2DYNA

Dynamin (pleckstrin homology domain) (dynph)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
111
structure length
111
Chain Sequence
ILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DYNAMIN
publication title Crystal structure of the pleckstrin homology domain from dynamin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signal transduction
total genus 22
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 3.6.5.5: Dynamin GTPase.
pdb deposition date 1997-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dynA00
5J3YA 3RCPA 3D8DA 4DX90 2HTHB 1PLSA 1M7EA 4HAWB 4GMVA 1OMWA 1OY2A 4HAZB 1UNPA 4HB4B 1U5FA 2DA0A 1UPQA 1P5TA 1FHOA 1WI1A 3TVVA 2Y8GA 4K17A 2ELBA 1MAIA 3KRXA 4GPTB 1MIZB 2Y7BA 2RNRB 1FAOA 4HDQA 4MT7A 3X23A 5C6RA 1XCGA 1BTKA 5HE3A 4WSFA 1MKEA 3M1IB 1DROA 1DBHA 4DBBA 2FJLA 2G35A 1K5GB 2ZPYA 4EKUA 2M38A 3SO6A 5C16A 1Z87A 4MK0A 3UZTA 2DX1A 3KZ1A 1X86A 2DHIA 1NTVA 2DKQA 2MWNB 3DXEA 1UNRA 1Y19B 1J19A 3PZDA 2DN6A 2COAA 2NZ8B 4HB2B 4MY6A 2YT0A 1PMSA 2GCJA 1W1HA 1WGQA 5D27A 2NMBA 1XD4A 1W1DA 3KY9A 3QWMA 4GN1A 2AL6A 2YT1A 3DXDA 4KVGB 3HQCA 2D9ZA 1X05A 4GZUA 1WVHA 4XWXA 2W2XC 5DI9B 5C79A 5CLQB 5J3TA 4C0AA 4YONA 1U5GA 3P7ZA 2VKIA 2LG1A 1U5EA 1DDVA 3KRWA 4KHOA 2R0DA 4KHBB 5JHHA 2E2XA 2EMTA 5DHAB 4HAVB 2CY4A 2RVBB 5C5BB 3FEHA 4HDOA 3QIJA 2YS1A 3BJIA 4K2OA 3FM8C 2P8VA 4IFSA 3GYPA 2OTXA 2D10A 4L6EA 5J3QA 2CY5A 4ZRIA 3ZVRA 4WVFB 1WJ1A 2P0HA 4Z2NA 3A8QA 1WG7A 3PG7A 1AWEA 1H4RA 2EMSA 4A6KA 1V5PA 2W2XD 1IRSA 2Q13A 1W1GA 2DKPA 2DHKA 2H7EA 1MK7B 5KCVA 1FB8A 2HE7A 2N23A 3SV1A 4IOYX 4H8SA 3SYXA 2DX5A 1WGUA 5CLLB 1X1FA 1GC7A 1Y5OA 2ELAA 2XQNM 2UVMA 4CHJA 1K5DB 3SUZA 2EJ8A 2BCJA 5JHGA 1B55A 1FHWA 2VSZA 2DFKA 2V76A 2JP2A 2D11A 3A98B 2YS5A 4DXAB 2KCJA 4F7GA 3TO1A 1SGHA 4TYZA 2DYNA 2Y8FA 1EVHA 3P6AA 1RRPB 1FGYA 1UEFA 1M7RA 4NSWA 5LOPB 5DIFB 2M14A 1TXDA 2LULA 4ZRKA 3KSYA 2VRWB 1FHXA 2EC1A 1KI1B 4A6FA 4CHMA 3F5RA 5LONB 3SNHA 1ZSQA 2AEHA 3A8PA 5JLJB 3AJ4A 4B6HA 1ZC3B 1ZC4B 5FI0A 3ULBA 1U2BA 4GXBA 4HHVA 2RSGA 1X1GA 5L81A 3G9WA 2I5CA 5HE0A 5DH9B 2CODA 2RUKB 2R09A 2K2UA 3N7CA 4BBKA 2DHJA 2H7DA 4EMOA 2YF0A 5GOWB 2J0JA 4IAPA 3WA0A 2K2JA 3TCAA 3D8EA 3MDBC 3TW1A 1XR0B 3ODOA 2KGXB 1OQNA 2D9VA 3PEGA 2Z0PA 2LOXA 1V61A 4KHAA 1ZVRA 1AQCA 4TKNA 1FGZA 4WJ7A 1XKEA 1LW3A 1MIXA 3D8FA 3VIAA 1V89A 2DTCA 1UNQA 4KAXB 1DYNA 2P0DA 1P6SA 1TQZA 5D3XA 2D2QA 2X18A 2D4QA 4P7IA 1E5WA 5FI1A 2UZSA 3MPXA 2D9WA 1V5UA 2I1KA 1RJ2A 3PVWA 3BINA 1BAKA 2PZ1A 1BTNA 2J0MA 1DDWA 1GG3A 1NI2A 1X11A 5KQ1A 3QBVB 1J0WA 1GC6A 3F0WA 2D9XA 3IVFA 1KZ7A 5HE2A 3O96A 1NTYA 1H10A 1XODA 4NY0A 1MK9B 1SHCA 3ULCA 2GS0A 2Z0QA 3FSSA 5HE1A 3T06A 2MKRA 4A5KA 2QKMA 2RLOA 5D3YA 2MDXA 1I2HA 3AU5A 2Z0OA 2LYDA 2GCLA 5C5BA 2P0FA 1KZGA 5JP4A 2UZRA 2L1CA 2IYBA 1FOEA 2J59M 2L2IA 1TJ6A 3DXCA 1ISNA 4HATB 4K81A 1WJMA 3OANA 2DYQA 2RGNB 4Z2MB 3V5WA 1EF1A 4DX8A 1PFJA 3HK0A 3PP2A 3U8ZA 2KUPA 5D3VA 2CAYA 5D3WA 2I5FA 