1NTYA

Crystal structure of the first dh/ph domain of trio to 1.7 a
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
305
structure length
305
Chain Sequence
ARRKEFIMAELIQTEKAYVRDLRECMDTYLWEMTSGVEEIPPGIVNKELIIFGNMQEIYEFHNNIFLKELEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKPDSTQLILEHAGSYFDEIQQRHGLANSISSYLIKPVQRITKYQLLLKELLTCCEEGKGEIKDGLEVMLSVPKRANDAMHLSMLEGFDENIESQGELILQESFQVWDPKTLIRKGRERHLFLFEMSLVFSKEVKDSSGRSKYLYKSKLFTSELGVTEHVEGDPCKFALWVGRTPTSDNKIVLKASSIENKQDWIKHIREVIQERT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Triple functional domain protein
publication title The C-terminal basic tail of RhoG assists the guanine nucleotide exchange factor trio in binding to phospholipids.
pubmed doi rcsb
source organism Homo sapiens
total genus 111
structure length 305
sequence length 305
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00621 RhoGEF RhoGEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 1ntyA01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1ntyA02
1QQGA 5C5BA 1ISNA 2V76A 2VSZA 1V89A 1X1FA 3CIKA 3TCAA 1DDMA 2UZSA 2D9VA 1U5EA 4Z2NA 1I2HA 4HB0B 2RGNB 1XKEA 4HB4B 1WI1A 5C5BB 1KZGA 1W1GA 3PEGA 5J3YA 1B55A 2EC1A 5DIFB 4MT7A 2OQBA 3M1IB 2DFKA 1UEFA 1EAZA 2YS1A 4B6HA 2RLOA 3HK0A 5J3TA 2DHIA 4Z2MB 5JHHA 2R0DA 2W2WA 2GCJA 3O96A 1KI1B 1QC6A 4IOYX 2PZ1A 4L6EA 3TW1A 4CYEA 2ELAA 4K81A 1XCGA 4A6KA 3UZTA 4P7IA 1BY1A 1GC7A 1LW3A 3CXBB 1NI2A 2D9XA 4A6FA 4HB2B 4YL8A 1J19A 1H4RA 1P5TA 2J0JA 2DYNA 3MPXA 1XODA 1Y5OA 2RNRB 2KCJA 2DX1A 2DHKA 1UNRA 2HE7A 1SGHA 4A6FB 3KY9A 2K00A 2YS3A 1NU2A 4HDOA 2MFQA 4GZUA 4Y94A 3ZDTA 3TVVA 2J59M 5J3QA 1MPHA 3SUZA 2D2QA 5DH9B 2MDXA 1W1DA 2R09A 4GMVA 1UNQA 2LYDA 1WG7A 1ZC4B 2DHJA 1FGZA 4H8SA 5LONB 1U2BA 4HAYB 5KQ4A 4HHVA 5JP4A 1FHOA 2Z0PA 4IFSA 1TQZA 5C6RA 2AL6A 3BJIA 1EVHA 3NSUA 1TJ6A 4KAXB 3MDBC 1DDVA 2M38A 5KQ1A 3IVFA 1P6SA 1DBHA 3SYXA 3VOQA 2ROVA 3PVWA 2J0KA 1DDWA 2D10A 2P0HA 3QBVB 3PVUA 2VKIA 3D8FA 4TYZA 1RJ2A 1X86A 1UPQA 2UVMA 2CODA 3PZDA 3SNHA 2DYQA 3KSYA 2EMTA 2K2UA 5HE1A 4KHAA 3ODWA 3ODXA 1FOEA 3ODOA 2DX5A 3X23A 2Y8FA 1MIXA 2KGXB 4DXAB 4IAPA 1W1HA 4GN1A 4A6HA 2E2XA 3WYFB 4EKUA 5D3XA 1UPRA 2H7DA 2NZ8B 1X05A 2L1CA 3ML4A 2Z0QA 2FJLA 1U5FA 5JHGA 2DKPA 3GYOA 2XQNM 1EGXA 1GC6A 2KUPA 3ULCA 2DLWA 1TXDA 1OQNA 4HAXB 2AEHA 1UNPA 4D0NB 3U8ZA 1WJ1A 4WJ7A 4GXBA 1EF1A 1BTKA 2BCJA 1V5UA 1DROA 2H7EA 5C79A 3ULBA 2QKMA 1SHCA 2L2IA 1BAKA 1OY2A 2RUKB 3QIJA 2P8VA 2YSZA 1V5PA 4BBKA 2G35A 1X11A 1MKEA 1FB8A 3F5RA 2Y7BA 4KHBB 2GS0A 3KRWA 5CLLB 2DA0A 5FI0A 2P0DA 2X18A 4MK0A 1M7RA 2CRFA 4K2PA 2YS5A 1WGUA 1V5MA 2LOXA 2N23A 2Z0OA 3DXDA 5D3VA 1F5XA 2ELBA 3WA0A 1H10A 2YT1A 1MK9B 1ZSQA 1PLSA 2NMBA 2YF0A 4HDQA 3SV1A 2P0FA 2M14A 2J0MA 1KZ7A 2LKOA 1DYNA 2OTXA 3GF9A 1XR0B 1ZM0A 2COCA 5C16A 2MWNB 4CHMA 2HTHB 4HATB 3F0WA 3D8DA 4XWXA 4HAUB 1GG3A 2DN6A 3HW2B 4F7GA 4WVFB 2GJYA 2D9WA 5EFXA 2LG1A 1V88A 2D4QA 1P3RA 3T06A 1PMSA 1U5DA 2IYBA 4F7HA 5CLQB 4NSWA 1Q67A 2W2XC 4C0AA 5JLJB 3LJUX 1RRPB 4K17A 2CAYA 4D0OA 4ZRJA 2D9YA 