2Y7BA

Crystal structure of the ph domain of human actin-binding protein anillin anln
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
134
structure length
134
Chain Sequence
VNSSVEERGFLTIFEDVSGFGAWHRRWCVLSGNCISYWTYPDDEKRKNPIGRINLANCTSRQIEPANREFCARRNTFELITVRPQREDDRETLVSQCRDTLCVTKNWLSADTKEERDLWMQKLNQVLVDIRLWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ACTIN-BINDING PROTEIN ANILLIN
publication title Crystal Structure of the Ph Domain of Human Actin-Binding Protein Anillin Anln
rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 33
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2011-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2y7bA00
3U7DA 1WJMA 2I5FA 2IFSA 4CHMA 2MWNB 4A6HA 3FEHA 2EMSA 2K2UA 1BTKA 2OTXA 1QC6A 3A8QA 2I5CA 4Y94A 1XKEA 3RCPA 4KAXB 2DHJA 2Y8GA 3PEGA 3SUZA 2YF0A 2M14A 2N23A 2DX5A 2K00A 1V88A 1AWEA 2D9YA 1V61A 1NI2A 1I7AA 3N7CA 3WYFB 4DX90 5KQ4A 1AQCA 2CY4A 2W2XD 3F5RA 1KZ7A 2DTCA 1TQZA 1K5GB 2YT1A 4GMVA 2ELAA 2FJLA 3FM8C 2L1CA 2I1KA 4H8SA 3ULCA 2IYBA 1ZSQA 2ROZB 3ZDTA 3OANA 2VSZA 3DXEA 3F0WA 1SGHA 4C0AA 1H10A 3TFMA 5DHFB 4EMOA 2P0DA 2YS1A 3U8ZA 2RLOA 4HB4B 2XQNM 1EF1A 3G9WA 2QKMA 1XCGA 1U2BA 1X1GA 1XD4A 2D4QA 5JLJB 1KI1B 4A6KA 1IRSA 3TVVA 4YL8A 2KGXB 5HE1A 2KUPA 2DYQA 2DKPA 2NMBA 2UZSA 2P8VA 5C16A 2DYNA 1U5EA 5EFXA 3UZTA 3KSYA 1MIXA 2ZPYA 4IFSA 1P6SA 3GYOA 4HAUB 1FGZA 3SO6A 3VIAA 1WGQA 3ODOA 2W2XC 1RRPB 4HDOA 3P7ZA 2RNRB 3ML4A 2EJ8A 1P3RA 5C5BB 2GCLA 1FB8A 2DX1A 1WVHA 2DA0A 3KY9A 4GXBA 1UPRA 5J3QA 2Y7BA 4CHJA 2EC1A 1FGYA 1B55A 2LYDA 4GN1A 3PVWA 1WG7A 3TCAA 1N3HA 3ODXA 4KHAA 1UNRA 1RJ2A 1Z87A 1WGUA 1TJ6A 2UZRA 5DH9B 3CIKA 2P0HA 3BJIA 2DHKA 2X18A 1PMSA 4BBKA 4F7UP 3HQCA 2QKLA 1P5TA 2OQBA 5CLLB 1V5MA 2AEHA 3KRWA 2YT0A 2ROVA 5D3WA 1EAZA 2D9ZA 2YS3A 3BINA 1DBHA 4HDQA 2DKQA 5DHAB 1GG3A 1MKEA 1XODA 2V76A 2GCJA 4KVGB 1DDMA 3SNHA 1U27A 3FSSA 4K2OA 5D3XA 2RUKB 1XR0B 2MFQA 2NZ8B 3VOQA 1GC6A 3O96A 3QBVB 1PLSA 2Q13A 4ZRKA 2CODA 5D3VA 2LOXA 4EKUA 2KCJA 5HE3A 1Q67A 4HB3B 3PSCA 2M38A 2D9VA 1MPHA 1ISNA 4GPTB 3IVFA 3TO1A 2I1JA 2J59M 5C5BA 3A98B 1I2HA 2D2QA 1XX0A 4WSFA 5JHHA 4HAZB 1UNPA 3WA0A 1FHXA 1GC7A 3ZVRA 4F7HA 2D9XA 1V5PA 2HTHB 2COCA 4TYZA 2HE7A 2ELBA 5J3TA 2BCJA 2DN6A 3A8PA 4XWXA 1NTVA 4GMXB 4A5KA 3DXCA 3DXDA 1Y5OA 3CXBB 1NTYA 1QQGA 4A6FB 2RVBB 1FAOA 1WI1A 2J0MA 2RSGA 2RGNB 4DBBA 3SV1A 3ODWA 1MIZB 2UVMA 2Y8FA 4D0NB 4MY6A 1W1HA 3KZ1A 5D27A 5JP4A 1J19A 1EVHA 3PVLA 1M7RA 5LOPB 1X05A 1BWNA 2R09A 1H4RA 2MKRA 4GZUA 3PVUA 1DDWA 3D8DA 1U29A 1BAKA 2K2JA 2LULA 4NSWA 1MK9B 2AL6A 3QIJA 1Y19B 4YONA 5KCVA 1WJ1A 4ZRIA 1OMWA 2DLWA 2R0DA 4HB2B 2CY5A 1MK7B 3PZDA 1FOEA 1UEFA 3D8FA 5HE0A 5FI0A 5J3YA 5KQ1A 4WJ7A 1UPQA 3AU4A 2GJYA 1W1GA 1U5DA 1X86A 1FHOA 3T06A 4Z2NA 2CRFA 2CAYA 5C79A 1PFJA 3PG7A 2LG1A 5FI1A 4HAXB 4K81A 4TKNA 1DYNA 2COAA 4ZRJA 3HW2B 1K5DB 1UNQA 2YSZA 1KZGA 2LOZA 1NU2A 4A6FA 2ADZA 1DROA 1LB1A 3PP2A 3MPXA 4HHVA 4CYEA 2YS5A 1EGXA 