2COCA 4HB0B 1P3RA 2N0YA 2QKLA 3ML4A 2YSZA 3WYFB 3PVUA 4ZRJA 3AU4A 4YL8A 4CYEA 1MPHA 3NSUA 4HAUB 4D0NB 5EFXA 3TFMA 1DDMA 2D9YA 3PVLA 1V88A 4PNKA 1I7AA 2YS3A 1UPRA 3ODWA 1V5MA 2CRFA 4K2PA 1Q67A 2ADZA 2K00A 1NU2A 3ZDTA 2ROVA 3CIKA 4F7HA 1N3HA 1EGXA 1U27A 4EJNA 2W2WA 1QC6A 2J0KA 2LKOA 3GYOA 1XX0A 3ODXA 2COFA 2I1JA 2MFQA 1U29A 1BWNA 2DLWA 3VOQA 2YVCA 3CXBB 4PQ0A 1QQGA 2GJYA 2LOZA 2YRYA 4F7UP 3U7DA 4HAXB 2ROZB 1LB1A 3LJUX 4Y94A 2IFSA 4A6FB 1EAZA 2OQBA 5KQ4A 4HB3B 5DHFB 1ZM0A 3PSCA 3HW2B 4A6HA 1U5DA 4HAYB 4GMXB
chains in the Genus database with same CATH superfamily
5J3YA 3RCPA 3D8DA 4DX90 2HTHB 1PLSA 1M7EA 4HAWB 4GMVA 1OMWA 1OY2A 4HAZB 1UNPA 4HB4B 1U5FA 2DA0A 1UPQA 1P5TA 3DCXA 1FHOA 1WI1A 4GOUA 3OHMB 3TVVA 2Y8GA 4K17A 2ELBA 1MAIA 3KRXA 4GPTB 1MIZB 2Y7BA 2RNRB 1FAOA 4HDQA 4MT7A 3X23A 5C6RA 1XCGA 1BTKA 1MI1A 5HE3A 4WSFA 1MKEA 3NWAA 3M1IB 1DROA 1DBHA 4DBBA 2FJLA 2G35A 1K5GB 2ZPYA 4EKUA 2M38A 4QJ4B 3SO6A 5C16A 1Z87A 4MK0A 3UZTA 2DX1A 3KZ1A 1X86A 2DHIA 1NTVA 2DKQA 2ZKMX 2MWNB 3DXEA 1UNRA 1Y19B 1J19A 3PZDA 2DN6A 2COAA 2NZ8B 5I2MA 4HB2B 4MY6A 2YT0A 1PMSA 2GCJA 1W1HA 1WGQA 5D27A 2NMBA 1XD4A 1W1DA 3KY9A 3QWMA 4GN1A 2AL6A 2YT1A 3DXDA 4KVGB 3HQCA 3NW8A 2D9ZA 1X05A 4GZUA 1WVHA 4XWXA 2W2XC 5DI9B 5C79A 5CLQB 5J3TA 4C0AA 4YONA 4DIXA 1U5GA 3P7ZA 2VKIA 2LG1A 1U5EA 1DDVA 3KRWA 4KHOA 2R0DA 4KHBB 5JHHA 2E2XA 3NWDA 2EMTA 5DHAB 4HAVB 2CY4A 2RVBB 5C5BB 3FEHA 4HDOA 3QIJA 2YS1A 3BJIA 4K2OA 3FM8C 2P8VA 4IFSA 3GYPA 2OTXA 2D10A 4L6EA 5J3QA 2CY5A 4ZRIA 3ZVRA 4WVFB 1T77A 1WJ1A 2P0HA 4Z2NA 3A8QA 1WG7A 3PG7A 2KIGA 1AWEA 1H4RA 2EMSA 4A6KA 1V5PA 2W2XD 1IRSA 2Q13A 1W1GA 2DKPA 3A58A 2DHKA 2H7EA 1MK7B 5KCVA 1FB8A 2HE7A 2N23A 3SV1A 4IOYX 4H8SA 2Z13A 3SYXA 2DX5A 1WGUA 5CLLB 1X1FA 1GC7A 1Y5OA 2ELAA 2XQNM 2UVMA 4CHJA 1K5DB 3SUZA 2EJ8A 2BCJA 5JHGA 1B55A 1FHWA 2VSZA 2DFKA 2V76A 2JP2A 2D11A 3A98B 2YS5A 4DXAB 2KCJA 4F7GA 2KUQA 4QJ3B 3TO1A 1SGHA 4TYZA 2DYNA 2Y8FA 1EVHA 3P6AA 1RRPB 1FGYA 1UEFA 1M7RA 4NSWA 2Z59A 5LOPB 5DIFB 2RRFA 2M14A 1TXDA 2LULA 4ZRKA 3KSYA 2VRWB 1FHXA 2EC1A 1KI1B 4A6FA 4CHMA 3F5RA 5LONB 3SNHA 1ZSQA 2AEHA 3A8PA 5JLJB 3AJ4A 4B6HA 1ZC3B 1ZC4B 5FI0A 3ULBA 4OSNA 1U2BA 4GXBA 4HHVA 2RSGA 1X1GA 5L81A 3G9WA 2I5CA 5HE0A 5DH9B 2CODA 2RUKB 2R09A 2K2UA 3N7CA 4BBKA 2DHJA 2H7DA 4EMOA 2YF0A 5GOWB 2J0JA 4IAPA 3WA0A 2K2JA 3TCAA 3D8EA 3MDBC 3TW1A 1XR0B 3ODOA 4GNKB 2KGXB 1OQNA 2D9VA 3PEGA 2Z0PA 2LOXA 1V61A 1ZYIA 1ZVRA 4KHAA 1AQCA 4TKNA 1FGZA 4WJ7A 4QJ5B 1XKEA 1LW3A 1MIXA 2FJUB 3D8FA 3VIAA 1V89A 2DTCA 1UNQA 2YT2A 4KAXB 1DYNA 2P0DA 1P6SA 1TQZA 5D3XA 2D2QA 2X18A 2D4QA 4P7IA 1E5WA 5FI1A 2UZSA 3MPXA 5LG4B 2D9WA 1V5UA 2I1KA 1RJ2A 3PVWA 3BINA 1BAKA 2PZ1A 1BTNA 2J0MA 1DDWA 1GG3A 1NI2A 1X11A 5KQ1A 3QBVB 1J0WA 1GC6A 3F0WA 2D9XA 3IVFA 1KZ7A 5HE2A 3O96A 1NTYA 2Z14A 1H10A 1XODA 4NY0A 1MK9B 3HSAA 1SHCA 3ULCA 2GS0A 2Z0QA 3FVCA 3FSSA 2KIEA 2Z4DA 5HE1A 3T06A 2MKRA 4A5KA 2QKMA 2RLOA 2R2YA 5D3YA 4KHBA 2MDXA 