1FHWA 1WGQA 1AQCA 5FI1A 3KRXA 3PVLA 3PSCA 4NY0A 2DTCA 1M7EA 2RVBB 4TKNA 2YVCA 3FSSA 1MIZB 1WVHA 1FGYA 4YONA 1XD4A 4GYVA 1K5GB 2I1KA 2D11A 4K2OA 3A8PA 3U7DA 3EO2A 4DX8A 3AU4A 2ADZA 5DHFB 1E5WA 4HAZB 4PNKA 3G9WA 3P7ZA 4HAWB 1NTVA 2EMSA 2IFSA 3RCPA 4GOUA 4DBBA 5HE2A 4KVGB 3A8QA 3DXCA 3BINA 1OMWA 2I5CA 1V61A 2Y8GA 4WSFA 2YT0A 1BTNA 2K2JA 1BWNA 1J0WA 5KCVA 5LOPB 3D8EA 1MAIA 3HQCA 1I7AA 3JV3A 3ZVRA 4PQ0A 2ZPYA 3OANA 3TO1A 5HE0A 5L81A 2UZRA 1U29A 2DKQA 1Y19B 1PFJA 3DXEA 2KR9A 1FHXA 5HE3A 5DI9B 1MK7B 2GCLA 2I1JA 3GYPA 4CHJA 3SO6A 1Z87A 3A98B 4MY6A 4DX90 1FAOA 4GPTB 5DHAB 4HB3B 2RSGA 1U27A 2W2XD 4F7UP 1AWEA 4EMOA 3FM8C 2MKRA 1K5DB 2COAA 1X1GA 4GMXB 1ZC3B 5D3YA 5GOWB 2CY5A 5D27A 3AJ4A 3QWMA 3KZ1A 1XX0A 2Q13A 2I5FA 4HAVB 1U5GA 3V5WA 4ZRKA 4KHOA 1WJMA 1ZVRA 1LB1A 2COFA 1N3HA 3TFMA 4A5KA 2QKLA 2LOZA 2YRYA 1NTYA 2LULA 3N7CA 4ZRIA 4EJNA 3FEHA 5D3WA 3PP2A 2N0YA 1IRSA 2JP2A 3PG7A 3VIAA 2CY4A 2ROZB 3AU5A 2VRWB 3P6AA 2EJ8A 2D9ZA
chains in the Genus database with same CATH superfamily
1QQGA 5C5BA 1ISNA 2V76A 2VSZA 1V89A 1X1FA 3CIKA 3TCAA 1DDMA 2UZSA 2D9VA 1U5EA 3A58A 4Z2NA 1I2HA 2R2YA 4HB0B 2RGNB 1XKEA 4HB4B 1WI1A 3NW8A 5C5BB 1KZGA 1W1GA 3PEGA 5J3YA 1B55A 5LG4B 2EC1A 5DIFB 4MT7A 2OQBA 3M1IB 2DFKA 1UEFA 1EAZA 2YS1A 4B6HA 2RLOA 3HK0A 5J3TA 2DHIA 4Z2MB 5JHHA 2R0DA 2W2WA 2GCJA 3O96A 1KI1B 1QC6A 4OSNA 4IOYX 2PZ1A 4L6EA 3TW1A 4CYEA 2ELAA 4K81A 2KIEA 1XCGA 4A6KA 3UZTA 3NWFA 4P7IA 1BY1A 1GC7A 1LW3A 3CXBB 1NI2A 2D9XA 4A6FA 4HB2B 4YL8A 1J19A 1H4RA 1P5TA 2J0JA 2DYNA 3MPXA 1XODA 1Y5OA 2RNRB 2KCJA 2DX1A 2DHKA 1UNRA 2HE7A 1SGHA 4A6FB 3KY9A 2K00A 2YS3A 1NU2A 4HDOA 2MFQA 4GZUA 4Y94A 2FJUB 2RRFA 3ZDTA 3TVVA 2J59M 5J3QA 1MPHA 3SUZA 2D2QA 5DH9B 2MDXA 1W1DA 2R09A 4GMVA 1UNQA 2LYDA 1WG7A 1ZC4B 5I2SA 2DHJA 1FGZA 4H8SA 5LONB 1U2BA 4HAYB 5KQ4A 4HHVA 5JP4A 1FHOA 2Z0PA 4IFSA 1TQZA 5C6RA 2AL6A 3BJIA 1EVHA 3NSUA 1TJ6A 4KAXB 3MDBC 1DDVA 2M38A 5KQ1A 3IVFA 1ZYIA 1P6SA 1DBHA 3SYXA 3VOQA 2ROVA 3PVWA 2J0KA 1DDWA 2D10A 2P0HA 3QBVB 3PVUA 2VKIA 3OHMB 3D8FA 2Z13A 1RJ2A 1X86A 4TYZA 3HSAA 1UPQA 2UVMA 2CODA 3PZDA 3SNHA 2DYQA 3KSYA 2EMTA 2K2UA 5HE1A 4KHAA 3ODWA 3ODXA 1FOEA 3ODOA 2DX5A 3X23A 2Y8FA 1MIXA 2KGXB 4DXAB 4IAPA 1W1HA 4GN1A 4A6HA 4CSQA 2E2XA 2ZKMX 3WYFB 4EKUA 5D3XA 1UPRA 3NWAA 2H7DA 2NZ8B 1X05A 2L1CA 3ML4A 2Z0QA 2FJLA 1U5FA 5JHGA 2DKPA 5I2MA 3GYOA 2XQNM 1EGXA 1GC6A 2KUPA 3ULCA 2DLWA 1TXDA 1OQNA 4HAXB 2AEHA 1UNPA 4D0NB 3U8ZA 1WJ1A 4WJ7A 4GXBA 1EF1A 1BTKA 2BCJA 1V5UA 2KR0A 1DROA 2H7EA 5C79A 2K8EA 3ULBA 2QKMA 1SHCA 2L2IA 1BAKA 4KHBA 1OY2A 2NBVA 5M4YB 5IRSA 2RUKB 3QIJA 2P8VA 2YSZA 1V5PA 4BBKA 2G35A 1X11A 1MKEA 1FB8A 3F5RA 1T77A 2Y7BA 4KHBB 2GS0A 3KRWA 5CLLB 2DA0A 5FI0A 2P0DA 2X18A 4MK0A 1M7RA 2CRFA 4K2PA 2YS5A 1WGUA 1V5MA 2LOXA 2N23A 4DIXA 2Z0OA 3DXDA 5D3VA 1F5XA 2ELBA 3WA0A 1H10A 2YT1A 4QJ4B 1MK9B 1ZSQA 1PLSA 2NMBA 2YF0A 4HDQA 3SV1A 2P0FA 2M14A 2J0MA 1KZ7A 2LKOA 1DYNA 2OTXA 3GF9A 1XR0B 1ZM0A 2COCA 5C16A 4L1RA 2MWNB 4CHMA 2HTHB 4HATB 3F0WA 3D8DA 4XWXA 4HAUB 1GG3A 2DN6A 3HW2B 4F7GA 4WVFB 2GJYA 2D9WA 