2DYNA

Dynamin (pleckstrin homology domain) (dynph)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
111
structure length
111
Chain Sequence
ILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DYNAMIN
publication title Crystal structure of the pleckstrin homology domain from dynamin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signal transduction
total genus 22
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 3.6.5.5: Dynamin GTPase.
pdb deposition date 1997-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dynA00
4IFSA 1QQGA 2I1JA 2MFQA 4ZRKA 2YVCA 2AEHA 1EVHA 5JHHA 1DDVA 2RLOA 2ELBA 4Y94A 4K2OA 3AJ4A 1GG3A 1WGUA 2H7EA 1NTYA 1Q67A 2YT0A 2M38A 2N0YA 4HAYB 5J3QA 3AU4A 1SHCA 2P0DA 1FHXA 2RNRB 1V5MA 3PVLA 3SO6A 2R09A 1Y19B 4YL8A 1PMSA 3VIAA 1U29A 5HE0A 1ISNA 1FHWA 3A8QA 3N7CA 5J3YA 4HAVB 2Y8GA 1PLSA 4H8SA 5FI0A 2CRFA 1FGYA 5LOPB 1ZM0A 3X23A 2P0HA 3SNHA 2COCA 2D4QA 3O96A 2COAA 1B55A 2DX5A 2UVMA 5L81A 4HAXB 2YT1A 3G9WA 2DN6A 2JP2A 1J19A 3WA0A 2W2WA 1DYNA 1M7EA 5JHGA 2GCLA 1U2BA 1XODA 3HQCA 2MDXA 1ZC3B 2OTXA 1U5FA 1LB1A 2ZPYA 1EF1A 2D10A 1V61A 2Z0PA 4PNKA 2EJ8A 3GYPA 3M1IB 4DBBA 2XQNM 1BAKA 4WSFA 4XWXA 2YS5A 1DBHA 2OQBA 3U7DA 3DXCA 5DIFB 1X05A 4K81A 2UZSA 4K17A 2DYQA 5LONB 4MK0A 4Z2MB 1V88A 1QC6A 3PZDA 2K00A 3KRXA 3PEGA 3SV1A 2CAYA 5C79A 1DDWA 2EC1A 2AL6A 1K5DB 4WJ7A 2UZRA 1X1GA 2HTHB 3FSSA 4HAUB 4K2PA 3CIKA 3VOQA 2K2UA 2L1CA 1P5TA 4HATB 3P7ZA 4DXAB 3TFMA 4HDOA 3P6AA 1BTKA 2H7DA 5KCVA 1MK9B 1X1FA 4HHVA 1UPQA 3QIJA 2I1KA 1UEFA 1W1DA 1X11A 2J0MA 1UPRA 1ZSQA 2R0DA 1H4RA 3D8EA 5D3YA 4CYEA 4PQ0A 4ZRJA 1M7RA 1U27A 4KHBB 5D3VA 2DHJA 4EJNA 1GC6A 1TQZA 3T06A 5HE1A 3RCPA 2Y7BA 2X18A 1OY2A 1P6SA 2Z0QA 1RJ2A 2ROZB 3ML4A 2LG1A 5HE3A 3IVFA 3LJUX 1U5EA 3CXBB 4IOYX 1NU2A 5DI9B 1DDMA 1I2HA 1Z87A 2DHKA 5C6RA 2KCJA 3D8DA 3PSCA 5EFXA 1V5UA 1FHOA 4IAPA 1WVHA 1U5DA 2MWNB 1GC7A 4HB2B 5FI1A 4KHAA 1EGXA 1NTVA 4DX90 4F7HA 1OMWA 1W1HA 5D27A 2D9XA 5CLLB 5JP4A 2E2XA 3NSUA 1ZVRA 4KHOA 2KGXB 2D2QA 1LW3A 5HE2A 2YSZA 4MT7A 4B6HA 2DLWA 4NY0A 2BCJA 2MKRA 2K2JA 2DYNA 1OQNA 2GJYA 3DXDA 1XX0A 1PFJA 1FB8A 1SGHA 3SYXA 2DKQA 2J0JA 2QKMA 3AU5A 4YONA 1TJ6A 2ADZA 1P3RA 5D3WA 2D9VA 4A6KA 2RSGA 2RVBB 2ROVA 5DHAB 3A8PA 1J0WA 3HW2B 2GS0A 3ULBA 5C5BA 2DKPA 2PZ1A 3A98B 2D9WA 3HK0A 2L2IA 2CY4A 5C5BB 1MAIA 2DX1A 5D3XA 3GYOA 3UZTA 1H10A 2YF0A 1AWEA 2D11A 2LOZA 1BWNA 4HB4B 4KVGB 1TXDA 4WVFB 2I5FA 3FEHA 1WJMA 3OANA 3ULCA 3BINA 1MPHA 4EKUA 1WGQA 1I7AA 3KZ1A 5DHFB 3V5WA 5J3TA 3MDBC 5C16A 1FAOA 3DXEA 4GN1A 1KZ7A 2RUKB 2YRYA 2CODA 3FM8C 2YS3A 4HAWB 1XD4A 5KQ4A 4F7UP 1XKEA 1WI1A 1DROA 2RGNB 4HAZB 1NI2A 4GMVA 1W1GA 1E5WA 4A6FA 4CHJA 3KY9A 3ZVRA 3KRWA 1BTNA 1N3HA 2NZ8B 2D9YA 2VRWB 2DTCA 4A6FB 3PG7A 4NSWA 1IRSA 4KAXB 2Y8FA 4A5KA 4F7GA 4MY6A 2J59M 1WG7A 3D8FA 2D9ZA 4P7IA 5CLQB 4GPTB 2EMTA 4GXBA 2LULA 1RRPB 3PP2A 1XCGA 2M14A 1X86A 2LOXA 1KI1B 4C0AA 3ZDTA 1MIZB 2IFSA 1EAZA 3WYFB 2FJLA 