2DYNA

Dynamin (pleckstrin homology domain) (dynph)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
111
structure length
111
Chain Sequence
ILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signal transduction
molecule keywords DYNAMIN
publication title Crystal structure of the pleckstrin homology domain from dynamin.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 3.6.5.5: Dynamin GTPase.
pdb deposition date 1997-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dynA00
2D11A 5KQ1A 2DX5A 4EKUA 3KZ1A 4H8SA 5DHAB 1RJ2A 2DHJA 3D8FA 4ZRJA 2DHIA 1H4RA 3D8EA 3N7CA 1MKEA 2L2IA 2UVMA 1ZSQA 5J3TA 1H10A 3V5WA 2M38A 1LW3A 2Z0PA 1WVHA 5LOPB 3P7ZA 4ZRIA 3M1IB 3DXCA 1WG7A 3PVWA 2UZSA 3G9WA 2R09A 2K00A 1W1GA 3LJUX 4KHOA 2ROZB 3TO1A 1M7RA 4B6HA 2QKLA 3PSCA 3A98B 2AL6A 2I1KA 3MPXA 1PMSA 2VRWB 1BTKA 4YL8A 1KZGA 1XR0B 5D3VA 2IFSA 3ML4A 2RVBB 3BJIA 4HAZB 4A6HA 2KGXB 2VKIA 4HATB 2CRFA 4KHBB 1WGUA 4DX90 1N3HA 3TCAA 1W1HA 5JLJB 2XQNM 5JHGA 5HE2A 4MY6A 1V5MA 2AEHA 2D9XA 1OMWA 1UNQA 1U5GA 3CXBB 5FI1A 4K2OA 5J3QA 2DLWA 2G35A 2Y8FA 2Z0OA 3PVLA 2P8VA 5C16A 4GPTB 2ADZA 2DFKA 5JP4A 2LG1A 4IAPA 1I2HA 4NY0A 1WI1A 2N23A 2YF0A 3ULBA 2GCJA 3HW2B 1EF1A 2P0FA 1UNPA 3ZVRA 3DXEA 1P6SA 2FJLA 4PNKA 2D9WA 2GJYA 2COAA 4A6FB 1U2BA 3HK0A 2I5FA 5KCVA 2UZRA 4MT7A 5D3YA 2YSZA 1OY2A 2IYBA 2EJ8A 1EGXA 5EFXA 4A6KA 3KRWA 2YT1A 2BCJA 5C5BB 1Q67A 2P0DA 1DDVA 1XODA 5KQ4A 4P7IA 2RGNB 2MDXA 1XKEA 2V76A 2DX1A 3DXDA 5DH9B 1OQNA 3PP2A 4YONA 3PVUA 2R0DA 2LOXA 2I5CA 1DROA 2ROVA 1TQZA 2W2XD 1UEFA 2DN6A 3AU4A 3WYFB 3T06A 2PZ1A 1ISNA 2H7EA 3O96A 1PFJA 4A5KA 1WJ1A 3ODWA 2EMSA 5CLLB 4TKNA 3AU5A 1BAKA 2EMTA 2H7DA 3SNHA 1GC7A 5DI9B 1MIXA 4PQ0A 2YS1A 3ODOA 1M7EA 1ZM0A 2GCLA 2HE7A 3ULCA 2DTCA 4DX8A 4EMOA 2LOZA 1EAZA 5JHHA 4GMXB 1V5UA 1NU2A 1Y19B 4CYEA 5C79A 2K2JA 5HE0A 4A6FA 3SUZA 1FAOA 2NMBA 4HHVA 2D10A 1MIZB 1XX0A 4F7GA 1W1DA 3PG7A 1UPRA 1ZC4B 1U5DA 1FB8A 1Y5OA 3QBVB 3CIKA 1ZC3B 5DIFB 4HAWB 1V89A 3FM8C 3KSYA 4D0NB 2K2UA 1WJMA 3VOQA 5D3WA 4XWXA 4Z2MB 2JP2A 3FSSA 4Z2NA 2VSZA 1X1FA 2CY5A 2EC1A 3GYOA 1Z87A 1GC6A 1WGQA 4GXBA 1BTNA 2E2XA 1KI1B 1TJ6A 3RCPA 1QQGA 5L81A 4F7UP 2YS3A 4HB2B 4F7HA 1NTVA 2N0YA 1FHXA 2CAYA 4DXAB 2LYDA 5J3YA 1AWEA 2DKQA 1GG3A 1XCGA 4L6EA 3VIAA 4HAVB 4MK0A 2DKPA 3D8DA 2RLOA 2D2QA 2MKRA 4KVGB 2YS5A 1TXDA 1MAIA 1X1GA 1EVHA 4GZUA 2YVCA 2M14A 3PEGA 1PLSA 3A8PA 3F5RA 3KRXA 3HQCA 1DYNA 2COCA 3X23A 4DBBA 3UZTA 2QKMA 2MWNB 2RUKB 3PZDA 2J59M 2J0KA 1XD4A 1IRSA 2DHKA 2OTXA 4HDQA 4HAUB 3NSUA 1DDWA 2RSGA 1QC6A 3TW1A 3TVVA 2ZPYA 4GMVA 3SYXA 3P6AA 1SGHA 1SHCA 2HTHB 2LULA 2Y8GA 4K17A 1J19A 3FEHA 4IOYX 4K81A 1MPHA 2ELAA 5LONB 1FOEA 1DBHA 3GYPA 2DYQA 1AQCA 5D3XA 3QIJA 5DHFB 5HE1A 1LB1A 4BBKA 1BWNA 1KZ7A 2GS0A 2YT0A 3U8ZA 4HDOA 3U7DA 4HB0B 4KHAA 3SV1A 3OANA 2D9VA 5C6RA 2MFQA 4KAXB 5CLQB 1X86A 1K5GB 1RRPB 2D4QA 4CHJA 2DYNA 4TYZA 1X11A 3QWMA 2DA0A 1V61A 2LKOA 2COFA 5C5BA 1J0WA 4HB4B 