1NTYA

Crystal structure of the first dh/ph domain of trio to 1.7 a
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
305
structure length
305
Chain Sequence
ARRKEFIMAELIQTEKAYVRDLRECMDTYLWEMTSGVEEIPPGIVNKELIIFGNMQEIYEFHNNIFLKELEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKPDSTQLILEHAGSYFDEIQQRHGLANSISSYLIKPVQRITKYQLLLKELLTCCEEGKGEIKDGLEVMLSVPKRANDAMHLSMLEGFDENIESQGELILQESFQVWDPKTLIRKGRERHLFLFEMSLVFSKEVKDSSGRSKYLYKSKLFTSELGVTEHVEGDPCKFALWVGRTPTSDNKIVLKASSIENKQDWIKHIREVIQERT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Triple functional domain protein
publication title The C-terminal basic tail of RhoG assists the guanine nucleotide exchange factor trio in binding to phospholipids.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 111
structure length 305
sequence length 305
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00621 RhoGEF RhoGEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 1ntyA01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1ntyA02
3VOQA 3PVWA 4K2PA 1XX0A 2YS1A 2J0JA 2NMBA 3AJ4A 2CY5A 2ELBA 3AU4A 1KI1B 4NY0A 2COCA 1J0WA 1BAKA 4CYEA 1V5MA 2D9XA 5C6RA 2H7EA 4CHMA 2DLWA 1N3HA 3ODWA 3PG7A 4WSFA 3WA0A 3V5WA 2DX5A 4DXAB 1WJMA 2RGNB 1F5XA 2D2QA 3MDBC 5FI0A 5DHAB 2N0YA 1X86A 1FHOA 4TKNA 3F0WA 3ZDTA 1V5UA 3D8EA 4F7GA 2L1CA 1TJ6A 5CLQB 1W1HA 4Y94A 5HE3A 2ZPYA 1WJ1A 2CODA 4ZRKA 1X05A 3SV1A 3UZTA 1BTKA 2RLOA 2MWNB 2GCLA 2DKPA 3ULBA 5KQ1A 4HDOA 4GOUA 2Z0OA 1XKEA 2DFKA 3A98B 4KHBB 3KRWA 2J0KA 1NU2A 2Z0PA 2AEHA 5D27A 3KSYA 1SHCA 1NTVA 2KGXB 3DXCA 1ZM0A 3ODXA 1IRSA 1OQNA 4EJNA 2K00A 4GMVA 4DBBA 2D11A 3FM8C 1FHWA 1UNQA 1MIXA 1UPQA 2RVBB 2CAYA 1K5DB 3GF9A 2DHKA 1BTNA 1UNRA 5J3YA 1U29A 1ZSQA 5C5BA 1V5PA 2FJLA 2LULA 1TXDA 2PZ1A 1FAOA 4TYZA 1EGXA 1U5DA 2EC1A 2YF0A 2IFSA 5LONB 1KZ7A 2KCJA 4HATB 4EMOA 2LOZA 4HB3B 2N23A 3O96A 4MK0A 4H8SA 3SNHA 3G9WA 3HQCA 2EJ8A 1FGZA 3JV3A 1Q67A 1DBHA 1MK7B 2I5CA 3GYPA 2XQNM 4A6KA 2CRFA 1U5EA 4IOYX 1U2BA 2UZSA 2DHJA 3HK0A 2W2WA 4HHVA 3WYFB 2J0MA 1PFJA 2LYDA 4Z2NA 2GCJA 1FGYA 2JP2A 4KHAA 4K17A 1AQCA 1U5FA 1ZC3B 3P6AA 1DDMA 2ROVA 2VRWB 4YONA 1EAZA 1XODA 2LKOA 4GPTB 3BJIA 1OMWA 5HE1A 1XCGA 5DI9B 2UZRA 5J3QA 1WG7A 5KCVA 5GOWB 2E2XA 2H7DA 2NZ8B 5C5BB 1QC6A 1MPHA 5L81A 4CHJA 1MK9B 3PSCA 4P7IA 4A6FB 1H10A 5JHGA 2ADZA 2GJYA 2OTXA 2DA0A 5C16A 4HDQA 1X1GA 2DN6A 1FOEA 2D9YA 2EMTA 2W2XC 1P3RA 1X1FA 1P5TA 1X11A 3IVFA 1MAIA 1U5GA 1NI2A 2VKIA 4Z2MB 5DIFB 3CXBB 1W1DA 3SUZA 5CLLB 3ODOA 2R0DA 2I1KA 2G35A 2EMSA 2YSZA 1WGUA 1V89A 2K2UA 3KZ1A 4A5KA 2I1JA 1FHXA 2YVCA 3EO2A 1RRPB 1J19A 1OY2A 4HB4B 5EFXA 3TFMA 1DROA 4GMXB 4K81A 1M7RA 2J59M 1PMSA 3F5RA 3RCPA 3DXEA 3FEHA 1UEFA 2CY4A 1B55A 3D8DA 1H4RA 1GC6A 3QBVB 3QIJA 1QQGA 2M14A 4GYVA 3U8ZA 3PEGA 2DX1A 2W2XD 2QKMA 1NTYA 2Z0QA 1V61A 1I2HA 5FI1A 2R09A 4HB0B 3X23A 3PZDA 2P8VA 1FB8A 3MPXA 1W1GA 5DH9B 2HE7A 2COFA 2D9ZA 3T06A 2DHIA 2RNRB 2Y8GA 1LB1A 5LOPB 5C79A 3HW2B 5JHHA 3U7DA 1Y19B 2GS0A 4D0NB 2QKLA 1Y5OA 3QWMA 1XD4A 4HAXB 4KAXB 1AWEA 3VIAA 4MT7A 2COAA 