1NTYA

Crystal structure of the first dh/ph domain of trio to 1.7 a
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
305
structure length
305
Chain Sequence
ARRKEFIMAELIQTEKAYVRDLRECMDTYLWEMTSGVEEIPPGIVNKELIIFGNMQEIYEFHNNIFLKELEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKPDSTQLILEHAGSYFDEIQQRHGLANSISSYLIKPVQRITKYQLLLKELLTCCEEGKGEIKDGLEVMLSVPKRANDAMHLSMLEGFDENIESQGELILQESFQVWDPKTLIRKGRERHLFLFEMSLVFSKEVKDSSGRSKYLYKSKLFTSELGVTEHVEGDPCKFALWVGRTPTSDNKIVLKASSIENKQDWIKHIREVIQERT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Triple functional domain protein
publication title The C-terminal basic tail of RhoG assists the guanine nucleotide exchange factor trio in binding to phospholipids.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 111
structure length 305
sequence length 305
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00621 RhoGEF RhoGEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 1ntyA01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1ntyA02
5JLJB 3HK0A 3A98B 4A5KA 4EKUA 3ODXA 1PMSA 1WJMA 2K2UA 2E2XA 1XCGA 1TJ6A 3AU5A 4MK0A 2COAA 2DFKA 1U2BA 5JHHA 3U7DA 1U5FA 1MPHA 4CHJA 2VKIA 3SYXA 1OMWA 2YF0A 1V61A 5C79A 1MAIA 2J0KA 2LOXA 1U5DA 5J3TA 2RSGA 1M7EA 1I2HA 1OQNA 2UZRA 2N0YA 1UEFA 3FM8C 3QWMA 2M14A 5C5BA 4DXAB 2YVCA 1Z87A 2DKPA 5LONB 2Y8GA 4HB2B 1BY1A 1AQCA 1GG3A 3FEHA 1LW3A 2DHJA 1TXDA 2W2WA 2ELAA 3KZ1A 5J3YA 5D3YA 3TCAA 3ODOA 3WYFB 1KZGA 4A6FA 1LB1A 1W1GA 4TKNA 1BTNA 4NSWA 4GOUA 5FI1A 2W2XD 1SGHA 3NSUA 2I1KA 4TYZA 1BAKA 1SHCA 4ZRIA 4Z2NA 2UVMA 2KCJA 2Z0OA 4GPTB 4ZRKA 4L6EA 3SUZA 1Y19B 5DHAB 4K81A 1MKEA 2YRYA 1J19A 4H8SA 4K17A 2IYBA 1UPQA 3KRWA 5HE1A 1MIXA 3QBVB 4PNKA 3ULBA 2I5CA 2KGXB 2DYQA 2GCLA 3MPXA 2K00A 2D2QA 1TQZA 4KHOA 3A8QA 2P0FA 2J0MA 5HE2A 1PLSA 3PVWA 1FHWA 2LYDA 2HE7A 4KAXB 1FHXA 5DH9B 1EAZA 2DX1A 2LULA 2CRFA 1F5XA 1BTKA 1ZVRA 2UZSA 4HHVA 4HAXB 3WA0A 1NTYA 4HAZB 1ZC4B 1M7RA 3VOQA 1DBHA 2L1CA 2BCJA 3PP2A 2MKRA 2QKMA 2DHKA 1X1GA 2COFA 1XODA 4HAWB 1P3RA 1MK9B 2EMSA 3IVFA 5KCVA 1I7AA 3ULCA 1FOEA 1MK7B 3HQCA 2FJLA 2DTCA 3CXBB 4KHAA 2H7EA 2H7DA 3MDBC 2RVBB 2YS5A 3AU4A 1ZSQA 3D8EA 1AWEA 1QQGA 2KR9A 3ML4A 1NTVA 1DDVA 1P6SA 2D9VA 4YONA 5EFXA 1WGQA 1RRPB 5D3VA 2ROZB 5GOWB 5DHFB 1J0WA 3DXCA 4HAYB 5HE0A 3AJ4A 1EVHA 1XR0B 2R0DA 1XKEA 2RLOA 3ZVRA 4WSFA 3GYPA 1BWNA 2EJ8A 3TFMA 1XD4A 1V5MA 2DLWA 1U29A 2EMTA 1WJ1A 3V5WA 2V76A 2D4QA 3PEGA 3ZDTA 1W1HA 2LKOA 3F0WA 2OTXA 2IFSA 2CODA 1PFJA 2R09A 3PZDA 4DX8A 1WG7A 4EJNA 5KQ1A 1N3HA 2Y8FA 2RNRB 1B55A 2P0DA 2AL6A 2N23A 4PQ0A 3PG7A 1Y5OA 4ZRJA 2QKLA 2VRWB 3O96A 2MFQA 4A6HA 1WVHA 3RCPA 1W1DA 3FSSA 1MIZB 4GYVA 3QIJA 4KHBB 2CAYA 4A6KA 5DIFB 2CY4A 1KI1B 4IOYX 2J59M 2P0HA 2LG1A 3PSCA 1DDMA 4F7GA 1U5EA 2DA0A 2DYNA 3KY9A 4K2PA 2J0JA 5JHGA 2Q13A 4KVGB 1U5GA 4F7HA 1DROA 1FB8A 2YT1A 4NY0A 2DN6A 1V5PA 1ZC3B 1Q67A 3D8FA 2PZ1A 4CYEA 1WGUA 2W2XC 3OANA 1GC7A 3UZTA 3TO1A 5L81A 3SNHA 2YS3A 2HTHB 5LOPB 1V5UA 1OY2A 2YS1A 2XQNM 1V88A 2M38A 1X11A 1X1FA 1WI1A 2G35A 3KRXA 5KQ4A 3TW1A 