 A;  2GCJ A;  5C5B B;  3PP2 A;  4HB2 B;  1X1G A;  5C5B A;  1MKE A;  2EC1 A;  2NZ8 B;  2UZS A;  3A8P A;  2K2U A;  1LB1 A;  4F7U P;  2G35 A;  3IVF A;  2KR0 A;  3ULC A;  3G9W A;  4CSQ A;  4QJ5 B;  1U5G A;  2HE7 A;  3DXE A;  2Z0O A;  1GG3 A;  2QKL A;  3PSC A;  1WI1 A;  1UEF A;  5HE1 A;  2Z14 A;  2GCL A;  2J0M A;  3QBV B;  5C6R A;  1UPQ A;  3MDB C;  2MKR A;  3U7D A;  2Z0Q A;  5I2S A;  2N0Y A;  2UVM A;  5DI9 B;  3DCX A;  2GJY A;  4HAZ B;  2YS1 A;  1RJ2 A;  4A6F B;  1ZVR A;  4A6F A;  3FEH A;  4QXA B;  5J3Q A;  1EF1 A;  1MIX A;  1PLS A;  2Q13 A;  5C79 A;  1TXD A;  1W1H A;  2Z59 A;  2DX5 A;  2ZKM X;  3HIE A; 
#chains in the Genus database with same CATH homology
 1DBH A;  4DBB A;  2W2X D;  3TW1 A;  1WGU A;  3VOQ A;  3DXD A;  3TO1 A;  5KQ4 A;  2J59 M;  5KQ1 A;  4MK0 A;  1NTV A;  5GOW B;  1V61 A;  5J3Y A;  2CY5 A;  4YL8 A;  1EGX A;  1BAK A;  1AQC A;  2YT0 A;  2YS5 A;  2YF0 A;  1ZSQ A;  4GN1 A;  3SUZ A;  1GC6 A;  3D8F A;  2AEH A;  3ML4 A;  1WVH A;  4KHA A;  3ULB A;  5EFX A;  4L6E A;  4Z2N A;  3VIA A;  1I2H A;  1KI1 B;  2KUP A;  1UNQ A;  2EMS A;  2D9X A;  1DDW A;  3KRW A;  3PEG A;  4MY6 A;  5FI0 A;  2D11 A;  4WSF A;  3O96 A;  3ODX A;  3A98 B;  3F0W A;  3P6A A;  4GPT B;  5FI1 A;  2LUL A;  2LOX A;  1TQZ A;  2J0J A;  2K2J A;  1WG7 A;  3OAN A;  1PMS A;  1QC6 A;  2OQB A;  2RLO A;  2BCJ A;  1V5P A;  3MPX A;  4PNK A;  3PVW A;  2W2X C;  2D4Q A;  5JHG A;  1U5F A;  2N23 A;  4C0A A;  2M14 A;  4WJ7 A;  2CRF A;  2DX1 A;  5L81 A;  3PVU A;  4P7I A;  3TFM A;  2RUK B;  1DYN A;  1X1F A;  1V89 A;  4CHM A;  2I1J A;  1XD4 A;  3LJU X;  3X23 A;  1OMW A;  1FGZ A;  1FHX A;  5LON B;  4Y94 A;  1P6S A;  1Z87 A;  4CHJ A;  4DX9 0;  2QKM A;  4GMX B;  5D3Y A;  2DYQ A;  2IYB A;  2DHK A;  3ZDT A;  4Z2M B;  2EMT A;  3T06 A;  3PZD A;  2DA0 A;  1PFJ A;  2DTC A;  4GMV A;  3ZVR A;  2Z0P A;  1U2B A;  2D9Z A;  1MK9 B;  4TKN A;  3D8E A;  3DXC A;  2AL6 A;  2LKO A;  5JP4 A;  4KAX B;  2Y7B A;  1MAI A;  2DN6 A;  4K2P A;  2GS0 A;  1GC7 A;  2DLW A;  3FM8 C;  4HAY B;  3AU5 A;  1FHW A;  1X11 A;  3FSS A;  1LW3 A;  2OTX A;  1QQG A;  3WA0 A;  1ZM0 A;  5HE2 A;  2VRW B;  5CLL B;  2ROV A;  4KVG B;  4B6H A;  1I7A A;  2YSZ A;  3CIK A;  3PG7 A;  2I5F A;  1V88 A;  1W1D A;  1XCG A;  1M7R A;  2RNR B;  2X18 A;  3ODW A;  4H8S A;  1UPR A;  2YT1 A;  3QWM A;  3D8D A;  4BBK A;  2P8V A;  1IRS A;  4NY0 A;  2D2Q A;  4KHO A;  4PQ0 A;  1U5E A;  3KRX A;  1FGY A;  5D3X A;  4ZRJ A;  2HTH B;  1KZ7 A;  2DHI A;  2J0K A;  1MIZ B;  3UZT A;  4DXA B;  2MDX A;  2COD A;  1Y5O