5CLQB 4PNKA 3V5WA 1ZC3B 1X1FA 1M7EA 3TW1A 3AU5A 4MK0A 1U5GA 4L6EA 2MDXA 3QWMA 4DX8A 4IOYX 2DFKA 4HATB 1W1DA 2E2XA 2YVCA 2D10A 4KHBB 1DDVA 3P6AA 5DI9B 5L81A 2H7DA 4WVFB 1TXDA 1LW3A 2D9WA 2H7EA 2G35A 4HAYB 2COFA 2PZ1A 1FHWA 2JP2A 2W2WA 1E5WA 2J0KA 3M1IB 2GS0A 1OY2A 2P0FA 4F7GA 2DHIA 3D8EA 3X23A 4K2PA 1ZM0A 1SHCA 3SYXA 4EJNA 3LJUX 2Z0OA 4PQ0A 2LKOA 5JHGA 4DXAB 1V89A 4HB0B 4Z2MB 3HK0A 5LONB 4HAWB 3GYPA 1ZC4B 3NSUA 1U5FA 2N0YA 2VRWB 3KRXA 2VKIA 5HE2A 4KHOA 4IAPA 2J0JA 4K17A 4NY0A 2L2IA 2D11A 5DIFB 1BTNA 5GOWB 2YRYA 4HAVB 5C6RA 1V5UA 1MAIA 1OQNA 2EMTA 5D3YA 2Z0PA 1ZVRA 3MDBC 3ULBA 1X11A 1J0WA 4B6HA 3AJ4A 2Z0QA 4P7IA 4MT7A
chains in the Genus database with same CATH superfamily
3U7DA 1WJMA 2I5FA 4KHBA 2IFSA 4CHMA 2MWNB 4A6HA 3FEHA 2EMSA 2K2UA 1BTKA 2OTXA 1QC6A 3A8QA 3B77A 2I5CA 4Y94A 1XKEA 3RCPA 2YT2A 4KAXB 2DHJA 2Y8GA 3PEGA 3SUZA 2YF0A 2M14A 2N23A 2DX5A 2K00A 1V88A 1AWEA 5I2SA 2D9YA 1V61A 1NI2A 1I7AA 3N7CA 3WYFB 5I2MA 3NWFA 4DX90 5KQ4A 1AQCA 2CY4A 2W2XD 3F5RA 1KZ7A 2DTCA 1TQZA 1K5GB 2YT1A 4GMVA 2ELAA 2FJLA 3FM8C 2L1CA 2I1KA 4H8SA 2ZKMX 1MI1A 3ULCA 2IYBA 1ZSQA 2ROZB 3ZDTA 3OANA 2VSZA 3DXEA 3F0WA 5LG4B 1SGHA 4C0AA 1H10A 3TFMA 5DHFB 4EMOA 2P0DA 2KR0A 2YS1A 3U8ZA 2Z4DA 2RLOA 3NW8A 4HB4B 2XQNM 1EF1A 2RRFA 3G9WA 2QKMA 1XCGA 1U2BA 1X1GA 1XD4A 2D4QA 2NBVA 5JLJB 1KI1B 4A6KA 1IRSA 3TVVA 4YL8A 2KGXB 5HE1A 2KUPA 2DYQA 2DKPA 2NMBA 2UZSA 2P8VA 5C16A 2DYNA 1U5EA 3OHMB 5EFXA 3UZTA 3KSYA 4D6WA 1MIXA 2ZPYA 4IFSA 1P6SA 3GYOA 4HAUB 1FGZA 3SO6A 3VIAA 1WGQA 3ODOA 2W2XC 1RRPB 4HDOA 3P7ZA 2RNRB 3ML4A 2EJ8A 1P3RA 5C5BB 2GCLA 1FB8A 2DX1A 1WVHA 2DA0A 3KY9A 4GXBA 1UPRA 5J3QA 2Y7BA 4CHJA 2EC1A 1FGYA 1B55A 2LYDA 4GN1A 3PVWA 2KUQA 1WG7A 3TCAA 1N3HA 3ODXA 4KHAA 1UNRA 1RJ2A 1Z87A 1WGUA 1TJ6A 2UZRA 2KIEA 5DH9B 3CIKA 2P0HA 3BJIA 2DHKA 2X18A 3HIEA 1PMSA 4BBKA 4F7UP 3HQCA 2QKLA 1P5TA 2OQBA 3DCXA 5CLLB 1V5MA 4HSIA 2AEHA 3KRWA 2YT0A 2ROVA 5D3WA 1EAZA 2D9ZA 2YS3A 3BINA 1DBHA 4HDQA 2DKQA 5DHAB 1GG3A 1MKEA 1XODA 2V76A 2GCJA 4KVGB 1DDMA 3SNHA 1U27A 3FSSA 4K2OA 5D3XA 2RUKB 1XR0B 2MFQA 4L1RA 2NZ8B 3VOQA 1GC6A 3O96A 3QBVB 1PLSA 2K49A 2Q13A 4ZRKA 2CODA 5D3VA 2LOXA 4EKUA 2KCJA 5HE3A 1Q67A 4GOUA 4HB3B 3PSCA 2M38A 3HSAA 2D9VA 2Z14A 1MPHA 1ISNA 4GPTB 3IVFA 3TO1A 2I1JA 2J59M 5C5BA 3A98B 1I2HA 2D2QA 1XX0A 4WSFA 5JHHA 4HAZB 1UNPA 3WA0A 1FHXA 1GC7A 3ZVRA 4F7HA 2D9XA 1V5PA 2HTHB 2COCA 4TYZA 2HE7A 2ELBA 5J3TA 2BCJA 1ZYIA 2DN6A 4DIXA 3A8PA 4XWXA 1NTVA 4GMXB 4A5KA 3FVCA 3DXCA 3DXDA 4QJ5B 1Y5OA 3CXBB 1NTYA 1QQGA 1T77A 4A6FB 2RVBB 2K8EA 1FAOA 1WI1A 2J0MA 2RSGA 3A58A 2RGNB 4DBBA 3SV1A 3ODWA 1MIZB 2UVMA 2Y8FA 4D0NB 4MY6A 1W1HA 2FJUB 3KZ1A 5D27A 5JP4A 1J19A 1EVHA 3PVLA 1M7RA 5LOPB 1X05A 1BWNA 2Z59A 2R09A 1H4RA 2MKRA 4GZUA 3PVUA 1DDWA 3D8DA 1U29A 1BAKA 4OSNA 2K2JA 2LULA 4NSWA 1MK9B 2AL6A 3QIJA 1Y19B 2Z13A 4YONA 5KCVA 1WJ1A 4ZRIA 1OMWA 2DLWA 2R0DA 4HB2B 2CY5A 1MK7B 3PZDA 1FOEA 1UEFA 3D8FA 5HE0A 5FI0A 5J3YA 5KQ1A 4WJ7A 1UPQA 