1KZGA 4IFSA 4ZRJA 1SGHA 4WVFB 1UNPA 2MFQA 5D3XA 4EKUA 3FSSA 3PVUA 2K2JA 4YL8A 2ELAA 2YT0A 3TCAA 3ULCA 4PNKA 2LG1A 3M1IB 2HTHB 1GG3A 3AU5A 1GC7A 4F7HA 3A8QA 2L2IA 2ROZB 1RJ2A 5JP4A 4A6HA 3ML4A 3CIKA 4WJ7A 2YRYA 4BBKA 1UPRA 3KRXA 3LJUX 2MKRA 5DHFB 5J3TA 1DYNA 1U27A 2D9WA 2YS5A 2P0DA 2KR9A 2VSZA 2Y8FA 3PVLA 1I7AA 4ZRIA 4KHOA 4F7UP 1WGQA 2D4QA 1V88A 2DYQA 5D3YA 1EF1A 4DX8A 1E5WA 3SO6A 4L6EA 3P7ZA 4MY6A 3NSUA 4HAVB 3KY9A 2DYNA 2P0HA 4C0AA 2YS3A 2M38A 3D8FA 4HAUB 1WVHA 1TQZA 2MDXA 3TVVA 4K2OA 2D9VA 2RSGA 1MIZB 2KUPA 1DDWA 3SYXA 2Y7BA 1ZVRA 1XR0B 2RUKB 2UVMA 4IAPA 3GYOA 4XWXA 2DTCA 1ISNA 4NSWA 2P0FA 4HB2B 4GXBA 5HE0A 3ZVRA 4D0OA 3A8PA 2BCJA 4GZUA 2DKQA 1BWNA 4DX90 2OQBA 2I5FA 1LW3A 2D10A 5KQ4A 3DXDA 1ZC4B 1PLSA 2V76A 1DDVA 1P6SA 1Z87A 4B6HA 5HE2A 4GN1A 3BINA 1EVHA 4A6FA 1MKEA 2LOXA 5D3WA 5D3VA 1K5GB 3TO1A 4HAWB 4HAYB 2AL6A 1M7EA 2IYBA 2YT1A 3N7CA 3OANA 2Q13A 3TW1A 4HAZB 3PP2A 4PQ0A 5JLJB 1WI1A 4KVGB 2X18A 1BY1A
chains in the Genus database with same CATH superfamily
3VOQA 3PVWA 4K2PA 1XX0A 2YS1A 2J0JA 2NMBA 3AJ4A 2CY5A 2ELBA 3AU4A 1KI1B 4NY0A 2COCA 1J0WA 1BAKA 4CYEA 1V5MA 2D9XA 5C6RA 2H7EA 4CHMA 2DLWA 1N3HA 3ODWA 3PG7A 4WSFA 3WA0A 3V5WA 2DX5A 4DXAB 1WJMA 2RGNB 1F5XA 2D2QA 2Z13A 3B77A 3MDBC 5FI0A 5DHAB 2N0YA 1X86A 1FHOA 4TKNA 3F0WA 3ZDTA 1V5UA 3D8EA 4F7GA 2L1CA 1TJ6A 5I2MA 5CLQB 1W1HA 4Y94A 5HE3A 2ZPYA 1WJ1A 2CODA 4ZRKA 1X05A 3SV1A 3UZTA 1BTKA 2RLOA 2MWNB 2NBVA 2GCLA 2GUMA 2DKPA 3ULBA 5KQ1A 4HDOA 4GOUA 2Z0OA 1XKEA 2DFKA 3A98B 4KHBB 3KRWA 2J0KA 1NU2A 2Z0PA 2AEHA 5D27A 3KSYA 1SHCA 1NTVA 2KGXB 3DXCA 1ZM0A 3NWFA 3ODXA 1IRSA 1OQNA 4EJNA 2K00A 4GMVA 4DBBA 2D11A 3FM8C 1FHWA 1UNQA 2K49A 1MIXA 1UPQA 2RVBB 2CAYA 1K5DB 3GF9A 2DHKA 1BTNA 2KIGA 1UNRA 5J3YA 1U29A 1ZSQA 5C5BA 1V5PA 4GNKB 2FJLA 2LULA 1TXDA 2PZ1A 1FAOA 2FJUB 4TYZA 1EGXA 1U5DA 2EC1A 2YF0A 2IFSA 5LONB 1KZ7A 2KCJA 4HATB 4EMOA 2LOZA 4HB3B 5I2SA 2N23A 3FVCA 3O96A 4MK0A 4H8SA 3SNHA 3G9WA 3HQCA 2EJ8A 1FGZA 3JV3A 1Q67A 1DBHA 3NWAA 1MK7B 2I5CA 3GYPA 2XQNM 4A6KA 2CRFA 1U5EA 4IOYX 1U2BA 2UZSA 2DHJA 3HK0A 2Z14A 2W2WA 4HHVA 3WYFB 2J0MA 1PFJA 2LYDA 4QXAB 4Z2NA 2GCJA 1FGYA 2JP2A 4KHAA 4K17A 1AQCA 1U5FA 1ZC3B 3P6AA 1DDMA 2ROVA 2VRWB 4YONA 1EAZA 1XODA 2LKOA 4GPTB 3BJIA 1OMWA 5HE1A 1XCGA 5DI9B 2UZRA 5J3QA 1T77A 1MI1A 1WG7A 5KCVA 5GOWB 2E2XA 2H7DA 2NZ8B 5C5BB 1QC6A 1MPHA 5L81A 4CHJA 1MK9B 3PSCA 4P7IA 4A6FB 1H10A 3NW8A 5JHGA 2ADZA 2GJYA 2OTXA 2DA0A 5C16A 4HDQA 1X1GA 2DN6A 1FOEA 2D9YA 2EMTA 2W2XC 1P3RA 1X1FA 1P5TA 1X11A 3IVFA 1MAIA 1U5GA 1NI2A 2VKIA 4Z2MB 5DIFB 4CSQA 3CXBB 1W1DA 3SUZA 5CLLB 3ODOA 2R0DA 2I1KA 2G35A 2EMSA 2YSZA 1WGUA 2KUQA 1V89A 2KR0A 4HSIA 2K2UA 3KZ1A 4A5KA 2I1JA 1FHXA 2YVCA 3EO2A 1RRPB 1J19A 1OY2A 4HB4B 5EFXA 3TFMA 1DROA 4GMXB 2K8EA 4K81A 1M7RA 2J59M 1PMSA 3F5RA 3RCPA 3DXEA 3FEHA 1UEFA 2CY4A 1B55A 3U12A 3D8DA 1ZYIA 1H4RA 1GC6A 3QBVB 3DCXA 3QIJA 1QQGA 2M14A 4GYVA 3U8ZA 3PEGA 2DX1A 2W2XD 2QKMA 1NTYA 2Z0QA 4OSNA 1V61A 3NWDA 1I2HA 5FI1A 2R09A 4HB0B 3X23A 3PZDA 2P8VA 1FB8A 3MPXA 1W1GA 5DH9B 2HE7A 2COFA 2D9ZA 