2DYNA

Dynamin (pleckstrin homology domain) (dynph)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
111
structure length
111
Chain Sequence
ILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the pleckstrin homology domain from dynamin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signal transduction
molecule keywords DYNAMIN
total genus 22
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 3.6.5.5: Dynamin GTPase.
pdb deposition date 1997-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dynA00
4HDOA 2CODA 2XQNM 4HAUB 4GZUA 3ODXA 5D3YA 1DDWA 2VSZA 4CHJA 2W2WA 2I5FA 1BWNA 3AU5A 3OANA 2COCA 4A6KA 2YS1A 3O96A 2DLWA 4KAXB 2DHJA 4HB2B 2YRYA 1WVHA 1BTKA 5L81A 5FI1A 5DH9B 3KSYA 1J0WA 1FGYA 5JHGA 1U5FA 1GC6A 4DXAB 2VRWB 4XWXA 1U5DA 1DDVA 1U2BA 4H8SA 2GJYA 3VIAA 3KY9A 1UNPA 2DYQA 2G35A 5D3WA 1IRSA 2D2QA 2MDXA 3DXEA 1DROA 1UEFA 5KQ4A 2ROZB 1UNQA 2L1CA 4NY0A 1ZM0A 1XX0A 2YVCA 4GPTB 1FHOA 1ISNA 2D4QA 1XKEA 3AU4A 3HK0A 3LJUX 5KCVA 5C6RA 1W1DA 1BAKA 3PEGA 4DBBA 3MDBC 1ZSQA 2D9XA 1TQZA 4MK0A 5LOPB 1TXDA 4BBKA 2D11A 1V61A 4EMOA 2HE7A 5EFXA 2J0KA 2EJ8A 5D3VA 4ZRIA 3A8PA 5C5BA 1XD4A 1FGZA 2ZPYA 2ELAA 1E5WA 3ULBA 5DI9B 5DHFB 2I5CA 4B6HA 1QC6A 4PNKA 2D9ZA 2Z0QA 1SGHA 4EKUA 2Q13A 1ZC3B 4IOYX 3A8QA 2DN6A 2OTXA 3U8ZA 4HATB 5HE2A 4A6HA 3TW1A 4NSWA 3DXDA 2EMTA 2M14A 2KGXB 2Y7BA 2W2XD 2NZ8B 2Z0OA 1MKEA 1X1GA 1P5TA 4HB3B 1UNRA 2CAYA 1EAZA 2P0DA 2D9WA 2QKMA 3PVWA 4HAXB 1Y19B 2GS0A 3TFMA 1H10A 3RCPA 1FHWA 2DHKA 1I7AA 2Y8FA 1P6SA 5HE1A 2N0YA 2V76A 1FAOA 4K17A 2RNRB 2NMBA 3PZDA 2VKIA 4KHAA 4CHMA 3G9WA 1KI1B 2LYDA 2IFSA 5C5BB 2DHIA 3MPXA 3KRWA 1NTVA 2ELBA 2H7EA 3QWMA 3N7CA 1MPHA 1B55A 4HB0B 1OQNA 2YT1A 2YS5A 5JHHA 4HAYB 3P7ZA 3F5RA 1H4RA 1J19A 1FOEA 2D9YA 1ZC4B 4YONA 1EVHA 2R0DA 4TYZA 1XODA 3CXBB 3GYPA 3SO6A 3PP2A 2FJLA 3U7DA 3ODWA 4HDQA 3AJ4A 2AL6A 2CRFA 2K2UA 1U29A 2RLOA 1PFJA 2EC1A 3KZ1A 5LONB 3ULCA 1EGXA 3HQCA 2MFQA 4F7GA 1RJ2A 2L2IA 1OY2A 4A6FA 2UZSA 5DIFB 3D8FA 1V89A 4KHBB 2KCJA 2J59M 1FHXA 2BCJA 2P8VA 1NTYA 3A98B 1X11A 1W1HA 3ZVRA 3PG7A 2DX1A 1NU2A 3M1IB 2GCLA 3SNHA 2YS3A 4WVFB 4P7IA 2HTHB 1N3HA 4YL8A 2J0MA 4HAWB 1MIZB 1WI1A 2MKRA 2J0JA 1X05A 4Y94A 2W2XC 3SYXA 2QKLA 4D0NB 1WGQA 3NSUA 3WA0A 4WJ7A 2AEHA 1KZGA 4IAPA 1UPQA 2GCJA 4Z2NA 1U5EA 4KHOA 1XCGA 5J3QA 4GXBA 3FEHA 2COAA 1DYNA 2YT0A 3T06A 1DDMA 1AQCA 3DXCA 1Z87A 2R09A 3QIJA 5C79A 5J3TA 2RSGA 1Y5OA 2RVBB 3UZTA 1V5MA 2P0HA 2PZ1A 4EJNA 2YF0A 1U5GA 2KUPA 2LULA 2DFKA 1V5PA 4L6EA 1WJ1A 1GG3A 1LW3A 1ZVRA 1MAIA 3KRXA 4DX8A 4GMXB 4IFSA 5JP4A 1X86A 1MIXA 3V5WA 4TKNA 3ML4A 3F0WA 1SHCA 1FB8A 3TCAA 4HB4B 1V5UA 2EMSA 3TVVA 3D8DA 1P3RA 2YSZA 5J3YA 1M7RA 2DA0A 1U27A 4GN1A 2D9VA 2DKPA 4K2PA 2ADZA 1QQGA 1NI2A 4K81A 1WG7A 2M38A 2IYBA 2X18A 3PVLA 4F7HA 4C0AA 1PMSA 5FI0A 2LOZA 2RGNB 3ODOA 3P6AA 1RRPB 5C16A 3PVUA 5KQ1A 2JP2A 1LB1A 2I1KA 1K5GB 4MT7A 3FSSA 5GOWB 4HAZB 1EF1A 4ZRKA 1X1FA 2CY5A 2Y8GA 4MY6A 3VOQA 