2GUMA 1I2HA 3AU5A 3U12A 2Z0OA 2LYDA 2GCLA 5C5BA 2P0FA 1KZGA 5JP4A 2UZRA 2L1CA 2IYBA 1FOEA 2J59M 2L2IA 3NWFA 1TJ6A 3DXCA 1ISNA 4HSIA 4HATB 4K81A 1WJMA 4QXAB 3OANA 2DYQA 2RGNB 4Z2MB 3V5WA 1EF1A 4DX8A 1PFJA 3HK0A 2K8EA 3PP2A 3U8ZA 2KUPA 5D3VA 2CAYA 5D3WA 2I5FA 2COCA 4HB0B 1P3RA 5I2SA 4L1RA 2N0YA 2QKLA 3ML4A 4D6WA 2YSZA 3WYFB 3PVUA 4ZRJA 3AU4A 4YL8A 2KR0A 4CYEA 1MPHA 3NSUA 4HAUB 4D0NB 5EFXA 3TFMA 1DDMA 2D9YA 5IRSA 3PVLA 4CSQA 1V88A 4PNKA 1I7AA 2YS3A 3HIEA 4OT1A 5M4YB 1UPRA 3ODWA 3B77A 1V5MA 2CRFA 4K2PA 1Q67A 2ADZA 2K00A 1NU2A 3ZDTA 2ROVA 3CIKA 4F7HA 1N3HA 1EGXA 1U27A 4EJNA 2W2WA 1QC6A 2J0KA 2LKOA 3GYOA 1XX0A 2K49A 3ODXA 2COFA 2I1JA 2MFQA 1U29A 1BWNA 2DLWA 3VOQA 2YVCA 3CXBB 4PQ0A 1QQGA 2GJYA 2LOZA 2YRYA 4F7UP 3U7DA 4HAXB 2ROZB 1LB1A 3LJUX 4Y94A 2IFSA 4A6FB 1EAZA 2OQBA 5KQ4A 4HB3B 5DHFB 1ZM0A 3PSCA 3HW2B 4A6HA 1U5DA 4HAYB 2NBVA 4GMXB
chains in the Genus database with same CATH topology
5J3YA 3RCPA 3D8DA 4DX90 2HTHB 1PLSA 1M7EA 4HAWB 4GMVA 1OMWA 1OY2A 4HAZB 1UNPA 4HB4B 1U5FA 2DA0A 1UPQA 1P5TA 1FHOA 1WI1A 3TVVA 2Y8GA 4K17A 2ELBA 1MAIA 3KRXA 4GPTB 1MIZB 2Y7BA 2RNRB 1FAOA 4HDQA 4MT7A 3X23A 5C6RA 1XCGA 1BTKA 5HE3A 4WSFA 1MKEA 3M1IB 1DROA 1DBHA 4DBBA 2FJLA 2G35A 1K5GB 2ZPYA 4EKUA 2M38A 3SO6A 5C16A 1Z87A 4MK0A 3UZTA 2DX1A 3KZ1A 1X86A 2DHIA 1NTVA 2DKQA 2MWNB 3DXEA 1UNRA 1Y19B 1J19A 3PZDA 2DN6A 2COAA 2NZ8B 4HB2B 4MY6A 2YT0A 1PMSA 2GCJA 1W1HA 1WGQA 5D27A 2NMBA 1XD4A 1W1DA 3KY9A 3QWMA 4GN1A 2AL6A 2YT1A 3DXDA 4KVGB 3HQCA 2D9ZA 1X05A 4GZUA 1WVHA 4XWXA 2W2XC 5DI9B 5C79A 5CLQB 5J3TA 4C0AA 4YONA 1U5GA 3P7ZA 2VKIA 2LG1A 1U5EA 1DDVA 3KRWA 4KHOA 2R0DA 4KHBB 5JHHA 2E2XA 2EMTA 5DHAB 4HAVB 2CY4A 2RVBB 5C5BB 3FEHA 4HDOA 3QIJA 2YS1A 3BJIA 4K2OA 3FM8C 2P8VA 4IFSA 3GYPA 2OTXA 2D10A 4L6EA 5J3QA 2CY5A 4ZRIA 3ZVRA 4WVFB 1WJ1A 2P0HA 4Z2NA 3A8QA 1WG7A 3PG7A 1AWEA 1H4RA 2EMSA 4A6KA 1V5PA 2W2XD 1IRSA 2Q13A 1W1GA 2DKPA 2DHKA 2H7EA 1MK7B 5KCVA 1FB8A 2HE7A 2N23A 3SV1A 4IOYX 4H8SA 3SYXA 2DX5A 1WGUA 5CLLB 1X1FA 1GC7A 1Y5OA 2ELAA 2XQNM 2UVMA 4CHJA 1K5DB 3SUZA 2EJ8A 2BCJA 5JHGA 1B55A 1FHWA 2VSZA 2DFKA 2V76A 2JP2A 2D11A 3A98B 2YS5A 4DXAB 2KCJA 4F7GA 3TO1A 1SGHA 4TYZA 2DYNA 2Y8FA 1EVHA 3P6AA 1RRPB 1FGYA 1UEFA 1M7RA 4NSWA 5LOPB 5DIFB 2M14A 1TXDA 2LULA 4ZRKA 3KSYA 2VRWB 1FHXA 2EC1A 1KI1B 4A6FA 4CHMA 3F5RA 5LONB 3SNHA 1ZSQA 2AEHA 3A8PA 5JLJB 3AJ4A 4B6HA 1ZC3B 1ZC4B 5FI0A 3ULBA 1U2BA 4GXBA 4HHVA 2RSGA 1X1GA 5L81A 3G9WA 2I5CA 5HE0A 5DH9B 2CODA 2RUKB 2R09A 2K2UA 3N7CA 4BBKA 2DHJA 2H7DA 4EMOA 2YF0A 5GOWB 2J0JA 4IAPA 3WA0A 2K2JA 3TCAA 3D8EA 3MDBC 3TW1A 1XR0B 3ODOA 2KGXB 1OQNA 2D9VA 3PEGA 2Z0PA 2LOXA 1V61A 4KHAA 1ZVRA 1AQCA 4TKNA 1FGZA 4WJ7A 1XKEA 1LW3A 1MIXA 3D8FA 3VIAA 1V89A 2DTCA 1UNQA 4KAXB 1DYNA 2P0DA 1P6SA 1TQZA 5D3XA 2D2QA 2X18A 2D4QA 4P7IA 1E5WA 5FI1A 2UZSA 3MPXA 2D9WA 1V5UA 2I1KA 1RJ2A 3PVWA 3BINA 1BAKA 2PZ1A 1BTNA 2J0MA 1DDWA 1GG3A 1NI2A 1X11A 5KQ1A 3QBVB 1J0WA 1GC6A 3F0WA 2D9XA 