2DYNA

Dynamin (pleckstrin homology domain) (dynph)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
111
structure length
111
Chain Sequence
ILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the pleckstrin homology domain from dynamin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signal transduction
molecule keywords DYNAMIN
total genus 22
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 3.6.5.5: Dynamin GTPase.
pdb deposition date 1997-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dynA00
3ODWA 3SO6A 5CLQB 2N0YA 2COAA 4WJ7A 2QKLA 2D9YA 3M1IB 1UPRA 1WGQA 1H4RA 2ELAA 1FGZA 4TYZA 2RUKB 3DXEA 5L81A 2M14A 3V5WA 2Q13A 1Q67A 4XWXA 1TJ6A 1XKEA 2RVBB 1KI1B 1M7RA 3FSSA 1KZGA 5DIFB 1B55A 2GJYA 1FOEA 2EC1A 1QC6A 4K81A 1X11A 1V5PA 2J0KA 2COCA 3WA0A 2LG1A 3RCPA 1FHOA 3KRXA 3PVUA 1TXDA 1ZM0A 2DYNA 5JP4A 2P0HA 2D9WA 2YT1A 4YL8A 1V88A 5CLLB 3FM8C 4F7GA 1H10A 2ADZA 2H7EA 4NSWA 2D11A 2X18A 3D8DA 3MPXA 4DX8A 4HAVB 3A98B 1I7AA 3X23A 1ZC4B 2E2XA 1AQCA 3G9WA 2YSZA 1UPQA 2MDXA 2FJLA 2K2JA 5HE1A 5D27A 5D3WA 4GMVA 2CAYA 2W2WA 3AJ4A 1FHXA 1WG7A 1BTNA 1BWNA 2AEHA 1X1GA 4IOYX 2DA0A 2DKPA 2DLWA 1OQNA 3GYPA 5GOWB 5HE3A 1XODA 4HAZB 3ULCA 1QQGA 5LOPB 4HDOA 4P7IA 4DBBA 4HDQA 4ZRIA 2Z0PA 3SV1A 1FGYA 3ZDTA 3P7ZA 3PVWA 1U5DA 5C5BA 2BCJA 4A6HA 1LB1A 5LONB 1XX0A 4PQ0A 1NI2A 2D2QA 1MIXA 4IAPA 1MPHA 5FI0A 2JP2A 1WJ1A 1Z87A 2EMSA 2DKQA 3D8FA 2OQBA 4TKNA 1LW3A 2ROVA 2I5FA 1DROA 1W1HA 1XD4A 1MK9B 3BINA 1NTVA 1AWEA 2DTCA 1FHWA 3CIKA 4HB0B 3A8PA 3NSUA 3VOQA 4K2PA 4F7HA 1V61A 4MK0A 3PG7A 3OANA 5D3XA 4GXBA 5DHFB 3U7DA 1P6SA 3PSCA 1FB8A 2Z0OA 1EF1A 2DX5A 1RRPB 5DHAB 4DXAB 2ZPYA 1U27A 3TW1A 1DDMA 2ELBA 4GZUA 5HE0A 3VIAA 2CODA 5JLJB 1XR0B 1E5WA 1WJMA 4CHJA 1WVHA 2YS3A 2J0MA 4NY0A 2W2XD 2KGXB 3UZTA 3QIJA 1ZSQA 2VKIA 2DN6A 4A6FA 1MK7B 2DFKA 3QBVB 1Y19B 2P8VA 1EGXA 1ISNA 4KHBB 2COFA 1PMSA 1U29A 3D8EA 5DI9B 3O96A 1EVHA 4EMOA 2P0FA 4CHMA 5DH9B 1TQZA 3HK0A 1N3HA 4KVGB 2YF0A 1ZC3B 5J3QA 1FAOA 5JHHA 3KSYA 1U5FA 4MT7A 2Y8GA 3FEHA 3F5RA 5C79A 2UZRA 3U8ZA 2UVMA 3KRWA 2CY4A 4PNKA 1PLSA 2GS0A 4WSFA 3BJIA 4HAWB 3T06A 4KAXB 1K5DB 2ROZB 2UZSA 2KUPA 2J0JA 2D9ZA 1RJ2A 2NZ8B 5FI1A 2IFSA 2M38A 4HAUB 4A5KA 1OMWA 2K2UA 5C6RA 1KZ7A 2LOZA 1I2HA 2Z0QA 3SNHA 4HB4B 4D0NB 2DHJA 3TO1A 1ZVRA 3KZ1A 2YVCA 1W1GA 4GPTB 4HATB 1U5GA 2KCJA 2YT0A 2D9VA 2W2XC 4HB3B 2IYBA 1V5UA 5J3TA 2YS5A 2DHIA 3TVVA 2MFQA 4ZRKA 2QKMA 4Y94A 1UNRA 3LJUX 2G35A 4MY6A 2NMBA 1X86A 5KQ4A 1IRSA 1UEFA 1MAIA 4CYEA 4ZRJA 4EKUA 4KHOA 2LOXA 2LULA 3ML4A 1WGUA 4K2OA 2R09A 1UNPA 3MDBC 1DBHA 3QWMA 2CY5A 1X1FA 3SUZA 4EJNA 1PFJA 4HHVA 5D3VA 2YS1A 2RNRB 4YONA 2LKOA 1W1DA 3IVFA 2DHKA 1Y5OA 2L1CA 4IFSA 1P5TA 4L6EA 1BTKA 2I5CA 2HTHB 2Y7BA 2EMTA 2V76A 2XQNM 2J59M 3ODOA 5J3YA 4HB2B 1GG3A 4A6KA 1DDWA 1WI1A 3N7CA 4HAXB 4Z2MB 1X05A 4DX90 4GMXB 4Z2NA 2D9XA 3PEGA 1V89A 3HQCA 3CXBB 2RLOA 5JHGA 1J0WA 1EAZA 3TFMA 2DYQA 4WVFB 2Y8FA 3TCAA 2RGNB 