5FI0A 2NMBA 2D9ZA 4WVFB 3JV3A 4B6HA 2LOZA 1UNQA 3D8DA 1IRSA 1ISNA 1U27A 2Y7BA 1V89A 3GYOA 4HAUB 2MDXA 4HB4B 3P6AA 2DHIA 2P8VA 5D3XA 1NI2A 4HATB 1K5DB 2OQBA 4Y94A 4MY6A 1KZ7A 5HE3A 1P5TA 5J3QA 4D0NB 3X23A 4BBKA 4XWXA 4DBBA 1QC6A 2DX5A 3TVVA 4D0OA 3ODWA 2Z0PA 3DXEA 2RGNB 4HB3B 4GN1A 2L2IA 1FAOA 1X05A 2DKQA 4GMVA 4IAPA 1DDWA 1FGZA 2KUPA 3BINA 4HB0B 2GCJA 1NU2A 3GF9A 3PVUA 4C0AA 1E5WA 4Z2MB 3EO2A 5C6RA 4HDOA 3VIAA 3A8PA 1H10A 2D10A 2GS0A 2MWNB 3CIKA 2I1JA 3P7ZA 3HW2B 5C16A 4MT7A 1GC6A 2COCA 4F7UP 4GZUA 2D9WA 1H4RA 2YT0A 2YSZA 4IFSA 4HDQA 1FGYA 3U8ZA 2JP2A 2D11A 1DYNA 2EC1A 2AEHA 2VSZA 5C5BB 3SO6A 1XX0A 1UPRA 2ROVA 5D3WA 5JP4A 3M1IB 5CLLB 5CLQB 3KSYA 3G9WA 1UNPA 1ZM0A 3DXDA 3F5RA 1UNRA 2I5FA 4K2OA 4EMOA 2D9XA 3LJUX 3PVLA 4YL8A 2Z0QA 1FHOA 1X86A 2NZ8B 2ELBA 1EGXA 2D9YA 4WJ7A 4A6FB 2ADZA 5D27A 4DX90 1EF1A 2GJYA 4GXBA 4CHMA 1RJ2A 2CY5A 2K2JA 1K5GB 4HAVB 3T06A 3N7CA 3SV1A 5DI9B 4P7IA 2RUKB 2ZPYA 4GMXB 3BJIA 2X18A
chains in the Genus database with same CATH superfamily
5JLJB 3HK0A 5LG4B 3A98B 4A5KA 4EKUA 3ODXA 1PMSA 1WJMA 2K2UA 2E2XA 1XCGA 1TJ6A 3AU5A 4MK0A 2COAA 2DFKA 1U2BA 5JHHA 3U7DA 1U5FA 5IRSA 1MPHA 4OT1A 4HSIA 4CHJA 2VKIA 3SYXA 1OMWA 2YF0A 1V61A 5C79A 1MAIA 2J0KA 3HIEA 4GNKB 2LOXA 1U5DA 5J3TA 2RSGA 1M7EA 1I2HA 1OQNA 2UZRA 2N0YA 1UEFA 3FM8C 3QWMA 2M14A 5C5BA 4DXAB 3DCXA 2YVCA 1Z87A 2DKPA 5LONB 2Y8GA 4HB2B 1BY1A 1AQCA 1GG3A 3FEHA 2YT2A 1LW3A 2DHJA 1TXDA 2W2WA 2ELAA 3KZ1A 5J3YA 5D3YA 3TCAA 3ODOA 3WYFB 1KZGA 4A6FA 1LB1A 1W1GA 4TKNA 1BTNA 4NSWA 4GOUA 5FI1A 5I2MA 2W2XD 1SGHA 4DIXA 3NSUA 2I1KA 4TYZA 1BAKA 1SHCA 4ZRIA 4Z2NA 1ZYIA 2UVMA 2KCJA 2Z0OA 4GPTB 4QJ3B 4ZRKA 4L6EA 3SUZA 1Y19B 5DHAB 4K81A 1MKEA 2YRYA 1J19A 4H8SA 4K17A 2IYBA 1UPQA 3KRWA 5HE1A 1MIXA 3QBVB 4PNKA 3ULBA 2I5CA 2KGXB 2DYQA 2GCLA 3MPXA 2K00A 2D2QA 1TQZA 4KHOA 3A8QA 2P0FA 2J0MA 5HE2A 2K49A 1PLSA 3PVWA 1FHWA 2LYDA 2HE7A 4KAXB 1FHXA 5DH9B 1EAZA 4QJ4B 2DX1A 2LULA 2CRFA 1F5XA 1BTKA 1ZVRA 2UZSA 4HHVA 4HAXB 3WA0A 1NTYA 4HAZB 1ZC4B 1M7RA 3VOQA 1DBHA 2L1CA 2BCJA 3PP2A 2MKRA 2QKMA 2DHKA 1X1GA 2COFA 1XODA 4HAWB 1P3RA 3NW8A 1MK9B 2FJUB 2EMSA 3IVFA 2R2YA 5KCVA 1I7AA 3ULCA 1FOEA 1MK7B 3OHMB 3HQCA 2FJLA 2DTCA 3CXBB 4KHAA 2H7EA 2H7DA 3MDBC 2RVBB 2YS5A 3AU4A 1ZSQA 2RRFA 3D8EA 2GUMA 1AWEA 1QQGA 2KR9A 3ML4A 1NTVA 1DDVA 1P6SA 2D9VA 4YONA 4L1RA 2K8EA 5EFXA 1WGQA 1RRPB 5D3VA 2ROZB 5GOWB 5DHFB 3NWAA 1J0WA 2KIGA 5I2SA 3DXCA 4HAYB 5HE0A 3AJ4A 1EVHA 1XR0B 2R0DA 1XKEA 2RLOA 3ZVRA 4WSFA 3GYPA 1BWNA 2EJ8A 3TFMA 2KUQA 1XD4A 1V5MA 2DLWA 2Z59A 1U29A 2EMTA 1WJ1A 2NBVA 3V5WA 2V76A 2D4QA 3PEGA 3ZDTA 1W1HA 2LKOA 3F0WA 2OTXA 2IFSA 2CODA 3NWDA 1PFJA 2R09A 3PZDA 4DX8A 1WG7A 4EJNA 5KQ1A 1N3HA 2Y8FA 2RNRB 1B55A 2P0DA 2AL6A 2N23A 4PQ0A 4CSQA 3PG7A 1Y5OA 5M4YB 4ZRJA 2QKLA 2VRWB 3FVCA 3O96A 2MFQA 4A6HA 1WVHA 3RCPA 1W1DA 3FSSA 1MIZB 4GYVA 3QIJA 2Z14A 2CAYA 4KHBB 4A6KA 5DIFB 2CY4A 1KI1B 4IOYX 2J59M 2P0HA 2LG1A 3PSCA 1DDMA 4F7GA 3NWFA 1U5EA 2DA0A 2DYNA 3KY9A 4K2PA 2J0JA 5JHGA 2Q13A 4QJ5B 4KVGB 1U5GA 4F7HA 1DROA 1FB8A 2YT1A 4NY0A 2DN6A 