3AU4A 2GJYA 1W1GA 1U5DA 4QJ4B 3NWDA 1X86A 1FHOA 3T06A 4Z2NA 2CRFA 2CAYA 2GUMA 1PFJA 5C79A 3PG7A 2LG1A 5FI1A 4HAXB 4K81A 4TKNA 1DYNA 2COAA 4ZRJA 3HW2B 1K5DB 1UNQA 2YSZA 1KZGA 2LOZA 1NU2A 4A6FA 2ADZA 1DROA 1LB1A 3PP2A 3MPXA 4HHVA 4CYEA 2YS5A 1EGXA 5CLQB 4PNKA 4QJ3B 3V5WA 1ZC3B 5M4YB 1X1FA 1M7EA 3TW1A 3AU5A 4MK0A 1U5GA 4L6EA 2MDXA 3QWMA 4DX8A 4IOYX 2DFKA 4HATB 1W1DA 2E2XA 2YVCA 2D10A 4KHBB 1DDVA 3P6AA 5DI9B 5L81A 2H7DA 4WVFB 1TXDA 1LW3A 2D9WA 2H7EA 2G35A 4HAYB 2COFA 3NWAA 2PZ1A 1FHWA 2JP2A 2W2WA 1E5WA 2J0KA 3M1IB 4GNKB 2GS0A 1OY2A 4CSQA 2P0FA 4F7GA 2DHIA 3D8EA 3X23A 4K2PA 1ZM0A 1SHCA 3SYXA 4EJNA 3LJUX 2Z0OA 4PQ0A 2LKOA 5IRSA 5JHGA 3U12A 4DXAB 1V89A 4HB0B 2KIGA 3HK0A 4Z2MB 5LONB 4HAWB 4QXAB 3GYPA 1ZC4B 3NSUA 1U5FA 2N0YA 2VRWB 3KRXA 2VKIA 5HE2A 4KHOA 2R2YA 4IAPA 2J0JA 4K17A 4NY0A 2L2IA 2D11A 5DIFB 1BTNA 5GOWB 2YRYA 4HAVB 5C6RA 1V5UA 1MAIA 1OQNA 2EMTA 5D3YA 2Z0PA 1ZVRA 3MDBC 3ULBA 1X11A 1J0WA 4B6HA 3AJ4A 2Z0QA 4OT1A 4P7IA 4MT7A
chains in the Genus database with same CATH topology
3U7DA 1WJMA 2I5FA 2IFSA 4CHMA 2MWNB 4A6HA 3FEHA 2EMSA 2K2UA 1BTKA 2OTXA 1QC6A 3A8QA 2I5CA 4Y94A 1XKEA 3RCPA 4KAXB 2DHJA 2Y8GA 3PEGA 3SUZA 2YF0A 2M14A 2N23A 2DX5A 2K00A 1V88A 1AWEA 2D9YA 1V61A 1NI2A 1I7AA 3N7CA 3WYFB 4DX90 5KQ4A 1AQCA 2CY4A 2W2XD 3F5RA 1KZ7A 2DTCA 1TQZA 1K5GB 2YT1A 4GMVA 2ELAA 2FJLA 3FM8C 2L1CA 2I1KA 4H8SA 3ULCA 2IYBA 1ZSQA 2ROZB 3ZDTA 3OANA 2VSZA 3DXEA 3F0WA 1SGHA 4C0AA 1H10A 3TFMA 5DHFB 4EMOA 2P0DA 2YS1A 3U8ZA 2RLOA 4HB4B 2XQNM 1EF1A 3G9WA 2QKMA 1XCGA 1U2BA 1X1GA 1XD4A 2D4QA 5JLJB 1KI1B 4A6KA 1IRSA 3TVVA 4YL8A 2KGXB 5HE1A 2KUPA 2DYQA 2DKPA 2NMBA 2UZSA 2P8VA 5C16A 2DYNA 1U5EA 5EFXA 3UZTA 3KSYA 1MIXA 2ZPYA 4IFSA 1P6SA 3GYOA 4HAUB 1FGZA 3SO6A 3VIAA 1WGQA 3ODOA 2W2XC 1RRPB 4HDOA 3P7ZA 2RNRB 3ML4A 2EJ8A 1P3RA 5C5BB 2GCLA 1FB8A 2DX1A 1WVHA 2DA0A 3KY9A 4GXBA 1UPRA 5J3QA 2Y7BA 4CHJA 2EC1A 1FGYA 1B55A 2LYDA 4GN1A 3PVWA 1WG7A 3TCAA 1N3HA 3ODXA 4KHAA 1UNRA 1RJ2A 1Z87A 1WGUA 1TJ6A 2UZRA 5DH9B 3CIKA 2P0HA 3BJIA 2DHKA 2X18A 1PMSA 4BBKA 4F7UP 3HQCA 2QKLA 1P5TA 2OQBA 5CLLB 1V5MA 2AEHA 3KRWA 2YT0A 2ROVA 5D3WA 1EAZA 2D9ZA 2YS3A 3BINA 1DBHA 4HDQA 2DKQA 5DHAB 1GG3A 1MKEA 1XODA 2V76A 2GCJA 4KVGB 1DDMA 3SNHA 1U27A 3FSSA 4K2OA 5D3XA 2RUKB 1XR0B 2MFQA 2NZ8B 3VOQA 1GC6A 3O96A 3QBVB 1PLSA 2Q13A 4ZRKA 2CODA 5D3VA 2LOXA 4EKUA 2KCJA 5HE3A 1Q67A 4HB3B 3PSCA 2M38A 2D9VA 1MPHA 1ISNA 4GPTB 3IVFA 3TO1A 2I1JA 2J59M 5C5BA 3A98B 1I2HA 2D2QA 1XX0A 4WSFA 5JHHA 4HAZB 1UNPA 3WA0A 1FHXA 1GC7A 3ZVRA 4F7HA 2D9XA 1V5PA 2HTHB 2COCA 4TYZA 2HE7A 2ELBA 5J3TA 2BCJA 2DN6A 3A8PA 4XWXA 1NTVA 4GMXB 4A5KA 3DXCA 3DXDA 1Y5OA 3CXBB 1NTYA 1QQGA 4A6FB 2RVBB 1FAOA 1WI1A 2J0MA 2RSGA 2RGNB 4DBBA 3SV1A 3ODWA 1MIZB 2UVMA 2Y8FA 4D0NB 4MY6A 1W1HA 3KZ1A 5D27A 5JP4A 1J19A 1EVHA 3PVLA 1M7RA 5LOPB 1X05A 1BWNA 2R09A 1H4RA 2MKRA 4GZUA 3PVUA 1DDWA 3D8DA 1U29A 1BAKA 2K2JA 2LULA 4NSWA 1MK9B 2AL6A 3QIJA 1Y19B 4YONA 5KCVA 1WJ1A 4ZRIA 1OMWA 