3IVFA 1KZ7A 5HE2A 3O96A 1NTYA 1H10A 1XODA 4NY0A 1MK9B 1SHCA 3ULCA 2GS0A 2Z0QA 3FSSA 5HE1A 3T06A 2MKRA 4A5KA 2QKMA 2RLOA 5D3YA 2MDXA 1I2HA 3AU5A 2Z0OA 2LYDA 2GCLA 5C5BA 2P0FA 1KZGA 5JP4A 2UZRA 2L1CA 2IYBA 1FOEA 2J59M 2L2IA 1TJ6A 3DXCA 1ISNA 4HATB 4K81A 1WJMA 3OANA 2DYQA 2RGNB 4Z2MB 3V5WA 1EF1A 4DX8A 1PFJA 3HK0A 3PP2A 3U8ZA 2KUPA 5D3VA 2CAYA 5D3WA 2I5FA 2COCA 4HB0B 1P3RA 2N0YA 2QKLA 3ML4A 2YSZA 3WYFB 3PVUA 4ZRJA 3AU4A 4YL8A 4CYEA 1MPHA 3NSUA 4HAUB 4D0NB 5EFXA 3TFMA 1DDMA 2D9YA 3PVLA 1V88A 4PNKA 1I7AA 2YS3A 1UPRA 3ODWA 1V5MA 2CRFA 4K2PA 1Q67A 2ADZA 2K00A 1NU2A 3ZDTA 2ROVA 3CIKA 4F7HA 1N3HA 1EGXA 1U27A 4EJNA 2W2WA 1QC6A 2J0KA 2LKOA 3GYOA 1XX0A 3ODXA 2COFA 2I1JA 2MFQA 1U29A 1BWNA 2DLWA 3VOQA 2YVCA 3CXBB 4PQ0A 1QQGA 2GJYA 2LOZA 2YRYA 4F7UP 3U7DA 4HAXB 2ROZB 1LB1A 3LJUX 4Y94A 2IFSA 4A6FB 1EAZA 2OQBA 5KQ4A 4HB3B 5DHFB 1ZM0A 3PSCA 3HW2B 4A6HA 1U5DA 4HAYB 4GMXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J3Y A;  3RCP A;  3D8D A;  4DX9 0;  2HTH B;  1PLS A;  1M7E A;  4HAW B;  4GMV A;  1OMW A;  1OY2 A;  4HAZ B;  1UNP A;  4HB4 B;  1U5F A;  2DA0 A;  1UPQ A;  1P5T A;  1FHO A;  1WI1 A;  3TVV A;  2Y8G A;  4K17 A;  2ELB A;  1MAI A;  3KRX A;  4GPT B;  1MIZ B;  2Y7B A;  2RNR B;  1FAO A;  4HDQ A;  4MT7 A;  3X23 A;  5C6R A;  1XCG A;  1BTK A;  5HE3 A;  4WSF A;  1MKE A;  3M1I B;  1DRO A;  1DBH A;  4DBB A;  2FJL A;  2G35 A;  1K5G B;  2ZPY A;  4EKU A;  2M38 A;  3SO6 A;  5C16 A;  1Z87 A;  4MK0 A;  3UZT A;  2DX1 A;  3KZ1 A;  1X86 A;  2DHI A;  1NTV A;  2DKQ A;  2MWN B;  3DXE A;  1UNR A;  1Y19 B;  1J19 A;  3PZD A;  2DN6 A;  2COA A;  2NZ8 B;  4HB2 B;  4MY6 A;  2YT0 A;  1PMS A;  2GCJ A;  1W1H A;  1WGQ A;  5D27 A;  2NMB A;  1XD4 A;  1W1D A;  3KY9 A;  3QWM A;  4GN1 A;  2AL6 A;  2YT1 A;  3DXD A;  4KVG B;  3HQC A;  2D9Z A;  1X05 A;  4GZU A;  1WVH A;  4XWX A;  2W2X C;  5DI9 B;  5C79 A;  5CLQ B;  5J3T A;  4C0A A;  4YON A;  1U5G A;  3P7Z A;  2VKI A;  2LG1 A;  1U5E A;  1DDV A;  3KRW A;  4KHO A;  2R0D A;  4KHB B;  5JHH A;  2E2X A;  2EMT A;  5DHA B;  4HAV B;  2CY4 A;  2RVB B;  5C5B B;  3FEH A;  4HDO A;  3QIJ A;  2YS1 A;  3BJI A;  4K2O A;  3FM8 C;  2P8V A;  4IFS A;  3GYP A;  2OTX A;  2D10 A;  4L6E A;  5J3Q A;  2CY5 A;  4ZRI A;  3ZVR A;  4WVF B;  1WJ1 A;  2P0H A;  4Z2N A;  3A8Q A;  1WG7 A;  3PG7 A;  1AWE A;  1H4R A;  2EMS A;  4A6K A;  1V5P A;  2W2X D;  1IRS A;  2Q13 A;  1W1G A;  2DKP A;  2DHK A;  2H7E A;  1MK7 B;  5KCV A;  1FB8 A;  2HE7 A;  2N23 A;  3SV1 A;  4IOY X;  4H8S A;  3SYX A;  2DX5 A;  1WGU A;  5CLL B;  1X1F A;  1GC7 A;  1Y5O A;  2ELA A;  2XQN M;  2UVM A;  4CHJ A;  1K5D B;  3SUZ A;  2EJ8 A;  2BCJ A;  5JHG A;  1B55 A;  1FHW A;  2VSZ A;  2DFK A;  2V76 A;  2JP2 A;  2D11 A;  3A98 B;  2YS5 A;  4DXA B;  2KCJ A;  4F7G A;  3TO1 A;  1SGH A;  4TYZ A;  2DYN A;  2Y8F A;  1EVH A;  3P6A A;  1RRP B;  1FGY A;  1UEF A;  1M7R A;  4NSW A;  5LOP B;  5DIF B;  2M14 A;  1TXD A;  2LUL A;  