3IVFA 1UPRA 1OMWA 3X23A 5DHAB 3HW2B 4PQ0A 1GC7A 4ZRJA 3D8EA 3BINA 4KVGB 2DYNA 1AWEA 2ROVA 1KZ7A 1M7EA 2I1JA 3TO1A 2UVMA 2K00A 1WGUA 2H7DA 1MK7B 1W1GA 4HHVA 1TJ6A 2LOXA 3PSCA 1DBHA 2LKOA 2RUKB 3SV1A 3ZDTA 3GYOA 5CLQB 2DKQA 4DX90 1XR0B 5JLJB 2DX5A 3WYFB 3CIKA 2MWNB 4CYEA 4Z2MB 2N23A 1MK9B 4GMVA 4K2OA 3BJIA 3SUZA 5CLLB 5D27A 1WJMA 5HE0A 5D3XA 1I2HA 3FM8C 4WSFA 2UZRA 4F7UP 2CY4A 2D10A 2P0FA 4A6FB 1V88A 1K5DB 2COFA 2DTCA 3QBVB 1Q67A 4HAVB 2LG1A 4A5KA 2OQBA 2E2XA 2K2JA 1BTNA 1PLSA 5HE3A 2Z0PA
chains in the Genus database with same CATH superfamily
4HDOA 2CODA 2XQNM 4HAUB 4GZUA 3ODXA 5D3YA 1DDWA 2KUQA 2VSZA 2W2WA 4CHJA 2I5FA 1BWNA 3AU5A 3OANA 2COCA 4A6KA 2YS1A 3O96A 2DLWA 4KAXB 2GUMA 2DHJA 5LG4B 4HB2B 2YRYA 1WVHA 1BTKA 5L81A 3NWFA 5FI1A 5IRSA 5DH9B 3KSYA 1J0WA 1FGYA 5JHGA 1U5FA 1GC6A 4DXAB 2VRWB 4XWXA 1U5DA 1DDVA 3A58A 1U2BA 4H8SA 2GJYA 3VIAA 3KY9A 1UNPA 2DYQA 2G35A 5D3WA 1IRSA 2D2QA 2MDXA 3DXEA 1DROA 1UEFA 5KQ4A 1MI1A 2ROZB 1UNQA 2L1CA 4NY0A 1ZM0A 1XX0A 2R2YA 2YVCA 4GPTB 1FHOA 1ISNA 2D4QA 2RRFA 1XKEA 3AU4A 3HK0A 3LJUX 5KCVA 5C6RA 1W1DA 1BAKA 3PEGA 4DBBA 3MDBC 1ZSQA 2D9XA 1TQZA 4MK0A 5LOPB 1TXDA 4BBKA 2D11A 4GNKB 2Z14A 1V61A 4EMOA 4KHBA 2HE7A 5EFXA 2J0KA 2EJ8A 5D3VA 4ZRIA 3A8PA 5C5BA 1XD4A 1FGZA 2ZPYA 2ELAA 3NWAA 2KIEA 1E5WA 3ULBA 5DI9B 5DHFB 2I5CA 4B6HA 1QC6A 4PNKA 2D9ZA 2Z13A 2Z0QA 1SGHA 4EKUA 2Q13A 1ZC3B 4QJ4B 4IOYX 3A8QA 2DN6A 2OTXA 3U8ZA 4HATB 5HE2A 4A6HA 3TW1A 4NSWA 4HSIA 3DXDA 2EMTA 2M14A 2KGXB 2Y7BA 2W2XD 2NZ8B 2Z0OA 3HIEA 1MKEA 1X1GA 1P5TA 3U12A 4HB3B 1UNRA 2CAYA 1EAZA 2P0DA 2D9WA 2QKMA 3PVWA 4HAXB 1Y19B 2GS0A 3TFMA 1H10A 3RCPA 1FHWA 2DHKA 1I7AA 2K8EA 2Y8FA 1P6SA 5HE1A 2N0YA 4D6WA 2V76A 1FAOA 4K17A 3NW8A 2RNRB 2NMBA 3PZDA 2VKIA 4KHAA 4CSQA 4CHMA 3G9WA 1KI1B 2LYDA 2IFSA 5C5BB 2DHIA 3MPXA 3KRWA 1NTVA 2ELBA 4GOUA 2H7EA 3QWMA 3N7CA 1MPHA 1B55A 4HB0B 1OQNA 2YT1A 2YS5A 5JHHA 4HAYB 3P7ZA 3F5RA 1H4RA 1J19A 1FOEA 2D9YA 1ZC4B 4OSNA 4YONA 4OT1A 1EVHA 2R0DA 4TYZA 1XODA 3CXBB 3GYPA 3SO6A 2Z4DA 3PP2A 2FJLA 3U7DA 3ODWA 4HDQA 3AJ4A 2AL6A 2CRFA 2K2UA 1U29A 2RLOA 1PFJA 2EC1A 3KZ1A 5LONB 3ULCA 1EGXA 3HQCA 2MFQA 4F7GA 1RJ2A 2L2IA 1OY2A 4A6FA 2UZSA 5DIFB 3D8FA 1V89A 4KHBB 2KCJA 2J59M 1FHXA 2BCJA 2P8VA 1NTYA 3A98B 1X11A 1W1HA 3ZVRA 3PG7A 2DX1A 1NU2A 3M1IB 2GCLA 3SNHA 2YS3A 5I2MA 4WVFB 4P7IA 2HTHB 1N3HA 4YL8A 2J0MA 4HAWB 1MIZB 1WI1A 2FJUB 2MKRA 2J0JA 1X05A 4Y94A 2W2XC 3SYXA 2QKLA 4D0NB 1WGQA 3NSUA 3WA0A 4WJ7A 2AEHA 1KZGA 4IAPA 1UPQA 2GCJA 4Z2NA 3DCXA 1U5EA 4KHOA 1XCGA 5J3QA 4GXBA 2Z59A 3FEHA 2COAA 1DYNA 2YT0A 3T06A 1DDMA 1AQCA 3DXCA 1Z87A 2R09A 3QIJA 5C79A 5J3TA 2RSGA 1Y5OA 2RVBB 3UZTA 1V5MA 2P0HA 2PZ1A 4EJNA 2YF0A 1U5GA 2KUPA 2LULA 2DFKA 1V5PA 4L6EA 1WJ1A 1GG3A 1LW3A 3OHMB 1ZVRA 1MAIA 3KRXA 4DX8A 4GMXB 4IFSA 5JP4A 1X86A 1MIXA 3V5WA 4TKNA 3ML4A 3F0WA 1SHCA 1FB8A 3TCAA 4HB4B 1V5UA 2EMSA 4QXAB 3TVVA 3D8DA 1P3RA 2YSZA 5J3YA 1M7RA 2DA0A 1U27A 4GN1A 2D9VA 