5EFXA 2LG1A 1V88A 2D4QA 1P3RA 3T06A 1PMSA 1U5DA 2YT2A 2IYBA 4F7HA 5CLQB 4NSWA 1Q67A 2W2XC 4C0AA 5JLJB 3LJUX 1RRPB 4K17A 2CAYA 4D0OA 4ZRJA 2D9YA 1FHWA 1WGQA 1AQCA 5FI1A 3KRXA 3PVLA 3PSCA 4NY0A 2DTCA 1M7EA 2RVBB 4TKNA 2YVCA 3FSSA 1MIZB 1WVHA 1FGYA 4YONA 1MI1A 1XD4A 4GYVA 4GNKB 1K5GB 2I1KA 2D11A 4K2OA 3A8PA 3U7DA 3EO2A 4DX8A 3AU4A 2ADZA 5DHFB 1E5WA 4HAZB 4PNKA 3G9WA 3P7ZA 4HAWB 1NTVA 3HIEA 2EMSA 2IFSA 3NWDA 3RCPA 4GOUA 4DBBA 3B77A 4D6WA 3U12A 5HE2A 4KVGB 3A8QA 3DXCA 3BINA 1OMWA 2I5CA 1V61A 2K49A 2Y8GA 2KIGA 4WSFA 2YT0A 1BTNA 2K2JA 1BWNA 1J0WA 5KCVA 5LOPB 2KUQA 3D8EA 1MAIA 3FVCA 3HQCA 1I7AA 3JV3A 3ZVRA 4PQ0A 2ZPYA 3OANA 3TO1A 5HE0A 5L81A 2UZRA 1U29A 2Z4DA 2DKQA 1Y19B 1PFJA 3DXEA 2KR9A 1FHXA 5HE3A 5DI9B 1MK7B 2GCLA 2I1JA 3GYPA 4OT1A 4CHJA 3SO6A 4HSIA 1Z87A 3A98B 4MY6A 4DX90 1FAOA 4GPTB 5DHAB 4HB3B 2RSGA 1U27A 2W2XD 4F7UP 1AWEA 4EMOA 3FM8C 2MKRA 1K5DB 2COAA 1X1GA 4GMXB 1ZC3B 5D3YA 5GOWB 2CY5A 4QJ5B 5D27A 3AJ4A 3QWMA 3KZ1A 1XX0A 2Q13A 2I5FA 4HAVB 2Z14A 1U5GA 3V5WA 4ZRKA 4KHOA 1WJMA 1ZVRA 1LB1A 4QXAB 2COFA 1N3HA 3TFMA 4A5KA 2QKLA 2GUMA 2LOZA 2YRYA 1NTYA 2LULA 3N7CA 4ZRIA 4EJNA 3FEHA 5D3WA 2Z59A 3DCXA 3PP2A 4QJ3B 2N0YA 1IRSA 2JP2A 3PG7A 3VIAA 2CY4A 2ROZB 3AU5A 2VRWB 3P6AA 2EJ8A 2D9ZA
chains in the Genus database with same CATH topology
1QQGA 5C5BA 1ISNA 2V76A 2VSZA 1V89A 1X1FA 3CIKA 3TCAA 1DDMA 2UZSA 2D9VA 1U5EA 4Z2NA 1I2HA 4HB0B 2RGNB 1XKEA 4HB4B 1WI1A 5C5BB 1KZGA 1W1GA 3PEGA 5J3YA 1B55A 2EC1A 5DIFB 4MT7A 2OQBA 3M1IB 2DFKA 1UEFA 1EAZA 2YS1A 4B6HA 2RLOA 3HK0A 5J3TA 2DHIA 4Z2MB 5JHHA 2R0DA 2W2WA 2GCJA 3O96A 1KI1B 1QC6A 4IOYX 2PZ1A 4L6EA 3TW1A 4CYEA 2ELAA 4K81A 1XCGA 4A6KA 3UZTA 4P7IA 1BY1A 1GC7A 1LW3A 3CXBB 1NI2A 2D9XA 4A6FA 4HB2B 4YL8A 1J19A 1H4RA 1P5TA 2J0JA 2DYNA 3MPXA 1XODA 1Y5OA 2RNRB 2KCJA 2DX1A 2DHKA 1UNRA 2HE7A 1SGHA 4A6FB 3KY9A 2K00A 2YS3A 1NU2A 4HDOA 2MFQA 4GZUA 4Y94A 3ZDTA 3TVVA 2J59M 5J3QA 1MPHA 3SUZA 2D2QA 5DH9B 2MDXA 1W1DA 2R09A 4GMVA 1UNQA 2LYDA 1WG7A 1ZC4B 2DHJA 1FGZA 4H8SA 5LONB 1U2BA 4HAYB 5KQ4A 4HHVA 5JP4A 1FHOA 2Z0PA 4IFSA 1TQZA 5C6RA 2AL6A 3BJIA 1EVHA 3NSUA 1TJ6A 4KAXB 3MDBC 1DDVA 2M38A 5KQ1A 3IVFA 1P6SA 1DBHA 3SYXA 3VOQA 2ROVA 3PVWA 2J0KA 1DDWA 2D10A 2P0HA 3QBVB 3PVUA 2VKIA 3D8FA 4TYZA 1RJ2A 1X86A 1UPQA 2UVMA 2CODA 3PZDA 3SNHA 2DYQA 3KSYA 2EMTA 2K2UA 5HE1A 4KHAA 3ODWA 3ODXA 1FOEA 3ODOA 2DX5A 3X23A 2Y8FA 1MIXA 2KGXB 4DXAB 4IAPA 1W1HA 4GN1A 4A6HA 2E2XA 3WYFB 4EKUA 5D3XA 1UPRA 2H7DA 2NZ8B 1X05A 2L1CA 3ML4A 2Z0QA 2FJLA 1U5FA 5JHGA 2DKPA 3GYOA 2XQNM 1EGXA 1GC6A 2KUPA 3ULCA 2DLWA 1TXDA 1OQNA 4HAXB 2AEHA 1UNPA 4D0NB 3U8ZA 1WJ1A 4WJ7A 4GXBA 1EF1A 1BTKA 2BCJA 1V5UA 1DROA 2H7EA 5C79A 3ULBA 2QKMA 1SHCA 2L2IA 1BAKA 1OY2A 2RUKB 3QIJA 2P8VA 2YSZA 1V5PA 4BBKA 2G35A 1X11A 1MKEA 1FB8A 3F5RA 2Y7BA 4KHBB 2GS0A 3KRWA 5CLLB 2DA0A 5FI0A 2P0DA 2X18A 4MK0A 1M7RA 2CRFA 4K2PA 2YS5A 1WGUA 1V5MA 2LOXA 2N23A 2Z0OA 3DXDA 5D3VA 1F5XA 2ELBA 3WA0A 1H10A 2YT1A 1MK9B 1ZSQA 1PLSA 2NMBA 2YF0A 4HDQA 3SV1A 2P0FA 2M14A 2J0MA 1KZ7A 2LKOA 1DYNA 2OTXA 3GF9A 1XR0B 1ZM0A 