2DLWA 2R0DA 4HB2B 2CY5A 1MK7B 3PZDA 1FOEA 1UEFA 3D8FA 5HE0A 5FI0A 5J3YA 5KQ1A 4WJ7A 1UPQA 3AU4A 2GJYA 1W1GA 1U5DA 1X86A 1FHOA 3T06A 4Z2NA 2CRFA 2CAYA 5C79A 1PFJA 3PG7A 2LG1A 5FI1A 4HAXB 4K81A 4TKNA 1DYNA 2COAA 4ZRJA 3HW2B 1K5DB 1UNQA 2YSZA 1KZGA 2LOZA 1NU2A 4A6FA 2ADZA 1DROA 1LB1A 3PP2A 3MPXA 4HHVA 4CYEA 2YS5A 1EGXA 5CLQB 4PNKA 3V5WA 1ZC3B 1X1FA 1M7EA 3TW1A 3AU5A 4MK0A 1U5GA 4L6EA 2MDXA 3QWMA 4DX8A 4IOYX 2DFKA 4HATB 1W1DA 2E2XA 2YVCA 2D10A 4KHBB 1DDVA 3P6AA 5DI9B 5L81A 2H7DA 4WVFB 1TXDA 1LW3A 2D9WA 2H7EA 2G35A 4HAYB 2COFA 2PZ1A 1FHWA 2JP2A 2W2WA 1E5WA 2J0KA 3M1IB 2GS0A 1OY2A 2P0FA 4F7GA 2DHIA 3D8EA 3X23A 4K2PA 1ZM0A 1SHCA 3SYXA 4EJNA 3LJUX 2Z0OA 4PQ0A 2LKOA 5JHGA 4DXAB 1V89A 4HB0B 4Z2MB 3HK0A 5LONB 4HAWB 3GYPA 1ZC4B 3NSUA 1U5FA 2N0YA 2VRWB 3KRXA 2VKIA 5HE2A 4KHOA 4IAPA 2J0JA 4K17A 4NY0A 2L2IA 2D11A 5DIFB 1BTNA 5GOWB 2YRYA 4HAVB 5C6RA 1V5UA 1MAIA 1OQNA 2EMTA 5D3YA 2Z0PA 1ZVRA 3MDBC 3ULBA 1X11A 1J0WA 4B6HA 3AJ4A 2Z0QA 4P7IA 4MT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U7D A;  1WJM A;  2I5F A;  2IFS A;  4CHM A;  2MWN B;  4A6H A;  3FEH A;  2EMS A;  2K2U A;  1BTK A;  2OTX A;  1QC6 A;  3A8Q A;  2I5C A;  4Y94 A;  1XKE A;  3RCP A;  4KAX B;  2DHJ A;  2Y8G A;  3PEG A;  3SUZ A;  2YF0 A;  2M14 A;  2N23 A;  2DX5 A;  2K00 A;  1V88 A;  1AWE A;  2D9Y A;  1V61 A;  1NI2 A;  1I7A A;  3N7C A;  3WYF B;  4DX9 0;  5KQ4 A;  1AQC A;  2CY4 A;  2W2X D;  3F5R A;  1KZ7 A;  2DTC A;  1TQZ A;  1K5G B;  2YT1 A;  4GMV A;  2ELA A;  2FJL A;  3FM8 C;  2L1C A;  2I1K A;  4H8S A;  3ULC A;  2IYB A;  1ZSQ A;  2ROZ B;  3ZDT A;  3OAN A;  2VSZ A;  3DXE A;  3F0W A;  1SGH A;  4C0A A;  1H10 A;  3TFM A;  5DHF B;  4EMO A;  2P0D A;  2YS1 A;  3U8Z A;  2RLO A;  4HB4 B;  2XQN M;  1EF1 A;  3G9W A;  2QKM A;  1XCG A;  1U2B A;  1X1G A;  1XD4 A;  2D4Q A;  5JLJ B;  1KI1 B;  4A6K A;  1IRS A;  3TVV A;  4YL8 A;  2KGX B;  5HE1 A;  2KUP A;  2DYQ A;  2DKP A;  2NMB A;  2UZS A;  2P8V A;  5C16 A;  2DYN A;  1U5E A;  5EFX A;  3UZT A;  3KSY A;  1MIX A;  2ZPY A;  4IFS A;  1P6S A;  3GYO A;  4HAU B;  1FGZ A;  3SO6 A;  3VIA A;  1WGQ A;  3ODO A;  2W2X C;  1RRP B;  4HDO A;  3P7Z A;  2RNR B;  3ML4 A;  2EJ8 A;  1P3R A;  5C5B B;  2GCL A;  1FB8 A;  2DX1 A;  1WVH A;  2DA0 A;  3KY9 A;  4GXB A;  1UPR A;  5J3Q A;  2Y7B A;  4CHJ A;  2EC1 A;  1FGY A;  1B55 A;  2LYD A;  4GN1 A;  3PVW A;  1WG7 A;  3TCA A;  1N3H A;  3ODX A;  4KHA A;  1UNR A;  1RJ2 A;  1Z87 A;  1WGU A;  1TJ6 A;  2UZR A;  5DH9 B;  3CIK A;  2P0H A;  3BJI A;  2DHK A;  2X18 A;  1PMS A;  4BBK A;  4F7U P;  3HQC A;  2QKL A;  1P5T A;  2OQB A;  5CLL B;  1V5M A;  2AEH A;  3KRW A;  2YT0 A;  2ROV A;  5D3W A;  1EAZ A;  2D9Z A;  2YS3 A;  3BIN A;  1DBH A;  4HDQ A;  2DKQ A;  5DHA B;  1GG3 A;  1MKE A;  1XOD A;  2V76 A;  2GCJ A;  4KVG B;  1DDM A;  3SNH A;  1U27 A;  3FSS A;  4K2O A;  5D3X A;  2RUK B;  1XR0 B;  2MFQ A;  2NZ8 B;  3VOQ A;  1GC6 A;  3O96 A;  3QBV B;  1PLS A;  2Q13 A;  