1V5PA 1ZC3B 1Q67A 3D8FA 2PZ1A 4CYEA 1WGUA 2W2XC 3A58A 3OANA 1GC7A 4OSNA 3UZTA 3TO1A 5L81A 2ZKMX 3SNHA 2YS3A 2HTHB 5LOPB 1V5UA 1OY2A 2YS1A 2XQNM 1V88A 2M38A 1X11A 1X1FA 1WI1A 2G35A 3KRXA 5KQ4A 3TW1A 5FI0A 2NMBA 2D9ZA 4WVFB 3JV3A 4B6HA 2LOZA 1UNQA 3D8DA 1IRSA 1ISNA 1U27A 2Y7BA 1V89A 3GYOA 4HAUB 2MDXA 4HB4B 3P6AA 2DHIA 2P8VA 5D3XA 1NI2A 4HATB 1K5DB 2OQBA 4Y94A 4MY6A 1KZ7A 5HE3A 1P5TA 5J3QA 4D0NB 3X23A 4BBKA 4XWXA 4DBBA 3HSAA 1QC6A 2DX5A 2Z13A 3TVVA 4D0OA 4QXAB 3ODWA 2Z0PA 3DXEA 2RGNB 4HB3B 4GN1A 2L2IA 4KHBA 1FAOA 1X05A 2DKQA 4GMVA 4IAPA 1DDWA 1FGZA 2KUPA 3BINA 4HB0B 2GCJA 1NU2A 3GF9A 3PVUA 4C0AA 1E5WA 4Z2MB 3EO2A 5C6RA 4HDOA 3VIAA 3A8PA 1H10A 2D10A 2GS0A 2MWNB 3CIKA 2I1JA 3P7ZA 3HW2B 1MI1A 4MT7A 5C16A 1GC6A 2COCA 4F7UP 4GZUA 2D9WA 1H4RA 2YT0A 4D6WA 2YSZA 4IFSA 4HDQA 1FGYA 3U8ZA 2JP2A 2D11A 1DYNA 1T77A 2EC1A 2AEHA 2Z4DA 2VSZA 5C5BB 3SO6A 1XX0A 1UPRA 2ROVA 5D3WA 5JP4A 3B77A 3M1IB 5CLLB 5CLQB 3KSYA 3G9WA 1UNPA 1ZM0A 3DXDA 3F5RA 1UNRA 2I5FA 4K2OA 4EMOA 2D9XA 2KR0A 3LJUX 3PVLA 4YL8A 2KIEA 2Z0QA 1FHOA 1X86A 2NZ8B 2ELBA 1EGXA 2D9YA 4WJ7A 4A6FB 2ADZA 5D27A 4DX90 1EF1A 2GJYA 4GXBA 4CHMA 1RJ2A 2CY5A 2K2JA 1K5GB 4HAVB 3T06A 3N7CA 3SV1A 5DI9B 4P7IA 3U12A 2RUKB 2ZPYA 4GMXB 3BJIA 2X18A
chains in the Genus database with same CATH topology
5JLJB 3HK0A 3A98B 4A5KA 4EKUA 3ODXA 1PMSA 1WJMA 2K2UA 2E2XA 1XCGA 1TJ6A 3AU5A 4MK0A 2COAA 2DFKA 1U2BA 5JHHA 3U7DA 1U5FA 1MPHA 4CHJA 2VKIA 3SYXA 1OMWA 2YF0A 1V61A 5C79A 1MAIA 2J0KA 2LOXA 1U5DA 5J3TA 2RSGA 1M7EA 1I2HA 1OQNA 2UZRA 2N0YA 1UEFA 3FM8C 3QWMA 2M14A 5C5BA 4DXAB 2YVCA 1Z87A 2DKPA 5LONB 2Y8GA 4HB2B 1BY1A 1AQCA 1GG3A 3FEHA 1LW3A 2DHJA 1TXDA 2W2WA 2ELAA 3KZ1A 5J3YA 5D3YA 3TCAA 3ODOA 3WYFB 1KZGA 4A6FA 1LB1A 1W1GA 4TKNA 1BTNA 4NSWA 4GOUA 5FI1A 2W2XD 1SGHA 3NSUA 2I1KA 4TYZA 1BAKA 1SHCA 4ZRIA 4Z2NA 2UVMA 2KCJA 2Z0OA 4GPTB 4ZRKA 4L6EA 3SUZA 1Y19B 5DHAB 4K81A 1MKEA 2YRYA 1J19A 4H8SA 4K17A 2IYBA 1UPQA 3KRWA 5HE1A 1MIXA 3QBVB 4PNKA 3ULBA 2I5CA 2KGXB 2DYQA 2GCLA 3MPXA 2K00A 2D2QA 1TQZA 4KHOA 3A8QA 2P0FA 2J0MA 5HE2A 1PLSA 3PVWA 1FHWA 2LYDA 2HE7A 4KAXB 1FHXA 5DH9B 1EAZA 2DX1A 2LULA 2CRFA 1F5XA 1BTKA 1ZVRA 2UZSA 4HHVA 4HAXB 3WA0A 1NTYA 4HAZB 1ZC4B 1M7RA 3VOQA 1DBHA 2L1CA 2BCJA 3PP2A 2MKRA 2QKMA 2DHKA 1X1GA 2COFA 1XODA 4HAWB 1P3RA 1MK9B 2EMSA 3IVFA 5KCVA 1I7AA 3ULCA 1FOEA 1MK7B 3HQCA 2FJLA 2DTCA 3CXBB 4KHAA 2H7EA 2H7DA 3MDBC 2RVBB 2YS5A 3AU4A 1ZSQA 3D8EA 1AWEA 1QQGA 2KR9A 3ML4A 1NTVA 1DDVA 1P6SA 2D9VA 4YONA 5EFXA 1WGQA 1RRPB 5D3VA 2ROZB 5GOWB 5DHFB 1J0WA 3DXCA 4HAYB 5HE0A 3AJ4A 1EVHA 1XR0B 2R0DA 1XKEA 2RLOA 3ZVRA 4WSFA 3GYPA 1BWNA 2EJ8A 3TFMA 1XD4A 1V5MA 2DLWA 1U29A 2EMTA 1WJ1A 3V5WA 2V76A 2D4QA 3PEGA 3ZDTA 1W1HA 2LKOA 3F0WA 2OTXA 2IFSA 2CODA 1PFJA 2R09A 3PZDA 4DX8A 1WG7A 4EJNA 5KQ1A 1N3HA 2Y8FA 2RNRB 1B55A 2P0DA 2AL6A 2N23A 4PQ0A 3PG7A 1Y5OA 4ZRJA 2QKLA 2VRWB 3O96A 2MFQA 4A6HA 1WVHA 3RCPA 1W1DA 3FSSA 1MIZB 4GYVA 3QIJA 4KHBB 2CAYA 4A6KA 5DIFB 2CY4A 1KI1B 4IOYX 2J59M 2P0HA 2LG1A 3PSCA 1DDMA 4F7GA 1U5EA 2DA0A 2DYNA 3KY9A 4K2PA 2J0JA 