2COCA 5C16A 2MWNB 4CHMA 2HTHB 4HATB 3F0WA 3D8DA 4XWXA 4HAUB 1GG3A 2DN6A 3HW2B 4F7GA 4WVFB 2GJYA 2D9WA 5EFXA 2LG1A 1V88A 2D4QA 1P3RA 3T06A 1PMSA 1U5DA 2IYBA 4F7HA 5CLQB 4NSWA 1Q67A 2W2XC 4C0AA 5JLJB 3LJUX 1RRPB 4K17A 2CAYA 4D0OA 4ZRJA 2D9YA 1FHWA 1WGQA 1AQCA 5FI1A 3KRXA 3PVLA 3PSCA 4NY0A 2DTCA 1M7EA 2RVBB 4TKNA 2YVCA 3FSSA 1MIZB 1WVHA 1FGYA 4YONA 1XD4A 4GYVA 1K5GB 2I1KA 2D11A 4K2OA 3A8PA 3U7DA 3EO2A 4DX8A 3AU4A 2ADZA 5DHFB 1E5WA 4HAZB 4PNKA 3G9WA 3P7ZA 4HAWB 1NTVA 2EMSA 2IFSA 3RCPA 4GOUA 4DBBA 5HE2A 4KVGB 3A8QA 3DXCA 3BINA 1OMWA 2I5CA 1V61A 2Y8GA 4WSFA 2YT0A 1BTNA 2K2JA 1BWNA 1J0WA 5KCVA 5LOPB 3D8EA 1MAIA 3HQCA 1I7AA 3JV3A 3ZVRA 4PQ0A 2ZPYA 3OANA 3TO1A 5HE0A 5L81A 2UZRA 1U29A 2DKQA 1Y19B 1PFJA 3DXEA 2KR9A 1FHXA 5HE3A 5DI9B 1MK7B 2GCLA 2I1JA 3GYPA 4CHJA 3SO6A 1Z87A 3A98B 4MY6A 4DX90 1FAOA 4GPTB 5DHAB 4HB3B 2RSGA 1U27A 2W2XD 4F7UP 1AWEA 4EMOA 3FM8C 2MKRA 1K5DB 2COAA 1X1GA 4GMXB 1ZC3B 5D3YA 5GOWB 2CY5A 5D27A 3AJ4A 3QWMA 3KZ1A 1XX0A 2Q13A 2I5FA 4HAVB 1U5GA 3V5WA 4ZRKA 4KHOA 1WJMA 1ZVRA 1LB1A 2COFA 1N3HA 3TFMA 4A5KA 2QKLA 2LOZA 2YRYA 1NTYA 2LULA 3N7CA 4ZRIA 4EJNA 3FEHA 5D3WA 3PP2A 2N0YA 1IRSA 2JP2A 3PG7A 3VIAA 2CY4A 2ROZB 3AU5A 2VRWB 3P6AA 2EJ8A 2D9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QQG A;  5C5B A;  1ISN A;  2V76 A;  2VSZ A;  1V89 A;  1X1F A;  3CIK A;  3TCA A;  1DDM A;  2UZS A;  2D9V A;  1U5E A;  4Z2N A;  1I2H A;  4HB0 B;  2RGN B;  1XKE A;  4HB4 B;  1WI1 A;  5C5B B;  1KZG A;  1W1G A;  3PEG A;  5J3Y A;  1B55 A;  2EC1 A;  5DIF B;  4MT7 A;  2OQB A;  3M1I B;  2DFK A;  1UEF A;  1EAZ A;  2YS1 A;  4B6H A;  2RLO A;  3HK0 A;  5J3T A;  2DHI A;  4Z2M B;  5JHH A;  2R0D A;  2W2W A;  2GCJ A;  3O96 A;  1KI1 B;  1QC6 A;  4IOY X;  2PZ1 A;  4L6E A;  3TW1 A;  4CYE A;  2ELA A;  4K81 A;  1XCG A;  4A6K A;  3UZT A;  4P7I A;  1BY1 A;  1GC7 A;  1LW3 A;  3CXB B;  1NI2 A;  2D9X A;  4A6F A;  4HB2 B;  4YL8 A;  1J19 A;  1H4R A;  1P5T A;  2J0J A;  2DYN A;  3MPX A;  1XOD A;  1Y5O A;  2RNR B;  2KCJ A;  2DX1 A;  2DHK A;  1UNR A;  2HE7 A;  1SGH A;  4A6F B;  3KY9 A;  2K00 A;  2YS3 A;  1NU2 A;  4HDO A;  2MFQ A;  4GZU A;  4Y94 A;  3ZDT A;  3TVV A;  2J59 M;  5J3Q A;  1MPH A;  3SUZ A;  2D2Q A;  5DH9 B;  2MDX A;  1W1D A;  2R09 A;  4GMV A;  1UNQ A;  2LYD A;  1WG7 A;  1ZC4 B;  2DHJ A;  1FGZ A;  4H8S A;  5LON B;  1U2B A;  4HAY B;  5KQ4 A;  4HHV A;  5JP4 A;  1FHO A;  2Z0P A;  4IFS A;  1TQZ A;  5C6R A;  2AL6 A;  3BJI A;  1EVH A;  3NSU A;  1TJ6 A;  4KAX B;  3MDB C;  1DDV A;  2M38 A;  5KQ1 A;  3IVF A;  1P6S A;  1DBH A;  3SYX A;  3VOQ A;  2ROV A;  3PVW A;  2J0K A;  1DDW A;  2D10 A;  2P0H A;  3QBV B;  3PVU A;  2VKI A;  3D8F A;  4TYZ A;  1RJ2 A;  1X86 A;  1UPQ A;  2UVM A;  2COD A;  3PZD A;  3SNH A;  2DYQ A;  3KSY A;  2EMT A;  2K2U A;  5HE1 A;  4KHA A;  3ODW A;  3ODX A;  1FOE A;  3ODO A;  2DX5 A;  3X23 A;  2Y8F A;  1MIX A;  2KGX B;  4DXA B;  4IAP A;  1W1H A;  4GN1 A;  4A6H A;  2E2X A;  3WYF B;  4EKU A;  5D3X A;  1UPR A;  2H7D A;  2NZ8 B;  1X05 A;  2L1C A;  3ML4 A;  2Z0Q A;  2FJL