2G35A 3TO1A 2DFKA 2Q13A 1MKEA 4TKNA 2YS1A 4HB0B 2NMBA 3TVVA 2W2XD 1XR0B 1MK7B 4DX8A 5GOWB 3U8ZA 1UNQA 1Y5OA 1FOEA 1UNRA 3PVWA 3BJIA 1FGZA 4CHMA 5KQ1A 2I5CA 3TW1A 4ZRIA 2N23A 2CY5A 4BBKA 3ODOA 1ZC4B 2V76A 1UNPA 1V5PA 2EMSA 2GCJA 1WJ1A 3QWMA 4HB3B 3ODWA 4EMOA 1MIXA 1K5GB 2HE7A 2ELAA 4L6EA 4Z2NA 4HDQA 2IYBA 3F0WA 3TCAA 2VSZA 4A6HA 2W2XC 3MPXA 2Z0OA 2COFA 1U5GA 4D0NB 4GZUA 2LYDA 5JLJB 3QBVB 1KZGA 3KSYA 3PVUA 2VKIA 2LKOA 3ODXA 2P0FA 4TYZA 2DHIA 2J0KA 3SUZA 2KUPA 5DH9B 2DA0A 1V89A 1AQCA 2P8VA 4GMXB 2QKLA 3F5RA
chains in the Genus database with same CATH superfamily
4IFSA 1QQGA 2I1JA 2MFQA 4ZRKA 2YVCA 2AEHA 1EVHA 5JHHA 1DDVA 2RLOA 2ELBA 4Y94A 3NWFA 4K2OA 3AJ4A 1GG3A 1WGUA 2H7EA 1NTYA 1Q67A 2YT0A 4GOUA 2M38A 2N0YA 2YT2A 2K49A 4HAYB 5J3QA 3AU4A 1SHCA 2P0DA 1FHXA 2RNRB 1V5MA 5LG4B 3PVLA 3SO6A 2R09A 1Y19B 4YL8A 4L1RA 1PMSA 3VIAA 1U29A 5HE0A 1ISNA 1FHWA 3A8QA 3N7CA 5J3YA 4HAVB 2Y8GA 1PLSA 4H8SA 5FI0A 2CRFA 1FGYA 4D6WA 5LOPB 1ZM0A 3X23A 2P0HA 3SNHA 3NWAA 2COCA 2D4QA 3O96A 2COAA 1B55A 2DX5A 5I2MA 2UVMA 5L81A 4HAXB 2YT1A 3G9WA 2DN6A 2JP2A 1J19A 3WA0A 2W2WA 1DYNA 1M7EA 5JHGA 2GCLA 1U2BA 1XODA 3HQCA 2MDXA 1ZC3B 2OTXA 1U5FA 1LB1A 2ZPYA 1EF1A 2R2YA 2D10A 1V61A 2Z0PA 4PNKA 2EJ8A 3GYPA 3M1IB 4DBBA 2XQNM 1BAKA 4WSFA 2RRFA 4XWXA 2YS5A 1DBHA 2OQBA 3U7DA 3DXCA 3NW8A 5DIFB 1X05A 4K81A 2UZSA 4HSIA 4K17A 2DYQA 5LONB 4MK0A 4Z2MB 1V88A 2KUQA 1QC6A 4QJ5B 3PZDA 2K00A 3KRXA 3PEGA 2Z4DA 3SV1A 2CAYA 5C79A 1DDWA 2EC1A 2AL6A 1K5DB 4WJ7A 2UZRA 1X1GA 3FVCA 2HTHB 3FSSA 4HAUB 4K2PA 3CIKA 3VOQA 2K2UA 1MI1A 2L1CA 1P5TA 4HATB 3P7ZA 4DXAB 3TFMA 4HDOA 3P6AA 1BTKA 2H7DA 5KCVA 1MK9B 1X1FA 3A58A 4HHVA 1UPQA 3QIJA 2FJUB 2I1KA 1UEFA 4DIXA 1W1DA 1X11A 2J0MA 1UPRA 1ZSQA 2R0DA 1H4RA 3D8EA 5D3YA 4CYEA 2NBVA 4PQ0A 4ZRJA 1M7RA 1U27A 4KHBB 5D3VA 2DHJA 4EJNA 1GC6A 1TQZA 3T06A 5HE1A 3RCPA 2Y7BA 2X18A 4CSQA 1OY2A 1P6SA 2Z0QA 1RJ2A 2ROZB 3ML4A 2LG1A 5HE3A 3IVFA 3LJUX 1U5EA 3CXBB 4IOYX 5M4YB 4QXAB 5I2SA 1NU2A 5DI9B 1DDMA 1I2HA 1Z87A 2DHKA 5C6RA 2KCJA 3U12A 3D8DA 3PSCA 5EFXA 1V5UA 1FHOA 4IAPA 1WVHA 1U5DA 2MWNB 1GC7A 4HB2B 5FI1A 4KHAA 1EGXA 1NTVA 4DX90 4F7HA 2Z59A 1OMWA 1W1HA 5D27A 2D9XA 5CLLB 5JP4A 2E2XA 3NSUA 1ZVRA 4KHOA 2Z13A 2KGXB 2D2QA 1LW3A 5HE2A 2YSZA 4MT7A 4B6HA 2DLWA 4NY0A 2BCJA 2KIGA 2MKRA 2K2JA 2DYNA 1OQNA 2GJYA 3DXDA 1XX0A 1PFJA 1FB8A 1SGHA 3SYXA 2DKQA 2J0JA 2QKMA 3DCXA 3AU5A 4YONA 1TJ6A 2ADZA 1P3RA 5D3WA 2D9VA 4A6KA 2RSGA 2RVBB 2ROVA 5DHAB 3A8PA 1J0WA 3HW2B 2GS0A 3ULBA 5C5BA 2DKPA 2PZ1A 3A98B 2D9WA 3HK0A 2L2IA 2CY4A 5C5BB 1MAIA 2DX1A 5D3XA 3GYOA 3UZTA 1H10A 2YF0A 2GUMA 1AWEA 2D11A 2LOZA 1BWNA 4HB4B 4KVGB 1TXDA 4WVFB 3B77A 2I5FA 3FEHA 1WJMA 3OANA 3ULCA 3BINA 1MPHA 4EKUA 1WGQA 1I7AA 3KZ1A 5DHFB 3V5WA 5J3TA 3MDBC 5C16A 1FAOA 3DXEA 4GN1A 1KZ7A 2RUKB 4KHBA 2YRYA 4QJ3B 2CODA 3FM8C 2YS3A 2KIEA 4HAWB 3OHMB 1XD4A 5KQ4A 4F7UP 1XKEA 1ZYIA 1WI1A 1DROA 2RGNB 4HAZB 1NI2A 4GMVA 1W1GA 1E5WA 4A6FA 4CHJA 