2R0DA 1MIZB 2YRYA 5KCVA 2I1KA 2MWNB 4H8SA 2I1JA 1U5EA 3AU4A 4KHAA 4GN1A 1DDVA 3P6AA 5C16A 3DXCA 1MKEA 3SYXA 4F7UP 1GC6A 5C5BB 1NU2A 2N23A 1K5GB 1OY2A 1XCGA 5KQ1A 3ZVRA 1DYNA 3A8QA 1J19A 2K00A 2RSGA 2DX1A 1GC7A 4HAYB 3WYFB 4C0AA 2L2IA 4A6FB 2P0DA 2D4QA 2GCLA 1SHCA 3GYOA 3PVLA 3PZDA 3HW2B 3KY9A 1BAKA 4K17A 2AL6A 1SGHA 2LYDA 2HE7A 5D3YA 1P3RA 1NTYA 1V5MA 4BBKA 3PP2A 3F0WA 2GCJA 2PZ1A 1UNQA 1U2BA 3DXDA 2VRWB 5HE2A 2CRFA 3ULBA 1M7EA 2EJ8A 2MKRA 4B6HA 3ODXA 2D10A 5EFXA 2OTXA 3AU5A 2H7DA 2VSZA
chains in the Genus database with same CATH superfamily
3ODWA 3SO6A 4GNKB 5CLQB 2N0YA 2COAA 4WJ7A 2QKLA 2D9YA 3M1IB 1UPRA 1WGQA 1H4RA 2ELAA 1FGZA 4TYZA 2KIEA 5IRSA 2RUKB 2Z59A 3DXEA 5L81A 2M14A 3V5WA 2Q13A 1Q67A 4XWXA 1TJ6A 1XKEA 2RVBB 4OT1A 1KI1B 1M7RA 3FSSA 1KZGA 2KR0A 5DIFB 1B55A 2GJYA 2RRFA 1FOEA 2EC1A 1QC6A 1ZYIA 4K81A 1X11A 1V5PA 2J0KA 2COCA 2KIGA 3WA0A 2LG1A 3RCPA 1FHOA 3KRXA 3PVUA 1TXDA 1ZM0A 2DYNA 5JP4A 4QXAB 2P0HA 2D9WA 2YT1A 4YL8A 1V88A 5CLLB 3FM8C 4CSQA 4F7GA 1H10A 2Z13A 2ADZA 5LG4B 2H7EA 4NSWA 2D11A 2X18A 3D8DA 3MPXA 4DX8A 4HAVB 4OSNA 3A98B 1I7AA 2ZKMX 3X23A 1ZC4B 2E2XA 1AQCA 3G9WA 2YSZA 1UPQA 2MDXA 2FJLA 2K2JA 5HE1A 5D27A 5D3WA 4GMVA 2CAYA 2W2WA 3AJ4A 1FHXA 1WG7A 1BTNA 1BWNA 2AEHA 1X1GA 4IOYX 2DA0A 2DKPA 2DLWA 1OQNA 3GYPA 5GOWB 5HE3A 1XODA 4HAZB 3ULCA 1QQGA 5LOPB 4HDOA 4P7IA 4DBBA 4HDQA 4ZRIA 4GOUA 3HSAA 2Z0PA 3SV1A 1FGYA 3ZDTA 3P7ZA 3PVWA 1U5DA 5C5BA 2BCJA 4A6HA 1LB1A 4QJ3B 1XX0A 4PQ0A 5LONB 1NI2A 2D2QA 1MIXA 4IAPA 4HSIA 1MPHA 5FI0A 2JP2A 1WJ1A 1Z87A 2EMSA 2DKQA 3D8FA 2OQBA 4TKNA 1LW3A 2ROVA 2I5FA 1DROA 3FVCA 1W1HA 1XD4A 1MK9B 1T77A 3BINA 1NTVA 1AWEA 3NW8A 2DTCA 1FHWA 3CIKA 5M4YB 4HB0B 3A8PA 3NSUA 3VOQA 4K2PA 4F7HA 1V61A 4MK0A 3PG7A 3OANA 5D3XA 4GXBA 5DHFB 3U7DA 1P6SA 3PSCA 1FB8A 2Z0OA 1EF1A 3HIEA 2DX5A 1RRPB 5DHAB 4DXAB 2ZPYA 5I2SA 1U27A 3TW1A 1DDMA 2ELBA 4GZUA 5HE0A 3VIAA 2CODA 5JLJB 1XR0B 1E5WA 1WJMA 4CHJA 1WVHA 2YS3A 2J0MA 4NY0A 2W2XD 2KGXB 3UZTA 3QIJA 1ZSQA 2VKIA 2DN6A 4A6FA 1MK7B 2DFKA 3QBVB 1Y19B 2P8VA 1EGXA 2GUMA 1ISNA 4KHBB 2COFA 1PMSA 1U29A 3D8EA 5DI9B 3DCXA 3O96A 1EVHA 4EMOA 2FJUB 3NWFA 2P0FA 4CHMA 5DH9B 1TQZA 3HK0A 1N3HA 4KVGB 2YF0A 1ZC3B 5J3QA 3B77A 1FAOA 5JHHA 3KSYA 1MI1A 5I2MA 1U5FA 4MT7A 2Y8GA 3FEHA 3F5RA 5C79A 2UZRA 3U8ZA 2UVMA 3KRWA 2CY4A 3NWDA 2R2YA 4PNKA 1PLSA 2GS0A 4WSFA 3BJIA 4HAWB 2K8EA 3T06A 4KAXB 1K5DB 2ROZB 2UZSA 2KUPA 3NWAA 2J0JA 2D9ZA 1RJ2A 2NZ8B 5FI1A 2IFSA 2M38A 4HAUB 4A5KA 1OMWA 2K2UA 5C6RA 1KZ7A 2LOZA 1I2HA 2Z0QA 3SNHA 4HB4B 4D0NB 2DHJA 3TO1A 1ZVRA 2NBVA 3KZ1A 3OHMB 2KUQA 2YVCA 1W1GA 4GPTB 4HATB 1U5GA 2KCJA 2YT0A 2D9VA 2W2XC 4HB3B 2IYBA 1V5UA 5J3TA 2YS5A 2DHIA 3TVVA 2MFQA 4ZRKA 2QKMA 4Y94A 1UNRA 3LJUX 2G35A 4MY6A 2NMBA 1X86A 5KQ4A 1IRSA 1UEFA 1MAIA 4CYEA 4ZRJA 4EKUA 4KHOA 2LOXA 2LULA 3ML4A 1WGUA 4K2OA 4KHBA 2R09A 1UNPA 3MDBC 1DBHA 3QWMA 2CY5A 1X1FA 3SUZA 4EJNA 1PFJA 4HHVA 5D3VA 2YS1A 2RNRB 4YONA 2LKOA 