A;  1U5F A;  5JHG A;  2DKP A;  3GYO A;  2XQN M;  1EGX A;  1GC6 A;  2KUP A;  3ULC A;  2DLW A;  1TXD A;  1OQN A;  4HAX B;  2AEH A;  1UNP A;  4D0N B;  3U8Z A;  1WJ1 A;  4WJ7 A;  4GXB A;  1EF1 A;  1BTK A;  2BCJ A;  1V5U A;  1DRO A;  2H7E A;  5C79 A;  3ULB A;  2QKM A;  1SHC A;  2L2I A;  1BAK A;  1OY2 A;  2RUK B;  3QIJ A;  2P8V A;  2YSZ A;  1V5P A;  4BBK A;  2G35 A;  1X11 A;  1MKE A;  1FB8 A;  3F5R A;  2Y7B A;  4KHB B;  2GS0 A;  3KRW A;  5CLL B;  2DA0 A;  5FI0 A;  2P0D A;  2X18 A;  4MK0 A;  1M7R A;  2CRF A;  4K2P A;  2YS5 A;  1WGU A;  1V5M A;  2LOX A;  2N23 A;  2Z0O A;  3DXD A;  5D3V A;  1F5X A;  2ELB A;  3WA0 A;  1H10 A;  2YT1 A;  1MK9 B;  1ZSQ A;  1PLS A;  2NMB A;  2YF0 A;  4HDQ A;  3SV1 A;  2P0F A;  2M14 A;  2J0M A;  1KZ7 A;  2LKO A;  1DYN A;  2OTX A;  3GF9 A;  1XR0 B;  1ZM0 A;  2COC A;  5C16 A;  2MWN B;  4CHM A;  2HTH B;  4HAT B;  3F0W A;  3D8D A;  4XWX A;  4HAU B;  1GG3 A;  2DN6 A;  3HW2 B;  4F7G A;  4WVF B;  2GJY A;  2D9W A;  5EFX A;  2LG1 A;  1V88 A;  2D4Q A;  1P3R A;  3T06 A;  1PMS A;  1U5D A;  2IYB A;  4F7H A;  5CLQ B;  4NSW A;  1Q67 A;  2W2X C;  4C0A A;  5JLJ B;  3LJU X;  1RRP B;  4K17 A;  2CAY A;  4D0O A;  4ZRJ A;  2D9Y A;  1FHW A;  1WGQ A;  1AQC A;  5FI1 A;  3KRX A;  3PVL A;  3PSC A;  4NY0 A;  2DTC A;  1M7E A;  2RVB B;  4TKN A;  2YVC A;  3FSS A;  1MIZ B;  1WVH A;  1FGY A;  4YON A;  1XD4 A;  4GYV A;  1K5G B;  2I1K A;  2D11 A;  4K2O A;  3A8P A;  3U7D A;  3EO2 A;  4DX8 A;  3AU4 A;  2ADZ A;  5DHF B;  1E5W A;  4HAZ B;  4PNK A;  3G9W A;  3P7Z A;  4HAW B;  1NTV A;  2EMS A;  2IFS A;  3RCP A;  4GOU A;  4DBB A;  5HE2 A;  4KVG B;  3A8Q A;  3DXC A;  3BIN A;  1OMW A;  2I5C A;  1V61 A;  2Y8G A;  4WSF A;  2YT0 A;  1BTN A;  2K2J A;  1BWN A;  1J0W A;  5KCV A;  5LOP B;  3D8E A;  1MAI A;  3HQC A;  1I7A A;  3JV3 A;  3ZVR A;  4PQ0 A;  2ZPY A;  3OAN A;  3TO1 A;  5HE0 A;  5L81 A;  2UZR A;  1U29 A;  2DKQ A;  1Y19 B;  1PFJ A;  3DXE A;  2KR9 A;  1FHX A;  5HE3 A;  5DI9 B;  1MK7 B;  2GCL A;  2I1J A;  3GYP A;  4CHJ A;  3SO6 A;  1Z87 A;  3A98 B;  4MY6 A;  4DX9 0;  1FAO A;  4GPT B;  5DHA B;  4HB3 B;  2RSG A;  1U27 A;  2W2X D;  4F7U P;  1AWE A;  4EMO A;  3FM8 C;  2MKR A;  1K5D B;  2COA A;  1X1G A;  4GMX B;  1ZC3 B;  5D3Y A;  5GOW B;  2CY5 A;  5D27 A;  3AJ4 A;  3QWM A;  3KZ1 A;  1XX0 A;  2Q13 A;  2I5F A;  4HAV B;  1U5G A;  3V5W A;  4ZRK A;  4KHO A;  1WJM A;  1ZVR A;  1LB1 A;  2COF A;  1N3H A;  3TFM A;  4A5K A;  2QKL A;  2LOZ A;  2YRY A;  1NTY A;  2LUL A;  3N7C A;  4ZRI A;  4EJN A;  3FEH A;  5D3W A;  3PP2 A;  2N0Y A;  1IRS A;  2JP2 A;  3PG7 A;  3VIA A;  2CY4 A;  2ROZ B;  3AU5 A;  2VRW B;  3P6A A;  2EJ8 A;  2D9Z A; 
#chains in the Genus database with same CATH topology