3WA0A 3MDBC 2CY4A 2OQBA 2RNRB 3F0WA 5FI0A 1P5TA 2YRYA 3AJ4A 2KCJA 4EJNA 4WJ7A 2Z0QA 3BINA 1FGYA 2D9YA 2W2XC 4K2PA 3TFMA 1U5EA 3KY9A 4IFSA 2W2WA 1I7AA 1UNRA 1MK7B 2J0MA 2I1JA 1U29A 1NI2A 5HE3A 1FGZA 2L1CA 5D27A 2P0HA 1K5DB 2J0JA 4HAYB 1MK9B 2D9ZA 1U27A 3SO6A 1DDMA 4NSWA 1X05A 4HAXB 3ZDTA 1U5FA 3IVFA 4HB3B 4WVFB 4GN1A 2Y7BA 1ZVRA 1V88A 4C0AA 2X18A 5GOWB 1V5PA 1UPQA 4ZRKA 2ELBA 3A8QA 3ODXA 4Y94A 1NTYA 4WSFA 1E5WA 1P3RA 1FHOA 1FHWA 2KUPA 4CHMA 1B55A 2Q13A 2NZ8B 2CODA
chains in the Genus database with same CATH superfamily
4DIXA 2D11A 5KQ1A 2DX5A 4EKUA 3KZ1A 4H8SA 5DHAB 3NWFA 1RJ2A 2DHJA 3D8FA 4ZRJA 2DHIA 1H4RA 3D8EA 3N7CA 1MKEA 2YT2A 2L2IA 2UVMA 1ZSQA 5J3TA 1H10A 2Z59A 3V5WA 2M38A 1LW3A 2Z0PA 1WVHA 5LOPB 3P7ZA 4ZRIA 3M1IB 3DXCA 1WG7A 3PVWA 2UZSA 3G9WA 2R09A 2K00A 1W1GA 3LJUX 4KHOA 2ROZB 3TO1A 1M7RA 4B6HA 2QKLA 3PSCA 4GOUA 3A98B 2KUQA 2AL6A 2I1KA 3MPXA 1PMSA 2VRWB 1BTKA 4YL8A 1KZGA 2FJUB 4OSNA 1XR0B 5D3VA 2IFSA 3ML4A 2RVBB 3BJIA 4HAZB 2RRFA 4A6HA 2KGXB 2VKIA 4HATB 2CRFA 4KHBB 1WGUA 4HSIA 4DX90 1N3HA 3TCAA 1W1HA 5I2MA 2R2YA 5JLJB 2XQNM 5JHGA 5HE2A 4MY6A 1V5MA 2AEHA 2D9XA 1OMWA 1UNQA 1U5GA 3CXBB 5FI1A 4K2OA 5J3QA 2DLWA 1ZYIA 2ZKMX 2G35A 2Y8FA 2Z0OA 3PVLA 2P8VA 1T77A 5C16A 1MI1A 4GPTB 2ADZA 2DFKA 5JP4A 2LG1A 4IAPA 1I2HA 4NY0A 1WI1A 2N23A 2YF0A 3ULBA 2GCJA 3HW2B 1EF1A 2P0FA 1UNPA 3ZVRA 3DXEA 1P6SA 2FJLA 4PNKA 2D9WA 2GJYA 2COAA 4A6FB 1U2BA 5IRSA 3HK0A 2I5FA 5KCVA 2UZRA 4MT7A 5D3YA 2YSZA 1OY2A 2Z4DA 2IYBA 2EJ8A 1EGXA 5EFXA 4A6KA 3KRWA 2YT1A 2BCJA 5C5BB 1Q67A 4D6WA 2P0DA 1DDVA 1XODA 5KQ4A 4P7IA 3FVCA 2RGNB 2MDXA 1XKEA 2V76A 2DX1A 3DXDA 5DH9B 1OQNA 3PP2A 4YONA 3PVUA 2R0DA 2LOXA 2I5CA 1DROA 2ROVA 1TQZA 2W2XD 1UEFA 2DN6A 3AU4A 3WYFB 3T06A 2PZ1A 1ISNA 2H7EA 3O96A 1PFJA 3A58A 4A5KA 1WJ1A 3ODWA 2EMSA 4QXAB 5CLLB 4TKNA 3AU5A 1BAKA 2EMTA 2H7DA 3SNHA 1GC7A 5DI9B 1MIXA 4PQ0A 2YS1A 3ODOA 1M7EA 1ZM0A 2GCLA 5M4YB 2HE7A 3ULCA 2DTCA 4DX8A 4EMOA 2LOZA 1EAZA 5JHHA 4GMXB 1V5UA 1NU2A 1Y19B 4CYEA 5C79A 2K2JA 5HE0A 4A6FA 3NW8A 3OHMB 2KR0A 3SUZA 1FAOA 2NMBA 4HHVA 2D10A 1MIZB 1XX0A 4F7GA 1W1DA 1UPRA 3PG7A 1ZC4B 1U5DA 1FB8A 1Y5OA 3QBVB 3CIKA 1ZC3B 5DIFB 4HAWB 1V89A 3FM8C 3KSYA 4D0NB 2K2UA 1WJMA 3VOQA 5D3WA 3NWAA 4XWXA 2KIEA 4Z2MB 2JP2A 3FSSA 4Z2NA 2VSZA 1X1FA 2CY5A 2EC1A 3GYOA 1Z87A 1GC6A 3U12A 3B77A 1WGQA 3NWDA 4GXBA 1BTNA 4CSQA 2E2XA 1KI1B 1TJ6A 3RCPA 1QQGA 5L81A 2Z14A 4F7UP 2YS3A 4HB2B 4F7HA 1NTVA 2N0YA 1FHXA 2CAYA 4DXAB 2LYDA 5J3YA 1AWEA 2Z13A 3HSAA 2DKQA 1GG3A 5LG4B 1XCGA 4L6EA 3VIAA 4HAVB 4MK0A 2DKPA 3D8DA 2RLOA 2D2QA 2MKRA 4KVGB 2YS5A 1TXDA 1MAIA 1X1GA 1EVHA 4GZUA 2YVCA 2M14A 3PEGA 4KHBA 1PLSA 3A8PA 3F5RA 5I2SA 3KRXA 4OT1A 3HQCA 1DYNA 2COCA 3X23A 4DBBA 3UZTA 2QKMA 2MWNB 2RUKB 3PZDA 2J59M 2J0KA 1XD4A 1IRSA 2DHKA 2OTXA 4HDQA 4HAUB 3NSUA 1DDWA 2RSGA 1QC6A 3TW1A 3TVVA 2ZPYA 4GMVA 3SYXA 3P6AA 1SGHA 1SHCA 2HTHB 2LULA 2Y8GA 4K17A 1J19A 3FEHA 3HIEA 4IOYX 1MPHA 2ELAA 