1W1DA 3IVFA 2DHKA 1Y5OA 2L1CA 4IFSA 1P5TA 4L6EA 1BTKA 2I5CA 2HTHB 2Y7BA 2EMTA 2V76A 2XQNM 2J59M 3ODOA 5J3YA 4HB2B 1GG3A 4A6KA 1DDWA 1WI1A 3N7CA 4HAXB 4Z2MB 1X05A 4DX90 4GMXB 4Z2NA 2D9XA 3U12A 3PEGA 1V89A 3HQCA 3CXBB 2RLOA 5JHGA 1J0WA 1EAZA 3TFMA 2DYQA 4L1RA 4WVFB 2Y8FA 3TCAA 2RGNB 4D6WA 2R0DA 1MIZB 2YRYA 5KCVA 2I1KA 2MWNB 2Z14A 4H8SA 2I1JA 1U5EA 3AU4A 4KHAA 4GN1A 1DDVA 3P6AA 5C16A 3DXCA 2K49A 1MKEA 3SYXA 4F7UP 1GC6A 5C5BB 1NU2A 2N23A 1K5GB 1OY2A 1XCGA 5KQ1A 3A58A 3ZVRA 1DYNA 3A8QA 1J19A 2K00A 2RSGA 2DX1A 1GC7A 4HAYB 3WYFB 4C0AA 2L2IA 4A6FB 2P0DA 2D4QA 2GCLA 1SHCA 3GYOA 3PVLA 3PZDA 4QJ5B 3HW2B 3KY9A 4QJ4B 1BAKA 4K17A 2AL6A 1SGHA 2LYDA 2HE7A 5D3YA 1P3RA 1NTYA 1V5MA 4BBKA 3PP2A 3F0WA 2GCJA 2PZ1A 2YT2A 1UNQA 3DXDA 1U2BA 2VRWB 2Z4DA 5HE2A 2CRFA 3ULBA 1M7EA 2EJ8A 2MKRA 4B6HA 3ODXA 2D10A 5EFXA 4DIXA 2OTXA 3AU5A 2H7DA 2VSZA
chains in the Genus database with same CATH topology
3ODWA 3SO6A 5CLQB 2N0YA 2COAA 4WJ7A 2QKLA 2D9YA 3M1IB 1UPRA 1WGQA 1H4RA 2ELAA 1FGZA 4TYZA 2RUKB 3DXEA 5L81A 2M14A 3V5WA 2Q13A 1Q67A 4XWXA 1TJ6A 1XKEA 2RVBB 1KI1B 1M7RA 3FSSA 1KZGA 5DIFB 1B55A 2GJYA 1FOEA 2EC1A 1QC6A 4K81A 1X11A 1V5PA 2J0KA 2COCA 3WA0A 2LG1A 3RCPA 1FHOA 3KRXA 3PVUA 1TXDA 1ZM0A 2DYNA 5JP4A 2P0HA 2D9WA 2YT1A 4YL8A 1V88A 5CLLB 3FM8C 4F7GA 1H10A 2ADZA 2H7EA 4NSWA 2D11A 2X18A 3D8DA 3MPXA 4DX8A 4HAVB 3A98B 1I7AA 3X23A 1ZC4B 2E2XA 1AQCA 3G9WA 2YSZA 1UPQA 2MDXA 2FJLA 2K2JA 5HE1A 5D27A 5D3WA 4GMVA 2CAYA 2W2WA 3AJ4A 1FHXA 1WG7A 1BTNA 1BWNA 2AEHA 1X1GA 4IOYX 2DA0A 2DKPA 2DLWA 1OQNA 3GYPA 5GOWB 5HE3A 1XODA 4HAZB 3ULCA 1QQGA 5LOPB 4HDOA 4P7IA 4DBBA 4HDQA 4ZRIA 2Z0PA 3SV1A 1FGYA 3ZDTA 3P7ZA 3PVWA 1U5DA 5C5BA 2BCJA 4A6HA 1LB1A 5LONB 1XX0A 4PQ0A 1NI2A 2D2QA 1MIXA 4IAPA 1MPHA 5FI0A 2JP2A 1WJ1A 1Z87A 2EMSA 2DKQA 3D8FA 2OQBA 4TKNA 1LW3A 2ROVA 2I5FA 1DROA 1W1HA 1XD4A 1MK9B 3BINA 1NTVA 1AWEA 2DTCA 1FHWA 3CIKA 4HB0B 3A8PA 3NSUA 3VOQA 4K2PA 4F7HA 1V61A 4MK0A 3PG7A 3OANA 5D3XA 4GXBA 5DHFB 3U7DA 1P6SA 3PSCA 1FB8A 2Z0OA 1EF1A 2DX5A 1RRPB 5DHAB 4DXAB 2ZPYA 1U27A 3TW1A 1DDMA 2ELBA 4GZUA 5HE0A 3VIAA 2CODA 5JLJB 1XR0B 1E5WA 1WJMA 4CHJA 1WVHA 2YS3A 2J0MA 4NY0A 2W2XD 2KGXB 3UZTA 3QIJA 1ZSQA 2VKIA 2DN6A 4A6FA 1MK7B 2DFKA 3QBVB 1Y19B 2P8VA 1EGXA 1ISNA 4KHBB 2COFA 1PMSA 1U29A 3D8EA 5DI9B 3O96A 1EVHA 4EMOA 2P0FA 4CHMA 5DH9B 1TQZA 3HK0A 1N3HA 4KVGB 2YF0A 1ZC3B 5J3QA 1FAOA 5JHHA 3KSYA 1U5FA 4MT7A 2Y8GA 3FEHA 3F5RA 5C79A 2UZRA 3U8ZA 2UVMA 3KRWA 2CY4A 4PNKA 1PLSA 2GS0A 4WSFA 3BJIA 4HAWB 3T06A 4KAXB 1K5DB 2ROZB 2UZSA 2KUPA 2J0JA 2D9ZA 1RJ2A 2NZ8B 5FI1A 2IFSA 2M38A 4HAUB 4A5KA 1OMWA 2K2UA 5C6RA 1KZ7A 2LOZA 1I2HA 2Z0QA 3SNHA 4HB4B 4D0NB 2DHJA 3TO1A 1ZVRA 3KZ1A 2YVCA 1W1GA 4GPTB 4HATB 1U5GA 2KCJA 2YT0A 2D9VA 2W2XC 4HB3B 2IYBA 1V5UA 5J3TA 2YS5A 2DHIA 3TVVA 2MFQA 4ZRKA 2QKMA 4Y94A 1UNRA 3LJUX 2G35A 4MY6A 2NMBA 1X86A 5KQ4A 1IRSA 1UEFA 1MAIA 4CYEA 4ZRJA 4EKUA 4KHOA 2LOXA 2LULA 3ML4A 1WGUA 4K2OA 2R09A 