4ZRK A;  2COD A;  5D3V A;  2LOX A;  4EKU A;  2KCJ A;  5HE3 A;  1Q67 A;  4HB3 B;  3PSC A;  2M38 A;  2D9V A;  1MPH A;  1ISN A;  4GPT B;  3IVF A;  3TO1 A;  2I1J A;  2J59 M;  5C5B A;  3A98 B;  1I2H A;  2D2Q A;  1XX0 A;  4WSF A;  5JHH A;  4HAZ B;  1UNP A;  3WA0 A;  1FHX A;  1GC7 A;  3ZVR A;  4F7H A;  2D9X A;  1V5P A;  2HTH B;  2COC A;  4TYZ A;  2HE7 A;  2ELB A;  5J3T A;  2BCJ A;  2DN6 A;  3A8P A;  4XWX A;  1NTV A;  4GMX B;  4A5K A;  3DXC A;  3DXD A;  1Y5O A;  3CXB B;  1NTY A;  1QQG A;  4A6F B;  2RVB B;  1FAO A;  1WI1 A;  2J0M A;  2RSG A;  2RGN B;  4DBB A;  3SV1 A;  3ODW A;  1MIZ B;  2UVM A;  2Y8F A;  4D0N B;  4MY6 A;  1W1H A;  3KZ1 A;  5D27 A;  5JP4 A;  1J19 A;  1EVH A;  3PVL A;  1M7R A;  5LOP B;  1X05 A;  1BWN A;  2R09 A;  1H4R A;  2MKR A;  4GZU A;  3PVU A;  1DDW A;  3D8D A;  1U29 A;  1BAK A;  2K2J A;  2LUL A;  4NSW A;  1MK9 B;  2AL6 A;  3QIJ A;  1Y19 B;  4YON A;  5KCV A;  1WJ1 A;  4ZRI A;  1OMW A;  2DLW A;  2R0D A;  4HB2 B;  2CY5 A;  1MK7 B;  3PZD A;  1FOE A;  1UEF A;  3D8F A;  5HE0 A;  5FI0 A;  5J3Y A;  5KQ1 A;  4WJ7 A;  1UPQ A;  3AU4 A;  2GJY A;  1W1G A;  1U5D A;  1X86 A;  1FHO A;  3T06 A;  4Z2N A;  2CRF A;  2CAY A;  5C79 A;  1PFJ A;  3PG7 A;  2LG1 A;  5FI1 A;  4HAX B;  4K81 A;  4TKN A;  1DYN A;  2COA A;  4ZRJ A;  3HW2 B;  1K5D B;  1UNQ A;  2YSZ A;  1KZG A;  2LOZ A;  1NU2 A;  4A6F A;  2ADZ A;  1DRO A;  1LB1 A;  3PP2 A;  3MPX A;  4HHV A;  4CYE A;  2YS5 A;  1EGX A;  5CLQ B;  4PNK A;  3V5W A;  1ZC3 B;  1X1F A;  1M7E A;  3TW1 A;  3AU5 A;  4MK0 A;  1U5G A;  4L6E A;  2MDX A;  3QWM A;  4DX8 A;  4IOY X;  2DFK A;  4HAT B;  1W1D A;  2E2X A;  2YVC A;  2D10 A;  4KHB B;  1DDV A;  3P6A A;  5DI9 B;  5L81 A;  2H7D A;  4WVF B;  1TXD A;  1LW3 A;  2D9W A;  2H7E A;  2G35 A;  4HAY B;  2COF A;  2PZ1 A;  1FHW A;  2JP2 A;  2W2W A;  1E5W A;  2J0K A;  3M1I B;  2GS0 A;  1OY2 A;  2P0F A;  4F7G A;  2DHI A;  3D8E A;  3X23 A;  4K2P A;  1ZM0 A;  1SHC A;  3SYX A;  4EJN A;  3LJU X;  2Z0O A;  4PQ0 A;  2LKO A;  5JHG A;  4DXA B;  1V89 A;  4HB0 B;  4Z2M B;  3HK0 A;  5LON B;  4HAW B;  3GYP A;  1ZC4 B;  3NSU A;  1U5F A;  2N0Y A;  2VRW B;  3KRX A;  2VKI A;  5HE2 A;  4KHO A;  4IAP A;  2J0J A;  4K17 A;  4NY0 A;  2L2I A;  2D11 A;  5DIF B;  1BTN A;  5GOW B;  2YRY A;  4HAV B;  5C6R A;  1V5U A;  1MAI A;  1OQN A;  2EMT A;  5D3Y A;  2Z0P A;  1ZVR A;  3MDB C;  3ULB A;  1X11 A;  1J0W A;  4B6H A;  3AJ4 A;  2Z0Q A;  4P7I A;  4MT7 A; 
#chains in the Genus database with same CATH topology
 3U7D A;  1WJM A;  2I5F A;  4KHB A;  2IFS A;  4CHM A;  2MWN B;  4A6H A;  3FEH A;  2EMS A;  2K2U A;  1BTK A;  2OTX A;  1QC6 A;  3A8Q A;  3B77 A;  2I5C A;  4Y94 A;  1XKE A;  3RCP A;  2YT2 A;  4KAX B;  2DHJ A;  2Y8G A;  3PEG A;  3SUZ A;  2YF0 A;  2M14 A;  2N23 A;  2DX5 A;  2K00 A;  1V88 A;  1AWE A;  5I2S A;  2D9Y A;  1V61 A;  1NI2 A;  1I7A A;  3N7C A;  3WYF B;  5I2M A;  3NWF A;  4DX9 0;  5KQ4 A;  1AQC A;  2CY4 A;  2W2X D;  