5JHGA 2Q13A 4KVGB 1U5GA 4F7HA 1DROA 1FB8A 2YT1A 4NY0A 2DN6A 1V5PA 1ZC3B 1Q67A 3D8FA 2PZ1A 4CYEA 1WGUA 2W2XC 3OANA 1GC7A 3UZTA 3TO1A 5L81A 3SNHA 2YS3A 2HTHB 5LOPB 1V5UA 1OY2A 2YS1A 2XQNM 1V88A 2M38A 1X11A 1X1FA 1WI1A 2G35A 3KRXA 5KQ4A 3TW1A 5FI0A 2NMBA 2D9ZA 4WVFB 3JV3A 4B6HA 2LOZA 1UNQA 3D8DA 1IRSA 1ISNA 1U27A 2Y7BA 1V89A 3GYOA 4HAUB 2MDXA 4HB4B 3P6AA 2DHIA 2P8VA 5D3XA 1NI2A 4HATB 1K5DB 2OQBA 4Y94A 4MY6A 1KZ7A 5HE3A 1P5TA 5J3QA 4D0NB 3X23A 4BBKA 4XWXA 4DBBA 1QC6A 2DX5A 3TVVA 4D0OA 3ODWA 2Z0PA 3DXEA 2RGNB 4HB3B 4GN1A 2L2IA 1FAOA 1X05A 2DKQA 4GMVA 4IAPA 1DDWA 1FGZA 2KUPA 3BINA 4HB0B 2GCJA 1NU2A 3GF9A 3PVUA 4C0AA 1E5WA 4Z2MB 3EO2A 5C6RA 4HDOA 3VIAA 3A8PA 1H10A 2D10A 2GS0A 2MWNB 3CIKA 2I1JA 3P7ZA 3HW2B 5C16A 4MT7A 1GC6A 2COCA 4F7UP 4GZUA 2D9WA 1H4RA 2YT0A 2YSZA 4IFSA 4HDQA 1FGYA 3U8ZA 2JP2A 2D11A 1DYNA 2EC1A 2AEHA 2VSZA 5C5BB 3SO6A 1XX0A 1UPRA 2ROVA 5D3WA 5JP4A 3M1IB 5CLLB 5CLQB 3KSYA 3G9WA 1UNPA 1ZM0A 3DXDA 3F5RA 1UNRA 2I5FA 4K2OA 4EMOA 2D9XA 3LJUX 3PVLA 4YL8A 2Z0QA 1FHOA 1X86A 2NZ8B 2ELBA 1EGXA 2D9YA 4WJ7A 4A6FB 2ADZA 5D27A 4DX90 1EF1A 2GJYA 4GXBA 4CHMA 1RJ2A 2CY5A 2K2JA 1K5GB 4HAVB 3T06A 3N7CA 3SV1A 5DI9B 4P7IA 2RUKB 2ZPYA 4GMXB 3BJIA 2X18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JLJ B;  3HK0 A;  3A98 B;  4A5K A;  4EKU A;  3ODX A;  1PMS A;  1WJM A;  2K2U A;  2E2X A;  1XCG A;  1TJ6 A;  3AU5 A;  4MK0 A;  2COA A;  2DFK A;  1U2B A;  5JHH A;  3U7D A;  1U5F A;  1MPH A;  4CHJ A;  2VKI A;  3SYX A;  1OMW A;  2YF0 A;  1V61 A;  5C79 A;  1MAI A;  2J0K A;  2LOX A;  1U5D A;  5J3T A;  2RSG A;  1M7E A;  1I2H A;  1OQN A;  2UZR A;  2N0Y A;  1UEF A;  3FM8 C;  3QWM A;  2M14 A;  5C5B A;  4DXA B;  2YVC A;  1Z87 A;  2DKP A;  5LON B;  2Y8G A;  4HB2 B;  1BY1 A;  1AQC A;  1GG3 A;  3FEH A;  1LW3 A;  2DHJ A;  1TXD A;  2W2W A;  2ELA A;  3KZ1 A;  5J3Y A;  5D3Y A;  3TCA A;  3ODO A;  3WYF B;  1KZG A;  4A6F A;  1LB1 A;  1W1G A;  4TKN A;  1BTN A;  4NSW A;  4GOU A;  5FI1 A;  2W2X D;  1SGH A;  3NSU A;  2I1K A;  4TYZ A;  1BAK A;  1SHC A;  4ZRI A;  4Z2N A;  2UVM A;  2KCJ A;  2Z0O A;  4GPT B;  4ZRK A;  4L6E A;  3SUZ A;  1Y19 B;  5DHA B;  4K81 A;  1MKE A;  2YRY A;  1J19 A;  4H8S A;  4K17 A;  2IYB A;  1UPQ A;  3KRW A;  5HE1 A;  1MIX A;  3QBV B;  4PNK A;  3ULB A;  2I5C A;  2KGX B;  2DYQ A;  2GCL A;  3MPX A;  2K00 A;  2D2Q A;  1TQZ A;  4KHO A;  3A8Q A;  2P0F A;  2J0M A;  5HE2 A;  1PLS A;  3PVW A;  1FHW A;  2LYD A;  2HE7 A;  4KAX B;  1FHX A;  5DH9 B;  1EAZ A;  2DX1 A;  2LUL A;  2CRF A;  1F5X A;  1BTK A;  1ZVR A;  2UZS A;  4HHV A;  4HAX B;  3WA0 A;  1NTY A;  4HAZ B;  1ZC4 B;  1M7R A;  3VOQ A;  1DBH A;  2L1C A;  2BCJ A;  3PP2 A;  2MKR A;  2QKM A;  2DHK A;  1X1G A;  2COF A;  1XOD A;  4HAW B;  1P3R A;  1MK9 B;  2EMS A;  3IVF A;  5KCV A;  1I7A A;  3ULC A;  1FOE A;  1MK7 B;  3HQC A;  2FJL A;  2DTC A;  3CXB B;  4KHA A;  2H7E A;  2H7D A;  3MDB C;  2RVB B;  2YS5 A;  3AU4 A;  1ZSQ A;  3D8E A;  1AWE A;  1QQG A;  2KR9 A;  3ML4 A;  1NTV A;  1DDV A;  1P6S A;  2D9V A;  4YON A;  5EFX A;  