1UNPA 3MDBC 1DBHA 3QWMA 2CY5A 1X1FA 3SUZA 4EJNA 1PFJA 4HHVA 5D3VA 2YS1A 2RNRB 4YONA 2LKOA 1W1DA 3IVFA 2DHKA 1Y5OA 2L1CA 4IFSA 1P5TA 4L6EA 1BTKA 2I5CA 2HTHB 2Y7BA 2EMTA 2V76A 2XQNM 2J59M 3ODOA 5J3YA 4HB2B 1GG3A 4A6KA 1DDWA 1WI1A 3N7CA 4HAXB 4Z2MB 1X05A 4DX90 4GMXB 4Z2NA 2D9XA 3PEGA 1V89A 3HQCA 3CXBB 2RLOA 5JHGA 1J0WA 1EAZA 3TFMA 2DYQA 4WVFB 2Y8FA 3TCAA 2RGNB 2R0DA 1MIZB 2YRYA 5KCVA 2I1KA 2MWNB 4H8SA 2I1JA 1U5EA 3AU4A 4KHAA 4GN1A 1DDVA 3P6AA 5C16A 3DXCA 1MKEA 3SYXA 4F7UP 1GC6A 5C5BB 1NU2A 2N23A 1K5GB 1OY2A 1XCGA 5KQ1A 3ZVRA 1DYNA 3A8QA 1J19A 2K00A 2RSGA 2DX1A 1GC7A 4HAYB 3WYFB 4C0AA 2L2IA 4A6FB 2P0DA 2D4QA 2GCLA 1SHCA 3GYOA 3PVLA 3PZDA 3HW2B 3KY9A 1BAKA 4K17A 2AL6A 1SGHA 2LYDA 2HE7A 5D3YA 1P3RA 1NTYA 1V5MA 4BBKA 3PP2A 3F0WA 2GCJA 2PZ1A 1UNQA 1U2BA 3DXDA 2VRWB 5HE2A 2CRFA 3ULBA 1M7EA 2EJ8A 2MKRA 4B6HA 3ODXA 2D10A 5EFXA 2OTXA 3AU5A 2H7DA 2VSZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ODW A;  3SO6 A;  5CLQ B;  2N0Y A;  2COA A;  4WJ7 A;  2QKL A;  2D9Y A;  3M1I B;  1UPR A;  1WGQ A;  1H4R A;  2ELA A;  1FGZ A;  4TYZ A;  2RUK B;  3DXE A;  5L81 A;  2M14 A;  3V5W A;  2Q13 A;  1Q67 A;  4XWX A;  1TJ6 A;  1XKE A;  2RVB B;  1KI1 B;  1M7R A;  3FSS A;  1KZG A;  5DIF B;  1B55 A;  2GJY A;  1FOE A;  2EC1 A;  1QC6 A;  4K81 A;  1X11 A;  1V5P A;  2J0K A;  2COC A;  3WA0 A;  2LG1 A;  3RCP A;  1FHO A;  3KRX A;  3PVU A;  1TXD A;  1ZM0 A;  2DYN A;  5JP4 A;  2P0H A;  2D9W A;  2YT1 A;  4YL8 A;  1V88 A;  5CLL B;  3FM8 C;  4F7G A;  1H10 A;  2ADZ A;  2H7E A;  4NSW A;  2D11 A;  2X18 A;  3D8D A;  3MPX A;  4DX8 A;  4HAV B;  3A98 B;  1I7A A;  3X23 A;  1ZC4 B;  2E2X A;  1AQC A;  3G9W A;  2YSZ A;  1UPQ A;  2MDX A;  2FJL A;  2K2J A;  5HE1 A;  5D27 A;  5D3W A;  4GMV A;  2CAY A;  2W2W A;  3AJ4 A;  1FHX A;  1WG7 A;  1BTN A;  1BWN A;  2AEH A;  1X1G A;  4IOY X;  2DA0 A;  2DKP A;  2DLW A;  1OQN A;  3GYP A;  5GOW B;  5HE3 A;  1XOD A;  4HAZ B;  3ULC A;  1QQG A;  5LOP B;  4HDO A;  4P7I A;  4DBB A;  4HDQ A;  4ZRI A;  2Z0P A;  3SV1 A;  1FGY A;  3ZDT A;  3P7Z A;  3PVW A;  1U5D A;  5C5B A;  2BCJ A;  4A6H A;  1LB1 A;  5LON B;  1XX0 A;  4PQ0 A;  1NI2 A;  2D2Q A;  1MIX A;  4IAP A;  1MPH A;  5FI0 A;  2JP2 A;  1WJ1 A;  1Z87 A;  2EMS A;  2DKQ A;  3D8F A;  2OQB A;  4TKN A;  1LW3 A;  2ROV A;  2I5F A;  1DRO A;  1W1H A;  1XD4 A;  1MK9 B;  3BIN A;  1NTV A;  1AWE A;  2DTC A;  1FHW A;  3CIK A;  4HB0 B;  3A8P A;  3NSU A;  3VOQ A;  4K2P A;  4F7H A;  1V61 A;  4MK0 A;  3PG7 A;  3OAN A;  5D3X A;  4GXB A;  5DHF B;  3U7D A;  1P6S A;  3PSC A;  1FB8 A;  2Z0O A;  1EF1 A;  2DX5 A;  1RRP B;  5DHA B;  4DXA B;  2ZPY A;  1U27 A;  3TW1 A;  1DDM A;  2ELB A;  4GZU A;  5HE0 A;  3VIA A;  2COD A;  5JLJ B;  1XR0 B;  1E5W A;  1WJM A;  4CHJ A;  1WVH A;  2YS3 A;  2J0M A;  4NY0 A;  2W2X D;  2KGX B;  3UZT A;  3QIJ A;  1ZSQ A;  2VKI A;  2DN6 A;  4A6F A;  1MK7 B;  2DFK A;  3QBV B;  1Y19 B;  2P8V A;  1EGX A;  1ISN A;  