3F5R A;  1KZ7 A;  2DTC A;  1TQZ A;  1K5G B;  2YT1 A;  4GMV A;  2ELA A;  2FJL A;  3FM8 C;  2L1C A;  2I1K A;  4H8S A;  2ZKM X;  1MI1 A;  3ULC A;  2IYB A;  1ZSQ A;  2ROZ B;  3ZDT A;  3OAN A;  2VSZ A;  3DXE A;  3F0W A;  5LG4 B;  1SGH A;  4C0A A;  1H10 A;  3TFM A;  5DHF B;  4EMO A;  2P0D A;  2KR0 A;  2YS1 A;  3U8Z A;  2Z4D A;  2RLO A;  3NW8 A;  4HB4 B;  2XQN M;  1EF1 A;  2RRF A;  3G9W A;  2QKM A;  1XCG A;  1U2B A;  1X1G A;  1XD4 A;  2D4Q A;  2NBV A;  5JLJ B;  1KI1 B;  4A6K A;  1IRS A;  3TVV A;  4YL8 A;  2KGX B;  5HE1 A;  2KUP A;  2DYQ A;  2DKP A;  2NMB A;  2UZS A;  2P8V A;  5C16 A;  2DYN A;  1U5E A;  3OHM B;  5EFX A;  3UZT A;  3KSY A;  4D6W A;  1MIX A;  2ZPY A;  4IFS A;  1P6S A;  3GYO A;  4HAU B;  1FGZ A;  3SO6 A;  3VIA A;  1WGQ A;  3ODO A;  2W2X C;  1RRP B;  4HDO A;  3P7Z A;  2RNR B;  3ML4 A;  2EJ8 A;  1P3R A;  5C5B B;  2GCL A;  1FB8 A;  2DX1 A;  1WVH A;  2DA0 A;  3KY9 A;  4GXB A;  1UPR A;  5J3Q A;  2Y7B A;  4CHJ A;  2EC1 A;  1FGY A;  1B55 A;  2LYD A;  4GN1 A;  3PVW A;  2KUQ A;  1WG7 A;  3TCA A;  1N3H A;  3ODX A;  4KHA A;  1UNR A;  1RJ2 A;  1Z87 A;  1WGU A;  1TJ6 A;  2UZR A;  2KIE A;  5DH9 B;  3CIK A;  2P0H A;  3BJI A;  2DHK A;  2X18 A;  3HIE A;  1PMS A;  4BBK A;  4F7U P;  3HQC A;  2QKL A;  1P5T A;  2OQB A;  3DCX A;  5CLL B;  1V5M A;  4HSI A;  2AEH A;  3KRW A;  2YT0 A;  2ROV A;  5D3W A;  1EAZ A;  2D9Z A;  2YS3 A;  3BIN A;  1DBH A;  4HDQ A;  2DKQ A;  5DHA B;  1GG3 A;  1MKE A;  1XOD A;  2V76 A;  2GCJ A;  4KVG B;  1DDM A;  3SNH A;  1U27 A;  3FSS A;  4K2O A;  5D3X A;  2RUK B;  1XR0 B;  2MFQ A;  4L1R A;  2NZ8 B;  3VOQ A;  1GC6 A;  3O96 A;  3QBV B;  1PLS A;  2K49 A;  2Q13 A;  4ZRK A;  2COD A;  5D3V A;  2LOX A;  4EKU A;  2KCJ A;  5HE3 A;  1Q67 A;  4GOU A;  4HB3 B;  3PSC A;  2M38 A;  3HSA A;  2D9V A;  2Z14 A;  1MPH A;  1ISN A;  4GPT B;  3IVF A;  3TO1 A;  2I1J A;  2J59 M;  5C5B A;  3A98 B;  1I2H A;  2D2Q A;  1XX0 A;  4WSF A;  5JHH A;  4HAZ B;  1UNP A;  3WA0 A;  1FHX A;  1GC7 A;  3ZVR A;  4F7H A;  2D9X A;  1V5P A;  2HTH B;  2COC A;  4TYZ A;  2HE7 A;  2ELB A;  5J3T A;  2BCJ A;  1ZYI A;  2DN6 A;  4DIX A;  3A8P A;  4XWX A;  1NTV A;  4GMX B;  4A5K A;  3FVC A;  3DXC A;  3DXD A;  4QJ5 B;  1Y5O A;  3CXB B;  1NTY A;  1QQG A;  1T77 A;  4A6F B;  2RVB B;  2K8E A;  1FAO A;  1WI1 A;  2J0M A;  2RSG A;  3A58 A;  2RGN B;  4DBB A;  3SV1 A;  3ODW A;  1MIZ B;  2UVM A;  2Y8F A;  4D0N B;  4MY6 A;  1W1H A;  2FJU B;  3KZ1 A;  5D27 A;  5JP4 A;  1J19 A;  1EVH A;  3PVL A;  1M7R A;  5LOP B;  1X05 A;  1BWN A;  2Z59 A;  2R09 A;  1H4R A;  2MKR A;  4GZU A;  3PVU A;  1DDW A;  3D8D A;  1U29 A;  1BAK A;  4OSN A;  2K2J A;  2LUL A;  4NSW A;  1MK9 B;  2AL6 A;  3QIJ A;  1Y19 B;  2Z13 A;  4YON A;  5KCV A;  1WJ1 A;  4ZRI A;  1OMW A;  2DLW A;  2R0D A;  4HB2 B;  2CY5 A;  1MK7 B;  3PZD A;  1FOE A;  1UEF A;  3D8F A;  5HE0 A;  5FI0 A;  5J3Y A;  5KQ1 A;  4WJ7 A;  1UPQ A;  3AU4 A;  2GJY A;  1W1G A;  1U5D A;  