4ZRK A;  3KSY A;  2VRW B;  1FHX A;  2EC1 A;  1KI1 B;  4A6F A;  4CHM A;  3F5R A;  5LON B;  3SNH A;  1ZSQ A;  2AEH A;  3A8P A;  5JLJ B;  3AJ4 A;  4B6H A;  1ZC3 B;  1ZC4 B;  5FI0 A;  3ULB A;  1U2B A;  4GXB A;  4HHV A;  2RSG A;  1X1G A;  5L81 A;  3G9W A;  2I5C A;  5HE0 A;  5DH9 B;  2COD A;  2RUK B;  2R09 A;  2K2U A;  3N7C A;  4BBK A;  2DHJ A;  2H7D A;  4EMO A;  2YF0 A;  5GOW B;  2J0J A;  4IAP A;  3WA0 A;  2K2J A;  3TCA A;  3D8E A;  3MDB C;  3TW1 A;  1XR0 B;  3ODO A;  2KGX B;  1OQN A;  2D9V A;  3PEG A;  2Z0P A;  2LOX A;  1V61 A;  4KHA A;  1ZVR A;  1AQC A;  4TKN A;  1FGZ A;  4WJ7 A;  1XKE A;  1LW3 A;  1MIX A;  3D8F A;  3VIA A;  1V89 A;  2DTC A;  1UNQ A;  4KAX B;  1DYN A;  2P0D A;  1P6S A;  1TQZ A;  5D3X A;  2D2Q A;  2X18 A;  2D4Q A;  4P7I A;  1E5W A;  5FI1 A;  2UZS A;  3MPX A;  2D9W A;  1V5U A;  2I1K A;  1RJ2 A;  3PVW A;  3BIN A;  1BAK A;  2PZ1 A;  1BTN A;  2J0M A;  1DDW A;  1GG3 A;  1NI2 A;  1X11 A;  5KQ1 A;  3QBV B;  1J0W A;  1GC6 A;  3F0W A;  2D9X A;  3IVF A;  1KZ7 A;  5HE2 A;  3O96 A;  1NTY A;  1H10 A;  1XOD A;  4NY0 A;  1MK9 B;  1SHC A;  3ULC A;  2GS0 A;  2Z0Q A;  3FSS A;  5HE1 A;  3T06 A;  2MKR A;  4A5K A;  2QKM A;  2RLO A;  5D3Y A;  2MDX A;  1I2H A;  3AU5 A;  2Z0O A;  2LYD A;  2GCL A;  5C5B A;  2P0F A;  1KZG A;  5JP4 A;  2UZR A;  2L1C A;  2IYB A;  1FOE A;  2J59 M;  2L2I A;  1TJ6 A;  3DXC A;  1ISN A;  4HAT B;  4K81 A;  1WJM A;  3OAN A;  2DYQ A;  2RGN B;  4Z2M B;  3V5W A;  1EF1 A;  4DX8 A;  1PFJ A;  3HK0 A;  3PP2 A;  3U8Z A;  2KUP A;  5D3V A;  2CAY A;  5D3W A;  2I5F A;  2COC A;  4HB0 B;  1P3R A;  2N0Y A;  2QKL A;  3ML4 A;  2YSZ A;  3WYF B;  3PVU A;  4ZRJ A;  3AU4 A;  4YL8 A;  4CYE A;  1MPH A;  3NSU A;  4HAU B;  4D0N B;  5EFX A;  3TFM A;  1DDM A;  2D9Y A;  3PVL A;  1V88 A;  4PNK A;  1I7A A;  2YS3 A;  1UPR A;  3ODW A;  1V5M A;  2CRF A;  4K2P A;  1Q67 A;  2ADZ A;  2K00 A;  1NU2 A;  3ZDT A;  2ROV A;  3CIK A;  4F7H A;  1N3H A;  1EGX A;  1U27 A;  4EJN A;  2W2W A;  1QC6 A;  2J0K A;  2LKO A;  3GYO A;  1XX0 A;  3ODX A;  2COF A;  2I1J A;  2MFQ A;  1U29 A;  1BWN A;  2DLW A;  3VOQ A;  2YVC A;  3CXB B;  4PQ0 A;  1QQG A;  2GJY A;  2LOZ A;  2YRY A;  4F7U P;  3U7D A;  4HAX B;  2ROZ B;  1LB1 A;  3LJU X;  4Y94 A;  2IFS A;  4A6F B;  1EAZ A;  2OQB A;  5KQ4 A;  4HB3 B;  5DHF B;  1ZM0 A;  3PSC A;  3HW2 B;  4A6H A;  1U5D A;  4HAY B;  4GMX B; 
#chains in the Genus database with same CATH topology
 5J3Y A;  3RCP A;  3D8D A;  4DX9 0;  2HTH B;  1PLS A;  1M7E A;  4HAW B;  4GMV A;  1OMW A;  1OY2 A;  4HAZ B;  1UNP A;  4HB4 B;  1U5F A;  2DA0 A;  1UPQ A;  1P5T A;  3DCX A;  1FHO A;  1WI1 A;  4GOU A;  3OHM B;  3TVV A;  2Y8G A;  4K17 A;  2ELB A;  1MAI A;  3KRX A;  4GPT B;  1MIZ B;  2Y7B A;  2RNR B;  1FAO A;  4HDQ A;  4MT7 A;  3X23 A;  5C6R A;  1XCG A;  1BTK A;  1MI1 A;  5HE3 A;  4WSF A;  1MKE A;  3NWA A;  3M1I B;  1DRO A;  1DBH A;  4DBB A;  2FJL A;  2G35 A;  1K5G B;  2ZPY