4KHB B;  2COF A;  1PMS A;  1U29 A;  3D8E A;  5DI9 B;  3O96 A;  1EVH A;  4EMO A;  2P0F A;  4CHM A;  5DH9 B;  1TQZ A;  3HK0 A;  1N3H A;  4KVG B;  2YF0 A;  1ZC3 B;  5J3Q A;  1FAO A;  5JHH A;  3KSY A;  1U5F A;  4MT7 A;  2Y8G A;  3FEH A;  3F5R A;  5C79 A;  2UZR A;  3U8Z A;  2UVM A;  3KRW A;  2CY4 A;  4PNK A;  1PLS A;  2GS0 A;  4WSF A;  3BJI A;  4HAW B;  3T06 A;  4KAX B;  1K5D B;  2ROZ B;  2UZS A;  2KUP A;  2J0J A;  2D9Z A;  1RJ2 A;  2NZ8 B;  5FI1 A;  2IFS A;  2M38 A;  4HAU B;  4A5K A;  1OMW A;  2K2U A;  5C6R A;  1KZ7 A;  2LOZ A;  1I2H A;  2Z0Q A;  3SNH A;  4HB4 B;  4D0N B;  2DHJ A;  3TO1 A;  1ZVR A;  3KZ1 A;  2YVC A;  1W1G A;  4GPT B;  4HAT B;  1U5G A;  2KCJ A;  2YT0 A;  2D9V A;  2W2X C;  4HB3 B;  2IYB A;  1V5U A;  5J3T A;  2YS5 A;  2DHI A;  3TVV A;  2MFQ A;  4ZRK A;  2QKM A;  4Y94 A;  1UNR A;  3LJU X;  2G35 A;  4MY6 A;  2NMB A;  1X86 A;  5KQ4 A;  1IRS A;  1UEF A;  1MAI A;  4CYE A;  4ZRJ A;  4EKU A;  4KHO A;  2LOX A;  2LUL A;  3ML4 A;  1WGU A;  4K2O A;  2R09 A;  1UNP A;  3MDB C;  1DBH A;  3QWM A;  2CY5 A;  1X1F A;  3SUZ A;  4EJN A;  1PFJ A;  4HHV A;  5D3V A;  2YS1 A;  2RNR B;  4YON A;  2LKO A;  1W1D A;  3IVF A;  2DHK A;  1Y5O A;  2L1C A;  4IFS A;  1P5T A;  4L6E A;  1BTK A;  2I5C A;  2HTH B;  2Y7B A;  2EMT A;  2V76 A;  2XQN M;  2J59 M;  3ODO A;  5J3Y A;  4HB2 B;  1GG3 A;  4A6K A;  1DDW A;  1WI1 A;  3N7C A;  4HAX B;  4Z2M B;  1X05 A;  4DX9 0;  4GMX B;  4Z2N A;  2D9X A;  3PEG A;  1V89 A;  3HQC A;  3CXB B;  2RLO A;  5JHG A;  1J0W A;  1EAZ A;  3TFM A;  2DYQ A;  4WVF B;  2Y8F A;  3TCA A;  2RGN B;  2R0D A;  1MIZ B;  2YRY A;  5KCV A;  2I1K A;  2MWN B;  4H8S A;  2I1J A;  1U5E A;  3AU4 A;  4KHA A;  4GN1 A;  1DDV A;  3P6A A;  5C16 A;  3DXC A;  1MKE A;  3SYX A;  4F7U P;  1GC6 A;  5C5B B;  1NU2 A;  2N23 A;  1K5G B;  1OY2 A;  1XCG A;  5KQ1 A;  3ZVR A;  1DYN A;  3A8Q A;  1J19 A;  2K00 A;  2RSG A;  2DX1 A;  1GC7 A;  4HAY B;  3WYF B;  4C0A A;  2L2I A;  4A6F B;  2P0D A;  2D4Q A;  2GCL A;  1SHC A;  3GYO A;  3PVL A;  3PZD A;  3HW2 B;  3KY9 A;  1BAK A;  4K17 A;  2AL6 A;  1SGH A;  2LYD A;  2HE7 A;  5D3Y A;  1P3R A;  1NTY A;  1V5M A;  4BBK A;  3PP2 A;  3F0W A;  2GCJ A;  2PZ1 A;  1UNQ A;  1U2B A;  3DXD A;  2VRW B;  5HE2 A;  2CRF A;  3ULB A;  1M7E A;  2EJ8 A;  2MKR A;  4B6H A;  3ODX A;  2D10 A;  5EFX A;  2OTX A;  3AU5 A;  2H7D A;  2VSZ A; 
#chains in the Genus database with same CATH topology
 3ODW A;  3SO6 A;  4GNK B;  5CLQ B;  2N0Y A;  2COA A;  4WJ7 A;  2QKL A;  2D9Y A;  3M1I B;  1UPR A;  1WGQ A;  1H4R A;  2ELA A;  1FGZ A;  4TYZ A;  2KIE A;  5IRS A;  2RUK B;  2Z59 A;  3DXE A;  5L81 A;  2M14 A;  3V5W A;  2Q13 A;  1Q67 A;  4XWX A;  1TJ6 A;  1XKE A;  2RVB B;  4OT1 A;  1KI1 B;  1M7R A;  3FSS A;  1KZG A;  2KR0 A;  5DIF B;  1B55 A;  2GJY A;  2RRF A;  1FOE A;  2EC1 A;  1QC6 A;  1ZYI A;  4K81 A;  1X11 A;  1V5P A;  2J0K A;  2COC A;  2KIG A;  3WA0 A;  2LG1 A;  3RCP A;  