3T06A 2DHIA 2RNRB 2Y8GA 1LB1A 5LOPB 5C79A 3HW2B 5JHHA 3U7DA 1Y19B 2GS0A 4D0NB 2QKLA 1Y5OA 3QWMA 1XD4A 4HAXB 4KAXB 1AWEA 3HSAA 3VIAA 4MT7A 2COAA 1KZGA 4IFSA 5IRSA 4ZRJA 1SGHA 4WVFB 1UNPA 2MFQA 5D3XA 4EKUA 3FSSA 3PVUA 2K2JA 4YL8A 4KHBA 2ELAA 2YT0A 3TCAA 3ULCA 4PNKA 2LG1A 3M1IB 4OT1A 2HTHB 1GG3A 2Z59A 3AU5A 1GC7A 2R2YA 4F7HA 3A8QA 2L2IA 2ROZB 1RJ2A 5JP4A 4DIXA 4A6HA 3ML4A 3CIKA 4WJ7A 2YRYA 4BBKA 1UPRA 2ZKMX 3KRXA 3LJUX 2MKRA 5DHFB 5J3TA 3OHMB 1DYNA 1U27A 2D9WA 2YS5A 2P0DA 2KR9A 2VSZA 2Y8FA 3PVLA 1I7AA 4ZRIA 4KHOA 4F7UP 5M4YB 1WGQA 2D4QA 1V88A 2DYQA 5D3YA 1EF1A 4DX8A 1E5WA 3SO6A 4L6EA 3P7ZA 4MY6A 3NSUA 4HAVB 3KY9A 2DYNA 2P0HA 4C0AA 2YS3A 2M38A 3D8FA 4HAUB 1WVHA 1TQZA 2MDXA 3TVVA 4K2OA 2D9VA 2RSGA 2RRFA 1MIZB 2KUPA 1DDWA 2KIEA 3SYXA 2Y7BA 1ZVRA 1XR0B 2RUKB 2UVMA 4IAPA 3GYOA 4L1RA 4XWXA 2DTCA 1ISNA 4NSWA 2P0FA 4HB2B 4GXBA 5HE0A 3ZVRA 4D0OA 3A8PA 2BCJA 4QJ3B 4GZUA 3HIEA 2DKQA 1BWNA 4DX90 2OQBA 2I5FA 1LW3A 2D10A 5KQ4A 5LG4B 3DXDA 1ZC4B 2YT2A 4QJ4B 1PLSA 2V76A 1DDVA 1P6SA 1Z87A 4B6HA 2Z4DA 5HE2A 3A58A 4GN1A 3BINA 1EVHA 4A6FA 1MKEA 2LOXA 5D3WA 4QJ5B 5D3VA 1K5GB 3TO1A 4HAWB 4HAYB 2AL6A 1M7EA 2IYBA 2YT1A 3N7CA 3OANA 2Q13A 3TW1A 4HAZB 3PP2A 4PQ0A 4D6WA 5JLJB 1WI1A 4KVGB 2X18A 1BY1A
chains in the Genus database with same CATH topology
3VOQA 3PVWA 4K2PA 1XX0A 2YS1A 2J0JA 2NMBA 3AJ4A 2CY5A 2ELBA 3AU4A 1KI1B 4NY0A 2COCA 1J0WA 1BAKA 4CYEA 1V5MA 2D9XA 5C6RA 2H7EA 4CHMA 2DLWA 1N3HA 3ODWA 3PG7A 4WSFA 3WA0A 3V5WA 2DX5A 4DXAB 1WJMA 2RGNB 1F5XA 2D2QA 3MDBC 5FI0A 5DHAB 2N0YA 1X86A 1FHOA 4TKNA 3F0WA 3ZDTA 1V5UA 3D8EA 4F7GA 2L1CA 1TJ6A 5CLQB 1W1HA 4Y94A 5HE3A 2ZPYA 1WJ1A 2CODA 4ZRKA 1X05A 3SV1A 3UZTA 1BTKA 2RLOA 2MWNB 2GCLA 2DKPA 3ULBA 5KQ1A 4HDOA 4GOUA 2Z0OA 1XKEA 2DFKA 3A98B 4KHBB 3KRWA 2J0KA 1NU2A 2Z0PA 2AEHA 5D27A 3KSYA 1SHCA 1NTVA 2KGXB 3DXCA 1ZM0A 3ODXA 1IRSA 1OQNA 4EJNA 2K00A 4GMVA 4DBBA 2D11A 3FM8C 1FHWA 1UNQA 1MIXA 1UPQA 2RVBB 2CAYA 1K5DB 3GF9A 2DHKA 1BTNA 1UNRA 5J3YA 1U29A 1ZSQA 5C5BA 1V5PA 2FJLA 2LULA 1TXDA 2PZ1A 1FAOA 4TYZA 1EGXA 1U5DA 2EC1A 2YF0A 2IFSA 5LONB 1KZ7A 2KCJA 4HATB 4EMOA 2LOZA 4HB3B 2N23A 3O96A 4MK0A 4H8SA 3SNHA 3G9WA 3HQCA 2EJ8A 1FGZA 3JV3A 1Q67A 1DBHA 1MK7B 2I5CA 3GYPA 2XQNM 4A6KA 2CRFA 1U5EA 4IOYX 1U2BA 2UZSA 2DHJA 3HK0A 2W2WA 4HHVA 3WYFB 2J0MA 1PFJA 2LYDA 4Z2NA 2GCJA 1FGYA 2JP2A 4KHAA 4K17A 1AQCA 1U5FA 1ZC3B 3P6AA 1DDMA 2ROVA 2VRWB 4YONA 1EAZA 1XODA 2LKOA 4GPTB 3BJIA 1OMWA 5HE1A 1XCGA 5DI9B 2UZRA 5J3QA 1WG7A 5KCVA 5GOWB 2E2XA 2H7DA 2NZ8B 5C5BB 1QC6A 1MPHA 5L81A 4CHJA 1MK9B 3PSCA 4P7IA 4A6FB 1H10A 5JHGA 2ADZA 2GJYA 2OTXA 2DA0A 5C16A 4HDQA 1X1GA 2DN6A 1FOEA 2D9YA 2EMTA 2W2XC 1P3RA 1X1FA 1P5TA 1X11A 3IVFA 1MAIA 1U5GA 1NI2A 2VKIA 4Z2MB 5DIFB 3CXBB 1W1DA 3SUZA 5CLLB 3ODOA 2R0DA 2I1KA 2G35A 2EMSA 2YSZA 1WGUA 1V89A 2K2UA 3KZ1A 4A5KA 2I1JA 1FHXA 2YVCA 3EO2A 1RRPB 1J19A 1OY2A 4HB4B 5EFXA 3TFMA 1DROA 4GMXB 4K81A 1M7RA 2J59M 1PMSA 3F5RA 3RCPA 3DXEA 3FEHA 1UEFA 2CY4A 1B55A 3D8DA 1H4RA 1GC6A 3QBVB 3QIJA 1QQGA 2M14A 4GYVA 3U8ZA 3PEGA 2DX1A 2W2XD 2QKMA 