A;  4EKU A;  2M38 A;  4QJ4 B;  3SO6 A;  5C16 A;  1Z87 A;  4MK0 A;  3UZT A;  2DX1 A;  3KZ1 A;  1X86 A;  2DHI A;  1NTV A;  2DKQ A;  2ZKM X;  2MWN B;  3DXE A;  1UNR A;  1Y19 B;  1J19 A;  3PZD A;  2DN6 A;  2COA A;  2NZ8 B;  5I2M A;  4HB2 B;  4MY6 A;  2YT0 A;  1PMS A;  2GCJ A;  1W1H A;  1WGQ A;  5D27 A;  2NMB A;  1XD4 A;  1W1D A;  3KY9 A;  3QWM A;  4GN1 A;  2AL6 A;  2YT1 A;  3DXD A;  4KVG B;  3HQC A;  3NW8 A;  2D9Z A;  1X05 A;  4GZU A;  1WVH A;  4XWX A;  2W2X C;  5DI9 B;  5C79 A;  5CLQ B;  5J3T A;  4C0A A;  4YON A;  4DIX A;  1U5G A;  3P7Z A;  2VKI A;  2LG1 A;  1U5E A;  1DDV A;  3KRW A;  4KHO A;  2R0D A;  4KHB B;  5JHH A;  2E2X A;  3NWD A;  2EMT A;  5DHA B;  4HAV B;  2CY4 A;  2RVB B;  5C5B B;  3FEH A;  4HDO A;  3QIJ A;  2YS1 A;  3BJI A;  4K2O A;  3FM8 C;  2P8V A;  4IFS A;  3GYP A;  2OTX A;  2D10 A;  4L6E A;  5J3Q A;  2CY5 A;  4ZRI A;  3ZVR A;  4WVF B;  1T77 A;  1WJ1 A;  2P0H A;  4Z2N A;  3A8Q A;  1WG7 A;  3PG7 A;  2KIG A;  1AWE A;  1H4R A;  2EMS A;  4A6K A;  1V5P A;  2W2X D;  1IRS A;  2Q13 A;  1W1G A;  2DKP A;  3A58 A;  2DHK A;  2H7E A;  1MK7 B;  5KCV A;  1FB8 A;  2HE7 A;  2N23 A;  3SV1 A;  4IOY X;  4H8S A;  2Z13 A;  3SYX A;  2DX5 A;  1WGU A;  5CLL B;  1X1F A;  1GC7 A;  1Y5O A;  2ELA A;  2XQN M;  2UVM A;  4CHJ A;  1K5D B;  3SUZ A;  2EJ8 A;  2BCJ A;  5JHG A;  1B55 A;  1FHW A;  2VSZ A;  2DFK A;  2V76 A;  2JP2 A;  2D11 A;  3A98 B;  2YS5 A;  4DXA B;  2KCJ A;  4F7G A;  2KUQ A;  4QJ3 B;  3TO1 A;  1SGH A;  4TYZ A;  2DYN A;  2Y8F A;  1EVH A;  3P6A A;  1RRP B;  1FGY A;  1UEF A;  1M7R A;  4NSW A;  2Z59 A;  5LOP B;  5DIF B;  2RRF A;  2M14 A;  1TXD A;  2LUL A;  4ZRK A;  3KSY A;  2VRW B;  1FHX A;  2EC1 A;  1KI1 B;  4A6F A;  4CHM A;  3F5R A;  5LON B;  3SNH A;  1ZSQ A;  2AEH A;  3A8P A;  5JLJ B;  3AJ4 A;  4B6H A;  1ZC3 B;  1ZC4 B;  5FI0 A;  3ULB A;  4OSN A;  1U2B A;  4GXB A;  4HHV A;  2RSG A;  1X1G A;  5L81 A;  3G9W A;  2I5C A;  5HE0 A;  5DH9 B;  2COD A;  2RUK B;  2R09 A;  2K2U A;  3N7C A;  4BBK A;  2DHJ A;  2H7D A;  4EMO A;  2YF0 A;  5GOW B;  2J0J A;  4IAP A;  3WA0 A;  2K2J A;  3TCA A;  3D8E A;  3MDB C;  3TW1 A;  1XR0 B;  3ODO A;  4GNK B;  2KGX B;  1OQN A;  2D9V A;  3PEG A;  2Z0P A;  2LOX A;  1V61 A;  1ZYI A;  1ZVR A;  4KHA A;  1AQC A;  4TKN A;  1FGZ A;  4WJ7 A;  4QJ5 B;  1XKE A;  1LW3 A;  1MIX A;  2FJU B;  3D8F A;  3VIA A;  1V89 A;  2DTC A;  1UNQ A;  2YT2 A;  4KAX B;  1DYN A;  2P0D A;  1P6S A;  1TQZ A;  5D3X A;  2D2Q A;  2X18 A;  2D4Q A;  4P7I A;  1E5W A;  5FI1 A;  2UZS A;  3MPX A;  5LG4 B;  2D9W A;  1V5U A;  2I1K A;  1RJ2 A;  3PVW A;  3BIN A;  1BAK A;  2PZ1 A;  1BTN A;  2J0M A;  1DDW A;  1GG3 A;  1NI2 A;  1X11 A;  5KQ1 A;  3QBV B;  1J0W A;  1GC6 A;  3F0W A;  2D9X A;  3IVF A;  1KZ7 A;  5HE2 A;  3O96 A;  1NTY A;  2Z14 A;  1H10 A;  1XOD A;  4NY0 A;  1MK9 B;  3HSA A;  1SHC A;  3ULC A;  2GS0 A;  2Z0Q A;  3FVC A;  3FSS A;  2KIE A;  2Z4D A;  5HE1 A;  3T06 A;  