1FHO A;  3KRX A;  3PVU A;  1TXD A;  1ZM0 A;  2DYN A;  5JP4 A;  4QXA B;  2P0H A;  2D9W A;  2YT1 A;  4YL8 A;  1V88 A;  5CLL B;  3FM8 C;  4CSQ A;  4F7G A;  1H10 A;  2Z13 A;  2ADZ A;  5LG4 B;  2H7E A;  4NSW A;  2D11 A;  2X18 A;  3D8D A;  3MPX A;  4DX8 A;  4HAV B;  4OSN A;  3A98 B;  1I7A A;  2ZKM X;  3X23 A;  1ZC4 B;  2E2X A;  1AQC A;  3G9W A;  2YSZ A;  1UPQ A;  2MDX A;  2FJL A;  2K2J A;  5HE1 A;  5D27 A;  5D3W A;  4GMV A;  2CAY A;  2W2W A;  3AJ4 A;  1FHX A;  1WG7 A;  1BTN A;  1BWN A;  2AEH A;  1X1G A;  4IOY X;  2DA0 A;  2DKP A;  2DLW A;  1OQN A;  3GYP A;  5GOW B;  5HE3 A;  1XOD A;  4HAZ B;  3ULC A;  1QQG A;  5LOP B;  4HDO A;  4P7I A;  4DBB A;  4HDQ A;  4ZRI A;  4GOU A;  3HSA A;  2Z0P A;  3SV1 A;  1FGY A;  3ZDT A;  3P7Z A;  3PVW A;  1U5D A;  5C5B A;  2BCJ A;  4A6H A;  1LB1 A;  4QJ3 B;  1XX0 A;  4PQ0 A;  5LON B;  1NI2 A;  2D2Q A;  1MIX A;  4IAP A;  4HSI A;  1MPH A;  5FI0 A;  2JP2 A;  1WJ1 A;  1Z87 A;  2EMS A;  2DKQ A;  3D8F A;  2OQB A;  4TKN A;  1LW3 A;  2ROV A;  2I5F A;  1DRO A;  3FVC A;  1W1H A;  1XD4 A;  1MK9 B;  1T77 A;  3BIN A;  1NTV A;  1AWE A;  3NW8 A;  2DTC A;  1FHW A;  3CIK A;  5M4Y B;  4HB0 B;  3A8P A;  3NSU A;  3VOQ A;  4K2P A;  4F7H A;  1V61 A;  4MK0 A;  3PG7 A;  3OAN A;  5D3X A;  4GXB A;  5DHF B;  3U7D A;  1P6S A;  3PSC A;  1FB8 A;  2Z0O A;  1EF1 A;  3HIE A;  2DX5 A;  1RRP B;  5DHA B;  4DXA B;  2ZPY A;  5I2S A;  1U27 A;  3TW1 A;  1DDM A;  2ELB A;  4GZU A;  5HE0 A;  3VIA A;  2COD A;  5JLJ B;  1XR0 B;  1E5W A;  1WJM A;  4CHJ A;  1WVH A;  2YS3 A;  2J0M A;  4NY0 A;  2W2X D;  2KGX B;  3UZT A;  3QIJ A;  1ZSQ A;  2VKI A;  2DN6 A;  4A6F A;  1MK7 B;  2DFK A;  3QBV B;  1Y19 B;  2P8V A;  1EGX A;  2GUM A;  1ISN A;  4KHB B;  2COF A;  1PMS A;  1U29 A;  3D8E A;  5DI9 B;  3DCX A;  3O96 A;  1EVH A;  4EMO A;  2FJU B;  3NWF A;  2P0F A;  4CHM A;  5DH9 B;  1TQZ A;  3HK0 A;  1N3H A;  4KVG B;  2YF0 A;  1ZC3 B;  5J3Q A;  3B77 A;  1FAO A;  5JHH A;  3KSY A;  1MI1 A;  5I2M A;  1U5F A;  4MT7 A;  2Y8G A;  3FEH A;  3F5R A;  5C79 A;  2UZR A;  3U8Z A;  2UVM A;  3KRW A;  2CY4 A;  3NWD A;  2R2Y A;  4PNK A;  1PLS A;  2GS0 A;  4WSF A;  3BJI A;  4HAW B;  2K8E A;  3T06 A;  4KAX B;  1K5D B;  2ROZ B;  2UZS A;  2KUP A;  3NWA A;  2J0J A;  2D9Z A;  1RJ2 A;  2NZ8 B;  5FI1 A;  2IFS A;  2M38 A;  4HAU B;  4A5K A;  1OMW A;  2K2U A;  5C6R A;  1KZ7 A;  2LOZ A;  1I2H A;  2Z0Q A;  3SNH A;  4HB4 B;  4D0N B;  2DHJ A;  3TO1 A;  1ZVR A;  2NBV A;  3KZ1 A;  3OHM B;  2KUQ A;  2YVC A;  1W1G A;  4GPT B;  4HAT B;  1U5G A;  2KCJ A;  2YT0 A;  2D9V A;  2W2X C;  4HB3 B;  2IYB A;  1V5U A;  5J3T A;  2YS5 A;  2DHI A;  3TVV A;  2MFQ A;  4ZRK A;  2QKM A;  4Y94 A;  1UNR A;  3LJU X;  2G35 A;  4MY6 A;  2NMB A;  1X86 A;  5KQ4 A;  1IRS A;  1UEF A;  1MAI A;  4CYE A;  4ZRJ A;  4EKU A;  4KHO A;  2LOX A;  2LUL A;  3ML4 A;  1WGU A;  4K2O A;  4KHB A;  2R09 A;  1UNP A;  3MDB C;  1DBH A;  3QWM A;  2CY5 A;  1X1F