2DKPA 4K2PA 2ADZA 1QQGA 1NI2A 4K81A 1WG7A 2M38A 2IYBA 2X18A 3HSAA 3PVLA 4F7HA 4C0AA 4L1RA 1PMSA 5FI0A 2K49A 2LOZA 2RGNB 3B77A 3ODOA 3P6AA 1RRPB 5C16A 3PVUA 5KQ1A 2JP2A 1LB1A 2I1KA 1K5GB 4MT7A 3FSSA 5GOWB 4HAZB 1EF1A 4ZRKA 1X1FA 2CY5A 3FVCA 2Y8GA 4MY6A 2YT2A 3IVFA 3VOQA 1UPRA 1OMWA 3X23A 5DHAB 3HW2B 4PQ0A 1GC7A 4ZRJA 3D8EA 3BINA 4KVGB 2DYNA 1AWEA 2ROVA 3NWDA 1KZ7A 1M7EA 2I1JA 3TO1A 4DIXA 1T77A 2UVMA 2K00A 1WGUA 2H7DA 1MK7B 4QJ3B 1W1GA 4HHVA 1TJ6A 2LOXA 3PSCA 1DBHA 2LKOA 2RUKB 3SV1A 3ZDTA 3GYOA 1ZYIA 5CLQB 2DKQA 4DX90 1XR0B 5JLJB 2DX5A 3WYFB 3CIKA 2MWNB 4CYEA 4Z2MB 2N23A 1MK9B 4GMVA 4K2OA 3BJIA 3SUZA 5CLLB 5D27A 1WJMA 5HE0A 5D3XA 1I2HA 5M4YB 3FM8C 2NBVA 4WSFA 2KR0A 2UZRA 4F7UP 2CY4A 2D10A 2P0FA 2KIGA 2ZKMX 4A6FB 1V88A 1K5DB 2COFA 2DTCA 4QJ5B 3QBVB 1Q67A 4HAVB 2LG1A 4A5KA 2OQBA 2E2XA 2K2JA 1BTNA 5I2SA 1PLSA 5HE3A 2Z0PA
chains in the Genus database with same CATH topology
4HDOA 2CODA 2XQNM 4HAUB 4GZUA 3ODXA 5D3YA 1DDWA 2VSZA 4CHJA 2W2WA 2I5FA 1BWNA 3AU5A 3OANA 2COCA 4A6KA 2YS1A 3O96A 2DLWA 4KAXB 2DHJA 4HB2B 2YRYA 1WVHA 1BTKA 5L81A 5FI1A 5DH9B 3KSYA 1J0WA 1FGYA 5JHGA 1U5FA 1GC6A 4DXAB 2VRWB 4XWXA 1U5DA 1DDVA 1U2BA 4H8SA 2GJYA 3VIAA 3KY9A 1UNPA 2DYQA 2G35A 5D3WA 1IRSA 2D2QA 2MDXA 3DXEA 1DROA 1UEFA 5KQ4A 2ROZB 1UNQA 2L1CA 4NY0A 1ZM0A 1XX0A 2YVCA 4GPTB 1FHOA 1ISNA 2D4QA 1XKEA 3AU4A 3HK0A 3LJUX 5KCVA 5C6RA 1W1DA 1BAKA 3PEGA 4DBBA 3MDBC 1ZSQA 2D9XA 1TQZA 4MK0A 5LOPB 1TXDA 4BBKA 2D11A 1V61A 4EMOA 2HE7A 5EFXA 2J0KA 2EJ8A 5D3VA 4ZRIA 3A8PA 5C5BA 1XD4A 1FGZA 2ZPYA 2ELAA 1E5WA 3ULBA 5DI9B 5DHFB 2I5CA 4B6HA 1QC6A 4PNKA 2D9ZA 2Z0QA 1SGHA 4EKUA 2Q13A 1ZC3B 4IOYX 3A8QA 2DN6A 2OTXA 3U8ZA 4HATB 5HE2A 4A6HA 3TW1A 4NSWA 3DXDA 2EMTA 2M14A 2KGXB 2Y7BA 2W2XD 2NZ8B 2Z0OA 1MKEA 1X1GA 1P5TA 4HB3B 1UNRA 2CAYA 1EAZA 2P0DA 2D9WA 2QKMA 3PVWA 4HAXB 1Y19B 2GS0A 3TFMA 1H10A 3RCPA 1FHWA 2DHKA 1I7AA 2Y8FA 1P6SA 5HE1A 2N0YA 2V76A 1FAOA 4K17A 2RNRB 2NMBA 3PZDA 2VKIA 4KHAA 4CHMA 3G9WA 1KI1B 2LYDA 2IFSA 5C5BB 2DHIA 3MPXA 3KRWA 1NTVA 2ELBA 2H7EA 3QWMA 3N7CA 1MPHA 1B55A 4HB0B 1OQNA 2YT1A 2YS5A 5JHHA 4HAYB 3P7ZA 3F5RA 1H4RA 1J19A 1FOEA 2D9YA 1ZC4B 4YONA 1EVHA 2R0DA 4TYZA 1XODA 3CXBB 3GYPA 3SO6A 3PP2A 2FJLA 3U7DA 3ODWA 4HDQA 3AJ4A 2AL6A 2CRFA 2K2UA 1U29A 2RLOA 1PFJA 2EC1A 3KZ1A 5LONB 3ULCA 1EGXA 3HQCA 2MFQA 4F7GA 1RJ2A 2L2IA 1OY2A 4A6FA 2UZSA 5DIFB 3D8FA 1V89A 4KHBB 2KCJA 2J59M 1FHXA 2BCJA 2P8VA 1NTYA 3A98B 1X11A 1W1HA 3ZVRA 3PG7A 2DX1A 1NU2A 3M1IB 2GCLA 3SNHA 2YS3A 4WVFB 4P7IA 2HTHB 1N3HA 4YL8A 2J0MA 4HAWB 1MIZB 1WI1A 2MKRA 2J0JA 1X05A 4Y94A 2W2XC 3SYXA 2QKLA 4D0NB 1WGQA 3NSUA 3WA0A 4WJ7A 2AEHA 1KZGA 4IAPA 1UPQA 2GCJA 4Z2NA 1U5EA 4KHOA 1XCGA 5J3QA 4GXBA 3FEHA 2COAA 1DYNA 2YT0A 3T06A 1DDMA 1AQCA 3DXCA 1Z87A 2R09A 3QIJA 5C79A 5J3TA 2RSGA 1Y5OA 2RVBB 3UZTA 1V5MA 2P0HA 2PZ1A 4EJNA 2YF0A 1U5GA 2KUPA 2LULA 2DFKA 1V5PA 4L6EA 1WJ1A 1GG3A 1LW3A 1ZVRA 1MAIA 3KRXA 4DX8A 4GMXB 4IFSA 5JP4A 