2K8EA 3KY9A 3ZVRA 3KRWA 1BTNA 1N3HA 2NZ8B 2D9YA 2VRWB 2DTCA 4A6FB 3PG7A 4NSWA 1IRSA 4KAXB 2Y8FA 4A5KA 4F7GA 4MY6A 2ZKMX 2J59M 1WG7A 3D8FA 2D9ZA 4P7IA 5CLQB 4GPTB 2EMTA 4GXBA 2LULA 1RRPB 3PP2A 1XCGA 2M14A 1X86A 2LOXA 1KI1B 4C0AA 3ZDTA 1MIZB 2IFSA 1EAZA 3WYFB 2FJLA 2G35A 3TO1A 2DFKA 2Q13A 1MKEA 4TKNA 2YS1A 4HB0B 2NMBA 3TVVA 2W2XD 3NWDA 1XR0B 1MK7B 4DX8A 5GOWB 3U8ZA 1UNQA 1Y5OA 1FOEA 1UNRA 3PVWA 3BJIA 1FGZA 4CHMA 5KQ1A 2I5CA 3TW1A 4ZRIA 2N23A 2CY5A 4OT1A 4BBKA 3ODOA 1ZC4B 2V76A 1UNPA 1V5PA 2EMSA 4QJ4B 2GCJA 1WJ1A 3QWMA 4HB3B 3ODWA 3HSAA 4EMOA 5IRSA 1MIXA 1K5GB 2HE7A 2ELAA 4L6EA 4Z2NA 4HDQA 2IYBA 3F0WA 3TCAA 2VSZA 4GNKB 4A6HA 2W2XC 2KR0A 3MPXA 2Z0OA 2COFA 1U5GA 1T77A 4D0NB 4GZUA 2LYDA 5JLJB 3QBVB 1KZGA 3KSYA 3PVUA 2VKIA 4OSNA 2LKOA 3ODXA 2P0FA 2Z14A 4TYZA 2DHIA 2J0KA 3SUZA 2KUPA 5DH9B 2DA0A 1V89A 1AQCA 2P8VA 4GMXB 2QKLA 3F5RA 3HIEA
chains in the Genus database with same CATH topology
4IFSA 1QQGA 2I1JA 2MFQA 4ZRKA 2YVCA 2AEHA 1EVHA 5JHHA 1DDVA 2RLOA 2ELBA 4Y94A 4K2OA 3AJ4A 1GG3A 1WGUA 2H7EA 1NTYA 1Q67A 2YT0A 2M38A 2N0YA 4HAYB 5J3QA 3AU4A 1SHCA 2P0DA 1FHXA 2RNRB 1V5MA 3PVLA 3SO6A 2R09A 1Y19B 4YL8A 1PMSA 3VIAA 1U29A 5HE0A 1ISNA 1FHWA 3A8QA 3N7CA 5J3YA 4HAVB 2Y8GA 1PLSA 4H8SA 5FI0A 2CRFA 1FGYA 5LOPB 1ZM0A 3X23A 2P0HA 3SNHA 2COCA 2D4QA 3O96A 2COAA 1B55A 2DX5A 2UVMA 5L81A 4HAXB 2YT1A 3G9WA 2DN6A 2JP2A 1J19A 3WA0A 2W2WA 1DYNA 1M7EA 5JHGA 2GCLA 1U2BA 1XODA 3HQCA 2MDXA 1ZC3B 2OTXA 1U5FA 1LB1A 2ZPYA 1EF1A 2D10A 1V61A 2Z0PA 4PNKA 2EJ8A 3GYPA 3M1IB 4DBBA 2XQNM 1BAKA 4WSFA 4XWXA 2YS5A 1DBHA 2OQBA 3U7DA 3DXCA 5DIFB 1X05A 4K81A 2UZSA 4K17A 2DYQA 5LONB 4MK0A 4Z2MB 1V88A 1QC6A 3PZDA 2K00A 3KRXA 3PEGA 3SV1A 2CAYA 5C79A 1DDWA 2EC1A 2AL6A 1K5DB 4WJ7A 2UZRA 1X1GA 2HTHB 3FSSA 4HAUB 4K2PA 3CIKA 3VOQA 2K2UA 2L1CA 1P5TA 4HATB 3P7ZA 4DXAB 3TFMA 4HDOA 3P6AA 1BTKA 2H7DA 5KCVA 1MK9B 1X1FA 4HHVA 1UPQA 3QIJA 2I1KA 1UEFA 1W1DA 1X11A 2J0MA 1UPRA 1ZSQA 2R0DA 1H4RA 3D8EA 5D3YA 4CYEA 4PQ0A 4ZRJA 1M7RA 1U27A 4KHBB 5D3VA 2DHJA 4EJNA 1GC6A 1TQZA 3T06A 5HE1A 3RCPA 2Y7BA 2X18A 1OY2A 1P6SA 2Z0QA 1RJ2A 2ROZB 3ML4A 2LG1A 5HE3A 3IVFA 3LJUX 1U5EA 3CXBB 4IOYX 1NU2A 5DI9B 1DDMA 1I2HA 1Z87A 2DHKA 5C6RA 2KCJA 3D8DA 3PSCA 5EFXA 1V5UA 1FHOA 4IAPA 1WVHA 1U5DA 2MWNB 1GC7A 4HB2B 5FI1A 4KHAA 1EGXA 1NTVA 4DX90 4F7HA 1OMWA 1W1HA 5D27A 2D9XA 5CLLB 5JP4A 2E2XA 3NSUA 1ZVRA 4KHOA 2KGXB 2D2QA 1LW3A 5HE2A 2YSZA 4MT7A 4B6HA 2DLWA 4NY0A 2BCJA 2MKRA 2K2JA 2DYNA 1OQNA 2GJYA 3DXDA 1XX0A 1PFJA 1FB8A 1SGHA 3SYXA 2DKQA 2J0JA 2QKMA 3AU5A 4YONA 1TJ6A 2ADZA 1P3RA 5D3WA 2D9VA 4A6KA 2RSGA 2RVBB 2ROVA 5DHAB 3A8PA 1J0WA 3HW2B 2GS0A 3ULBA 5C5BA 2DKPA 2PZ1A 3A98B 2D9WA 3HK0A 2L2IA 2CY4A 5C5BB 1MAIA 2DX1A 5D3XA 3GYOA 3UZTA 1H10A 2YF0A 1AWEA 2D11A 2LOZA 1BWNA 4HB4B 4KVGB 1TXDA 4WVFB 2I5FA 3FEHA 1WJMA 3OANA 3ULCA 3BINA 1MPHA 4EKUA 1WGQA 1I7AA 3KZ1A 5DHFB 3V5WA 5J3TA 3MDBC 5C16A 1FAOA 3DXEA 4GN1A 1KZ7A 2RUKB 2YRYA 2CODA 