1WGQ A;  1RRP B;  5D3V A;  2ROZ B;  5GOW B;  5DHF B;  1J0W A;  3DXC A;  4HAY B;  5HE0 A;  3AJ4 A;  1EVH A;  1XR0 B;  2R0D A;  1XKE A;  2RLO A;  3ZVR A;  4WSF A;  3GYP A;  1BWN A;  2EJ8 A;  3TFM A;  1XD4 A;  1V5M A;  2DLW A;  1U29 A;  2EMT A;  1WJ1 A;  3V5W A;  2V76 A;  2D4Q A;  3PEG A;  3ZDT A;  1W1H A;  2LKO A;  3F0W A;  2OTX A;  2IFS A;  2COD A;  1PFJ A;  2R09 A;  3PZD A;  4DX8 A;  1WG7 A;  4EJN A;  5KQ1 A;  1N3H A;  2Y8F A;  2RNR B;  1B55 A;  2P0D A;  2AL6 A;  2N23 A;  4PQ0 A;  3PG7 A;  1Y5O A;  4ZRJ A;  2QKL A;  2VRW B;  3O96 A;  2MFQ A;  4A6H A;  1WVH A;  3RCP A;  1W1D A;  3FSS A;  1MIZ B;  4GYV A;  3QIJ A;  4KHB B;  2CAY A;  4A6K A;  5DIF B;  2CY4 A;  1KI1 B;  4IOY X;  2J59 M;  2P0H A;  2LG1 A;  3PSC A;  1DDM A;  4F7G A;  1U5E A;  2DA0 A;  2DYN A;  3KY9 A;  4K2P A;  2J0J A;  5JHG A;  2Q13 A;  4KVG B;  1U5G A;  4F7H A;  1DRO A;  1FB8 A;  2YT1 A;  4NY0 A;  2DN6 A;  1V5P A;  1ZC3 B;  1Q67 A;  3D8F A;  2PZ1 A;  4CYE A;  1WGU A;  2W2X C;  3OAN A;  1GC7 A;  3UZT A;  3TO1 A;  5L81 A;  3SNH A;  2YS3 A;  2HTH B;  5LOP B;  1V5U A;  1OY2 A;  2YS1 A;  2XQN M;  1V88 A;  2M38 A;  1X11 A;  1X1F A;  1WI1 A;  2G35 A;  3KRX A;  5KQ4 A;  3TW1 A;  5FI0 A;  2NMB A;  2D9Z A;  4WVF B;  3JV3 A;  4B6H A;  2LOZ A;  1UNQ A;  3D8D A;  1IRS A;  1ISN A;  1U27 A;  2Y7B A;  1V89 A;  3GYO A;  4HAU B;  2MDX A;  4HB4 B;  3P6A A;  2DHI A;  2P8V A;  5D3X A;  1NI2 A;  4HAT B;  1K5D B;  2OQB A;  4Y94 A;  4MY6 A;  1KZ7 A;  5HE3 A;  1P5T A;  5J3Q A;  4D0N B;  3X23 A;  4BBK A;  4XWX A;  4DBB A;  1QC6 A;  2DX5 A;  3TVV A;  4D0O A;  3ODW A;  2Z0P A;  3DXE A;  2RGN B;  4HB3 B;  4GN1 A;  2L2I A;  1FAO A;  1X05 A;  2DKQ A;  4GMV A;  4IAP A;  1DDW A;  1FGZ A;  2KUP A;  3BIN A;  4HB0 B;  2GCJ A;  1NU2 A;  3GF9 A;  3PVU A;  4C0A A;  1E5W A;  4Z2M B;  3EO2 A;  5C6R A;  4HDO A;  3VIA A;  3A8P A;  1H10 A;  2D10 A;  2GS0 A;  2MWN B;  3CIK A;  2I1J A;  3P7Z A;  3HW2 B;  5C16 A;  4MT7 A;  1GC6 A;  2COC A;  4F7U P;  4GZU A;  2D9W A;  1H4R A;  2YT0 A;  2YSZ A;  4IFS A;  4HDQ A;  1FGY A;  3U8Z A;  2JP2 A;  2D11 A;  1DYN A;  2EC1 A;  2AEH A;  2VSZ A;  5C5B B;  3SO6 A;  1XX0 A;  1UPR A;  2ROV A;  5D3W A;  5JP4 A;  3M1I B;  5CLL B;  5CLQ B;  3KSY A;  3G9W A;  1UNP A;  1ZM0 A;  3DXD A;  3F5R A;  1UNR A;  2I5F A;  4K2O A;  4EMO A;  2D9X A;  3LJU X;  3PVL A;  4YL8 A;  2Z0Q A;  1FHO A;  1X86 A;  2NZ8 B;  2ELB A;  1EGX A;  2D9Y A;  4WJ7 A;  4A6F B;  2ADZ A;  5D27 A;  4DX9 0;  1EF1 A;  2GJY A;  4GXB A;  4CHM A;  1RJ2 A;  2CY5 A;  2K2J A;  1K5G B;  4HAV B;  3T06 A;  3N7C A;  3SV1 A;  5DI9 B;  4P7I A;  2RUK B;  2ZPY A;  4GMX B;  3BJI A;  2X18 A; 
#chains in the Genus database with same CATH topology