2MKR A;  4A5K A;  2QKM A;  2RLO A;  2R2Y A;  5D3Y A;  4KHB A;  2MDX A;  2GUM A;  1I2H A;  3AU5 A;  3U12 A;  2Z0O A;  2LYD A;  2GCL A;  5C5B A;  2P0F A;  1KZG A;  5JP4 A;  2UZR A;  2L1C A;  2IYB A;  1FOE A;  2J59 M;  2L2I A;  3NWF A;  1TJ6 A;  3DXC A;  1ISN A;  4HSI A;  4HAT B;  4K81 A;  1WJM A;  4QXA B;  3OAN A;  2DYQ A;  2RGN B;  4Z2M B;  3V5W A;  1EF1 A;  4DX8 A;  1PFJ A;  3HK0 A;  2K8E A;  3PP2 A;  3U8Z A;  2KUP A;  5D3V A;  2CAY A;  5D3W A;  2I5F A;  2COC A;  4HB0 B;  1P3R A;  5I2S A;  4L1R A;  2N0Y A;  2QKL A;  3ML4 A;  4D6W A;  2YSZ A;  3WYF B;  3PVU A;  4ZRJ A;  3AU4 A;  4YL8 A;  2KR0 A;  4CYE A;  1MPH A;  3NSU A;  4HAU B;  4D0N B;  5EFX A;  3TFM A;  1DDM A;  2D9Y A;  5IRS A;  3PVL A;  4CSQ A;  1V88 A;  4PNK A;  1I7A A;  2YS3 A;  3HIE A;  4OT1 A;  5M4Y B;  1UPR A;  3ODW A;  3B77 A;  1V5M A;  2CRF A;  4K2P A;  1Q67 A;  2ADZ A;  2K00 A;  1NU2 A;  3ZDT A;  2ROV A;  3CIK A;  4F7H A;  1N3H A;  1EGX A;  1U27 A;  4EJN A;  2W2W A;  1QC6 A;  2J0K A;  2LKO A;  3GYO A;  1XX0 A;  2K49 A;  3ODX A;  2COF A;  2I1J A;  2MFQ A;  1U29 A;  1BWN A;  2DLW A;  3VOQ A;  2YVC A;  3CXB B;  4PQ0 A;  1QQG A;  2GJY A;  2LOZ A;  2YRY A;  4F7U P;  3U7D A;  4HAX B;  2ROZ B;  1LB1 A;  3LJU X;  4Y94 A;  2IFS A;  4A6F B;  1EAZ A;  2OQB A;  5KQ4 A;  4HB3 B;  5DHF B;  1ZM0 A;  3PSC A;  3HW2 B;  4A6H A;  1U5D A;  4HAY B;  2NBV A;  4GMX B; 
#chains in the Genus database with same CATH homology
 5J3Y A;  3RCP A;  3D8D A;  4DX9 0;  2HTH B;  1PLS A;  1M7E A;  4HAW B;  4GMV A;  1OMW A;  1OY2 A;  4HAZ B;  1UNP A;  4HB4 B;  1U5F A;  2DA0 A;  1UPQ A;  1P5T A;  1FHO A;  1WI1 A;  3TVV A;  2Y8G A;  4K17 A;  2ELB A;  1MAI A;  3KRX A;  4GPT B;  1MIZ B;  2Y7B A;  2RNR B;  1FAO A;  4HDQ A;  4MT7 A;  3X23 A;  5C6R A;  1XCG A;  1BTK A;  5HE3 A;  4WSF A;  1MKE A;  3M1I B;  1DRO A;  1DBH A;  4DBB A;  2FJL A;  2G35 A;  1K5G B;  2ZPY A;  4EKU A;  2M38 A;  3SO6 A;  5C16 A;  1Z87 A;  4MK0 A;  3UZT A;  2DX1 A;  3KZ1 A;  1X86 A;  2DHI A;  1NTV A;  2DKQ A;  2MWN B;  3DXE A;  1UNR A;  1Y19 B;  1J19 A;  3PZD A;  2DN6 A;  2COA A;  2NZ8 B;  4HB2 B;  4MY6 A;  2YT0 A;  1PMS A;  2GCJ A;  1W1H A;  1WGQ A;  5D27 A;  2NMB A;  1XD4 A;  1W1D A;  3KY9 A;  3QWM A;  4GN1 A;  2AL6 A;  2YT1 A;  3DXD A;  4KVG B;  3HQC A;  2D9Z A;  1X05 A;  4GZU A;  1WVH A;  4XWX A;  2W2X C;  5DI9 B;  5C79 A;  5CLQ B;  5J3T A;  4C0A A;  4YON A;  1U5G A;  3P7Z A;  2VKI A;  2LG1 A;  1U5E A;  1DDV A;  3KRW A;  4KHO A;  2R0D A;  4KHB B;  5JHH A;  2E2X A;  2EMT A;  5DHA B;  4HAV B;  2CY4 A;  2RVB B;  5C5B B;  3FEH A;  4HDO A;  3QIJ A;  2YS1 A;  3BJI A;  4K2O A;  3FM8 C;  2P8V A;  4IFS A;  3GYP A;  2OTX A;  2D10 A;  4L6E A;  5J3Q A;  2CY5 A;  4ZRI A;  3ZVR A;  4WVF B;  1WJ1 A;  2P0H A;  4Z2N A;  3A8Q A;  1WG7 A;  3PG7 A;  1AWE A;  1H4R A;  2EMS A;  4A6K A;  1V5P A;  2W2X D;  1IRS A;  2Q13 A;  1W1G A;  2DKP A;  2DHK A;  2H7E A;  