3FM8C 2YS3A 4HAWB 1XD4A 5KQ4A 4F7UP 1XKEA 1WI1A 1DROA 2RGNB 4HAZB 1NI2A 4GMVA 1W1GA 1E5WA 4A6FA 4CHJA 3KY9A 3ZVRA 3KRWA 1BTNA 1N3HA 2NZ8B 2D9YA 2VRWB 2DTCA 4A6FB 3PG7A 4NSWA 1IRSA 4KAXB 2Y8FA 4A5KA 4F7GA 4MY6A 2J59M 1WG7A 3D8FA 2D9ZA 4P7IA 5CLQB 4GPTB 2EMTA 4GXBA 2LULA 1RRPB 3PP2A 1XCGA 2M14A 1X86A 2LOXA 1KI1B 4C0AA 3ZDTA 1MIZB 2IFSA 1EAZA 3WYFB 2FJLA 2G35A 3TO1A 2DFKA 2Q13A 1MKEA 4TKNA 2YS1A 4HB0B 2NMBA 3TVVA 2W2XD 1XR0B 1MK7B 4DX8A 5GOWB 3U8ZA 1UNQA 1Y5OA 1FOEA 1UNRA 3PVWA 3BJIA 1FGZA 4CHMA 5KQ1A 2I5CA 3TW1A 4ZRIA 2N23A 2CY5A 4BBKA 3ODOA 1ZC4B 2V76A 1UNPA 1V5PA 2EMSA 2GCJA 1WJ1A 3QWMA 4HB3B 3ODWA 4EMOA 1MIXA 1K5GB 2HE7A 2ELAA 4L6EA 4Z2NA 4HDQA 2IYBA 3F0WA 3TCAA 2VSZA 4A6HA 2W2XC 3MPXA 2Z0OA 2COFA 1U5GA 4D0NB 4GZUA 2LYDA 5JLJB 3QBVB 1KZGA 3KSYA 3PVUA 2VKIA 2LKOA 3ODXA 2P0FA 4TYZA 2DHIA 2J0KA 3SUZA 2KUPA 5DH9B 2DA0A 1V89A 1AQCA 2P8VA 4GMXB 2QKLA 3F5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IFS A;  1QQG A;  2I1J A;  2MFQ A;  4ZRK A;  2YVC A;  2AEH A;  1EVH A;  5JHH A;  1DDV A;  2RLO A;  2ELB A;  4Y94 A;  4K2O A;  3AJ4 A;  1GG3 A;  1WGU A;  2H7E A;  1NTY A;  1Q67 A;  2YT0 A;  2M38 A;  2N0Y A;  4HAY B;  5J3Q A;  3AU4 A;  1SHC A;  2P0D A;  1FHX A;  2RNR B;  1V5M A;  3PVL A;  3SO6 A;  2R09 A;  1Y19 B;  4YL8 A;  1PMS A;  3VIA A;  1U29 A;  5HE0 A;  1ISN A;  1FHW A;  3A8Q A;  3N7C A;  5J3Y A;  4HAV B;  2Y8G A;  1PLS A;  4H8S A;  5FI0 A;  2CRF A;  1FGY A;  5LOP B;  1ZM0 A;  3X23 A;  2P0H A;  3SNH A;  2COC A;  2D4Q A;  3O96 A;  2COA A;  1B55 A;  2DX5 A;  2UVM A;  5L81 A;  4HAX B;  2YT1 A;  3G9W A;  2DN6 A;  2JP2 A;  1J19 A;  3WA0 A;  2W2W A;  1DYN A;  1M7E A;  5JHG A;  2GCL A;  1U2B A;  1XOD A;  3HQC A;  2MDX A;  1ZC3 B;  2OTX A;  1U5F A;  1LB1 A;  2ZPY A;  1EF1 A;  2D10 A;  1V61 A;  2Z0P A;  4PNK A;  2EJ8 A;  3GYP A;  3M1I B;  4DBB A;  2XQN M;  1BAK A;  4WSF A;  4XWX A;  2YS5 A;  1DBH A;  2OQB A;  3U7D A;  3DXC A;  5DIF B;  1X05 A;  4K81 A;  2UZS A;  4K17 A;  2DYQ A;  5LON B;  4MK0 A;  4Z2M B;  1V88 A;  1QC6 A;  3PZD A;  2K00 A;  3KRX A;  3PEG A;  3SV1 A;  2CAY A;  5C79 A;  1DDW A;  2EC1 A;  2AL6 A;  1K5D B;  4WJ7 A;  2UZR A;  1X1G A;  2HTH B;  3FSS A;  4HAU B;  4K2P A;  3CIK A;  3VOQ A;  2K2U A;  2L1C A;  1P5T A;  4HAT B;  3P7Z A;  4DXA B;  3TFM A;  4HDO A;  3P6A A;  1BTK A;  2H7D A;  5KCV A;  1MK9 B;  1X1F A;  4HHV A;  1UPQ A;  3QIJ A;  2I1K A;  1UEF A;  1W1D A;  1X11 A;  2J0M A;  1UPR A;  1ZSQ A;  2R0D A;  1H4R A;  3D8E A;  5D3Y A;  4CYE A;  4PQ0 A;  4ZRJ A;  1M7R A;  1U27 A;  4KHB B;  5D3V A;  2DHJ A;  4EJN A;  1GC6 A;  1TQZ A;  3T06 A;  5HE1 A;  3RCP A;  2Y7B A;  2X18 A;  1OY2 A;  1P6S A;  2Z0Q A;  1RJ2 A;  2ROZ B;  3ML4 A;  2LG1 A;  5HE3 A;  3IVF A;  3LJU X;  1U5E A;  3CXB B;  4IOY X;  1NU2 A;  5DI9 B;  1DDM A;  1I2H A;  1Z87 A;  2DHK A;  5C6R A;  2KCJ A;  3D8D A;  3PSC A;  5EFX A;  1V5U A;  1FHO A;  4IAP A;  1WVH A;  1U5D A;  