4K81A 5LONB 1FOEA 1DBHA 3GYPA 2DYQA 1AQCA 5D3XA 3QIJA 5DHFB 5HE1A 1LB1A 4BBKA 1BWNA 1KZ7A 2GS0A 2YT0A 3U8ZA 4QJ4B 4HDOA 3U7DA 4HB0B 4KHAA 3SV1A 3OANA 2D9VA 5C6RA 2GUMA 2MFQA 4KAXB 5CLQB 1X86A 3DCXA 1K5GB 1RRPB 2D4QA 4CHJA 2DYNA 4TYZA 1X11A 3QWMA 2DA0A 2KIGA 1V61A 2LKOA 2COFA 5C5BA 1J0WA 2K49A 4HB4B 3WA0A 3MDBC 2CY4A 2OQBA 2RNRB 3F0WA 2K8EA 4L1RA 5FI0A 1P5TA 2YRYA 3AJ4A 2KCJA 4EJNA 4WJ7A 2Z0QA 3BINA 1FGYA 4QJ3B 2D9YA 2W2XC 4K2PA 3TFMA 1U5EA 3KY9A 4IFSA 2W2WA 1I7AA 1UNRA 1MK7B 2J0MA 2I1JA 4GNKB 1U29A 1NI2A 2NBVA 5HE3A 4QJ5B 1FGZA 2L1CA 5D27A 2P0HA 1K5DB 2J0JA 4HAYB 1MK9B 2D9ZA 1U27A 3SO6A 1DDMA 4NSWA 1X05A 4HAXB 3ZDTA 1U5FA 3IVFA 4HB3B 4WVFB 4GN1A 2Y7BA 1ZVRA 1V88A 4C0AA 2X18A 5GOWB 1V5PA 1UPQA 4ZRKA 2ELBA 3A8QA 3ODXA 4Y94A 1NTYA 4WSFA 1E5WA 1P3RA 1FHOA 1FHWA 2KUPA 4CHMA 1B55A 2Q13A 2NZ8B 2CODA
chains in the Genus database with same CATH topology
2D11A 5KQ1A 2DX5A 4EKUA 3KZ1A 4H8SA 5DHAB 1RJ2A 2DHJA 3D8FA 4ZRJA 2DHIA 1H4RA 3D8EA 3N7CA 1MKEA 2L2IA 2UVMA 1ZSQA 5J3TA 1H10A 3V5WA 2M38A 1LW3A 2Z0PA 1WVHA 5LOPB 3P7ZA 4ZRIA 3M1IB 3DXCA 1WG7A 3PVWA 2UZSA 3G9WA 2R09A 2K00A 1W1GA 3LJUX 4KHOA 2ROZB 3TO1A 1M7RA 4B6HA 2QKLA 3PSCA 3A98B 2AL6A 2I1KA 3MPXA 1PMSA 2VRWB 1BTKA 4YL8A 1KZGA 1XR0B 5D3VA 2IFSA 3ML4A 2RVBB 3BJIA 4HAZB 4A6HA 2KGXB 2VKIA 4HATB 2CRFA 4KHBB 1WGUA 4DX90 1N3HA 3TCAA 1W1HA 5JLJB 2XQNM 5JHGA 5HE2A 4MY6A 1V5MA 2AEHA 2D9XA 1OMWA 1UNQA 1U5GA 3CXBB 5FI1A 4K2OA 5J3QA 2DLWA 2G35A 2Y8FA 2Z0OA 3PVLA 2P8VA 5C16A 4GPTB 2ADZA 2DFKA 5JP4A 2LG1A 4IAPA 1I2HA 4NY0A 1WI1A 2N23A 2YF0A 3ULBA 2GCJA 3HW2B 1EF1A 2P0FA 1UNPA 3ZVRA 3DXEA 1P6SA 2FJLA 4PNKA 2D9WA 2GJYA 2COAA 4A6FB 1U2BA 3HK0A 2I5FA 5KCVA 2UZRA 4MT7A 5D3YA 2YSZA 1OY2A 2IYBA 2EJ8A 1EGXA 5EFXA 4A6KA 3KRWA 2YT1A 2BCJA 5C5BB 1Q67A 2P0DA 1DDVA 1XODA 5KQ4A 4P7IA 2RGNB 2MDXA 1XKEA 2V76A 2DX1A 3DXDA 5DH9B 1OQNA 3PP2A 4YONA 3PVUA 2R0DA 2LOXA 2I5CA 1DROA 2ROVA 1TQZA 2W2XD 1UEFA 2DN6A 3AU4A 3WYFB 3T06A 2PZ1A 1ISNA 2H7EA 3O96A 1PFJA 4A5KA 1WJ1A 3ODWA 2EMSA 5CLLB 4TKNA 3AU5A 1BAKA 2EMTA 2H7DA 3SNHA 1GC7A 5DI9B 1MIXA 4PQ0A 2YS1A 3ODOA 1M7EA 1ZM0A 2GCLA 2HE7A 3ULCA 2DTCA 4DX8A 4EMOA 2LOZA 1EAZA 5JHHA 4GMXB 1V5UA 1NU2A 1Y19B 4CYEA 5C79A 2K2JA 5HE0A 4A6FA 3SUZA 1FAOA 2NMBA 4HHVA 2D10A 1MIZB 1XX0A 4F7GA 1W1DA 3PG7A 1UPRA 1ZC4B 1U5DA 1FB8A 1Y5OA 3QBVB 3CIKA 1ZC3B 5DIFB 4HAWB 1V89A 3FM8C 3KSYA 4D0NB 2K2UA 1WJMA 3VOQA 5D3WA 4XWXA 4Z2MB 2JP2A 3FSSA 4Z2NA 2VSZA 1X1FA 2CY5A 2EC1A 3GYOA 1Z87A 1GC6A 1WGQA 4GXBA 1BTNA 2E2XA 1KI1B 1TJ6A 3RCPA 1QQGA 5L81A 4F7UP 2YS3A 4HB2B 4F7HA 1NTVA 2N0YA 1FHXA 2CAYA 4DXAB 2LYDA 5J3YA 1AWEA 2DKQA 1GG3A 1XCGA 4L6EA 3VIAA 4HAVB 4MK0A 2DKPA 3D8DA 2RLOA 2D2QA 2MKRA 4KVGB 2YS5A 1TXDA 1MAIA 1X1GA 1EVHA 4GZUA 2YVCA 2M14A 3PEGA 1PLSA 3A8PA 3F5RA 3KRXA 3HQCA 1DYNA 2COCA 3X23A 4DBBA 3UZTA 2QKMA 2MWNB 2RUKB 3PZDA 2J59M 2J0KA 1XD4A 1IRSA 2DHKA 2OTXA 4HDQA 4HAUB 3NSUA 1DDWA 2RSGA 1QC6A 3TW1A 