4QJ4 B;  3NWD A;  1X86 A;  1FHO A;  3T06 A;  4Z2N A;  2CRF A;  2CAY A;  2GUM A;  1PFJ A;  5C79 A;  3PG7 A;  2LG1 A;  5FI1 A;  4HAX B;  4K81 A;  4TKN A;  1DYN A;  2COA A;  4ZRJ A;  3HW2 B;  1K5D B;  1UNQ A;  2YSZ A;  1KZG A;  2LOZ A;  1NU2 A;  4A6F A;  2ADZ A;  1DRO A;  1LB1 A;  3PP2 A;  3MPX A;  4HHV A;  4CYE A;  2YS5 A;  1EGX A;  5CLQ B;  4PNK A;  4QJ3 B;  3V5W A;  1ZC3 B;  5M4Y B;  1X1F A;  1M7E A;  3TW1 A;  3AU5 A;  4MK0 A;  1U5G A;  4L6E A;  2MDX A;  3QWM A;  4DX8 A;  4IOY X;  2DFK A;  4HAT B;  1W1D A;  2E2X A;  2YVC A;  2D10 A;  4KHB B;  1DDV A;  3P6A A;  5DI9 B;  5L81 A;  2H7D A;  4WVF B;  1TXD A;  1LW3 A;  2D9W A;  2H7E A;  2G35 A;  4HAY B;  2COF A;  3NWA A;  2PZ1 A;  1FHW A;  2JP2 A;  2W2W A;  1E5W A;  2J0K A;  3M1I B;  4GNK B;  2GS0 A;  1OY2 A;  4CSQ A;  2P0F A;  4F7G A;  2DHI A;  3D8E A;  3X23 A;  4K2P A;  1ZM0 A;  1SHC A;  3SYX A;  4EJN A;  3LJU X;  2Z0O A;  4PQ0 A;  2LKO A;  5IRS A;  5JHG A;  3U12 A;  4DXA B;  1V89 A;  4HB0 B;  2KIG A;  3HK0 A;  4Z2M B;  5LON B;  4HAW B;  4QXA B;  3GYP A;  1ZC4 B;  3NSU A;  1U5F A;  2N0Y A;  2VRW B;  3KRX A;  2VKI A;  5HE2 A;  4KHO A;  2R2Y A;  4IAP A;  2J0J A;  4K17 A;  4NY0 A;  2L2I A;  2D11 A;  5DIF B;  1BTN A;  5GOW B;  2YRY A;  4HAV B;  5C6R A;  1V5U A;  1MAI A;  1OQN A;  2EMT A;  5D3Y A;  2Z0P A;  1ZVR A;  3MDB C;  3ULB A;  1X11 A;  1J0W A;  4B6H A;  3AJ4 A;  2Z0Q A;  4OT1 A;  4P7I A;  4MT7 A; 
#chains in the Genus database with same CATH homology
 3U7D A;  1WJM A;  2I5F A;  2IFS A;  4CHM A;  2MWN B;  4A6H A;  3FEH A;  2EMS A;  2K2U A;  1BTK A;  2OTX A;  1QC6 A;  3A8Q A;  2I5C A;  4Y94 A;  1XKE A;  3RCP A;  4KAX B;  2DHJ A;  2Y8G A;  3PEG A;  3SUZ A;  2YF0 A;  2M14 A;  2N23 A;  2DX5 A;  2K00 A;  1V88 A;  1AWE A;  2D9Y A;  1V61 A;  1NI2 A;  1I7A A;  3N7C A;  3WYF B;  4DX9 0;  5KQ4 A;  1AQC A;  2CY4 A;  2W2X D;  3F5R A;  1KZ7 A;  2DTC A;  1TQZ A;  1K5G B;  2YT1 A;  4GMV A;  2ELA A;  2FJL A;  3FM8 C;  2L1C A;  2I1K A;  4H8S A;  3ULC A;  2IYB A;  1ZSQ A;  2ROZ B;  3ZDT A;  3OAN A;  2VSZ A;  3DXE A;  3F0W A;  1SGH A;  4C0A A;  1H10 A;  3TFM A;  5DHF B;  4EMO A;  2P0D A;  2YS1 A;  3U8Z A;  2RLO A;  4HB4 B;  2XQN M;  1EF1 A;  3G9W A;  2QKM A;  1XCG A;  1U2B A;  1X1G A;  1XD4 A;  2D4Q A;  5JLJ B;  1KI1 B;  4A6K A;  1IRS A;  3TVV A;  4YL8 A;  2KGX B;  5HE1 A;  2KUP A;  2DYQ A;  2DKP A;  2NMB A;  2UZS A;  2P8V A;  5C16 A;  2DYN A;  1U5E A;  5EFX A;  3UZT A;  3KSY A;  1MIX A;  2ZPY A;  4IFS A;  1P6S A;  3GYO A;  4HAU B;  1FGZ A;  3SO6 A;  3VIA A;  1WGQ A;  3ODO A;  2W2X C;  1RRP B;  4HDO A;  3P7Z A;  2RNR B;  3ML4 A;  2EJ8 A;  1P3R A;  5C5B B;  2GCL A;  1FB8 A;  2DX1 A;  1WVH A;  2DA0 A;  3KY9 A;  4GXB A;  1UPR A;  5J3Q A;  2Y7B A;  4CHJ A;  2EC1 A;  1FGY A;  1B55 A;  2LYD A;  4GN1 A;  3PVW A;  1WG7 A;  3TCA A;  1N3H A;  3ODX A;  4KHA A;  1UNR A;  1RJ2 A;  1Z87 A;  1WGU A;  1TJ6 A;  2UZR A;  5DH9 B;  3CIK A;  2P0H