 1QQG A;  5C5B A;  1ISN A;  2V76 A;  2VSZ A;  1V89 A;  1X1F A;  3CIK A;  3TCA A;  1DDM A;  2UZS A;  2D9V A;  1U5E A;  3A58 A;  4Z2N A;  1I2H A;  2R2Y A;  4HB0 B;  2RGN B;  1XKE A;  4HB4 B;  1WI1 A;  3NW8 A;  5C5B B;  1KZG A;  1W1G A;  3PEG A;  5J3Y A;  1B55 A;  5LG4 B;  2EC1 A;  5DIF B;  4MT7 A;  2OQB A;  3M1I B;  2DFK A;  1UEF A;  1EAZ A;  2YS1 A;  4B6H A;  2RLO A;  3HK0 A;  5J3T A;  2DHI A;  4Z2M B;  5JHH A;  2R0D A;  2W2W A;  2GCJ A;  3O96 A;  1KI1 B;  1QC6 A;  4OSN A;  4IOY X;  2PZ1 A;  4L6E A;  3TW1 A;  4CYE A;  2ELA A;  4K81 A;  2KIE A;  1XCG A;  4A6K A;  3UZT A;  3NWF A;  4P7I A;  1BY1 A;  1GC7 A;  1LW3 A;  3CXB B;  1NI2 A;  2D9X A;  4A6F A;  4HB2 B;  4YL8 A;  1J19 A;  1H4R A;  1P5T A;  2J0J A;  2DYN A;  3MPX A;  1XOD A;  1Y5O A;  2RNR B;  2KCJ A;  2DX1 A;  2DHK A;  1UNR A;  2HE7 A;  1SGH A;  4A6F B;  3KY9 A;  2K00 A;  2YS3 A;  1NU2 A;  4HDO A;  2MFQ A;  4GZU A;  4Y94 A;  2FJU B;  2RRF A;  3ZDT A;  3TVV A;  2J59 M;  5J3Q A;  1MPH A;  3SUZ A;  2D2Q A;  5DH9 B;  2MDX A;  1W1D A;  2R09 A;  4GMV A;  1UNQ A;  2LYD A;  1WG7 A;  1ZC4 B;  5I2S A;  2DHJ A;  1FGZ A;  4H8S A;  5LON B;  1U2B A;  4HAY B;  5KQ4 A;  4HHV A;  5JP4 A;  1FHO A;  2Z0P A;  4IFS A;  1TQZ A;  5C6R A;  2AL6 A;  3BJI A;  1EVH A;  3NSU A;  1TJ6 A;  4KAX B;  3MDB C;  1DDV A;  2M38 A;  5KQ1 A;  3IVF A;  1ZYI A;  1P6S A;  1DBH A;  3SYX A;  3VOQ A;  2ROV A;  3PVW A;  2J0K A;  1DDW A;  2D10 A;  2P0H A;  3QBV B;  3PVU A;  2VKI A;  3OHM B;  3D8F A;  2Z13 A;  1RJ2 A;  1X86 A;  4TYZ A;  3HSA A;  1UPQ A;  2UVM A;  2COD A;  3PZD A;  3SNH A;  2DYQ A;  3KSY A;  2EMT A;  2K2U A;  5HE1 A;  4KHA A;  3ODW A;  3ODX A;  1FOE A;  3ODO A;  2DX5 A;  3X23 A;  2Y8F A;  1MIX A;  2KGX B;  4DXA B;  4IAP A;  1W1H A;  4GN1 A;  4A6H A;  4CSQ A;  2E2X A;  2ZKM X;  3WYF B;  4EKU A;  5D3X A;  1UPR A;  3NWA A;  2H7D A;  2NZ8 B;  1X05 A;  2L1C A;  3ML4 A;  2Z0Q A;  2FJL A;  1U5F A;  5JHG A;  2DKP A;  5I2M A;  3GYO A;  2XQN M;  1EGX A;  1GC6 A;  2KUP A;  3ULC A;  2DLW A;  1TXD A;  1OQN A;  4HAX B;  2AEH A;  1UNP A;  4D0N B;  3U8Z A;  1WJ1 A;  4WJ7 A;  4GXB A;  1EF1 A;  1BTK A;  2BCJ A;  1V5U A;  2KR0 A;  1DRO A;  2H7E A;  5C79 A;  2K8E A;  3ULB A;  2QKM A;  1SHC A;  2L2I A;  1BAK A;  4KHB A;  1OY2 A;  2NBV A;  5M4Y B;  5IRS A;  2RUK B;  3QIJ A;  2P8V A;  2YSZ A;  1V5P A;  4BBK A;  2G35 A;  1X11 A;  1MKE A;  1FB8 A;  3F5R A;  1T77 A;  2Y7B A;  4KHB B;  2GS0 A;  3KRW A;  5CLL B;  2DA0 A;  5FI0 A;  2P0D A;  2X18 A;  4MK0 A;  1M7R A;  2CRF A;  4K2P A;  2YS5 A;  1WGU A;  1V5M A;  2LOX A;  2N23 A;  4DIX A;  2Z0O A;  3DXD A;  5D3V A;  1F5X A;  2ELB A;  3WA0 A;  1H10 A;  2YT1 A;  4QJ4 B;  1MK9 B;  1ZSQ A;  1PLS A;  2NMB A;  2YF0 A;  4HDQ A;  3SV1 A;  2P0F A;  2M14 A;  2J0M A;  1KZ7 A;  2LKO A;  1DYN A;  2OTX A;  3GF9 A;  1XR0 B;  1ZM0 A;  2COC A;  5C16 A;  4L1R A;  2MWN B;  4CHM A;  2HTH B;  4HAT B;  3F0W A;  3D8D A;  4XWX A;  4HAU B;  1GG3 A;  2DN6 A;  3HW2 B;  4F7G A;  4WVF B;  2GJY A;  2D9W A;  5EFX A;  2LG1 A;  1V88 A;  2D4Q A;  1P3R A;  3T06 A;  1PMS A;  1U5D A;  2YT2 A;  2IYB A;  4F7H A;  5CLQ B;  4NSW A;  1Q67 A;  2W2X C;  4C0A A;  5JLJ B;  3LJU X;  1RRP B;  4K17 A;  2CAY A;  4D0O A;  4ZRJ A;  2D9Y A;  1FHW A;  1WGQ A;  1AQC A;  5FI1 A;  3KRX A;  3PVL A;  3PSC A;  4NY0 A;  2DTC A;  1M7E A;  2RVB B;  4TKN A;  