3TVVA 2ZPYA 4GMVA 3SYXA 3P6AA 1SGHA 1SHCA 2HTHB 2LULA 2Y8GA 4K17A 1J19A 3FEHA 4IOYX 4K81A 1MPHA 2ELAA 5LONB 1FOEA 1DBHA 3GYPA 2DYQA 1AQCA 5D3XA 3QIJA 5DHFB 5HE1A 1LB1A 4BBKA 1BWNA 1KZ7A 2GS0A 2YT0A 3U8ZA 4HDOA 3U7DA 4HB0B 4KHAA 3SV1A 3OANA 2D9VA 5C6RA 2MFQA 4KAXB 5CLQB 1X86A 1K5GB 1RRPB 2D4QA 4CHJA 2DYNA 4TYZA 1X11A 3QWMA 2DA0A 1V61A 2LKOA 2COFA 5C5BA 1J0WA 4HB4B 3WA0A 3MDBC 2CY4A 2OQBA 2RNRB 3F0WA 5FI0A 1P5TA 2YRYA 3AJ4A 2KCJA 4EJNA 4WJ7A 2Z0QA 3BINA 1FGYA 2D9YA 2W2XC 4K2PA 3TFMA 1U5EA 3KY9A 4IFSA 2W2WA 1I7AA 1UNRA 1MK7B 2J0MA 2I1JA 1U29A 1NI2A 5HE3A 1FGZA 2L1CA 5D27A 2P0HA 1K5DB 2J0JA 4HAYB 1MK9B 2D9ZA 1U27A 3SO6A 1DDMA 4NSWA 1X05A 4HAXB 3ZDTA 1U5FA 3IVFA 4HB3B 4WVFB 4GN1A 2Y7BA 1ZVRA 1V88A 4C0AA 2X18A 5GOWB 1V5PA 1UPQA 4ZRKA 2ELBA 3A8QA 3ODXA 4Y94A 1NTYA 4WSFA 1E5WA 1P3RA 1FHOA 1FHWA 2KUPA 4CHMA 1B55A 2Q13A 2NZ8B 2CODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D11 A;  5KQ1 A;  2DX5 A;  4EKU A;  3KZ1 A;  4H8S A;  5DHA B;  1RJ2 A;  2DHJ A;  3D8F A;  4ZRJ A;  2DHI A;  1H4R A;  3D8E A;  3N7C A;  1MKE A;  2L2I A;  2UVM A;  1ZSQ A;  5J3T A;  1H10 A;  3V5W A;  2M38 A;  1LW3 A;  2Z0P A;  1WVH A;  5LOP B;  3P7Z A;  4ZRI A;  3M1I B;  3DXC A;  1WG7 A;  3PVW A;  2UZS A;  3G9W A;  2R09 A;  2K00 A;  1W1G A;  3LJU X;  4KHO A;  2ROZ B;  3TO1 A;  1M7R A;  4B6H A;  2QKL A;  3PSC A;  3A98 B;  2AL6 A;  2I1K A;  3MPX A;  1PMS A;  2VRW B;  1BTK A;  4YL8 A;  1KZG A;  1XR0 B;  5D3V A;  2IFS A;  3ML4 A;  2RVB B;  3BJI A;  4HAZ B;  4A6H A;  2KGX B;  2VKI A;  4HAT B;  2CRF A;  4KHB B;  1WGU A;  4DX9 0;  1N3H A;  3TCA A;  1W1H A;  5JLJ B;  2XQN M;  5JHG A;  5HE2 A;  4MY6 A;  1V5M A;  2AEH A;  2D9X A;  1OMW A;  1UNQ A;  1U5G A;  3CXB B;  5FI1 A;  4K2O A;  5J3Q A;  2DLW A;  2G35 A;  2Y8F A;  2Z0O A;  3PVL A;  2P8V A;  5C16 A;  4GPT B;  2ADZ A;  2DFK A;  5JP4 A;  2LG1 A;  4IAP A;  1I2H A;  4NY0 A;  1WI1 A;  2N23 A;  2YF0 A;  3ULB A;  2GCJ A;  3HW2 B;  1EF1 A;  2P0F A;  1UNP A;  3ZVR A;  3DXE A;  1P6S A;  2FJL A;  4PNK A;  2D9W A;  2GJY A;  2COA A;  4A6F B;  1U2B A;  3HK0 A;  2I5F A;  5KCV A;  2UZR A;  4MT7 A;  5D3Y A;  2YSZ A;  1OY2 A;  2IYB A;  2EJ8 A;  1EGX A;  5EFX A;  4A6K A;  3KRW A;  2YT1 A;  2BCJ A;  5C5B B;  1Q67 A;  2P0D A;  1DDV A;  1XOD A;  5KQ4 A;  4P7I A;  2RGN B;  2MDX A;  1XKE A;  2V76 A;  2DX1 A;  3DXD A;  5DH9 B;  1OQN A;  3PP2 A;  4YON A;  3PVU A;  2R0D A;  2LOX A;  2I5C A;  1DRO A;  2ROV A;  1TQZ A;  2W2X D;  1UEF A;  2DN6 A;  3AU4 A;  3WYF B;  3T06 A;  2PZ1 A;  1ISN A;  2H7E A;  3O96 A;  1PFJ A;  4A5K A;  1WJ1 A;  3ODW A;  2EMS A;  5CLL B;  4TKN A;  3AU5 A;  1BAK A;  2EMT A;  2H7D A;  3SNH A;  1GC7 A;  5DI9 B;  1MIX A;  4PQ0 A;  2YS1 A;  3ODO A;  1M7E A;  1ZM0 A;  2GCL A;  2HE7 A;  3ULC A;  2DTC A;  4DX8 A;  4EMO A;  2LOZ A;  1EAZ A;  5JHH A;  4GMX B;  1V5U A;  1NU2 A;  1Y19 B;  4CYE A;  5C79 A;  2K2J A;  5HE0 A;  4A6F A;  3SUZ A;  1FAO A;  2NMB A;  4HHV A;  2D10 A;  1MIZ B;  1XX0 A;  4F7G A;  1W1D A;  3PG7 A;  1UPR A;  1ZC4 B;  1U5D A;  1FB8 A;  1Y5O A;  3QBV B;  3CIK A;  1ZC3 B;  5DIF B;  4HAW B;  1V89 A;  3FM8 C;  3KSY A;  4D0N B;  2K2U A;  1WJM A;  3VOQ A;  5D3W A;  4XWX A;  4Z2M B;  2JP2 A;  3FSS A;  4Z2N A;  2VSZ A;  1X1F A;  2CY5 A;  2EC1 A;  3GYO A;  1Z87 A;  1GC6 A;  1WGQ A;  4GXB A;  1BTN A;  2E2X A;  1KI1 B;  1TJ6 A;  3RCP A;  1QQG A;  5L81 A;  4F7U P;  2YS3 A;  4HB2 B;  4F7H A;  1NTV A;  2N0Y A;  1FHX A;  2CAY A;  4DXA B;  2LYD A;  5J3Y A;  1AWE A;  2DKQ A;  1GG3 A;  1XCG A;  4L6E A;  3VIA A;  4HAV B;  4MK0 A;  2DKP A;  3D8D A;  2RLO A;  2D2Q A;  2MKR A;  4KVG B;  2YS5 A;  1TXD A;  1MAI A;  1X1G A;  1EVH A;  4GZU A;  2YVC A;  2M14 A;  3PEG A;  1PLS A;  3A8P A;  3F5R A;  3KRX A;  3HQC A;  1DYN A;  2COC A;  3X23 A;  4DBB A;  3UZT A;  2QKM A;  2MWN B;  2RUK B;  3PZD A;  2J59 M;  2J0K A;  1XD4 A;  1IRS A;  2DHK A;  2OTX A;  4HDQ A;  4HAU B;  3NSU A;  1DDW A;  2RSG A;  1QC6 A;  3TW1 A;  3TVV A;  2ZPY A;  4GMV A;  3SYX A;  3P6A A;  1SGH A;  1SHC A;  2HTH B;  2LUL A;  2Y8G A;  4K17 A;  1J19 A;  3FEH A;  4IOY X;  4K81 A;  1MPH A;  2ELA A;  5LON B;  1FOE A;  1DBH A;  3GYP A;  2DYQ A;  1AQC A;  5D3X A;  3QIJ A;  5DHF B;  5HE1 A;  1LB1 A;  4BBK A;  1BWN A;  1KZ7 A;  2GS0 A;  2YT0 A;  3U8Z A;  4HDO A;  3U7D A;  4HB0 B;  4KHA A;  3SV1 A;  3OAN A;  2D9V A;  5C6R A;  2MFQ A;  4KAX B;  5CLQ B;  1X86 A;  1K5G B;  1RRP B;  2D4Q A;  4CHJ A;  2DYN A;  4TYZ A;  1X11 A;  3QWM A;  2DA0 A;  1V61 A;  2LKO A;  2COF A;  5C5B A;  1J0W A;  4HB4 B;  3WA0 A;  3MDB C;  2CY4 A;  2OQB A;  2RNR B;  3F0W A;  5FI0 A;  1P5T A;  2YRY A;  3AJ4 A;  2KCJ A;  4EJN A;  4WJ7 A;  2Z0Q A;  3BIN A;  1FGY A;  2D9Y A;  2W2X C;  4K2P A;  3TFM A;  1U5E A;  3KY9 A;  4IFS A;  2W2W A;  1I7A A;  1UNR A;  1MK7 B;  2J0M A;  2I1J A;  1U29 A;  1NI2 A;  5HE3 A;  1FGZ A;  2L1C A;  5D27 A;  2P0H A;  1K5D B;  2J0J A;  4HAY B;  1MK9 B;  2D9Z A;  1U27 A;  3SO6 A;  1DDM A;  4NSW A;  1X05 A;  4HAX B;  3ZDT A;  1U5F A;  3IVF A;  4HB3 B;  4WVF B;  4GN1 A;  2Y7B A;  1ZVR A;  1V88 A;  4C0A A;  2X18 A;  5GOW B;  1V5P A;  1UPQ A;  4ZRK A;  2ELB A;  3A8Q A;  3ODX A;  4Y94 A;  1NTY A;  4WSF A;  1E5W A;  1P3R A;  1FHO A;  1FHW A;  2KUP A;  4CHM A;  1B55 A;  2Q13 A;  2NZ8 B;  2COD A; 
#chains in the Genus database with same CATH topology
 4DIX A;  2D11 A;  5KQ1 A;  2DX5 A;  4EKU A;  3KZ1 A;  4H8S A;  5DHA B;  3NWF A;  1RJ2 A;  2DHJ A;  3D8F A;  4ZRJ A;  2DHI A;  1H4R A;  3D8E A;  3N7C A;  1MKE A;  2YT2 A;  2L2I A;  2UVM A;  1ZSQ A;  5J3T A;  1H10 A;  2Z59 A;  3V5W A;  2M38 A;  1LW3 A;  2Z0P A;  1WVH A;  5LOP B;  3P7Z A;  4ZRI A;  3M1I B;  3DXC A;  1WG7 A;  3PVW A;  2UZS A;  3G9W A;  2R09 A;  2K00 A;  1W1G A;  3LJU X;  4KHO A;  2ROZ B;  3TO1 A;  1M7R A;  4B6H A;  2QKL A;  3PSC A;  4GOU A;  3A98 B;  2KUQ A;  2AL6 A;  2I1K