1X86A 1MIXA 3V5WA 4TKNA 3ML4A 3F0WA 1SHCA 1FB8A 3TCAA 4HB4B 1V5UA 2EMSA 3TVVA 3D8DA 1P3RA 2YSZA 5J3YA 1M7RA 2DA0A 1U27A 4GN1A 2D9VA 2DKPA 4K2PA 2ADZA 1QQGA 1NI2A 4K81A 1WG7A 2M38A 2IYBA 2X18A 3PVLA 4F7HA 4C0AA 1PMSA 5FI0A 2LOZA 2RGNB 3ODOA 3P6AA 1RRPB 5C16A 3PVUA 5KQ1A 2JP2A 1LB1A 2I1KA 1K5GB 4MT7A 3FSSA 5GOWB 4HAZB 1EF1A 4ZRKA 1X1FA 2CY5A 2Y8GA 4MY6A 3VOQA 3IVFA 1UPRA 1OMWA 3X23A 5DHAB 3HW2B 4PQ0A 1GC7A 4ZRJA 3D8EA 3BINA 4KVGB 2DYNA 1AWEA 2ROVA 1KZ7A 1M7EA 2I1JA 3TO1A 2UVMA 2K00A 1WGUA 2H7DA 1MK7B 1W1GA 4HHVA 1TJ6A 2LOXA 3PSCA 1DBHA 2LKOA 2RUKB 3SV1A 3ZDTA 3GYOA 5CLQB 2DKQA 4DX90 1XR0B 5JLJB 2DX5A 3WYFB 3CIKA 2MWNB 4CYEA 4Z2MB 2N23A 1MK9B 4GMVA 4K2OA 3BJIA 3SUZA 5CLLB 5D27A 1WJMA 5HE0A 5D3XA 1I2HA 3FM8C 4WSFA 2UZRA 4F7UP 2CY4A 2D10A 2P0FA 4A6FB 1V88A 1K5DB 2COFA 2DTCA 3QBVB 1Q67A 4HAVB 2LG1A 4A5KA 2OQBA 2E2XA 2K2JA 1BTNA 1PLSA 5HE3A 2Z0PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HDO A;  2COD A;  2XQN M;  4HAU B;  4GZU A;  3ODX A;  5D3Y A;  1DDW A;  2VSZ A;  4CHJ A;  2W2W A;  2I5F A;  1BWN A;  3AU5 A;  3OAN A;  2COC A;  4A6K A;  2YS1 A;  3O96 A;  2DLW A;  4KAX B;  2DHJ A;  4HB2 B;  2YRY A;  1WVH A;  1BTK A;  5L81 A;  5FI1 A;  5DH9 B;  3KSY A;  1J0W A;  1FGY A;  5JHG A;  1U5F A;  1GC6 A;  4DXA B;  2VRW B;  4XWX A;  1U5D A;  1DDV A;  1U2B A;  4H8S A;  2GJY A;  3VIA A;  3KY9 A;  1UNP A;  2DYQ A;  2G35 A;  5D3W A;  1IRS A;  2D2Q A;  2MDX A;  3DXE A;  1DRO A;  1UEF A;  5KQ4 A;  2ROZ B;  1UNQ A;  2L1C A;  4NY0 A;  1ZM0 A;  1XX0 A;  2YVC A;  4GPT B;  1FHO A;  1ISN A;  2D4Q A;  1XKE A;  3AU4 A;  3HK0 A;  3LJU X;  5KCV A;  5C6R A;  1W1D A;  1BAK A;  3PEG A;  4DBB A;  3MDB C;  1ZSQ A;  2D9X A;  1TQZ A;  4MK0 A;  5LOP B;  1TXD A;  4BBK A;  2D11 A;  1V61 A;  4EMO A;  2HE7 A;  5EFX A;  2J0K A;  2EJ8 A;  5D3V A;  4ZRI A;  3A8P A;  5C5B A;  1XD4 A;  1FGZ A;  2ZPY A;  2ELA A;  1E5W A;  3ULB A;  5DI9 B;  5DHF B;  2I5C A;  4B6H A;  1QC6 A;  4PNK A;  2D9Z A;  2Z0Q A;  1SGH A;  4EKU A;  2Q13 A;  1ZC3 B;  4IOY X;  3A8Q A;  2DN6 A;  2OTX A;  3U8Z A;  4HAT B;  5HE2 A;  4A6H A;  3TW1 A;  4NSW A;  3DXD A;  2EMT A;  2M14 A;  2KGX B;  2Y7B A;  2W2X D;  2NZ8 B;  2Z0O A;  1MKE A;  1X1G A;  1P5T A;  4HB3 B;  1UNR A;  2CAY A;  1EAZ A;  2P0D A;  2D9W A;  2QKM A;  3PVW A;  4HAX B;  1Y19 B;  2GS0 A;  3TFM A;  1H10 A;  3RCP A;  1FHW A;  2DHK A;  1I7A A;  2Y8F A;  1P6S A;  5HE1 A;  2N0Y A;  2V76 A;  1FAO A;  4K17 A;  2RNR B;  2NMB A;  3PZD A;  2VKI A;  4KHA A;  4CHM A;  3G9W A;  1KI1 B;  2LYD A;  2IFS A;  5C5B B;  2DHI A;  3MPX A;  3KRW A;  1NTV A;  2ELB A;  2H7E A;  3QWM A;  3N7C A;  1MPH A;  1B55 A;  4HB0 B;  1OQN A;  2YT1 A;  2YS5 A;  5JHH A;  4HAY B;  3P7Z A;  3F5R A;  1H4R A;  1J19 A;  1FOE A;  2D9Y A;  1ZC4 B;  4YON A;  1EVH A;  2R0D A;  4TYZ A;  1XOD A;  3CXB B;  3GYP A;  3SO6 A;  3PP2 A;  2FJL A;  3U7D A;  3ODW A;  4HDQ A;  3AJ4 A;  2AL6 A;  2CRF A;  