1NTYA 2Z0QA 1V61A 1I2HA 5FI1A 2R09A 4HB0B 3X23A 3PZDA 2P8VA 1FB8A 3MPXA 1W1GA 5DH9B 2HE7A 2COFA 2D9ZA 3T06A 2DHIA 2RNRB 2Y8GA 1LB1A 5LOPB 5C79A 3HW2B 5JHHA 3U7DA 1Y19B 2GS0A 4D0NB 2QKLA 1Y5OA 3QWMA 1XD4A 4HAXB 4KAXB 1AWEA 3VIAA 4MT7A 2COAA 1KZGA 4IFSA 4ZRJA 1SGHA 4WVFB 1UNPA 2MFQA 5D3XA 4EKUA 3FSSA 3PVUA 2K2JA 4YL8A 2ELAA 2YT0A 3TCAA 3ULCA 4PNKA 2LG1A 3M1IB 2HTHB 1GG3A 3AU5A 1GC7A 4F7HA 3A8QA 2L2IA 2ROZB 1RJ2A 5JP4A 4A6HA 3ML4A 3CIKA 4WJ7A 2YRYA 4BBKA 1UPRA 3KRXA 3LJUX 2MKRA 5DHFB 5J3TA 1DYNA 1U27A 2D9WA 2YS5A 2P0DA 2KR9A 2VSZA 2Y8FA 3PVLA 1I7AA 4ZRIA 4KHOA 4F7UP 1WGQA 2D4QA 1V88A 2DYQA 5D3YA 1EF1A 4DX8A 1E5WA 3SO6A 4L6EA 3P7ZA 4MY6A 3NSUA 4HAVB 3KY9A 2DYNA 2P0HA 4C0AA 2YS3A 2M38A 3D8FA 4HAUB 1WVHA 1TQZA 2MDXA 3TVVA 4K2OA 2D9VA 2RSGA 1MIZB 2KUPA 1DDWA 3SYXA 2Y7BA 1ZVRA 1XR0B 2RUKB 2UVMA 4IAPA 3GYOA 4XWXA 2DTCA 1ISNA 4NSWA 2P0FA 4HB2B 4GXBA 5HE0A 3ZVRA 4D0OA 3A8PA 2BCJA 4GZUA 2DKQA 1BWNA 4DX90 2OQBA 2I5FA 1LW3A 2D10A 5KQ4A 3DXDA 1ZC4B 1PLSA 2V76A 1DDVA 1P6SA 1Z87A 4B6HA 5HE2A 4GN1A 3BINA 1EVHA 4A6FA 1MKEA 2LOXA 5D3WA 5D3VA 1K5GB 3TO1A 4HAWB 4HAYB 2AL6A 1M7EA 2IYBA 2YT1A 3N7CA 3OANA 2Q13A 3TW1A 4HAZB 3PP2A 4PQ0A 5JLJB 1WI1A 4KVGB 2X18A 1BY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VOQ A;  3PVW A;  4K2P A;  1XX0 A;  2YS1 A;  2J0J A;  2NMB A;  3AJ4 A;  2CY5 A;  2ELB A;  3AU4 A;  1KI1 B;  4NY0 A;  2COC A;  1J0W A;  1BAK A;  4CYE A;  1V5M A;  2D9X A;  5C6R A;  2H7E A;  4CHM A;  2DLW A;  1N3H A;  3ODW A;  3PG7 A;  4WSF A;  3WA0 A;  3V5W A;  2DX5 A;  4DXA B;  1WJM A;  2RGN B;  1F5X A;  2D2Q A;  3MDB C;  5FI0 A;  5DHA B;  2N0Y A;  1X86 A;  1FHO A;  4TKN A;  3F0W A;  3ZDT A;  1V5U A;  3D8E A;  4F7G A;  2L1C A;  1TJ6 A;  5CLQ B;  1W1H A;  4Y94 A;  5HE3 A;  2ZPY A;  1WJ1 A;  2COD A;  4ZRK A;  1X05 A;  3SV1 A;  3UZT A;  1BTK A;  2RLO A;  2MWN B;  2GCL A;  2DKP A;  3ULB A;  5KQ1 A;  4HDO A;  4GOU A;  2Z0O A;  1XKE A;  2DFK A;  3A98 B;  4KHB B;  3KRW A;  2J0K A;  1NU2 A;  2Z0P A;  2AEH A;  5D27 A;  3KSY A;  1SHC A;  1NTV A;  2KGX B;  3DXC A;  1ZM0 A;  3ODX A;  1IRS A;  1OQN A;  4EJN A;  2K00 A;  4GMV A;  4DBB A;  2D11 A;  3FM8 C;  1FHW A;  1UNQ A;  1MIX A;  1UPQ A;  2RVB B;  2CAY A;  1K5D B;  3GF9 A;  2DHK A;  1BTN A;  1UNR A;  5J3Y A;  1U29 A;  1ZSQ A;  5C5B A;  1V5P A;  2FJL A;  2LUL A;  1TXD A;  2PZ1 A;  1FAO A;  4TYZ A;  1EGX A;  1U5D A;  2EC1 A;  2YF0 A;  2IFS A;  5LON B;  1KZ7 A;  2KCJ A;  4HAT B;  4EMO A;  2LOZ A;  4HB3 B;  2N23 A;  3O96 A;  4MK0 A;  4H8S A;  3SNH A;  3G9W A;  3HQC A;  2EJ8 A;  1FGZ A;  3JV3 A;  1Q67 A;  1DBH A;  1MK7 B;  2I5C A;  3GYP A;  2XQN M;  4A6K A;  2CRF A;  1U5E A;  4IOY X;  1U2B A;  2UZS A;  2DHJ A;  3HK0 A;  2W2W A;  4HHV A;  3WYF B;  2J0M A;  1PFJ A;  2LYD A;  4Z2N A;  2GCJ A;  1FGY A;  2JP2 A;  4KHA A;  4K17 A;  1AQC A;  1U5F A;  1ZC3 B;  3P6A A;  1DDM A;  2ROV A;  2VRW B;  4YON A;  1EAZ A;  1XOD A;  2LKO A;  4GPT B;  3BJI A;  1OMW A;  5HE1 A;  1XCG A;  5DI9 B;  2UZR A;  5J3Q A;  1WG7 A;  5KCV A;  5GOW B;  2E2X A;  2H7D A;  2NZ8 B;  5C5B B;  1QC6 A;  1MPH A;  5L81 A;  4CHJ A;  1MK9 B;  3PSC A;  4P7I A;  4A6F B;  1H10 A;  5JHG A;  2ADZ A;  2GJY A;  2OTX A;  2DA0 A;  5C16 A;  4HDQ A;  1X1G A;  2DN6 A;  1FOE A;  2D9Y A;  2EMT A;  2W2X C;  1P3R A;  1X1F A;  1P5T A;  1X11 A;  3IVF A;  1MAI A;  1U5G A;  1NI2 A;  2VKI A;  4Z2M B;  5DIF B;  3CXB B;  1W1D A;  3SUZ A;  5CLL B;  3ODO A;  2R0D A;  2I1K A;  2G35 A;  2EMS A;  2YSZ A;  1WGU A;  1V89 A;  2K2U A;  3KZ1 A;  4A5K A;  2I1J A;  1FHX A;  2YVC A;  3EO2 A;  1RRP B;  1J19 A;  1OY2 A;  4HB4 B;  5EFX A;  3TFM A;  1DRO A;  4GMX B;  4K81 A;  1M7R A;  2J59 M;  1PMS A;  3F5R A;  3RCP A;  3DXE A;  3FEH A;  1UEF A;  2CY4 A;  1B55 A;  3D8D A;  1H4R A;  1GC6 A;  3QBV B;  3QIJ A;  1QQG A;  2M14 A;  4GYV A;  3U8Z A;  3PEG A;  2DX1 A;  2W2X D;  2QKM A;  1NTY A;  2Z0Q A;  1V61 A;  1I2H A;  5FI1 A;  2R09 A;  4HB0 B;  3X23 A;  3PZD A;  2P8V A;  1FB8 A;  3MPX A;  1W1G A;  5DH9 B;  2HE7 A;  2COF A;  2D9Z A;  3T06 A;  2DHI A;  2RNR B;  2Y8G A;  1LB1 A;  5LOP B;  5C79 A;  3HW2 B;  5JHH A;  3U7D A;  1Y19 B;  2GS0 A;  4D0N B;  2QKL A;  1Y5O A;  3QWM A;  1XD4 A;  4HAX B;  4KAX B;  1AWE A;  3VIA A;  4MT7 A;  2COA A;  1KZG A;  4IFS A;  4ZRJ A;  1SGH A;  4WVF B;  1UNP A;  2MFQ A;  5D3X A;  4EKU A;  3FSS A;  3PVU A;  2K2J A;  4YL8 A;  2ELA A;  2YT0 A;  3TCA A;  3ULC A;  4PNK A;  2LG1 A;  3M1I B;  2HTH B;  1GG3 A;  3AU5 A;  1GC7 A;  4F7H A;  3A8Q A;  2L2I A;  2ROZ B;  1RJ2 A;  5JP4 A;  4A6H A;  3ML4 A;  3CIK A;  4WJ7 A;  2YRY A;  4BBK A;  1UPR A;  3KRX A;  3LJU X;  2MKR A;  5DHF B;  5J3T A;  1DYN A;  1U27 A;  2D9W A;  2YS5 A;  2P0D A;  2KR9 A;  2VSZ A;  2Y8F A;  3PVL A;  1I7A A;  4ZRI A;  4KHO A;  4F7U P;  1WGQ A;  2D4Q A;  1V88 A;  2DYQ A;  5D3Y A;  1EF1 A;  4DX8 A;  1E5W A;  3SO6 A;  4L6E A;  3P7Z A;  4MY6 A;  3NSU A;  4HAV B;  3KY9 A;  2DYN A;  2P0H A;  4C0A A;  2YS3 A;  2M38 A;  3D8F A;  4HAU B;  1WVH A;  1TQZ A;  2MDX A;  3TVV A;  4K2O A;  2D9V A;  2RSG A;  1MIZ B;  2KUP A;  1DDW A;  3SYX A;  2Y7B A;  1ZVR A;  1XR0 B;  2RUK B;  2UVM A;  4IAP A;  3GYO A;  4XWX A;  2DTC A;  1ISN A;  4NSW A;  2P0F A;  4HB2 B;  4GXB A;  5HE0 A;  3ZVR A;  4D0O A;  3A8P A;  2BCJ A;  4GZU A;  2DKQ A;  1BWN A;  4DX9 0;  2OQB A;  2I5F A;  1LW3 A;  2D10 A;  5KQ4 A;  3DXD A;  1ZC4 B;  1PLS A;  2V76 A;  1DDV A;  1P6S A;  1Z87 A;  4B6H A;  5HE2 A;  4GN1 A;  3BIN A;  1EVH A;  4A6F A;  1MKE A;  2LOX A;  5D3W A;  5D3V A;  1K5G B;  3TO1 A;  4HAW B;  4HAY B;  2AL6 A;  1M7E A;  2IYB A;  2YT1 A;  3N7C A;  3OAN A;  2Q13 A;  3TW1 A;  4HAZ B;  3PP2 A;  4PQ0 A;  5JLJ B;  1WI1 A;  4KVG B;  2X18 A;  1BY1 A; 
#chains in the Genus database with same CATH topology