A;  3MPX A;  1PMS A;  2VRW B;  1BTK A;  4YL8 A;  1KZG A;  2FJU B;  4OSN A;  1XR0 B;  5D3V A;  2IFS A;  3ML4 A;  2RVB B;  3BJI A;  4HAZ B;  2RRF A;  4A6H A;  2KGX B;  2VKI A;  4HAT B;  2CRF A;  4KHB B;  1WGU A;  4HSI A;  4DX9 0;  1N3H A;  3TCA A;  1W1H A;  5I2M A;  2R2Y A;  5JLJ B;  2XQN M;  5JHG A;  5HE2 A;  4MY6 A;  1V5M A;  2AEH A;  2D9X A;  1OMW A;  1UNQ A;  1U5G A;  3CXB B;  5FI1 A;  4K2O A;  5J3Q A;  2DLW A;  1ZYI A;  2ZKM X;  2G35 A;  2Y8F A;  2Z0O A;  3PVL A;  2P8V A;  1T77 A;  5C16 A;  1MI1 A;  4GPT B;  2ADZ A;  2DFK A;  5JP4 A;  2LG1 A;  4IAP A;  1I2H A;  4NY0 A;  1WI1 A;  2N23 A;  2YF0 A;  3ULB A;  2GCJ A;  3HW2 B;  1EF1 A;  2P0F A;  1UNP A;  3ZVR A;  3DXE A;  1P6S A;  2FJL A;  4PNK A;  2D9W A;  2GJY A;  2COA A;  4A6F B;  1U2B A;  5IRS A;  3HK0 A;  2I5F A;  5KCV A;  2UZR A;  4MT7 A;  5D3Y A;  2YSZ A;  1OY2 A;  2Z4D A;  2IYB A;  2EJ8 A;  1EGX A;  5EFX A;  4A6K A;  3KRW A;  2YT1 A;  2BCJ A;  5C5B B;  1Q67 A;  4D6W A;  2P0D A;  1DDV A;  1XOD A;  5KQ4 A;  4P7I A;  3FVC A;  2RGN B;  2MDX A;  1XKE A;  2V76 A;  2DX1 A;  3DXD A;  5DH9 B;  1OQN A;  3PP2 A;  4YON A;  3PVU A;  2R0D A;  2LOX A;  2I5C A;  1DRO A;  2ROV A;  1TQZ A;  2W2X D;  1UEF A;  2DN6 A;  3AU4 A;  3WYF B;  3T06 A;  2PZ1 A;  1ISN A;  2H7E A;  3O96 A;  1PFJ A;  3A58 A;  4A5K A;  1WJ1 A;  3ODW A;  2EMS A;  4QXA B;  5CLL B;  4TKN A;  3AU5 A;  1BAK A;  2EMT A;  2H7D A;  3SNH A;  1GC7 A;  5DI9 B;  1MIX A;  4PQ0 A;  2YS1 A;  3ODO A;  1M7E A;  1ZM0 A;  2GCL A;  5M4Y B;  2HE7 A;  3ULC A;  2DTC A;  4DX8 A;  4EMO A;  2LOZ A;  1EAZ A;  5JHH A;  4GMX B;  1V5U A;  1NU2 A;  1Y19 B;  4CYE A;  5C79 A;  2K2J A;  5HE0 A;  4A6F A;  3NW8 A;  3OHM B;  2KR0 A;  3SUZ A;  1FAO A;  2NMB A;  4HHV A;  2D10 A;  1MIZ B;  1XX0 A;  4F7G A;  1W1D A;  1UPR A;  3PG7 A;  1ZC4 B;  1U5D A;  1FB8 A;  1Y5O A;  3QBV B;  3CIK A;  1ZC3 B;  5DIF B;  4HAW B;  1V89 A;  3FM8 C;  3KSY A;  4D0N B;  2K2U A;  1WJM A;  3VOQ A;  5D3W A;  3NWA A;  4XWX A;  2KIE A;  4Z2M B;  2JP2 A;  3FSS A;  4Z2N A;  2VSZ A;  1X1F A;  2CY5 A;  2EC1 A;  3GYO A;  1Z87 A;  1GC6 A;  3U12 A;  3B77 A;  1WGQ A;  3NWD A;  4GXB A;  1BTN A;  4CSQ A;  2E2X A;  1KI1 B;  1TJ6 A;  3RCP A;  1QQG A;  5L81 A;  2Z14 A;  4F7U P;  2YS3 A;  4HB2 B;  4F7H A;  1NTV A;  2N0Y A;  1FHX A;  2CAY A;  4DXA B;  2LYD A;  5J3Y A;  1AWE A;  2Z13 A;  3HSA A;  2DKQ A;  1GG3 A;  5LG4 B;  1XCG A;  4L6E A;  3VIA A;  4HAV B;  4MK0 A;  2DKP A;  3D8D A;  2RLO A;  2D2Q A;  2MKR A;  4KVG B;  2YS5 A;  1TXD A;  1MAI A;  1X1G A;  1EVH A;  4GZU A;  2YVC A;  2M14 A;  3PEG A;  4KHB A;  1PLS A;  3A8P A;  3F5R A;  5I2S A;  3KRX A;  4OT1 A;  3HQC A;  1DYN A;  2COC A;  3X23 A;  4DBB A;  3UZT A;  2QKM A;  2MWN B;  2RUK B;  3PZD A;  2J59 M;  2J0K A;  1XD4 A;  1IRS A;  2DHK A;  2OTX A;  4HDQ A;  4HAU B;  3NSU A;  1DDW A;  2RSG A;  1QC6 A;  3TW1 A;  3TVV A;  2ZPY A;  4GMV A;  3SYX A;  