2K2U A;  1U29 A;  2RLO A;  1PFJ A;  2EC1 A;  3KZ1 A;  5LON B;  3ULC A;  1EGX A;  3HQC A;  2MFQ A;  4F7G A;  1RJ2 A;  2L2I A;  1OY2 A;  4A6F A;  2UZS A;  5DIF B;  3D8F A;  1V89 A;  4KHB B;  2KCJ A;  2J59 M;  1FHX A;  2BCJ A;  2P8V A;  1NTY A;  3A98 B;  1X11 A;  1W1H A;  3ZVR A;  3PG7 A;  2DX1 A;  1NU2 A;  3M1I B;  2GCL A;  3SNH A;  2YS3 A;  4WVF B;  4P7I A;  2HTH B;  1N3H A;  4YL8 A;  2J0M A;  4HAW B;  1MIZ B;  1WI1 A;  2MKR A;  2J0J A;  1X05 A;  4Y94 A;  2W2X C;  3SYX A;  2QKL A;  4D0N B;  1WGQ A;  3NSU A;  3WA0 A;  4WJ7 A;  2AEH A;  1KZG A;  4IAP A;  1UPQ A;  2GCJ A;  4Z2N A;  1U5E A;  4KHO A;  1XCG A;  5J3Q A;  4GXB A;  3FEH A;  2COA A;  1DYN A;  2YT0 A;  3T06 A;  1DDM A;  1AQC A;  3DXC A;  1Z87 A;  2R09 A;  3QIJ A;  5C79 A;  5J3T A;  2RSG A;  1Y5O A;  2RVB B;  3UZT A;  1V5M A;  2P0H A;  2PZ1 A;  4EJN A;  2YF0 A;  1U5G A;  2KUP A;  2LUL A;  2DFK A;  1V5P A;  4L6E A;  1WJ1 A;  1GG3 A;  1LW3 A;  1ZVR A;  1MAI A;  3KRX A;  4DX8 A;  4GMX B;  4IFS A;  5JP4 A;  1X86 A;  1MIX A;  3V5W A;  4TKN A;  3ML4 A;  3F0W A;  1SHC A;  1FB8 A;  3TCA A;  4HB4 B;  1V5U A;  2EMS A;  3TVV A;  3D8D A;  1P3R A;  2YSZ A;  5J3Y A;  1M7R A;  2DA0 A;  1U27 A;  4GN1 A;  2D9V A;  2DKP A;  4K2P A;  2ADZ A;  1QQG A;  1NI2 A;  4K81 A;  1WG7 A;  2M38 A;  2IYB A;  2X18 A;  3PVL A;  4F7H A;  4C0A A;  1PMS A;  5FI0 A;  2LOZ A;  2RGN B;  3ODO A;  3P6A A;  1RRP B;  5C16 A;  3PVU A;  5KQ1 A;  2JP2 A;  1LB1 A;  2I1K A;  1K5G B;  4MT7 A;  3FSS A;  5GOW B;  4HAZ B;  1EF1 A;  4ZRK A;  1X1F A;  2CY5 A;  2Y8G A;  4MY6 A;  3VOQ A;  3IVF A;  1UPR A;  1OMW A;  3X23 A;  5DHA B;  3HW2 B;  4PQ0 A;  1GC7 A;  4ZRJ A;  3D8E A;  3BIN A;  4KVG B;  2DYN A;  1AWE A;  2ROV A;  1KZ7 A;  1M7E A;  2I1J A;  3TO1 A;  2UVM A;  2K00 A;  1WGU A;  2H7D A;  1MK7 B;  1W1G A;  4HHV A;  1TJ6 A;  2LOX A;  3PSC A;  1DBH A;  2LKO A;  2RUK B;  3SV1 A;  3ZDT A;  3GYO A;  5CLQ B;  2DKQ A;  4DX9 0;  1XR0 B;  5JLJ B;  2DX5 A;  3WYF B;  3CIK A;  2MWN B;  4CYE A;  4Z2M B;  2N23 A;  1MK9 B;  4GMV A;  4K2O A;  3BJI A;  3SUZ A;  5CLL B;  5D27 A;  1WJM A;  5HE0 A;  5D3X A;  1I2H A;  3FM8 C;  4WSF A;  2UZR A;  4F7U P;  2CY4 A;  2D10 A;  2P0F A;  4A6F B;  1V88 A;  1K5D B;  2COF A;  2DTC A;  3QBV B;  1Q67 A;  4HAV B;  2LG1 A;  4A5K A;  2OQB A;  2E2X A;  2K2J A;  1BTN A;  1PLS A;  5HE3 A;  2Z0P A; 
#chains in the Genus database with same CATH topology
 4HDO A;  2COD A;  2XQN M;  4HAU B;  4GZU A;  3ODX A;  5D3Y A;  1DDW A;  2KUQ A;  2VSZ A;  2W2W A;  4CHJ A;  2I5F A;  1BWN A;  3AU5 A;  3OAN A;  2COC A;  4A6K A;  2YS1 A;  3O96 A;  2DLW A;  4KAX B;  2GUM A;  2DHJ A;  5LG4 B;  4HB2 B;  2YRY A;  1WVH A;  1BTK A;  5L81 A;  3NWF A;  5FI1 A;  5IRS A;  5DH9 B;  3KSY A;  1J0W A;  1FGY A;  5JHG A;  1U5F A;  1GC6 A;  4DXA B;  2VRW B;  4XWX A;  1U5D A;  1DDV A;  3A58 A;  1U2B A;  4H8S A;  2GJY A;  3VIA A;  3KY9 A;  1UNP A;  2DYQ A;  