1MK7 B;  5KCV A;  1FB8 A;  2HE7 A;  2N23 A;  3SV1 A;  4IOY X;  4H8S A;  3SYX A;  2DX5 A;  1WGU A;  5CLL B;  1X1F A;  1GC7 A;  1Y5O A;  2ELA A;  2XQN M;  2UVM A;  4CHJ A;  1K5D B;  3SUZ A;  2EJ8 A;  2BCJ A;  5JHG A;  1B55 A;  1FHW A;  2VSZ A;  2DFK A;  2V76 A;  2JP2 A;  2D11 A;  3A98 B;  2YS5 A;  4DXA B;  2KCJ A;  4F7G A;  3TO1 A;  1SGH A;  4TYZ A;  2DYN A;  2Y8F A;  1EVH A;  3P6A A;  1RRP B;  1FGY A;  1UEF A;  1M7R A;  4NSW A;  5LOP B;  5DIF B;  2M14 A;  1TXD A;  2LUL A;  4ZRK A;  3KSY A;  2VRW B;  1FHX A;  2EC1 A;  1KI1 B;  4A6F A;  4CHM A;  3F5R A;  5LON B;  3SNH A;  1ZSQ A;  2AEH A;  3A8P A;  5JLJ B;  3AJ4 A;  4B6H A;  1ZC3 B;  1ZC4 B;  5FI0 A;  3ULB A;  1U2B A;  4GXB A;  4HHV A;  2RSG A;  1X1G A;  5L81 A;  3G9W A;  2I5C A;  5HE0 A;  5DH9 B;  2COD A;  2RUK B;  2R09 A;  2K2U A;  3N7C A;  4BBK A;  2DHJ A;  2H7D A;  4EMO A;  2YF0 A;  5GOW B;  2J0J A;  4IAP A;  3WA0 A;  2K2J A;  3TCA A;  3D8E A;  3MDB C;  3TW1 A;  1XR0 B;  3ODO A;  2KGX B;  1OQN A;  2D9V A;  3PEG A;  2Z0P A;  2LOX A;  1V61 A;  4KHA A;  1ZVR A;  1AQC A;  4TKN A;  1FGZ A;  4WJ7 A;  1XKE A;  1LW3 A;  1MIX A;  3D8F A;  3VIA A;  1V89 A;  2DTC A;  1UNQ A;  4KAX B;  1DYN A;  2P0D A;  1P6S A;  1TQZ A;  5D3X A;  2D2Q A;  2X18 A;  2D4Q A;  4P7I A;  1E5W A;  5FI1 A;  2UZS A;  3MPX A;  2D9W A;  1V5U A;  2I1K A;  1RJ2 A;  3PVW A;  3BIN A;  1BAK A;  2PZ1 A;  1BTN A;  2J0M A;  1DDW A;  1GG3 A;  1NI2 A;  1X11 A;  5KQ1 A;  3QBV B;  1J0W A;  1GC6 A;  3F0W A;  2D9X A;  3IVF A;  1KZ7 A;  5HE2 A;  3O96 A;  1NTY A;  1H10 A;  1XOD A;  4NY0 A;  1MK9 B;  1SHC A;  3ULC A;  2GS0 A;  2Z0Q A;  3FSS A;  5HE1 A;  3T06 A;  2MKR A;  4A5K A;  2QKM A;  2RLO A;  5D3Y A;  2MDX A;  1I2H A;  3AU5 A;  2Z0O A;  2LYD A;  2GCL A;  5C5B A;  2P0F A;  1KZG A;  5JP4 A;  2UZR A;  2L1C A;  2IYB A;  1FOE A;  2J59 M;  2L2I A;  1TJ6 A;  3DXC A;  1ISN A;  4HAT B;  4K81 A;  1WJM A;  3OAN A;  2DYQ A;  2RGN B;  4Z2M B;  3V5W A;  1EF1 A;  4DX8 A;  1PFJ A;  3HK0 A;  3PP2 A;  3U8Z A;  2KUP A;  5D3V A;  2CAY A;  5D3W A;  2I5F A;  2COC A;  4HB0 B;  1P3R A;  2N0Y A;  2QKL A;  3ML4 A;  2YSZ A;  3WYF B;  3PVU A;  4ZRJ A;  3AU4 A;  4YL8 A;  4CYE A;  1MPH A;  3NSU A;  4HAU B;  4D0N B;  5EFX A;  3TFM A;  1DDM A;  2D9Y A;  3PVL A;  1V88 A;  4PNK A;  1I7A A;  2YS3 A;  1UPR A;  3ODW A;  1V5M A;  2CRF A;  4K2P A;  1Q67 A;  2ADZ A;  2K00 A;  1NU2 A;  3ZDT A;  2ROV A;  3CIK A;  4F7H A;  1N3H A;  1EGX A;  1U27 A;  4EJN A;  2W2W A;  1QC6 A;  2J0K A;  2LKO A;  3GYO A;  1XX0 A;  3ODX A;  2COF A;  2I1J A;  2MFQ A;  1U29 A;  1BWN A;  2DLW A;  3VOQ A;  2YVC A;  3CXB B;  4PQ0 A;  1QQG A;  2GJY A;  2LOZ A;  2YRY A;  4F7U P;  3U7D A;  4HAX B;  2ROZ B;  1LB1 A;  3LJU X;  4Y94 A;  2IFS A;  4A6F B;  1EAZ A;  2OQB A;  5KQ4 A;  4HB3 B;  5DHF B;  1ZM0 A;  3PSC A;  3HW2 B;  4A6H A;  1U5D A;  4HAY B;  4GMX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...