2YVC A;  3FSS A;  1MIZ B;  1WVH A;  1FGY A;  4YON A;  1MI1 A;  1XD4 A;  4GYV A;  4GNK B;  1K5G B;  2I1K A;  2D11 A;  4K2O A;  3A8P A;  3U7D A;  3EO2 A;  4DX8 A;  3AU4 A;  2ADZ A;  5DHF B;  1E5W A;  4HAZ B;  4PNK A;  3G9W A;  3P7Z A;  4HAW B;  1NTV A;  3HIE A;  2EMS A;  2IFS A;  3NWD A;  3RCP A;  4GOU A;  4DBB A;  3B77 A;  4D6W A;  3U12 A;  5HE2 A;  4KVG B;  3A8Q A;  3DXC A;  3BIN A;  1OMW A;  2I5C A;  1V61 A;  2K49 A;  2Y8G A;  2KIG A;  4WSF A;  2YT0 A;  1BTN A;  2K2J A;  1BWN A;  1J0W A;  5KCV A;  5LOP B;  2KUQ A;  3D8E A;  1MAI A;  3FVC A;  3HQC A;  1I7A A;  3JV3 A;  3ZVR A;  4PQ0 A;  2ZPY A;  3OAN A;  3TO1 A;  5HE0 A;  5L81 A;  2UZR A;  1U29 A;  2Z4D A;  2DKQ A;  1Y19 B;  1PFJ A;  3DXE A;  2KR9 A;  1FHX A;  5HE3 A;  5DI9 B;  1MK7 B;  2GCL A;  2I1J A;  3GYP A;  4OT1 A;  4CHJ A;  3SO6 A;  4HSI A;  1Z87 A;  3A98 B;  4MY6 A;  4DX9 0;  1FAO A;  4GPT B;  5DHA B;  4HB3 B;  2RSG A;  1U27 A;  2W2X D;  4F7U P;  1AWE A;  4EMO A;  3FM8 C;  2MKR A;  1K5D B;  2COA A;  1X1G A;  4GMX B;  1ZC3 B;  5D3Y A;  5GOW B;  2CY5 A;  4QJ5 B;  5D27 A;  3AJ4 A;  3QWM A;  3KZ1 A;  1XX0 A;  2Q13 A;  2I5F A;  4HAV B;  2Z14 A;  1U5G A;  3V5W A;  4ZRK A;  4KHO A;  1WJM A;  1ZVR A;  1LB1 A;  4QXA B;  2COF A;  1N3H A;  3TFM A;  4A5K A;  2QKL A;  2GUM A;  2LOZ A;  2YRY A;  1NTY A;  2LUL A;  3N7C A;  4ZRI A;  4EJN A;  3FEH A;  5D3W A;  2Z59 A;  3DCX A;  3PP2 A;  4QJ3 B;  2N0Y A;  1IRS A;  2JP2 A;  3PG7 A;  3VIA A;  2CY4 A;  2ROZ B;  3AU5 A;  2VRW B;  3P6A A;  2EJ8 A;  2D9Z A; 
#chains in the Genus database with same CATH homology
 1QQG A;  5C5B A;  1ISN A;  2V76 A;  2VSZ A;  1V89 A;  1X1F A;  3CIK A;  3TCA A;  1DDM A;  2UZS A;  2D9V A;  1U5E A;  4Z2N A;  1I2H A;  4HB0 B;  2RGN B;  1XKE A;  4HB4 B;  1WI1 A;  5C5B B;  1KZG A;  1W1G A;  3PEG A;  5J3Y A;  1B55 A;  2EC1 A;  5DIF B;  4MT7 A;  2OQB A;  3M1I B;  2DFK A;  1UEF A;  1EAZ A;  2YS1 A;  4B6H A;  2RLO A;  3HK0 A;  5J3T A;  2DHI A;  4Z2M B;  5JHH A;  2R0D A;  2W2W A;  2GCJ A;  3O96 A;  1KI1 B;  1QC6 A;  4IOY X;  2PZ1 A;  4L6E A;  3TW1 A;  4CYE A;  2ELA A;  4K81 A;  1XCG A;  4A6K A;  3UZT A;  4P7I A;  1BY1 A;  1GC7 A;  1LW3 A;  3CXB B;  1NI2 A;  2D9X A;  4A6F A;  4HB2 B;  4YL8 A;  1J19 A;  1H4R A;  1P5T A;  2J0J A;  2DYN A;  3MPX A;  1XOD A;  1Y5O A;  2RNR B;  2KCJ A;  2DX1 A;  2DHK A;  1UNR A;  2HE7 A;  1SGH A;  4A6F B;  3KY9 A;  2K00 A;  2YS3 A;  1NU2 A;  4HDO A;  2MFQ A;  4GZU A;  4Y94 A;  3ZDT A;  3TVV A;  2J59 M;  5J3Q A;  1MPH A;  3SUZ A;  2D2Q A;  5DH9 B;  2MDX A;  1W1D A;  2R09 A;  4GMV A;  1UNQ A;  2LYD A;  1WG7 A;  1ZC4 B;  2DHJ A;  1FGZ A;  4H8S A;  5LON B;  1U2B A;  4HAY B;  5KQ4 A;  4HHV A;  5JP4 A;  1FHO A;  2Z0P A;  4IFS A;  1TQZ A;  5C6R A;  2AL6 A;  3BJI A;  1EVH A;  3NSU A;  1TJ6 A;  4KAX B;  3MDB C;  1DDV A;  2M38 A;  5KQ1 A;  3IVF A;  1P6S A;  1DBH A;  3SYX A;  3VOQ A;  2ROV A;  3PVW A;  2J0K A;  1DDW A;  2D10 A;  2P0H A;  3QBV B;  3PVU A;  2VKI A;  3D8F A;  4TYZ A;  1RJ2 A;  1X86 A;  1UPQ A;  2UVM A;  