2MWN B;  1GC7 A;  4HB2 B;  5FI1 A;  4KHA A;  1EGX A;  1NTV A;  4DX9 0;  4F7H A;  1OMW A;  1W1H A;  5D27 A;  2D9X A;  5CLL B;  5JP4 A;  2E2X A;  3NSU A;  1ZVR A;  4KHO A;  2KGX B;  2D2Q A;  1LW3 A;  5HE2 A;  2YSZ A;  4MT7 A;  4B6H A;  2DLW A;  4NY0 A;  2BCJ A;  2MKR A;  2K2J A;  2DYN A;  1OQN A;  2GJY A;  3DXD A;  1XX0 A;  1PFJ A;  1FB8 A;  1SGH A;  3SYX A;  2DKQ A;  2J0J A;  2QKM A;  3AU5 A;  4YON A;  1TJ6 A;  2ADZ A;  1P3R A;  5D3W A;  2D9V A;  4A6K A;  2RSG A;  2RVB B;  2ROV A;  5DHA B;  3A8P A;  1J0W A;  3HW2 B;  2GS0 A;  3ULB A;  5C5B A;  2DKP A;  2PZ1 A;  3A98 B;  2D9W A;  3HK0 A;  2L2I A;  2CY4 A;  5C5B B;  1MAI A;  2DX1 A;  5D3X A;  3GYO A;  3UZT A;  1H10 A;  2YF0 A;  1AWE A;  2D11 A;  2LOZ A;  1BWN A;  4HB4 B;  4KVG B;  1TXD A;  4WVF B;  2I5F A;  3FEH A;  1WJM A;  3OAN A;  3ULC A;  3BIN A;  1MPH A;  4EKU A;  1WGQ A;  1I7A A;  3KZ1 A;  5DHF B;  3V5W A;  5J3T A;  3MDB C;  5C16 A;  1FAO A;  3DXE A;  4GN1 A;  1KZ7 A;  2RUK B;  2YRY A;  2COD A;  3FM8 C;  2YS3 A;  4HAW B;  1XD4 A;  5KQ4 A;  4F7U P;  1XKE A;  1WI1 A;  1DRO A;  2RGN B;  4HAZ B;  1NI2 A;  4GMV A;  1W1G A;  1E5W A;  4A6F A;  4CHJ A;  3KY9 A;  3ZVR A;  3KRW A;  1BTN A;  1N3H A;  2NZ8 B;  2D9Y A;  2VRW B;  2DTC A;  4A6F B;  3PG7 A;  4NSW A;  1IRS A;  4KAX B;  2Y8F A;  4A5K A;  4F7G A;  4MY6 A;  2J59 M;  1WG7 A;  3D8F A;  2D9Z A;  4P7I A;  5CLQ B;  4GPT B;  2EMT A;  4GXB A;  2LUL A;  1RRP B;  3PP2 A;  1XCG A;  2M14 A;  1X86 A;  2LOX A;  1KI1 B;  4C0A A;  3ZDT A;  1MIZ B;  2IFS A;  1EAZ A;  3WYF B;  2FJL A;  2G35 A;  3TO1 A;  2DFK A;  2Q13 A;  1MKE A;  4TKN A;  2YS1 A;  4HB0 B;  2NMB A;  3TVV A;  2W2X D;  1XR0 B;  1MK7 B;  4DX8 A;  5GOW B;  3U8Z A;  1UNQ A;  1Y5O A;  1FOE A;  1UNR A;  3PVW A;  3BJI A;  1FGZ A;  4CHM A;  5KQ1 A;  2I5C A;  3TW1 A;  4ZRI A;  2N23 A;  2CY5 A;  4BBK A;  3ODO A;  1ZC4 B;  2V76 A;  1UNP A;  1V5P A;  2EMS A;  2GCJ A;  1WJ1 A;  3QWM A;  4HB3 B;  3ODW A;  4EMO A;  1MIX A;  1K5G B;  2HE7 A;  2ELA A;  4L6E A;  4Z2N A;  4HDQ A;  2IYB A;  3F0W A;  3TCA A;  2VSZ A;  4A6H A;  2W2X C;  3MPX A;  2Z0O A;  2COF A;  1U5G A;  4D0N B;  4GZU A;  2LYD A;  5JLJ B;  3QBV B;  1KZG A;  3KSY A;  3PVU A;  2VKI A;  2LKO A;  3ODX A;  2P0F A;  4TYZ A;  2DHI A;  2J0K A;  3SUZ A;  2KUP A;  5DH9 B;  2DA0 A;  1V89 A;  1AQC A;  2P8V A;  4GMX B;  2QKL A;  3F5R A; 
#chains in the Genus database with same CATH topology
 4IFS A;  1QQG A;  2I1J A;  2MFQ A;  4ZRK A;  2YVC A;  2AEH A;  1EVH A;  5JHH A;  1DDV A;  2RLO A;  2ELB A;  4Y94 A;  3NWF A;  4K2O A;  3AJ4 A;  1GG3 A;  1WGU A;  2H7E A;  1NTY A;  1Q67 A;  2YT0 A;  4GOU A;  2M38 A;  2N0Y A;  2YT2 A;  2K49 A;  4HAY B;  5J3Q A;  3AU4 A;  1SHC A;  2P0D A;  1FHX A;  2RNR B;  1V5M A;  5LG4 B;  3PVL A;  3SO6 A;  2R09 A;  1Y19 B;  4YL8 A;  4L1R A;  1PMS A;  3VIA A;  1U29 A;  5HE0 A;  1ISN A;  1FHW A;  3A8Q A;  3N7C A;  5J3Y A;  4HAV B;  2Y8G