 5JLJ B;  3HK0 A;  5LG4 B;  3A98 B;  4A5K A;  4EKU A;  3ODX A;  1PMS A;  1WJM A;  2K2U A;  2E2X A;  1XCG A;  1TJ6 A;  3AU5 A;  4MK0 A;  2COA A;  2DFK A;  1U2B A;  5JHH A;  3U7D A;  1U5F A;  5IRS A;  1MPH A;  4OT1 A;  4HSI A;  4CHJ A;  2VKI A;  3SYX A;  1OMW A;  2YF0 A;  1V61 A;  5C79 A;  1MAI A;  2J0K A;  3HIE A;  4GNK B;  2LOX A;  1U5D A;  5J3T A;  2RSG A;  1M7E A;  1I2H A;  1OQN A;  2UZR A;  2N0Y A;  1UEF A;  3FM8 C;  3QWM A;  2M14 A;  5C5B A;  4DXA B;  3DCX A;  2YVC A;  1Z87 A;  2DKP A;  5LON B;  2Y8G A;  4HB2 B;  1BY1 A;  1AQC A;  1GG3 A;  3FEH A;  2YT2 A;  1LW3 A;  2DHJ A;  1TXD A;  2W2W A;  2ELA A;  3KZ1 A;  5J3Y A;  5D3Y A;  3TCA A;  3ODO A;  3WYF B;  1KZG A;  4A6F A;  1LB1 A;  1W1G A;  4TKN A;  1BTN A;  4NSW A;  4GOU A;  5FI1 A;  5I2M A;  2W2X D;  1SGH A;  4DIX A;  3NSU A;  2I1K A;  4TYZ A;  1BAK A;  1SHC A;  4ZRI A;  4Z2N A;  1ZYI A;  2UVM A;  2KCJ A;  2Z0O A;  4GPT B;  4QJ3 B;  4ZRK A;  4L6E A;  3SUZ A;  1Y19 B;  5DHA B;  4K81 A;  1MKE A;  2YRY A;  1J19 A;  4H8S A;  4K17 A;  2IYB A;  1UPQ A;  3KRW A;  5HE1 A;  1MIX A;  3QBV B;  4PNK A;  3ULB A;  2I5C A;  2KGX B;  2DYQ A;  2GCL A;  3MPX A;  2K00 A;  2D2Q A;  1TQZ A;  4KHO A;  3A8Q A;  2P0F A;  2J0M A;  5HE2 A;  2K49 A;  1PLS A;  3PVW A;  1FHW A;  2LYD A;  2HE7 A;  4KAX B;  1FHX A;  5DH9 B;  1EAZ A;  4QJ4 B;  2DX1 A;  2LUL A;  2CRF A;  1F5X A;  1BTK A;  1ZVR A;  2UZS A;  4HHV A;  4HAX B;  3WA0 A;  1NTY A;  4HAZ B;  1ZC4 B;  1M7R A;  3VOQ A;  1DBH A;  2L1C A;  2BCJ A;  3PP2 A;  2MKR A;  2QKM A;  2DHK A;  1X1G A;  2COF A;  1XOD A;  4HAW B;  1P3R A;  3NW8 A;  1MK9 B;  2FJU B;  2EMS A;  3IVF A;  2R2Y A;  5KCV A;  1I7A A;  3ULC A;  1FOE A;  1MK7 B;  3OHM B;  3HQC A;  2FJL A;  2DTC A;  3CXB B;  4KHA A;  2H7E A;  2H7D A;  3MDB C;  2RVB B;  2YS5 A;  3AU4 A;  1ZSQ A;  2RRF A;  3D8E A;  2GUM A;  1AWE A;  1QQG A;  2KR9 A;  3ML4 A;  1NTV A;  1DDV A;  1P6S A;  2D9V A;  4YON A;  4L1R A;  2K8E A;  5EFX A;  1WGQ A;  1RRP B;  5D3V A;  2ROZ B;  5GOW B;  5DHF B;  3NWA A;  1J0W A;  2KIG A;  5I2S A;  3DXC A;  4HAY B;  5HE0 A;  3AJ4 A;  1EVH A;  1XR0 B;  2R0D A;  1XKE A;  2RLO A;  3ZVR A;  4WSF A;  3GYP A;  1BWN A;  2EJ8 A;  3TFM A;  2KUQ A;  1XD4 A;  1V5M A;  2DLW A;  2Z59 A;  1U29 A;  2EMT A;  1WJ1 A;  2NBV A;  3V5W A;  2V76 A;  2D4Q A;  3PEG A;  3ZDT A;  1W1H A;  2LKO A;  3F0W A;  2OTX A;  2IFS A;  2COD A;  3NWD A;  1PFJ A;  2R09 A;  3PZD A;  4DX8 A;  1WG7 A;  4EJN A;  5KQ1 A;  1N3H A;  2Y8F A;  2RNR B;  1B55 A;  2P0D A;  2AL6 A;  2N23 A;  4PQ0 A;  4CSQ A;  3PG7 A;  1Y5O A;  5M4Y B;  4ZRJ A;  2QKL A;  2VRW B;  3FVC A;  3O96 A;  2MFQ A;  4A6H A;  1WVH A;  3RCP A;  1W1D A;  3FSS A;  1MIZ B;  4GYV A;  3QIJ A;  2Z14 A;  2CAY A;  4KHB B;  4A6K A;  5DIF B;  2CY4 A;  1KI1 B;  4IOY X;  2J59 M;  2P0H A;  2LG1 A;  3PSC A;  1DDM A;  4F7G A;  3NWF A;  1U5E A;  2DA0 A;  2DYN A;  3KY9 A;  4K2P A;  2J0J A;  5JHG A;  2Q13 A;  4QJ5 B;  4KVG B;  1U5G A;  4F7H A;  1DRO A;  1FB8 A;  2YT1 A;  4NY0 A;  2DN6 A;  1V5P A;  1ZC3 B;  1Q67 A;  3D8F A;  2PZ1 A;  4CYE A;  1WGU A;  2W2X C;  3A58 A;  3OAN A;  1GC7 A;  4OSN A;  3UZT A;  3TO1 A;  5L81 A;  2ZKM X;  3SNH A;  2YS3 A;  2HTH B;  5LOP B;  1V5U A;  1OY2 A;  2YS1 A;  2XQN M;  1V88 A;  2M38 A;  1X11 A;  1X1F A;  1WI1 A;  2G35 A;  3KRX A;  5KQ4 A;  3TW1 A;  5FI0 A;  2NMB A;  