2G35 A;  5D3W A;  1IRS A;  2D2Q A;  2MDX A;  3DXE A;  1DRO A;  1UEF A;  5KQ4 A;  1MI1 A;  2ROZ B;  1UNQ A;  2L1C A;  4NY0 A;  1ZM0 A;  1XX0 A;  2R2Y A;  2YVC A;  4GPT B;  1FHO A;  1ISN A;  2D4Q A;  2RRF A;  1XKE A;  3AU4 A;  3HK0 A;  3LJU X;  5KCV A;  5C6R A;  1W1D A;  1BAK A;  3PEG A;  4DBB A;  3MDB C;  1ZSQ A;  2D9X A;  1TQZ A;  4MK0 A;  5LOP B;  1TXD A;  4BBK A;  2D11 A;  4GNK B;  2Z14 A;  1V61 A;  4EMO A;  4KHB A;  2HE7 A;  5EFX A;  2J0K A;  2EJ8 A;  5D3V A;  4ZRI A;  3A8P A;  5C5B A;  1XD4 A;  1FGZ A;  2ZPY A;  2ELA A;  3NWA A;  2KIE A;  1E5W A;  3ULB A;  5DI9 B;  5DHF B;  2I5C A;  4B6H A;  1QC6 A;  4PNK A;  2D9Z A;  2Z13 A;  2Z0Q A;  1SGH A;  4EKU A;  2Q13 A;  1ZC3 B;  4QJ4 B;  4IOY X;  3A8Q A;  2DN6 A;  2OTX A;  3U8Z A;  4HAT B;  5HE2 A;  4A6H A;  3TW1 A;  4NSW A;  4HSI A;  3DXD A;  2EMT A;  2M14 A;  2KGX B;  2Y7B A;  2W2X D;  2NZ8 B;  2Z0O A;  3HIE A;  1MKE A;  1X1G A;  1P5T A;  3U12 A;  4HB3 B;  1UNR A;  2CAY A;  1EAZ A;  2P0D A;  2D9W A;  2QKM A;  3PVW A;  4HAX B;  1Y19 B;  2GS0 A;  3TFM A;  1H10 A;  3RCP A;  1FHW A;  2DHK A;  1I7A A;  2K8E A;  2Y8F A;  1P6S A;  5HE1 A;  2N0Y A;  4D6W A;  2V76 A;  1FAO A;  4K17 A;  3NW8 A;  2RNR B;  2NMB A;  3PZD A;  2VKI A;  4KHA A;  4CSQ A;  4CHM A;  3G9W A;  1KI1 B;  2LYD A;  2IFS A;  5C5B B;  2DHI A;  3MPX A;  3KRW A;  1NTV A;  2ELB A;  4GOU A;  2H7E A;  3QWM A;  3N7C A;  1MPH A;  1B55 A;  4HB0 B;  1OQN A;  2YT1 A;  2YS5 A;  5JHH A;  4HAY B;  3P7Z A;  3F5R A;  1H4R A;  1J19 A;  1FOE A;  2D9Y A;  1ZC4 B;  4OSN A;  4YON A;  4OT1 A;  1EVH A;  2R0D A;  4TYZ A;  1XOD A;  3CXB B;  3GYP A;  3SO6 A;  2Z4D A;  3PP2 A;  2FJL A;  3U7D A;  3ODW A;  4HDQ A;  3AJ4 A;  2AL6 A;  2CRF A;  2K2U A;  1U29 A;  2RLO A;  1PFJ A;  2EC1 A;  3KZ1 A;  5LON B;  3ULC A;  1EGX A;  3HQC A;  2MFQ A;  4F7G A;  1RJ2 A;  2L2I A;  1OY2 A;  4A6F A;  2UZS A;  5DIF B;  3D8F A;  1V89 A;  4KHB B;  2KCJ A;  2J59 M;  1FHX A;  2BCJ A;  2P8V A;  1NTY A;  3A98 B;  1X11 A;  1W1H A;  3ZVR A;  3PG7 A;  2DX1 A;  1NU2 A;  3M1I B;  2GCL A;  3SNH A;  2YS3 A;  5I2M A;  4WVF B;  4P7I A;  2HTH B;  1N3H A;  4YL8 A;  2J0M A;  4HAW B;  1MIZ B;  1WI1 A;  2FJU B;  2MKR A;  2J0J A;  1X05 A;  4Y94 A;  2W2X C;  3SYX A;  2QKL A;  4D0N B;  1WGQ A;  3NSU A;  3WA0 A;  4WJ7 A;  2AEH A;  1KZG A;  4IAP A;  1UPQ A;  2GCJ A;  4Z2N A;  3DCX A;  1U5E A;  4KHO A;  1XCG A;  5J3Q A;  4GXB A;  2Z59 A;  3FEH A;  2COA A;  1DYN A;  2YT0 A;  3T06 A;  1DDM A;  1AQC A;  3DXC A;  1Z87 A;  2R09 A;  3QIJ A;  5C79 A;  5J3T A;  2RSG A;  1Y5O A;  2RVB B;  3UZT A;  1V5M A;  2P0H A;  2PZ1 A;  4EJN A;  2YF0 A;  1U5G A;  2KUP A;  2LUL A;  2DFK A;  1V5P A;  4L6E A;  1WJ1 A;  1GG3 A;  1LW3 A;  3OHM B;  1ZVR A;  1MAI A;  3KRX A;  4DX8 A;  4GMX B;  4IFS A;  5JP4 A;  1X86 A;  1MIX A;  3V5W A;  4TKN A;  3ML4 A;  3F0W A;  1SHC A;  1FB8 A;  3TCA A;  4HB4 B;  1V5U A;  2EMS A;  4QXA B;  3TVV