A;  1PLS A;  4H8S A;  5FI0 A;  2CRF A;  1FGY A;  4D6W A;  5LOP B;  1ZM0 A;  3X23 A;  2P0H A;  3SNH A;  3NWA A;  2COC A;  2D4Q A;  3O96 A;  2COA A;  1B55 A;  2DX5 A;  5I2M A;  2UVM A;  5L81 A;  4HAX B;  2YT1 A;  3G9W A;  2DN6 A;  2JP2 A;  1J19 A;  3WA0 A;  2W2W A;  1DYN A;  1M7E A;  5JHG A;  2GCL A;  1U2B A;  1XOD A;  3HQC A;  2MDX A;  1ZC3 B;  2OTX A;  1U5F A;  1LB1 A;  2ZPY A;  1EF1 A;  2R2Y A;  2D10 A;  1V61 A;  2Z0P A;  4PNK A;  2EJ8 A;  3GYP A;  3M1I B;  4DBB A;  2XQN M;  1BAK A;  4WSF A;  2RRF A;  4XWX A;  2YS5 A;  1DBH A;  2OQB A;  3U7D A;  3DXC A;  3NW8 A;  5DIF B;  1X05 A;  4K81 A;  2UZS A;  4HSI A;  4K17 A;  2DYQ A;  5LON B;  4MK0 A;  4Z2M B;  1V88 A;  2KUQ A;  1QC6 A;  4QJ5 B;  3PZD A;  2K00 A;  3KRX A;  3PEG A;  2Z4D A;  3SV1 A;  2CAY A;  5C79 A;  1DDW A;  2EC1 A;  2AL6 A;  1K5D B;  4WJ7 A;  2UZR A;  1X1G A;  3FVC A;  2HTH B;  3FSS A;  4HAU B;  4K2P A;  3CIK A;  3VOQ A;  2K2U A;  1MI1 A;  2L1C A;  1P5T A;  4HAT B;  3P7Z A;  4DXA B;  3TFM A;  4HDO A;  3P6A A;  1BTK A;  2H7D A;  5KCV A;  1MK9 B;  1X1F A;  3A58 A;  4HHV A;  1UPQ A;  3QIJ A;  2FJU B;  2I1K A;  1UEF A;  4DIX A;  1W1D A;  1X11 A;  2J0M A;  1UPR A;  1ZSQ A;  2R0D A;  1H4R A;  3D8E A;  5D3Y A;  4CYE A;  2NBV A;  4PQ0 A;  4ZRJ A;  1M7R A;  1U27 A;  4KHB B;  5D3V A;  2DHJ A;  4EJN A;  1GC6 A;  1TQZ A;  3T06 A;  5HE1 A;  3RCP A;  2Y7B A;  2X18 A;  4CSQ A;  1OY2 A;  1P6S A;  2Z0Q A;  1RJ2 A;  2ROZ B;  3ML4 A;  2LG1 A;  5HE3 A;  3IVF A;  3LJU X;  1U5E A;  3CXB B;  4IOY X;  5M4Y B;  4QXA B;  5I2S A;  1NU2 A;  5DI9 B;  1DDM A;  1I2H A;  1Z87 A;  2DHK A;  5C6R A;  2KCJ A;  3U12 A;  3D8D A;  3PSC A;  5EFX A;  1V5U A;  1FHO A;  4IAP A;  1WVH A;  1U5D A;  2MWN B;  1GC7 A;  4HB2 B;  5FI1 A;  4KHA A;  1EGX A;  1NTV A;  4DX9 0;  4F7H A;  2Z59 A;  1OMW A;  1W1H A;  5D27 A;  2D9X A;  5CLL B;  5JP4 A;  2E2X A;  3NSU A;  1ZVR A;  4KHO A;  2Z13 A;  2KGX B;  2D2Q A;  1LW3 A;  5HE2 A;  2YSZ A;  4MT7 A;  4B6H A;  2DLW A;  4NY0 A;  2BCJ A;  2KIG A;  2MKR A;  2K2J A;  2DYN A;  1OQN A;  2GJY A;  3DXD A;  1XX0 A;  1PFJ A;  1FB8 A;  1SGH A;  3SYX A;  2DKQ A;  2J0J A;  2QKM A;  3DCX A;  3AU5 A;  4YON A;  1TJ6 A;  2ADZ A;  1P3R A;  5D3W A;  2D9V A;  4A6K A;  2RSG A;  2RVB B;  2ROV A;  5DHA B;  3A8P A;  1J0W A;  3HW2 B;  2GS0 A;  3ULB A;  5C5B A;  2DKP A;  2PZ1 A;  3A98 B;  2D9W A;  3HK0 A;  2L2I A;  2CY4 A;  5C5B B;  1MAI A;  2DX1 A;  5D3X A;  3GYO A;  3UZT A;  1H10 A;  2YF0 A;  2GUM A;  1AWE A;  2D11 A;  2LOZ A;  1BWN A;  4HB4 B;  4KVG B;  1TXD A;  4WVF B;  3B77 A;  2I5F A;  3FEH A;  1WJM A;  3OAN A;  3ULC A;  3BIN A;  1MPH A;  4EKU A;  1WGQ A;  1I7A A;  3KZ1 A;  5DHF B;  3V5W A;  5J3T A;  3MDB C;  5C16 A;  1FAO A;  3DXE A;  4GN1 A;  1KZ7 A;  2RUK B;  4KHB A;  2YRY A;  4QJ3 B;  2COD A;  3FM8 C;  2YS3 A;  2KIE A;  4HAW B;  3OHM B;  1XD4 A;  5KQ4 A;  4F7U P;  1XKE A;  1ZYI A;  1WI1 A;  1DRO