 3VOQ A;  3PVW A;  4K2P A;  1XX0 A;  2YS1 A;  2J0J A;  2NMB A;  3AJ4 A;  2CY5 A;  2ELB A;  3AU4 A;  1KI1 B;  4NY0 A;  2COC A;  1J0W A;  1BAK A;  4CYE A;  1V5M A;  2D9X A;  5C6R A;  2H7E A;  4CHM A;  2DLW A;  1N3H A;  3ODW A;  3PG7 A;  4WSF A;  3WA0 A;  3V5W A;  2DX5 A;  4DXA B;  1WJM A;  2RGN B;  1F5X A;  2D2Q A;  2Z13 A;  3B77 A;  3MDB C;  5FI0 A;  5DHA B;  2N0Y A;  1X86 A;  1FHO A;  4TKN A;  3F0W A;  3ZDT A;  1V5U A;  3D8E A;  4F7G A;  2L1C A;  1TJ6 A;  5I2M A;  5CLQ B;  1W1H A;  4Y94 A;  5HE3 A;  2ZPY A;  1WJ1 A;  2COD A;  4ZRK A;  1X05 A;  3SV1 A;  3UZT A;  1BTK A;  2RLO A;  2MWN B;  2NBV A;  2GCL A;  2GUM A;  2DKP A;  3ULB A;  5KQ1 A;  4HDO A;  4GOU A;  2Z0O A;  1XKE A;  2DFK A;  3A98 B;  4KHB B;  3KRW A;  2J0K A;  1NU2 A;  2Z0P A;  2AEH A;  5D27 A;  3KSY A;  1SHC A;  1NTV A;  2KGX B;  3DXC A;  1ZM0 A;  3NWF A;  3ODX A;  1IRS A;  1OQN A;  4EJN A;  2K00 A;  4GMV A;  4DBB A;  2D11 A;  3FM8 C;  1FHW A;  1UNQ A;  2K49 A;  1MIX A;  1UPQ A;  2RVB B;  2CAY A;  1K5D B;  3GF9 A;  2DHK A;  1BTN A;  2KIG A;  1UNR A;  5J3Y A;  1U29 A;  1ZSQ A;  5C5B A;  1V5P A;  4GNK B;  2FJL A;  2LUL A;  1TXD A;  2PZ1 A;  1FAO A;  2FJU B;  4TYZ A;  1EGX A;  1U5D A;  2EC1 A;  2YF0 A;  2IFS A;  5LON B;  1KZ7 A;  2KCJ A;  4HAT B;  4EMO A;  2LOZ A;  4HB3 B;  5I2S A;  2N23 A;  3FVC A;  3O96 A;  4MK0 A;  4H8S A;  3SNH A;  3G9W A;  3HQC A;  2EJ8 A;  1FGZ A;  3JV3 A;  1Q67 A;  1DBH A;  3NWA A;  1MK7 B;  2I5C A;  3GYP A;  2XQN M;  4A6K A;  2CRF A;  1U5E A;  4IOY X;  1U2B A;  2UZS A;  2DHJ A;  3HK0 A;  2Z14 A;  2W2W A;  4HHV A;  3WYF B;  2J0M A;  1PFJ A;  2LYD A;  4QXA B;  4Z2N A;  2GCJ A;  1FGY A;  2JP2 A;  4KHA A;  4K17 A;  1AQC A;  1U5F A;  1ZC3 B;  3P6A A;  1DDM A;  2ROV A;  2VRW B;  4YON A;  1EAZ A;  1XOD A;  2LKO A;  4GPT B;  3BJI A;  1OMW A;  5HE1 A;  1XCG A;  5DI9 B;  2UZR A;  5J3Q A;  1T77 A;  1MI1 A;  1WG7 A;  5KCV A;  5GOW B;  2E2X A;  2H7D A;  2NZ8 B;  5C5B B;  1QC6 A;  1MPH A;  5L81 A;  4CHJ A;  1MK9 B;  3PSC A;  4P7I A;  4A6F B;  1H10 A;  3NW8 A;  5JHG A;  2ADZ A;  2GJY A;  2OTX A;  2DA0 A;  5C16 A;  4HDQ A;  1X1G A;  2DN6 A;  1FOE A;  2D9Y A;  2EMT A;  2W2X C;  1P3R A;  1X1F A;  1P5T A;  1X11 A;  3IVF A;  1MAI A;  1U5G A;  1NI2 A;  2VKI A;  4Z2M B;  5DIF B;  4CSQ A;  3CXB B;  1W1D A;  3SUZ A;  5CLL B;  3ODO A;  2R0D A;  2I1K A;  2G35 A;  2EMS A;  2YSZ A;  1WGU A;  2KUQ A;  1V89 A;  2KR0 A;  4HSI A;  2K2U A;  3KZ1 A;  4A5K A;  2I1J A;  1FHX A;  2YVC A;  3EO2 A;  1RRP B;  1J19 A;  1OY2 A;  4HB4 B;  5EFX A;  3TFM A;  1DRO A;  4GMX B;  2K8E A;  4K81 A;  1M7R A;  2J59 M;  1PMS A;  3F5R A;  3RCP A;  3DXE A;  3FEH A;  1UEF A;  2CY4 A;  1B55 A;  3U12 A;  3D8D A;  1ZYI A;  1H4R A;  1GC6 A;  3QBV B;  3DCX A;  3QIJ A;  1QQG A;  2M14 A;  4GYV A;  3U8Z A;  3PEG A;  2DX1 A;  2W2X D;  2QKM A;  1NTY A;  2Z0Q A;  4OSN A;  1V61 A;  3NWD A;  1I2H A;  5FI1 A;  2R09 A;  4HB0 B;  3X23 A;  3PZD A;  2P8V A;  1FB8 A;  3MPX A;  1W1G A;  5DH9 B;  2HE7 A;  2COF A;  2D9Z A;  3T06 A;  2DHI A;  2RNR B;  2Y8G A;  1LB1 A;  5LOP B;  5C79 A;  3HW2 B;  5JHH A;  3U7D A;  1Y19 B;  2GS0 A;  4D0N B;  2QKL A;  1Y5O A;  3QWM A;  1XD4 A;  4HAX B;  4KAX B;  1AWE A;  3HSA A;  3VIA A;  4MT7 A;  2COA A;  1KZG A;  4IFS A;  5IRS A;  4ZRJ A;  1SGH A;  4WVF B;  1UNP A;  2MFQ A;  5D3X A;  4EKU A;  3FSS A;  