3P6A A;  1SGH A;  1SHC A;  2HTH B;  2LUL A;  2Y8G A;  4K17 A;  1J19 A;  3FEH A;  3HIE A;  4IOY X;  1MPH A;  2ELA A;  4K81 A;  5LON B;  1FOE A;  1DBH A;  3GYP A;  2DYQ A;  1AQC A;  5D3X A;  3QIJ A;  5DHF B;  5HE1 A;  1LB1 A;  4BBK A;  1BWN A;  1KZ7 A;  2GS0 A;  2YT0 A;  3U8Z A;  4QJ4 B;  4HDO A;  3U7D A;  4HB0 B;  4KHA A;  3SV1 A;  3OAN A;  2D9V A;  5C6R A;  2GUM A;  2MFQ A;  4KAX B;  5CLQ B;  1X86 A;  3DCX A;  1K5G B;  1RRP B;  2D4Q A;  4CHJ A;  2DYN A;  4TYZ A;  1X11 A;  3QWM A;  2DA0 A;  2KIG A;  1V61 A;  2LKO A;  2COF A;  5C5B A;  1J0W A;  2K49 A;  4HB4 B;  3WA0 A;  3MDB C;  2CY4 A;  2OQB A;  2RNR B;  3F0W A;  2K8E A;  4L1R A;  5FI0 A;  1P5T A;  2YRY A;  3AJ4 A;  2KCJ A;  4EJN A;  4WJ7 A;  2Z0Q A;  3BIN A;  1FGY A;  4QJ3 B;  2D9Y A;  2W2X C;  4K2P A;  3TFM A;  1U5E A;  3KY9 A;  4IFS A;  2W2W A;  1I7A A;  1UNR A;  1MK7 B;  2J0M A;  2I1J A;  4GNK B;  1U29 A;  1NI2 A;  2NBV A;  5HE3 A;  4QJ5 B;  1FGZ A;  2L1C A;  5D27 A;  2P0H A;  1K5D B;  2J0J A;  4HAY B;  1MK9 B;  2D9Z A;  1U27 A;  3SO6 A;  1DDM A;  4NSW A;  1X05 A;  4HAX B;  3ZDT A;  1U5F A;  3IVF A;  4HB3 B;  4WVF B;  4GN1 A;  2Y7B A;  1ZVR A;  1V88 A;  4C0A A;  2X18 A;  5GOW B;  1V5P A;  1UPQ A;  4ZRK A;  2ELB A;  3A8Q A;  3ODX A;  4Y94 A;  1NTY A;  4WSF A;  1E5W A;  1P3R A;  1FHO A;  1FHW A;  2KUP A;  4CHM A;  1B55 A;  2Q13 A;  2NZ8 B;  2COD A; 
#chains in the Genus database with same CATH homology
 2D11 A;  5KQ1 A;  2DX5 A;  4EKU A;  3KZ1 A;  4H8S A;  5DHA B;  1RJ2 A;  2DHJ A;  3D8F A;  4ZRJ A;  2DHI A;  1H4R A;  3D8E A;  3N7C A;  1MKE A;  2L2I A;  2UVM A;  1ZSQ A;  5J3T A;  1H10 A;  3V5W A;  2M38 A;  1LW3 A;  2Z0P A;  1WVH A;  5LOP B;  3P7Z A;  4ZRI A;  3M1I B;  3DXC A;  1WG7 A;  3PVW A;  2UZS A;  3G9W A;  2R09 A;  2K00 A;  1W1G A;  3LJU X;  4KHO A;  2ROZ B;  3TO1 A;  1M7R A;  4B6H A;  2QKL A;  3PSC A;  3A98 B;  2AL6 A;  2I1K A;  3MPX A;  1PMS A;  2VRW B;  1BTK A;  4YL8 A;  1KZG A;  1XR0 B;  5D3V A;  2IFS A;  3ML4 A;  2RVB B;  3BJI A;  4HAZ B;  4A6H A;  2KGX B;  2VKI A;  4HAT B;  2CRF A;  4KHB B;  1WGU A;  4DX9 0;  1N3H A;  3TCA A;  1W1H A;  5JLJ B;  2XQN M;  5JHG A;  5HE2 A;  4MY6 A;  1V5M A;  2AEH A;  2D9X A;  1OMW A;  1UNQ A;  1U5G A;  3CXB B;  5FI1 A;  4K2O A;  5J3Q A;  2DLW A;  2G35 A;  2Y8F A;  2Z0O A;  3PVL A;  2P8V A;  5C16 A;  4GPT B;  2ADZ A;  2DFK A;  5JP4 A;  2LG1 A;  4IAP A;  1I2H A;  4NY0 A;  1WI1 A;  2N23 A;  2YF0 A;  3ULB A;  2GCJ A;  3HW2 B;  1EF1 A;  2P0F A;  1UNP A;  3ZVR A;  3DXE A;  1P6S A;  2FJL A;  4PNK A;  2D9W A;  2GJY A;  2COA A;  4A6F B;  1U2B A;  3HK0 A;  2I5F A;  5KCV A;  2UZR A;  4MT7 A;  5D3Y A;  2YSZ A;  1OY2 A;  2IYB A;  2EJ8 A;  1EGX A;  5EFX A;  4A6K A;  3KRW A;  2YT1 A;  2BCJ A;  5C5B B;  1Q67 A;  2P0D A;  1DDV A;  1XOD A;  5KQ4 A;  4P7I A;  2RGN B;  2MDX A;  1XKE A;  2V76 A;  2DX1 A;  3DXD A;  5DH9 B;  1OQN A;  3PP2 A;  4YON A;  3PVU A;  