A;  3SUZ A;  4EJN A;  1PFJ A;  4HHV A;  5D3V A;  2YS1 A;  2RNR B;  4YON A;  2LKO A;  1W1D A;  3IVF A;  2DHK A;  1Y5O A;  2L1C A;  4IFS A;  1P5T A;  4L6E A;  1BTK A;  2I5C A;  2HTH B;  2Y7B A;  2EMT A;  2V76 A;  2XQN M;  2J59 M;  3ODO A;  5J3Y A;  4HB2 B;  1GG3 A;  4A6K A;  1DDW A;  1WI1 A;  3N7C A;  4HAX B;  4Z2M B;  1X05 A;  4DX9 0;  4GMX B;  4Z2N A;  2D9X A;  3U12 A;  3PEG A;  1V89 A;  3HQC A;  3CXB B;  2RLO A;  5JHG A;  1J0W A;  1EAZ A;  3TFM A;  2DYQ A;  4L1R A;  4WVF B;  2Y8F A;  3TCA A;  2RGN B;  4D6W A;  2R0D A;  1MIZ B;  2YRY A;  5KCV A;  2I1K A;  2MWN B;  2Z14 A;  4H8S A;  2I1J A;  1U5E A;  3AU4 A;  4KHA A;  4GN1 A;  1DDV A;  3P6A A;  5C16 A;  3DXC A;  2K49 A;  1MKE A;  3SYX A;  4F7U P;  1GC6 A;  5C5B B;  1NU2 A;  2N23 A;  1K5G B;  1OY2 A;  1XCG A;  5KQ1 A;  3A58 A;  3ZVR A;  1DYN A;  3A8Q A;  1J19 A;  2K00 A;  2RSG A;  2DX1 A;  1GC7 A;  4HAY B;  3WYF B;  4C0A A;  2L2I A;  4A6F B;  2P0D A;  2D4Q A;  2GCL A;  1SHC A;  3GYO A;  3PVL A;  3PZD A;  4QJ5 B;  3HW2 B;  3KY9 A;  4QJ4 B;  1BAK A;  4K17 A;  2AL6 A;  1SGH A;  2LYD A;  2HE7 A;  5D3Y A;  1P3R A;  1NTY A;  1V5M A;  4BBK A;  3PP2 A;  3F0W A;  2GCJ A;  2PZ1 A;  2YT2 A;  1UNQ A;  3DXD A;  1U2B A;  2VRW B;  2Z4D A;  5HE2 A;  2CRF A;  3ULB A;  1M7E A;  2EJ8 A;  2MKR A;  4B6H A;  3ODX A;  2D10 A;  5EFX A;  4DIX A;  2OTX A;  3AU5 A;  2H7D A;  2VSZ A; 
#chains in the Genus database with same CATH homology
 3ODW A;  3SO6 A;  5CLQ B;  2N0Y A;  2COA A;  4WJ7 A;  2QKL A;  2D9Y A;  3M1I B;  1UPR A;  1WGQ A;  1H4R A;  2ELA A;  1FGZ A;  4TYZ A;  2RUK B;  3DXE A;  5L81 A;  2M14 A;  3V5W A;  2Q13 A;  1Q67 A;  4XWX A;  1TJ6 A;  1XKE A;  2RVB B;  1KI1 B;  1M7R A;  3FSS A;  1KZG A;  5DIF B;  1B55 A;  2GJY A;  1FOE A;  2EC1 A;  1QC6 A;  4K81 A;  1X11 A;  1V5P A;  2J0K A;  2COC A;  3WA0 A;  2LG1 A;  3RCP A;  1FHO A;  3KRX A;  3PVU A;  1TXD A;  1ZM0 A;  2DYN A;  5JP4 A;  2P0H A;  2D9W A;  2YT1 A;  4YL8 A;  1V88 A;  5CLL B;  3FM8 C;  4F7G A;  1H10 A;  2ADZ A;  2H7E A;  4NSW A;  2D11 A;  2X18 A;  3D8D A;  3MPX A;  4DX8 A;  4HAV B;  3A98 B;  1I7A A;  3X23 A;  1ZC4 B;  2E2X A;  1AQC A;  3G9W A;  2YSZ A;  1UPQ A;  2MDX A;  2FJL A;  2K2J A;  5HE1 A;  5D27 A;  5D3W A;  4GMV A;  2CAY A;  2W2W A;  3AJ4 A;  1FHX A;  1WG7 A;  1BTN A;  1BWN A;  2AEH A;  1X1G A;  4IOY X;  2DA0 A;  2DKP A;  2DLW A;  1OQN A;  3GYP A;  5GOW B;  5HE3 A;  1XOD A;  4HAZ B;  3ULC A;  1QQG A;  5LOP B;  4HDO A;  4P7I A;  4DBB A;  4HDQ A;  4ZRI A;  2Z0P A;  3SV1 A;  1FGY A;  3ZDT A;  3P7Z A;  3PVW A;  1U5D A;  5C5B A;  2BCJ A;  4A6H A;  1LB1 A;  5LON B;  1XX0 A;  4PQ0 A;  1NI2 A;  2D2Q A;  1MIX A;  4IAP A;  1MPH A;  5FI0 A;  2JP2 A;  1WJ1 A;  1Z87 A;  2EMS A;  2DKQ A;  3D8F A;  2OQB A;  4TKN A;  1LW3 A;  2ROV A;  2I5F A;  1DRO A;  1W1H A;  1XD4 A;  1MK9 B;  3BIN A;  1NTV A;  1AWE A;  2DTC A;  1FHW A;  3CIK A;  4HB0 B;  3A8P A;  3NSU