3PVU A;  2K2J A;  4YL8 A;  4KHB A;  2ELA A;  2YT0 A;  3TCA A;  3ULC A;  4PNK A;  2LG1 A;  3M1I B;  4OT1 A;  2HTH B;  1GG3 A;  2Z59 A;  3AU5 A;  1GC7 A;  2R2Y A;  4F7H A;  3A8Q A;  2L2I A;  2ROZ B;  1RJ2 A;  5JP4 A;  4DIX A;  4A6H A;  3ML4 A;  3CIK A;  4WJ7 A;  2YRY A;  4BBK A;  1UPR A;  2ZKM X;  3KRX A;  3LJU X;  2MKR A;  5DHF B;  5J3T A;  3OHM B;  1DYN A;  1U27 A;  2D9W A;  2YS5 A;  2P0D A;  2KR9 A;  2VSZ A;  2Y8F A;  3PVL A;  1I7A A;  4ZRI A;  4KHO A;  4F7U P;  5M4Y B;  1WGQ A;  2D4Q A;  1V88 A;  2DYQ A;  5D3Y A;  1EF1 A;  4DX8 A;  1E5W A;  3SO6 A;  4L6E A;  3P7Z A;  4MY6 A;  3NSU A;  4HAV B;  3KY9 A;  2DYN A;  2P0H A;  4C0A A;  2YS3 A;  2M38 A;  3D8F A;  4HAU B;  1WVH A;  1TQZ A;  2MDX A;  3TVV A;  4K2O A;  2D9V A;  2RSG A;  2RRF A;  1MIZ B;  2KUP A;  1DDW A;  2KIE A;  3SYX A;  2Y7B A;  1ZVR A;  1XR0 B;  2RUK B;  2UVM A;  4IAP A;  3GYO A;  4L1R A;  4XWX A;  2DTC A;  1ISN A;  4NSW A;  2P0F A;  4HB2 B;  4GXB A;  5HE0 A;  3ZVR A;  4D0O A;  3A8P A;  2BCJ A;  4QJ3 B;  4GZU A;  3HIE A;  2DKQ A;  1BWN A;  4DX9 0;  2OQB A;  2I5F A;  1LW3 A;  2D10 A;  5KQ4 A;  5LG4 B;  3DXD A;  1ZC4 B;  2YT2 A;  4QJ4 B;  1PLS A;  2V76 A;  1DDV A;  1P6S A;  1Z87 A;  4B6H A;  2Z4D A;  5HE2 A;  3A58 A;  4GN1 A;  3BIN A;  1EVH A;  4A6F A;  1MKE A;  2LOX A;  5D3W A;  4QJ5 B;  5D3V A;  1K5G B;  3TO1 A;  4HAW B;  4HAY B;  2AL6 A;  1M7E A;  2IYB A;  2YT1 A;  3N7C A;  3OAN A;  2Q13 A;  3TW1 A;  4HAZ B;  3PP2 A;  4PQ0 A;  4D6W A;  5JLJ B;  1WI1 A;  4KVG B;  2X18 A;  1BY1 A; 
#chains in the Genus database with same CATH homology
 3VOQ A;  3PVW A;  4K2P A;  1XX0 A;  2YS1 A;  2J0J A;  2NMB A;  3AJ4 A;  2CY5 A;  2ELB A;  3AU4 A;  1KI1 B;  4NY0 A;  2COC A;  1J0W A;  1BAK A;  4CYE A;  1V5M A;  2D9X A;  5C6R A;  2H7E A;  4CHM A;  2DLW A;  1N3H A;  3ODW A;  3PG7 A;  4WSF A;  3WA0 A;  3V5W A;  2DX5 A;  4DXA B;  1WJM A;  2RGN B;  1F5X A;  2D2Q A;  3MDB C;  5FI0 A;  5DHA B;  2N0Y A;  1X86 A;  1FHO A;  4TKN A;  3F0W A;  3ZDT A;  1V5U A;  3D8E A;  4F7G A;  2L1C A;  1TJ6 A;  5CLQ B;  1W1H A;  4Y94 A;  5HE3 A;  2ZPY A;  1WJ1 A;  2COD A;  4ZRK A;  1X05 A;  3SV1 A;  3UZT A;  1BTK A;  2RLO A;  2MWN B;  2GCL A;  2DKP A;  3ULB A;  5KQ1 A;  4HDO A;  4GOU A;  2Z0O A;  1XKE A;  2DFK A;  3A98 B;  4KHB B;  3KRW A;  2J0K A;  1NU2 A;  2Z0P A;  2AEH A;  5D27 A;  3KSY A;  1SHC A;  1NTV A;  2KGX B;  3DXC A;  1ZM0 A;  3ODX A;  1IRS A;  1OQN A;  4EJN A;  2K00 A;  4GMV A;  4DBB A;  2D11 A;  3FM8 C;  1FHW A;  1UNQ A;  1MIX A;  1UPQ A;  2RVB B;  2CAY A;  1K5D B;  3GF9 A;  2DHK A;  1BTN A;  1UNR A;  5J3Y A;  1U29 A;  1ZSQ A;  5C5B A;  1V5P A;  2FJL A;  2LUL A;  1TXD A;  2PZ1 A;  1FAO A;  4TYZ A;  1EGX A;  1U5D A;  2EC1 A;  2YF0 A;  2IFS A;  5LON B;  1KZ7 A;  2KCJ A;  4HAT B;  4EMO A;  2LOZ A;  4HB3 B;  2N23 A;  3O96 A;  4MK0 A;  4H8S A;  3SNH A;  3G9W A;  3HQC A;  2EJ8 A;  1FGZ A;  3JV3 A;  1Q67 A;  1DBH A;  1MK7 B;  2I5C A;  3GYP A;  2XQN M;  4A6K A;  2CRF A;  1U5E A;  4IOY X;  1U2B A;  2UZS A;  2DHJ A;  3HK0 