A;  3BJI A;  4ZRI A;  5J3T A;  1SHC A;  4IAP A;  1X05 A;  4HB3 B;  1MK7 B;  1EVH A;  1XX0 A;  4ZRK A;  2COC A;  3SO6 A;  2M38 A;  4DX8 A;  2RVB B;  2Y8F A;  3AJ4 A;  4IOY X;  4WVF B;  2Y8G A;  2MFQ A;  1XKE A;  1OY2 A;  1XR0 B;  3GYO A;  1P5T A;  2NMB A;  3A8Q A;  5D3V A;  3GYP A;  2LOZ A;  2MWN B;  3TCA A;  2LG1 A;  1ISN A;  1H10 A;  1K5D B;  2K00 A;  1J19 A;  1WJM A;  1Y19 B;  2D9V A;  1U27 A;  3N7C A;  1H4R A;  1B55 A;  3HW2 B;  5KCV A;  5D27 A;  4IFS A;  5JHH A;  3PVL A;  2H7D A;  2P0F A;  4A6K A;  4EJN A;  2UZR A;  4TYZ A;  5DH9 B;  4HHV A;  1V5M A;  2D9Y A;  1TJ6 A;  4GZU A;  3P7Z A;  1P3R A;  2ROZ B;  3U8Z A;  1DDV A;  1WJ1 A;  4HB0 B;  2COA A;  1MPH A;  4KHB B;  2DFK A;  2ELA A;  1NI2 A;  4NSW A;  1UNP A;  3SNH A;  5HE3 A;  1W1G A;  2W2W A;  2DKQ A;  1Q67 A;  1BTK A;  2EJ8 A;  2LYD A;  4HB4 B;  2COF A;  3BIN A;  1KZG A;  1FOE A;  1ZC3 B;  2PZ1 A;  1NTY A;  4GXB A;  4F7G A;  3SYX A;  2E2X A;  1DDM A;  3KSY A;  1ZC4 B;  1E5W A;  1AWE A;  1K5G B;  2R0D A;  5D3W A;  1WGQ A;  3HK0 A;  5LOP B;  2D9W A;  2R09 A;  3KY9 A;  2JP2 A;  1U29 A;  5DHA B;  4HAV B;  5HE0 A;  1J0W A;  2D10 A;  4A6H A;  1BTN A;  4HDQ A;  3RCP A;  1BWN A;  1M7E A;  2VKI A;  2P0H A;  2I1K A;  2YVC A;  4MT7 A;  2IFS A;  3AU4 A;  4HAU B;  2CAY A;  1RRP B;  2I5C A;  4EMO A;  1FB8 A;  2CY4 A;  4YON A;  1U5D A;  2XQN M;  2KCJ A;  4F7H A;  1FHO A;  4K17 A;  2H7E A;  1FAO A;  2V76 A;  2ZPY A;  1OQN A;  5CLQ B;  3HQC A;  2RGN B;  4K2O A;  2ADZ A;  2YS3 A;  3SV1 A;  1EAZ A;  2YRY A;  3TVV A;  2P0D A;  3KZ1 A;  3M1I B;  4D0N B;  4HDO A;  4HAW B;  1N3H A;  1UNR A;  3ODO A;  2DYN A;  1V5U A;  1X86 A;  2L2I A;  3V5W A;  2FJL A;  3NSU A;  4HAX B;  4EKU A;  3F5R A;  4A5K A;  3QIJ A;  2KGX B;  4CYE A;  2DKP A;  4XWX A;  1NU2 A;  5DHF B;  2VSZ A;  1SGH A;  2RSG A;  3CXB B;  5DIF B;  2DHJ A;  5C16 A;  5JLJ B;  1DRO A;  1XOD A;  2ELB A;  3WYF B;  2L1C A;  4HAT B;  4K81 A;  2GCJ A;  5C5B B;  3PP2 A;  4HB2 B;  1X1G A;  5C5B A;  1MKE A;  2EC1 A;  2NZ8 B;  2UZS A;  3A8P A;  2K2U A;  1LB1 A;  4F7U P;  2G35 A;  3IVF A;  3ULC A;  3G9W A;  1U5G A;  2HE7 A;  3DXE A;  2Z0O A;  1GG3 A;  2QKL A;  3PSC A;  1WI1 A;  1UEF A;  5HE1 A;  2GCL A;  2J0M A;  3QBV B;  5C6R A;  1UPQ A;  3MDB C;  2MKR A;  3U7D A;  2Z0Q A;  2N0Y A;  2UVM A;  5DI9 B;  2GJY A;  4HAZ B;  2YS1 A;  1RJ2 A;  4A6F B;  1ZVR A;  4A6F A;  3FEH A;  5J3Q A;  1EF1 A;  1MIX A;  1PLS A;  2Q13 A;  5C79 A;  1TXD A;  1W1H A;  2DX5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...