A;  3VOQ A;  4K2P A;  4F7H A;  1V61 A;  4MK0 A;  3PG7 A;  3OAN A;  5D3X A;  4GXB A;  5DHF B;  3U7D A;  1P6S A;  3PSC A;  1FB8 A;  2Z0O A;  1EF1 A;  2DX5 A;  1RRP B;  5DHA B;  4DXA B;  2ZPY A;  1U27 A;  3TW1 A;  1DDM A;  2ELB A;  4GZU A;  5HE0 A;  3VIA A;  2COD A;  5JLJ B;  1XR0 B;  1E5W A;  1WJM A;  4CHJ A;  1WVH A;  2YS3 A;  2J0M A;  4NY0 A;  2W2X D;  2KGX B;  3UZT A;  3QIJ A;  1ZSQ A;  2VKI A;  2DN6 A;  4A6F A;  1MK7 B;  2DFK A;  3QBV B;  1Y19 B;  2P8V A;  1EGX A;  1ISN A;  4KHB B;  2COF A;  1PMS A;  1U29 A;  3D8E A;  5DI9 B;  3O96 A;  1EVH A;  4EMO A;  2P0F A;  4CHM A;  5DH9 B;  1TQZ A;  3HK0 A;  1N3H A;  4KVG B;  2YF0 A;  1ZC3 B;  5J3Q A;  1FAO A;  5JHH A;  3KSY A;  1U5F A;  4MT7 A;  2Y8G A;  3FEH A;  3F5R A;  5C79 A;  2UZR A;  3U8Z A;  2UVM A;  3KRW A;  2CY4 A;  4PNK A;  1PLS A;  2GS0 A;  4WSF A;  3BJI A;  4HAW B;  3T06 A;  4KAX B;  1K5D B;  2ROZ B;  2UZS A;  2KUP A;  2J0J A;  2D9Z A;  1RJ2 A;  2NZ8 B;  5FI1 A;  2IFS A;  2M38 A;  4HAU B;  4A5K A;  1OMW A;  2K2U A;  5C6R A;  1KZ7 A;  2LOZ A;  1I2H A;  2Z0Q A;  3SNH A;  4HB4 B;  4D0N B;  2DHJ A;  3TO1 A;  1ZVR A;  3KZ1 A;  2YVC A;  1W1G A;  4GPT B;  4HAT B;  1U5G A;  2KCJ A;  2YT0 A;  2D9V A;  2W2X C;  4HB3 B;  2IYB A;  1V5U A;  5J3T A;  2YS5 A;  2DHI A;  3TVV A;  2MFQ A;  4ZRK A;  2QKM A;  4Y94 A;  1UNR A;  3LJU X;  2G35 A;  4MY6 A;  2NMB A;  1X86 A;  5KQ4 A;  1IRS A;  1UEF A;  1MAI A;  4CYE A;  4ZRJ A;  4EKU A;  4KHO A;  2LOX A;  2LUL A;  3ML4 A;  1WGU A;  4K2O A;  2R09 A;  1UNP A;  3MDB C;  1DBH A;  3QWM A;  2CY5 A;  1X1F A;  3SUZ A;  4EJN A;  1PFJ A;  4HHV A;  5D3V A;  2YS1 A;  2RNR B;  4YON A;  2LKO A;  1W1D A;  3IVF A;  2DHK A;  1Y5O A;  2L1C A;  4IFS A;  1P5T A;  4L6E A;  1BTK A;  2I5C A;  2HTH B;  2Y7B A;  2EMT A;  2V76 A;  2XQN M;  2J59 M;  3ODO A;  5J3Y A;  4HB2 B;  1GG3 A;  4A6K A;  1DDW A;  1WI1 A;  3N7C A;  4HAX B;  4Z2M B;  1X05 A;  4DX9 0;  4GMX B;  4Z2N A;  2D9X A;  3PEG A;  1V89 A;  3HQC A;  3CXB B;  2RLO A;  5JHG A;  1J0W A;  1EAZ A;  3TFM A;  2DYQ A;  4WVF B;  2Y8F A;  3TCA A;  2RGN B;  2R0D A;  1MIZ B;  2YRY A;  5KCV A;  2I1K A;  2MWN B;  4H8S A;  2I1J A;  1U5E A;  3AU4 A;  4KHA A;  4GN1 A;  1DDV A;  3P6A A;  5C16 A;  3DXC A;  1MKE A;  3SYX A;  4F7U P;  1GC6 A;  5C5B B;  1NU2 A;  2N23 A;  1K5G B;  1OY2 A;  1XCG A;  5KQ1 A;  3ZVR A;  1DYN A;  3A8Q A;  1J19 A;  2K00 A;  2RSG A;  2DX1 A;  1GC7 A;  4HAY B;  3WYF B;  4C0A A;  2L2I A;  4A6F B;  2P0D A;  2D4Q A;  2GCL A;  1SHC A;  3GYO A;  3PVL A;  3PZD A;  3HW2 B;  3KY9 A;  1BAK A;  4K17 A;  2AL6 A;  1SGH A;  2LYD A;  2HE7 A;  5D3Y A;  1P3R A;  1NTY A;  1V5M A;  4BBK A;  3PP2 A;  3F0W A;  2GCJ A;  2PZ1 A;  1UNQ A;  1U2B A;  3DXD A;  2VRW B;  5HE2 A;  2CRF A;  3ULB A;  1M7E A;  2EJ8 A;  2MKR A;  4B6H A;  3ODX A;  2D10 A;  5EFX A;  2OTX A;  3AU5 A;  2H7D A;  2VSZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...