2D9Z A;  4WVF B;  3JV3 A;  4B6H A;  2LOZ A;  1UNQ A;  3D8D A;  1IRS A;  1ISN A;  1U27 A;  2Y7B A;  1V89 A;  3GYO A;  4HAU B;  2MDX A;  4HB4 B;  3P6A A;  2DHI A;  2P8V A;  5D3X A;  1NI2 A;  4HAT B;  1K5D B;  2OQB A;  4Y94 A;  4MY6 A;  1KZ7 A;  5HE3 A;  1P5T A;  5J3Q A;  4D0N B;  3X23 A;  4BBK A;  4XWX A;  4DBB A;  3HSA A;  1QC6 A;  2DX5 A;  2Z13 A;  3TVV A;  4D0O A;  4QXA B;  3ODW A;  2Z0P A;  3DXE A;  2RGN B;  4HB3 B;  4GN1 A;  2L2I A;  4KHB A;  1FAO A;  1X05 A;  2DKQ A;  4GMV A;  4IAP A;  1DDW A;  1FGZ A;  2KUP A;  3BIN A;  4HB0 B;  2GCJ A;  1NU2 A;  3GF9 A;  3PVU A;  4C0A A;  1E5W A;  4Z2M B;  3EO2 A;  5C6R A;  4HDO A;  3VIA A;  3A8P A;  1H10 A;  2D10 A;  2GS0 A;  2MWN B;  3CIK A;  2I1J A;  3P7Z A;  3HW2 B;  1MI1 A;  4MT7 A;  5C16 A;  1GC6 A;  2COC A;  4F7U P;  4GZU A;  2D9W A;  1H4R A;  2YT0 A;  4D6W A;  2YSZ A;  4IFS A;  4HDQ A;  1FGY A;  3U8Z A;  2JP2 A;  2D11 A;  1DYN A;  1T77 A;  2EC1 A;  2AEH A;  2Z4D A;  2VSZ A;  5C5B B;  3SO6 A;  1XX0 A;  1UPR A;  2ROV A;  5D3W A;  5JP4 A;  3B77 A;  3M1I B;  5CLL B;  5CLQ B;  3KSY A;  3G9W A;  1UNP A;  1ZM0 A;  3DXD A;  3F5R A;  1UNR A;  2I5F A;  4K2O A;  4EMO A;  2D9X A;  2KR0 A;  3LJU X;  3PVL A;  4YL8 A;  2KIE A;  2Z0Q A;  1FHO A;  1X86 A;  2NZ8 B;  2ELB A;  1EGX A;  2D9Y A;  4WJ7 A;  4A6F B;  2ADZ A;  5D27 A;  4DX9 0;  1EF1 A;  2GJY A;  4GXB A;  4CHM A;  1RJ2 A;  2CY5 A;  2K2J A;  1K5G B;  4HAV B;  3T06 A;  3N7C A;  3SV1 A;  5DI9 B;  4P7I A;  3U12 A;  2RUK B;  2ZPY A;  4GMX B;  3BJI A;  2X18 A; 
#chains in the Genus database with same CATH homology
 5JLJ B;  3HK0 A;  3A98 B;  4A5K A;  4EKU A;  3ODX A;  1PMS A;  1WJM A;  2K2U A;  2E2X A;  1XCG A;  1TJ6 A;  3AU5 A;  4MK0 A;  2COA A;  2DFK A;  1U2B A;  5JHH A;  3U7D A;  1U5F A;  1MPH A;  4CHJ A;  2VKI A;  3SYX A;  1OMW A;  2YF0 A;  1V61 A;  5C79 A;  1MAI A;  2J0K A;  2LOX A;  1U5D A;  5J3T A;  2RSG A;  1M7E A;  1I2H A;  1OQN A;  2UZR A;  2N0Y A;  1UEF A;  3FM8 C;  3QWM A;  2M14 A;  5C5B A;  4DXA B;  2YVC A;  1Z87 A;  2DKP A;  5LON B;  2Y8G A;  4HB2 B;  1BY1 A;  1AQC A;  1GG3 A;  3FEH A;  1LW3 A;  2DHJ A;  1TXD A;  2W2W A;  2ELA A;  3KZ1 A;  5J3Y A;  5D3Y A;  3TCA A;  3ODO A;  3WYF B;  1KZG A;  4A6F A;  1LB1 A;  1W1G A;  4TKN A;  1BTN A;  4NSW A;  4GOU A;  5FI1 A;  2W2X D;  1SGH A;  3NSU A;  2I1K A;  4TYZ A;  1BAK A;  1SHC A;  4ZRI A;  4Z2N A;  2UVM A;  2KCJ A;  2Z0O A;  4GPT B;  4ZRK A;  4L6E A;  3SUZ A;  1Y19 B;  5DHA B;  4K81 A;  1MKE A;  2YRY A;  1J19 A;  4H8S A;  4K17 A;  2IYB A;  1UPQ A;  3KRW A;  5HE1 A;  1MIX A;  3QBV B;  4PNK A;  3ULB A;  2I5C A;  2KGX B;  2DYQ A;  2GCL A;  3MPX A;  2K00 A;  2D2Q A;  1TQZ A;  4KHO A;  3A8Q A;  2P0F A;  2J0M A;  5HE2 A;  1PLS A;  3PVW A;  1FHW A;  2LYD A;  2HE7 A;  4KAX B;  1FHX A;  5DH9 B;  1EAZ A;  2DX1 A;  2LUL A;  2CRF A;  1F5X A;  1BTK A;  1ZVR A;  2UZS A;  4HHV A;  4HAX B;  3WA0 A;  1NTY A;  4HAZ B;  1ZC4 B;  1M7R A;  3VOQ A;  1DBH A;  2L1C A;  2BCJ A;  3PP2 A;  2MKR A;  2QKM A;  2DHK A;  1X1G A;  2COF