A;  2RGN B;  4HAZ B;  1NI2 A;  4GMV A;  1W1G A;  1E5W A;  4A6F A;  4CHJ A;  2K8E A;  3KY9 A;  3ZVR A;  3KRW A;  1BTN A;  1N3H A;  2NZ8 B;  2D9Y A;  2VRW B;  2DTC A;  4A6F B;  3PG7 A;  4NSW A;  1IRS A;  4KAX B;  2Y8F A;  4A5K A;  4F7G A;  4MY6 A;  2ZKM X;  2J59 M;  1WG7 A;  3D8F A;  2D9Z A;  4P7I A;  5CLQ B;  4GPT B;  2EMT A;  4GXB A;  2LUL A;  1RRP B;  3PP2 A;  1XCG A;  2M14 A;  1X86 A;  2LOX A;  1KI1 B;  4C0A A;  3ZDT A;  1MIZ B;  2IFS A;  1EAZ A;  3WYF B;  2FJL A;  2G35 A;  3TO1 A;  2DFK A;  2Q13 A;  1MKE A;  4TKN A;  2YS1 A;  4HB0 B;  2NMB A;  3TVV A;  2W2X D;  3NWD A;  1XR0 B;  1MK7 B;  4DX8 A;  5GOW B;  3U8Z A;  1UNQ A;  1Y5O A;  1FOE A;  1UNR A;  3PVW A;  3BJI A;  1FGZ A;  4CHM A;  5KQ1 A;  2I5C A;  3TW1 A;  4ZRI A;  2N23 A;  2CY5 A;  4OT1 A;  4BBK A;  3ODO A;  1ZC4 B;  2V76 A;  1UNP A;  1V5P A;  2EMS A;  4QJ4 B;  2GCJ A;  1WJ1 A;  3QWM A;  4HB3 B;  3ODW A;  3HSA A;  4EMO A;  5IRS A;  1MIX A;  1K5G B;  2HE7 A;  2ELA A;  4L6E A;  4Z2N A;  4HDQ A;  2IYB A;  3F0W A;  3TCA A;  2VSZ A;  4GNK B;  4A6H A;  2W2X C;  2KR0 A;  3MPX A;  2Z0O A;  2COF A;  1U5G A;  1T77 A;  4D0N B;  4GZU A;  2LYD A;  5JLJ B;  3QBV B;  1KZG A;  3KSY A;  3PVU A;  2VKI A;  4OSN A;  2LKO A;  3ODX A;  2P0F A;  2Z14 A;  4TYZ A;  2DHI A;  2J0K A;  3SUZ A;  2KUP A;  5DH9 B;  2DA0 A;  1V89 A;  1AQC A;  2P8V A;  4GMX B;  2QKL A;  3F5R A;  3HIE A; 
#chains in the Genus database with same CATH homology
 4IFS A;  1QQG A;  2I1J A;  2MFQ A;  4ZRK A;  2YVC A;  2AEH A;  1EVH A;  5JHH A;  1DDV A;  2RLO A;  2ELB A;  4Y94 A;  4K2O A;  3AJ4 A;  1GG3 A;  1WGU A;  2H7E A;  1NTY A;  1Q67 A;  2YT0 A;  2M38 A;  2N0Y A;  4HAY B;  5J3Q A;  3AU4 A;  1SHC A;  2P0D A;  1FHX A;  2RNR B;  1V5M A;  3PVL A;  3SO6 A;  2R09 A;  1Y19 B;  4YL8 A;  1PMS A;  3VIA A;  1U29 A;  5HE0 A;  1ISN A;  1FHW A;  3A8Q A;  3N7C A;  5J3Y A;  4HAV B;  2Y8G A;  1PLS A;  4H8S A;  5FI0 A;  2CRF A;  1FGY A;  5LOP B;  1ZM0 A;  3X23 A;  2P0H A;  3SNH A;  2COC A;  2D4Q A;  3O96 A;  2COA A;  1B55 A;  2DX5 A;  2UVM A;  5L81 A;  4HAX B;  2YT1 A;  3G9W A;  2DN6 A;  2JP2 A;  1J19 A;  3WA0 A;  2W2W A;  1DYN A;  1M7E A;  5JHG A;  2GCL A;  1U2B A;  1XOD A;  3HQC A;  2MDX A;  1ZC3 B;  2OTX A;  1U5F A;  1LB1 A;  2ZPY A;  1EF1 A;  2D10 A;  1V61 A;  2Z0P A;  4PNK A;  2EJ8 A;  3GYP A;  3M1I B;  4DBB A;  2XQN M;  1BAK A;  4WSF A;  4XWX A;  2YS5 A;  1DBH A;  2OQB A;  3U7D A;  3DXC A;  5DIF B;  1X05 A;  4K81 A;  2UZS A;  4K17 A;  2DYQ A;  5LON B;  4MK0 A;  4Z2M B;  1V88 A;  1QC6 A;  3PZD A;  2K00 A;  3KRX A;  3PEG A;  3SV1 A;  2CAY A;  5C79 A;  1DDW A;  2EC1 A;  2AL6 A;  1K5D B;  4WJ7 A;  2UZR A;  1X1G A;  2HTH B;  3FSS A;  4HAU B;  4K2P A;  3CIK A;  3VOQ A;  2K2U A;  2L1C A;  1P5T A;  4HAT B;  3P7Z A;  4DXA B;  3TFM A;  4HDO A;  3P6A A;  1BTK A;  2H7D A;  5KCV A;  1MK9 B;  1X1F A;  4HHV A;  1UPQ A;  3QIJ A;  2I1K A;  1UEF A;  1W1D A;  