2R0D A;  2LOX A;  2I5C A;  1DRO A;  2ROV A;  1TQZ A;  2W2X D;  1UEF A;  2DN6 A;  3AU4 A;  3WYF B;  3T06 A;  2PZ1 A;  1ISN A;  2H7E A;  3O96 A;  1PFJ A;  4A5K A;  1WJ1 A;  3ODW A;  2EMS A;  5CLL B;  4TKN A;  3AU5 A;  1BAK A;  2EMT A;  2H7D A;  3SNH A;  1GC7 A;  5DI9 B;  1MIX A;  4PQ0 A;  2YS1 A;  3ODO A;  1M7E A;  1ZM0 A;  2GCL A;  2HE7 A;  3ULC A;  2DTC A;  4DX8 A;  4EMO A;  2LOZ A;  1EAZ A;  5JHH A;  4GMX B;  1V5U A;  1NU2 A;  1Y19 B;  4CYE A;  5C79 A;  2K2J A;  5HE0 A;  4A6F A;  3SUZ A;  1FAO A;  2NMB A;  4HHV A;  2D10 A;  1MIZ B;  1XX0 A;  4F7G A;  1W1D A;  3PG7 A;  1UPR A;  1ZC4 B;  1U5D A;  1FB8 A;  1Y5O A;  3QBV B;  3CIK A;  1ZC3 B;  5DIF B;  4HAW B;  1V89 A;  3FM8 C;  3KSY A;  4D0N B;  2K2U A;  1WJM A;  3VOQ A;  5D3W A;  4XWX A;  4Z2M B;  2JP2 A;  3FSS A;  4Z2N A;  2VSZ A;  1X1F A;  2CY5 A;  2EC1 A;  3GYO A;  1Z87 A;  1GC6 A;  1WGQ A;  4GXB A;  1BTN A;  2E2X A;  1KI1 B;  1TJ6 A;  3RCP A;  1QQG A;  5L81 A;  4F7U P;  2YS3 A;  4HB2 B;  4F7H A;  1NTV A;  2N0Y A;  1FHX A;  2CAY A;  4DXA B;  2LYD A;  5J3Y A;  1AWE A;  2DKQ A;  1GG3 A;  1XCG A;  4L6E A;  3VIA A;  4HAV B;  4MK0 A;  2DKP A;  3D8D A;  2RLO A;  2D2Q A;  2MKR A;  4KVG B;  2YS5 A;  1TXD A;  1MAI A;  1X1G A;  1EVH A;  4GZU A;  2YVC A;  2M14 A;  3PEG A;  1PLS A;  3A8P A;  3F5R A;  3KRX A;  3HQC A;  1DYN A;  2COC A;  3X23 A;  4DBB A;  3UZT A;  2QKM A;  2MWN B;  2RUK B;  3PZD A;  2J59 M;  2J0K A;  1XD4 A;  1IRS A;  2DHK A;  2OTX A;  4HDQ A;  4HAU B;  3NSU A;  1DDW A;  2RSG A;  1QC6 A;  3TW1 A;  3TVV A;  2ZPY A;  4GMV A;  3SYX A;  3P6A A;  1SGH A;  1SHC A;  2HTH B;  2LUL A;  2Y8G A;  4K17 A;  1J19 A;  3FEH A;  4IOY X;  4K81 A;  1MPH A;  2ELA A;  5LON B;  1FOE A;  1DBH A;  3GYP A;  2DYQ A;  1AQC A;  5D3X A;  3QIJ A;  5DHF B;  5HE1 A;  1LB1 A;  4BBK A;  1BWN A;  1KZ7 A;  2GS0 A;  2YT0 A;  3U8Z A;  4HDO A;  3U7D A;  4HB0 B;  4KHA A;  3SV1 A;  3OAN A;  2D9V A;  5C6R A;  2MFQ A;  4KAX B;  5CLQ B;  1X86 A;  1K5G B;  1RRP B;  2D4Q A;  4CHJ A;  2DYN A;  4TYZ A;  1X11 A;  3QWM A;  2DA0 A;  1V61 A;  2LKO A;  2COF A;  5C5B A;  1J0W A;  4HB4 B;  3WA0 A;  3MDB C;  2CY4 A;  2OQB A;  2RNR B;  3F0W A;  5FI0 A;  1P5T A;  2YRY A;  3AJ4 A;  2KCJ A;  4EJN A;  4WJ7 A;  2Z0Q A;  3BIN A;  1FGY A;  2D9Y A;  2W2X C;  4K2P A;  3TFM A;  1U5E A;  3KY9 A;  4IFS A;  2W2W A;  1I7A A;  1UNR A;  1MK7 B;  2J0M A;  2I1J A;  1U29 A;  1NI2 A;  5HE3 A;  1FGZ A;  2L1C A;  5D27 A;  2P0H A;  1K5D B;  2J0J A;  4HAY B;  1MK9 B;  2D9Z A;  1U27 A;  3SO6 A;  1DDM A;  4NSW A;  1X05 A;  4HAX B;  3ZDT A;  1U5F A;  3IVF A;  4HB3 B;  4WVF B;  4GN1 A;  2Y7B A;  1ZVR A;  1V88 A;  4C0A A;  2X18 A;  5GOW B;  1V5P A;  1UPQ A;  4ZRK A;  2ELB A;  3A8Q A;  3ODX A;  4Y94 A;  1NTY A;  4WSF A;  1E5W A;  1P3R A;  1FHO A;  1FHW A;  2KUP A;  4CHM A;  1B55 A;  2Q13 A;  2NZ8 B;  2COD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...