2COD A;  3PZD A;  3SNH A;  2DYQ A;  3KSY A;  2EMT A;  2K2U A;  5HE1 A;  4KHA A;  3ODW A;  3ODX A;  1FOE A;  3ODO A;  2DX5 A;  3X23 A;  2Y8F A;  1MIX A;  2KGX B;  4DXA B;  4IAP A;  1W1H A;  4GN1 A;  4A6H A;  2E2X A;  3WYF B;  4EKU A;  5D3X A;  1UPR A;  2H7D A;  2NZ8 B;  1X05 A;  2L1C A;  3ML4 A;  2Z0Q A;  2FJL A;  1U5F A;  5JHG A;  2DKP A;  3GYO A;  2XQN M;  1EGX A;  1GC6 A;  2KUP A;  3ULC A;  2DLW A;  1TXD A;  1OQN A;  4HAX B;  2AEH A;  1UNP A;  4D0N B;  3U8Z A;  1WJ1 A;  4WJ7 A;  4GXB A;  1EF1 A;  1BTK A;  2BCJ A;  1V5U A;  1DRO A;  2H7E A;  5C79 A;  3ULB A;  2QKM A;  1SHC A;  2L2I A;  1BAK A;  1OY2 A;  2RUK B;  3QIJ A;  2P8V A;  2YSZ A;  1V5P A;  4BBK A;  2G35 A;  1X11 A;  1MKE A;  1FB8 A;  3F5R A;  2Y7B A;  4KHB B;  2GS0 A;  3KRW A;  5CLL B;  2DA0 A;  5FI0 A;  2P0D A;  2X18 A;  4MK0 A;  1M7R A;  2CRF A;  4K2P A;  2YS5 A;  1WGU A;  1V5M A;  2LOX A;  2N23 A;  2Z0O A;  3DXD A;  5D3V A;  1F5X A;  2ELB A;  3WA0 A;  1H10 A;  2YT1 A;  1MK9 B;  1ZSQ A;  1PLS A;  2NMB A;  2YF0 A;  4HDQ A;  3SV1 A;  2P0F A;  2M14 A;  2J0M A;  1KZ7 A;  2LKO A;  1DYN A;  2OTX A;  3GF9 A;  1XR0 B;  1ZM0 A;  2COC A;  5C16 A;  2MWN B;  4CHM A;  2HTH B;  4HAT B;  3F0W A;  3D8D A;  4XWX A;  4HAU B;  1GG3 A;  2DN6 A;  3HW2 B;  4F7G A;  4WVF B;  2GJY A;  2D9W A;  5EFX A;  2LG1 A;  1V88 A;  2D4Q A;  1P3R A;  3T06 A;  1PMS A;  1U5D A;  2IYB A;  4F7H A;  5CLQ B;  4NSW A;  1Q67 A;  2W2X C;  4C0A A;  5JLJ B;  3LJU X;  1RRP B;  4K17 A;  2CAY A;  4D0O A;  4ZRJ A;  2D9Y A;  1FHW A;  1WGQ A;  1AQC A;  5FI1 A;  3KRX A;  3PVL A;  3PSC A;  4NY0 A;  2DTC A;  1M7E A;  2RVB B;  4TKN A;  2YVC A;  3FSS A;  1MIZ B;  1WVH A;  1FGY A;  4YON A;  1XD4 A;  4GYV A;  1K5G B;  2I1K A;  2D11 A;  4K2O A;  3A8P A;  3U7D A;  3EO2 A;  4DX8 A;  3AU4 A;  2ADZ A;  5DHF B;  1E5W A;  4HAZ B;  4PNK A;  3G9W A;  3P7Z A;  4HAW B;  1NTV A;  2EMS A;  2IFS A;  3RCP A;  4GOU A;  4DBB A;  5HE2 A;  4KVG B;  3A8Q A;  3DXC A;  3BIN A;  1OMW A;  2I5C A;  1V61 A;  2Y8G A;  4WSF A;  2YT0 A;  1BTN A;  2K2J A;  1BWN A;  1J0W A;  5KCV A;  5LOP B;  3D8E A;  1MAI A;  3HQC A;  1I7A A;  3JV3 A;  3ZVR A;  4PQ0 A;  2ZPY A;  3OAN A;  3TO1 A;  5HE0 A;  5L81 A;  2UZR A;  1U29 A;  2DKQ A;  1Y19 B;  1PFJ A;  3DXE A;  2KR9 A;  1FHX A;  5HE3 A;  5DI9 B;  1MK7 B;  2GCL A;  2I1J A;  3GYP A;  4CHJ A;  3SO6 A;  1Z87 A;  3A98 B;  4MY6 A;  4DX9 0;  1FAO A;  4GPT B;  5DHA B;  4HB3 B;  2RSG A;  1U27 A;  2W2X D;  4F7U P;  1AWE A;  4EMO A;  3FM8 C;  2MKR A;  1K5D B;  2COA A;  1X1G A;  4GMX B;  1ZC3 B;  5D3Y A;  5GOW B;  2CY5 A;  5D27 A;  3AJ4 A;  3QWM A;  3KZ1 A;  1XX0 A;  2Q13 A;  2I5F A;  4HAV B;  1U5G A;  3V5W A;  4ZRK A;  4KHO A;  1WJM A;  1ZVR A;  1LB1 A;  2COF A;  1N3H A;  3TFM A;  4A5K A;  2QKL A;  2LOZ A;  2YRY A;  1NTY A;  2LUL A;  3N7C A;  4ZRI A;  4EJN A;  3FEH A;  5D3W A;  3PP2 A;  2N0Y A;  1IRS A;  2JP2 A;  3PG7 A;  3VIA A;  2CY4 A;  2ROZ B;  3AU5 A;  2VRW B;  3P6A A;  2EJ8 A;  2D9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...