A;  3D8D A;  1P3R A;  2YSZ A;  5J3Y A;  1M7R A;  2DA0 A;  1U27 A;  4GN1 A;  2D9V A;  2DKP A;  4K2P A;  2ADZ A;  1QQG A;  1NI2 A;  4K81 A;  1WG7 A;  2M38 A;  2IYB A;  2X18 A;  3HSA A;  3PVL A;  4F7H A;  4C0A A;  4L1R A;  1PMS A;  5FI0 A;  2K49 A;  2LOZ A;  2RGN B;  3B77 A;  3ODO A;  3P6A A;  1RRP B;  5C16 A;  3PVU A;  5KQ1 A;  2JP2 A;  1LB1 A;  2I1K A;  1K5G B;  4MT7 A;  3FSS A;  5GOW B;  4HAZ B;  1EF1 A;  4ZRK A;  1X1F A;  2CY5 A;  3FVC A;  2Y8G A;  4MY6 A;  2YT2 A;  3IVF A;  3VOQ A;  1UPR A;  1OMW A;  3X23 A;  5DHA B;  3HW2 B;  4PQ0 A;  1GC7 A;  4ZRJ A;  3D8E A;  3BIN A;  4KVG B;  2DYN A;  1AWE A;  2ROV A;  3NWD A;  1KZ7 A;  1M7E A;  2I1J A;  3TO1 A;  4DIX A;  1T77 A;  2UVM A;  2K00 A;  1WGU A;  2H7D A;  1MK7 B;  4QJ3 B;  1W1G A;  4HHV A;  1TJ6 A;  2LOX A;  3PSC A;  1DBH A;  2LKO A;  2RUK B;  3SV1 A;  3ZDT A;  3GYO A;  1ZYI A;  5CLQ B;  2DKQ A;  4DX9 0;  1XR0 B;  5JLJ B;  2DX5 A;  3WYF B;  3CIK A;  2MWN B;  4CYE A;  4Z2M B;  2N23 A;  1MK9 B;  4GMV A;  4K2O A;  3BJI A;  3SUZ A;  5CLL B;  5D27 A;  1WJM A;  5HE0 A;  5D3X A;  1I2H A;  5M4Y B;  3FM8 C;  2NBV A;  4WSF A;  2KR0 A;  2UZR A;  4F7U P;  2CY4 A;  2D10 A;  2P0F A;  2KIG A;  2ZKM X;  4A6F B;  1V88 A;  1K5D B;  2COF A;  2DTC A;  4QJ5 B;  3QBV B;  1Q67 A;  4HAV B;  2LG1 A;  4A5K A;  2OQB A;  2E2X A;  2K2J A;  1BTN A;  5I2S A;  1PLS A;  5HE3 A;  2Z0P A; 
#chains in the Genus database with same CATH homology
 4HDO A;  2COD A;  2XQN M;  4HAU B;  4GZU A;  3ODX A;  5D3Y A;  1DDW A;  2VSZ A;  4CHJ A;  2W2W A;  2I5F A;  1BWN A;  3AU5 A;  3OAN A;  2COC A;  4A6K A;  2YS1 A;  3O96 A;  2DLW A;  4KAX B;  2DHJ A;  4HB2 B;  2YRY A;  1WVH A;  1BTK A;  5L81 A;  5FI1 A;  5DH9 B;  3KSY A;  1J0W A;  1FGY A;  5JHG A;  1U5F A;  1GC6 A;  4DXA B;  2VRW B;  4XWX A;  1U5D A;  1DDV A;  1U2B A;  4H8S A;  2GJY A;  3VIA A;  3KY9 A;  1UNP A;  2DYQ A;  2G35 A;  5D3W A;  1IRS A;  2D2Q A;  2MDX A;  3DXE A;  1DRO A;  1UEF A;  5KQ4 A;  2ROZ B;  1UNQ A;  2L1C A;  4NY0 A;  1ZM0 A;  1XX0 A;  2YVC A;  4GPT B;  1FHO A;  1ISN A;  2D4Q A;  1XKE A;  3AU4 A;  3HK0 A;  3LJU X;  5KCV A;  5C6R A;  1W1D A;  1BAK A;  3PEG A;  4DBB A;  3MDB C;  1ZSQ A;  2D9X A;  1TQZ A;  4MK0 A;  5LOP B;  1TXD A;  4BBK A;  2D11 A;  1V61 A;  4EMO A;  2HE7 A;  5EFX A;  2J0K A;  2EJ8 A;  5D3V A;  4ZRI A;  3A8P A;  5C5B A;  1XD4 A;  1FGZ A;  2ZPY A;  2ELA A;  1E5W A;  3ULB A;  5DI9 B;  5DHF B;  2I5C A;  4B6H A;  1QC6 A;  4PNK A;  2D9Z A;  2Z0Q A;  1SGH A;  4EKU A;  2Q13 A;  1ZC3 B;  4IOY X;  3A8Q A;  2DN6 A;  2OTX A;  3U8Z A;  4HAT B;  5HE2 A;  4A6H A;  3TW1 A;  4NSW A;  3DXD A;  2EMT A;  2M14 A;  2KGX B;  2Y7B A;  2W2X D;  2NZ8 B;  2Z0O A;  1MKE A;  1X1G A;  1P5T A;  4HB3 B;  1UNR A;  2CAY A;  1EAZ A;  2P0D A;  2D9W A;  2QKM A;  3PVW A;  4HAX B;  1Y19 B;  2GS0 A;  3TFM A;  1H10 A;  3RCP A;  1FHW A;  2DHK A;  1I7A A;  2Y8F A;  1P6S A;  5HE1 A;  2N0Y