1X11 A;  2J0M A;  1UPR A;  1ZSQ A;  2R0D A;  1H4R A;  3D8E A;  5D3Y A;  4CYE A;  4PQ0 A;  4ZRJ A;  1M7R A;  1U27 A;  4KHB B;  5D3V A;  2DHJ A;  4EJN A;  1GC6 A;  1TQZ A;  3T06 A;  5HE1 A;  3RCP A;  2Y7B A;  2X18 A;  1OY2 A;  1P6S A;  2Z0Q A;  1RJ2 A;  2ROZ B;  3ML4 A;  2LG1 A;  5HE3 A;  3IVF A;  3LJU X;  1U5E A;  3CXB B;  4IOY X;  1NU2 A;  5DI9 B;  1DDM A;  1I2H A;  1Z87 A;  2DHK A;  5C6R A;  2KCJ A;  3D8D A;  3PSC A;  5EFX A;  1V5U A;  1FHO A;  4IAP A;  1WVH A;  1U5D A;  2MWN B;  1GC7 A;  4HB2 B;  5FI1 A;  4KHA A;  1EGX A;  1NTV A;  4DX9 0;  4F7H A;  1OMW A;  1W1H A;  5D27 A;  2D9X A;  5CLL B;  5JP4 A;  2E2X A;  3NSU A;  1ZVR A;  4KHO A;  2KGX B;  2D2Q A;  1LW3 A;  5HE2 A;  2YSZ A;  4MT7 A;  4B6H A;  2DLW A;  4NY0 A;  2BCJ A;  2MKR A;  2K2J A;  2DYN A;  1OQN A;  2GJY A;  3DXD A;  1XX0 A;  1PFJ A;  1FB8 A;  1SGH A;  3SYX A;  2DKQ A;  2J0J A;  2QKM A;  3AU5 A;  4YON A;  1TJ6 A;  2ADZ A;  1P3R A;  5D3W A;  2D9V A;  4A6K A;  2RSG A;  2RVB B;  2ROV A;  5DHA B;  3A8P A;  1J0W A;  3HW2 B;  2GS0 A;  3ULB A;  5C5B A;  2DKP A;  2PZ1 A;  3A98 B;  2D9W A;  3HK0 A;  2L2I A;  2CY4 A;  5C5B B;  1MAI A;  2DX1 A;  5D3X A;  3GYO A;  3UZT A;  1H10 A;  2YF0 A;  1AWE A;  2D11 A;  2LOZ A;  1BWN A;  4HB4 B;  4KVG B;  1TXD A;  4WVF B;  2I5F A;  3FEH A;  1WJM A;  3OAN A;  3ULC A;  3BIN A;  1MPH A;  4EKU A;  1WGQ A;  1I7A A;  3KZ1 A;  5DHF B;  3V5W A;  5J3T A;  3MDB C;  5C16 A;  1FAO A;  3DXE A;  4GN1 A;  1KZ7 A;  2RUK B;  2YRY A;  2COD A;  3FM8 C;  2YS3 A;  4HAW B;  1XD4 A;  5KQ4 A;  4F7U P;  1XKE A;  1WI1 A;  1DRO A;  2RGN B;  4HAZ B;  1NI2 A;  4GMV A;  1W1G A;  1E5W A;  4A6F A;  4CHJ A;  3KY9 A;  3ZVR A;  3KRW A;  1BTN A;  1N3H A;  2NZ8 B;  2D9Y A;  2VRW B;  2DTC A;  4A6F B;  3PG7 A;  4NSW A;  1IRS A;  4KAX B;  2Y8F A;  4A5K A;  4F7G A;  4MY6 A;  2J59 M;  1WG7 A;  3D8F A;  2D9Z A;  4P7I A;  5CLQ B;  4GPT B;  2EMT A;  4GXB A;  2LUL A;  1RRP B;  3PP2 A;  1XCG A;  2M14 A;  1X86 A;  2LOX A;  1KI1 B;  4C0A A;  3ZDT A;  1MIZ B;  2IFS A;  1EAZ A;  3WYF B;  2FJL A;  2G35 A;  3TO1 A;  2DFK A;  2Q13 A;  1MKE A;  4TKN A;  2YS1 A;  4HB0 B;  2NMB A;  3TVV A;  2W2X D;  1XR0 B;  1MK7 B;  4DX8 A;  5GOW B;  3U8Z A;  1UNQ A;  1Y5O A;  1FOE A;  1UNR A;  3PVW A;  3BJI A;  1FGZ A;  4CHM A;  5KQ1 A;  2I5C A;  3TW1 A;  4ZRI A;  2N23 A;  2CY5 A;  4BBK A;  3ODO A;  1ZC4 B;  2V76 A;  1UNP A;  1V5P A;  2EMS A;  2GCJ A;  1WJ1 A;  3QWM A;  4HB3 B;  3ODW A;  4EMO A;  1MIX A;  1K5G B;  2HE7 A;  2ELA A;  4L6E A;  4Z2N A;  4HDQ A;  2IYB A;  3F0W A;  3TCA A;  2VSZ A;  4A6H A;  2W2X C;  3MPX A;  2Z0O A;  2COF A;  1U5G A;  4D0N B;  4GZU A;  2LYD A;  5JLJ B;  3QBV B;  1KZG A;  3KSY A;  3PVU A;  2VKI A;  2LKO A;  3ODX A;  2P0F A;  4TYZ A;  2DHI A;  2J0K A;  3SUZ A;  2KUP A;  5DH9 B;  2DA0 A;  1V89 A;  1AQC A;  2P8V A;  4GMX B;  2QKL A;  3F5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...