A;  2W2W A;  4HHV A;  3WYF B;  2J0M A;  1PFJ A;  2LYD A;  4Z2N A;  2GCJ A;  1FGY A;  2JP2 A;  4KHA A;  4K17 A;  1AQC A;  1U5F A;  1ZC3 B;  3P6A A;  1DDM A;  2ROV A;  2VRW B;  4YON A;  1EAZ A;  1XOD A;  2LKO A;  4GPT B;  3BJI A;  1OMW A;  5HE1 A;  1XCG A;  5DI9 B;  2UZR A;  5J3Q A;  1WG7 A;  5KCV A;  5GOW B;  2E2X A;  2H7D A;  2NZ8 B;  5C5B B;  1QC6 A;  1MPH A;  5L81 A;  4CHJ A;  1MK9 B;  3PSC A;  4P7I A;  4A6F B;  1H10 A;  5JHG A;  2ADZ A;  2GJY A;  2OTX A;  2DA0 A;  5C16 A;  4HDQ A;  1X1G A;  2DN6 A;  1FOE A;  2D9Y A;  2EMT A;  2W2X C;  1P3R A;  1X1F A;  1P5T A;  1X11 A;  3IVF A;  1MAI A;  1U5G A;  1NI2 A;  2VKI A;  4Z2M B;  5DIF B;  3CXB B;  1W1D A;  3SUZ A;  5CLL B;  3ODO A;  2R0D A;  2I1K A;  2G35 A;  2EMS A;  2YSZ A;  1WGU A;  1V89 A;  2K2U A;  3KZ1 A;  4A5K A;  2I1J A;  1FHX A;  2YVC A;  3EO2 A;  1RRP B;  1J19 A;  1OY2 A;  4HB4 B;  5EFX A;  3TFM A;  1DRO A;  4GMX B;  4K81 A;  1M7R A;  2J59 M;  1PMS A;  3F5R A;  3RCP A;  3DXE A;  3FEH A;  1UEF A;  2CY4 A;  1B55 A;  3D8D A;  1H4R A;  1GC6 A;  3QBV B;  3QIJ A;  1QQG A;  2M14 A;  4GYV A;  3U8Z A;  3PEG A;  2DX1 A;  2W2X D;  2QKM A;  1NTY A;  2Z0Q A;  1V61 A;  1I2H A;  5FI1 A;  2R09 A;  4HB0 B;  3X23 A;  3PZD A;  2P8V A;  1FB8 A;  3MPX A;  1W1G A;  5DH9 B;  2HE7 A;  2COF A;  2D9Z A;  3T06 A;  2DHI A;  2RNR B;  2Y8G A;  1LB1 A;  5LOP B;  5C79 A;  3HW2 B;  5JHH A;  3U7D A;  1Y19 B;  2GS0 A;  4D0N B;  2QKL A;  1Y5O A;  3QWM A;  1XD4 A;  4HAX B;  4KAX B;  1AWE A;  3VIA A;  4MT7 A;  2COA A;  1KZG A;  4IFS A;  4ZRJ A;  1SGH A;  4WVF B;  1UNP A;  2MFQ A;  5D3X A;  4EKU A;  3FSS A;  3PVU A;  2K2J A;  4YL8 A;  2ELA A;  2YT0 A;  3TCA A;  3ULC A;  4PNK A;  2LG1 A;  3M1I B;  2HTH B;  1GG3 A;  3AU5 A;  1GC7 A;  4F7H A;  3A8Q A;  2L2I A;  2ROZ B;  1RJ2 A;  5JP4 A;  4A6H A;  3ML4 A;  3CIK A;  4WJ7 A;  2YRY A;  4BBK A;  1UPR A;  3KRX A;  3LJU X;  2MKR A;  5DHF B;  5J3T A;  1DYN A;  1U27 A;  2D9W A;  2YS5 A;  2P0D A;  2KR9 A;  2VSZ A;  2Y8F A;  3PVL A;  1I7A A;  4ZRI A;  4KHO A;  4F7U P;  1WGQ A;  2D4Q A;  1V88 A;  2DYQ A;  5D3Y A;  1EF1 A;  4DX8 A;  1E5W A;  3SO6 A;  4L6E A;  3P7Z A;  4MY6 A;  3NSU A;  4HAV B;  3KY9 A;  2DYN A;  2P0H A;  4C0A A;  2YS3 A;  2M38 A;  3D8F A;  4HAU B;  1WVH A;  1TQZ A;  2MDX A;  3TVV A;  4K2O A;  2D9V A;  2RSG A;  1MIZ B;  2KUP A;  1DDW A;  3SYX A;  2Y7B A;  1ZVR A;  1XR0 B;  2RUK B;  2UVM A;  4IAP A;  3GYO A;  4XWX A;  2DTC A;  1ISN A;  4NSW A;  2P0F A;  4HB2 B;  4GXB A;  5HE0 A;  3ZVR A;  4D0O A;  3A8P A;  2BCJ A;  4GZU A;  2DKQ A;  1BWN A;  4DX9 0;  2OQB A;  2I5F A;  1LW3 A;  2D10 A;  5KQ4 A;  3DXD A;  1ZC4 B;  1PLS A;  2V76 A;  1DDV A;  1P6S A;  1Z87 A;  4B6H A;  5HE2 A;  4GN1 A;  3BIN A;  1EVH A;  4A6F A;  1MKE A;  2LOX A;  5D3W A;  5D3V A;  1K5G B;  3TO1 A;  4HAW B;  4HAY B;  2AL6 A;  1M7E A;  2IYB A;  2YT1 A;  3N7C A;  3OAN A;  2Q13 A;  3TW1 A;  4HAZ B;  3PP2 A;  4PQ0 A;  5JLJ B;  1WI1 A;  4KVG B;  2X18 A;  1BY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...