A;  2V76 A;  1FAO A;  4K17 A;  2RNR B;  2NMB A;  3PZD A;  2VKI A;  4KHA A;  4CHM A;  3G9W A;  1KI1 B;  2LYD A;  2IFS A;  5C5B B;  2DHI A;  3MPX A;  3KRW A;  1NTV A;  2ELB A;  2H7E A;  3QWM A;  3N7C A;  1MPH A;  1B55 A;  4HB0 B;  1OQN A;  2YT1 A;  2YS5 A;  5JHH A;  4HAY B;  3P7Z A;  3F5R A;  1H4R A;  1J19 A;  1FOE A;  2D9Y A;  1ZC4 B;  4YON A;  1EVH A;  2R0D A;  4TYZ A;  1XOD A;  3CXB B;  3GYP A;  3SO6 A;  3PP2 A;  2FJL A;  3U7D A;  3ODW A;  4HDQ A;  3AJ4 A;  2AL6 A;  2CRF A;  2K2U A;  1U29 A;  2RLO A;  1PFJ A;  2EC1 A;  3KZ1 A;  5LON B;  3ULC A;  1EGX A;  3HQC A;  2MFQ A;  4F7G A;  1RJ2 A;  2L2I A;  1OY2 A;  4A6F A;  2UZS A;  5DIF B;  3D8F A;  1V89 A;  4KHB B;  2KCJ A;  2J59 M;  1FHX A;  2BCJ A;  2P8V A;  1NTY A;  3A98 B;  1X11 A;  1W1H A;  3ZVR A;  3PG7 A;  2DX1 A;  1NU2 A;  3M1I B;  2GCL A;  3SNH A;  2YS3 A;  4WVF B;  4P7I A;  2HTH B;  1N3H A;  4YL8 A;  2J0M A;  4HAW B;  1MIZ B;  1WI1 A;  2MKR A;  2J0J A;  1X05 A;  4Y94 A;  2W2X C;  3SYX A;  2QKL A;  4D0N B;  1WGQ A;  3NSU A;  3WA0 A;  4WJ7 A;  2AEH A;  1KZG A;  4IAP A;  1UPQ A;  2GCJ A;  4Z2N A;  1U5E A;  4KHO A;  1XCG A;  5J3Q A;  4GXB A;  3FEH A;  2COA A;  1DYN A;  2YT0 A;  3T06 A;  1DDM A;  1AQC A;  3DXC A;  1Z87 A;  2R09 A;  3QIJ A;  5C79 A;  5J3T A;  2RSG A;  1Y5O A;  2RVB B;  3UZT A;  1V5M A;  2P0H A;  2PZ1 A;  4EJN A;  2YF0 A;  1U5G A;  2KUP A;  2LUL A;  2DFK A;  1V5P A;  4L6E A;  1WJ1 A;  1GG3 A;  1LW3 A;  1ZVR A;  1MAI A;  3KRX A;  4DX8 A;  4GMX B;  4IFS A;  5JP4 A;  1X86 A;  1MIX A;  3V5W A;  4TKN A;  3ML4 A;  3F0W A;  1SHC A;  1FB8 A;  3TCA A;  4HB4 B;  1V5U A;  2EMS A;  3TVV A;  3D8D A;  1P3R A;  2YSZ A;  5J3Y A;  1M7R A;  2DA0 A;  1U27 A;  4GN1 A;  2D9V A;  2DKP A;  4K2P A;  2ADZ A;  1QQG A;  1NI2 A;  4K81 A;  1WG7 A;  2M38 A;  2IYB A;  2X18 A;  3PVL A;  4F7H A;  4C0A A;  1PMS A;  5FI0 A;  2LOZ A;  2RGN B;  3ODO A;  3P6A A;  1RRP B;  5C16 A;  3PVU A;  5KQ1 A;  2JP2 A;  1LB1 A;  2I1K A;  1K5G B;  4MT7 A;  3FSS A;  5GOW B;  4HAZ B;  1EF1 A;  4ZRK A;  1X1F A;  2CY5 A;  2Y8G A;  4MY6 A;  3VOQ A;  3IVF A;  1UPR A;  1OMW A;  3X23 A;  5DHA B;  3HW2 B;  4PQ0 A;  1GC7 A;  4ZRJ A;  3D8E A;  3BIN A;  4KVG B;  2DYN A;  1AWE A;  2ROV A;  1KZ7 A;  1M7E A;  2I1J A;  3TO1 A;  2UVM A;  2K00 A;  1WGU A;  2H7D A;  1MK7 B;  1W1G A;  4HHV A;  1TJ6 A;  2LOX A;  3PSC A;  1DBH A;  2LKO A;  2RUK B;  3SV1 A;  3ZDT A;  3GYO A;  5CLQ B;  2DKQ A;  4DX9 0;  1XR0 B;  5JLJ B;  2DX5 A;  3WYF B;  3CIK A;  2MWN B;  4CYE A;  4Z2M B;  2N23 A;  1MK9 B;  4GMV A;  4K2O A;  3BJI A;  3SUZ A;  5CLL B;  5D27 A;  1WJM A;  5HE0 A;  5D3X A;  1I2H A;  3FM8 C;  4WSF A;  2UZR A;  4F7U P;  2CY4 A;  2D10 A;  2P0F A;  4A6F B;  1V88 A;  1K5D B;  2COF A;  2DTC A;  3QBV B;  1Q67 A;  4HAV B;  2LG1 A;  4A5K A;  2OQB A;  2E2X A;  2K2J A;  1BTN A;  1PLS A;  5HE3 A;  2Z0P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...