A;  1XOD A;  4HAW B;  1P3R A;  1MK9 B;  2EMS A;  3IVF A;  5KCV A;  1I7A A;  3ULC A;  1FOE A;  1MK7 B;  3HQC A;  2FJL A;  2DTC A;  3CXB B;  4KHA A;  2H7E A;  2H7D A;  3MDB C;  2RVB B;  2YS5 A;  3AU4 A;  1ZSQ A;  3D8E A;  1AWE A;  1QQG A;  2KR9 A;  3ML4 A;  1NTV A;  1DDV A;  1P6S A;  2D9V A;  4YON A;  5EFX A;  1WGQ A;  1RRP B;  5D3V A;  2ROZ B;  5GOW B;  5DHF B;  1J0W A;  3DXC A;  4HAY B;  5HE0 A;  3AJ4 A;  1EVH A;  1XR0 B;  2R0D A;  1XKE A;  2RLO A;  3ZVR A;  4WSF A;  3GYP A;  1BWN A;  2EJ8 A;  3TFM A;  1XD4 A;  1V5M A;  2DLW A;  1U29 A;  2EMT A;  1WJ1 A;  3V5W A;  2V76 A;  2D4Q A;  3PEG A;  3ZDT A;  1W1H A;  2LKO A;  3F0W A;  2OTX A;  2IFS A;  2COD A;  1PFJ A;  2R09 A;  3PZD A;  4DX8 A;  1WG7 A;  4EJN A;  5KQ1 A;  1N3H A;  2Y8F A;  2RNR B;  1B55 A;  2P0D A;  2AL6 A;  2N23 A;  4PQ0 A;  3PG7 A;  1Y5O A;  4ZRJ A;  2QKL A;  2VRW B;  3O96 A;  2MFQ A;  4A6H A;  1WVH A;  3RCP A;  1W1D A;  3FSS A;  1MIZ B;  4GYV A;  3QIJ A;  4KHB B;  2CAY A;  4A6K A;  5DIF B;  2CY4 A;  1KI1 B;  4IOY X;  2J59 M;  2P0H A;  2LG1 A;  3PSC A;  1DDM A;  4F7G A;  1U5E A;  2DA0 A;  2DYN A;  3KY9 A;  4K2P A;  2J0J A;  5JHG A;  2Q13 A;  4KVG B;  1U5G A;  4F7H A;  1DRO A;  1FB8 A;  2YT1 A;  4NY0 A;  2DN6 A;  1V5P A;  1ZC3 B;  1Q67 A;  3D8F A;  2PZ1 A;  4CYE A;  1WGU A;  2W2X C;  3OAN A;  1GC7 A;  3UZT A;  3TO1 A;  5L81 A;  3SNH A;  2YS3 A;  2HTH B;  5LOP B;  1V5U A;  1OY2 A;  2YS1 A;  2XQN M;  1V88 A;  2M38 A;  1X11 A;  1X1F A;  1WI1 A;  2G35 A;  3KRX A;  5KQ4 A;  3TW1 A;  5FI0 A;  2NMB A;  2D9Z A;  4WVF B;  3JV3 A;  4B6H A;  2LOZ A;  1UNQ A;  3D8D A;  1IRS A;  1ISN A;  1U27 A;  2Y7B A;  1V89 A;  3GYO A;  4HAU B;  2MDX A;  4HB4 B;  3P6A A;  2DHI A;  2P8V A;  5D3X A;  1NI2 A;  4HAT B;  1K5D B;  2OQB A;  4Y94 A;  4MY6 A;  1KZ7 A;  5HE3 A;  1P5T A;  5J3Q A;  4D0N B;  3X23 A;  4BBK A;  4XWX A;  4DBB A;  1QC6 A;  2DX5 A;  3TVV A;  4D0O A;  3ODW A;  2Z0P A;  3DXE A;  2RGN B;  4HB3 B;  4GN1 A;  2L2I A;  1FAO A;  1X05 A;  2DKQ A;  4GMV A;  4IAP A;  1DDW A;  1FGZ A;  2KUP A;  3BIN A;  4HB0 B;  2GCJ A;  1NU2 A;  3GF9 A;  3PVU A;  4C0A A;  1E5W A;  4Z2M B;  3EO2 A;  5C6R A;  4HDO A;  3VIA A;  3A8P A;  1H10 A;  2D10 A;  2GS0 A;  2MWN B;  3CIK A;  2I1J A;  3P7Z A;  3HW2 B;  5C16 A;  4MT7 A;  1GC6 A;  2COC A;  4F7U P;  4GZU A;  2D9W A;  1H4R A;  2YT0 A;  2YSZ A;  4IFS A;  4HDQ A;  1FGY A;  3U8Z A;  2JP2 A;  2D11 A;  1DYN A;  2EC1 A;  2AEH A;  2VSZ A;  5C5B B;  3SO6 A;  1XX0 A;  1UPR A;  2ROV A;  5D3W A;  5JP4 A;  3M1I B;  5CLL B;  5CLQ B;  3KSY A;  3G9W A;  1UNP A;  1ZM0 A;  3DXD A;  3F5R A;  1UNR A;  2I5F A;  4K2O A;  4EMO A;  2D9X A;  3LJU X;  3PVL A;  4YL8 A;  2Z0Q A;  1FHO A;  1X86 A;  2NZ8 B;  2ELB A;  1EGX A;  2D9Y A;  4WJ7 A;  4A6F B;  2ADZ A;  5D27 A;  4DX9 0;  1EF1 A;  2GJY A;  4GXB A;  4CHM A;  1RJ2 A;  2CY5 A;  2K2J A;  1K5G B;  4HAV B;  3T06 A;  3N7C A;  3SV1 A;  5DI9 B;  4P7I A;  2RUK B;  2ZPY A;  4GMX B;  3BJI A;  2X18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...