A;  3BJI A;  2DHK A;  2X18 A;  1PMS A;  4BBK A;  4F7U P;  3HQC A;  2QKL A;  1P5T A;  2OQB A;  5CLL B;  1V5M A;  2AEH A;  3KRW A;  2YT0 A;  2ROV A;  5D3W A;  1EAZ A;  2D9Z A;  2YS3 A;  3BIN A;  1DBH A;  4HDQ A;  2DKQ A;  5DHA B;  1GG3 A;  1MKE A;  1XOD A;  2V76 A;  2GCJ A;  4KVG B;  1DDM A;  3SNH A;  1U27 A;  3FSS A;  4K2O A;  5D3X A;  2RUK B;  1XR0 B;  2MFQ A;  2NZ8 B;  3VOQ A;  1GC6 A;  3O96 A;  3QBV B;  1PLS A;  2Q13 A;  4ZRK A;  2COD A;  5D3V A;  2LOX A;  4EKU A;  2KCJ A;  5HE3 A;  1Q67 A;  4HB3 B;  3PSC A;  2M38 A;  2D9V A;  1MPH A;  1ISN A;  4GPT B;  3IVF A;  3TO1 A;  2I1J A;  2J59 M;  5C5B A;  3A98 B;  1I2H A;  2D2Q A;  1XX0 A;  4WSF A;  5JHH A;  4HAZ B;  1UNP A;  3WA0 A;  1FHX A;  1GC7 A;  3ZVR A;  4F7H A;  2D9X A;  1V5P A;  2HTH B;  2COC A;  4TYZ A;  2HE7 A;  2ELB A;  5J3T A;  2BCJ A;  2DN6 A;  3A8P A;  4XWX A;  1NTV A;  4GMX B;  4A5K A;  3DXC A;  3DXD A;  1Y5O A;  3CXB B;  1NTY A;  1QQG A;  4A6F B;  2RVB B;  1FAO A;  1WI1 A;  2J0M A;  2RSG A;  2RGN B;  4DBB A;  3SV1 A;  3ODW A;  1MIZ B;  2UVM A;  2Y8F A;  4D0N B;  4MY6 A;  1W1H A;  3KZ1 A;  5D27 A;  5JP4 A;  1J19 A;  1EVH A;  3PVL A;  1M7R A;  5LOP B;  1X05 A;  1BWN A;  2R09 A;  1H4R A;  2MKR A;  4GZU A;  3PVU A;  1DDW A;  3D8D A;  1U29 A;  1BAK A;  2K2J A;  2LUL A;  4NSW A;  1MK9 B;  2AL6 A;  3QIJ A;  1Y19 B;  4YON A;  5KCV A;  1WJ1 A;  4ZRI A;  1OMW A;  2DLW A;  2R0D A;  4HB2 B;  2CY5 A;  1MK7 B;  3PZD A;  1FOE A;  1UEF A;  3D8F A;  5HE0 A;  5FI0 A;  5J3Y A;  5KQ1 A;  4WJ7 A;  1UPQ A;  3AU4 A;  2GJY A;  1W1G A;  1U5D A;  1X86 A;  1FHO A;  3T06 A;  4Z2N A;  2CRF A;  2CAY A;  5C79 A;  1PFJ A;  3PG7 A;  2LG1 A;  5FI1 A;  4HAX B;  4K81 A;  4TKN A;  1DYN A;  2COA A;  4ZRJ A;  3HW2 B;  1K5D B;  1UNQ A;  2YSZ A;  1KZG A;  2LOZ A;  1NU2 A;  4A6F A;  2ADZ A;  1DRO A;  1LB1 A;  3PP2 A;  3MPX A;  4HHV A;  4CYE A;  2YS5 A;  1EGX A;  5CLQ B;  4PNK A;  3V5W A;  1ZC3 B;  1X1F A;  1M7E A;  3TW1 A;  3AU5 A;  4MK0 A;  1U5G A;  4L6E A;  2MDX A;  3QWM A;  4DX8 A;  4IOY X;  2DFK A;  4HAT B;  1W1D A;  2E2X A;  2YVC A;  2D10 A;  4KHB B;  1DDV A;  3P6A A;  5DI9 B;  5L81 A;  2H7D A;  4WVF B;  1TXD A;  1LW3 A;  2D9W A;  2H7E A;  2G35 A;  4HAY B;  2COF A;  2PZ1 A;  1FHW A;  2JP2 A;  2W2W A;  1E5W A;  2J0K A;  3M1I B;  2GS0 A;  1OY2 A;  2P0F A;  4F7G A;  2DHI A;  3D8E A;  3X23 A;  4K2P A;  1ZM0 A;  1SHC A;  3SYX A;  4EJN A;  3LJU X;  2Z0O A;  4PQ0 A;  2LKO A;  5JHG A;  4DXA B;  1V89 A;  4HB0 B;  4Z2M B;  3HK0 A;  5LON B;  4HAW B;  3GYP A;  1ZC4 B;  3NSU A;  1U5F A;  2N0Y A;  2VRW B;  3KRX A;  2VKI A;  5HE2 A;  4KHO A;  4IAP A;  2J0J A;  4K17 A;  4NY0 A;  2L2I A;  2D11 A;  5DIF B;  1BTN A;  5GOW B;  2YRY A;  4HAV B;  5C6R A;  1V5U A;  1MAI A;  1OQN A;  2EMT A;  5D3Y A;  2Z0P A;  1ZVR A;  3MDB C;  3ULB A;  1X11 A;  1J0W A;  4B6H A;  3AJ4 A;  2Z0Q A;  4P7I A;  4MT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...