2Y7BA

Crystal structure of the ph domain of human actin-binding protein anillin anln
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
134
structure length
134
Chain Sequence
VNSSVEERGFLTIFEDVSGFGAWHRRWCVLSGNCISYWTYPDDEKRKNPIGRINLANCTSRQIEPANREFCARRNTFELITVRPQREDDRETLVSQCRDTLCVTKNWLSADTKEERDLWMQKLNQVLVDIRLWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords ACTIN-BINDING PROTEIN ANILLIN
publication title Crystal Structure of the Ph Domain of Human Actin-Binding Protein Anillin Anln
rcsb
source organism Homo sapiens
total genus 33
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2011-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2y7bA00
3ZDTA 2N23A 1UPQA 4HB4B 1DDMA 2UZSA 2DKPA 1QQGA 2Z0PA 1SGHA 2CY5A 1B55A 1U5DA 3SUZA 4EKUA 3NSUA 3WYFB 1M7RA 1ZM0A 4A6KA 2R09A 4DBBA 4ZRIA 3VIAA 1XR0B 1MK7B 2ELBA 5LONB 2LULA 3DXDA 1NTVA 4A6HA 5HE1A 2P0DA 4KHBB 5HE2A 2D9ZA 3PZDA 3TCAA 4HB0B 4HB2B 5D27A 1V61A 3BINA 4Y94A 2AEHA 2RSGA 4CHMA 2HTHB 3PEGA 4HAXB 1FAOA 1EAZA 1BWNA 1IRSA 1ZC4B 1NU2A 4A6FA 1Z87A 4WSFA 1H4RA 1SHCA 1V5UA 1P5TA 2K2JA 1RJ2A 1EVHA 1P6SA 2H7DA 2VSZA 5FI0A 2XQNM 3CXBB 3V5WA 4HHVA 3SYXA 1FGZA 2W2XD 2W2WA 1KZ7A 2D4QA 2MKRA 5C79A 1OMWA 4MY6A 1WJ1A 1FHWA 2NMBA 4ZRKA 3VOQA 3KRXA 3O96A 2COFA 4TYZA 3AU5A 1ISNA 2DKQA 1X1GA 2VRWB 1FHOA 2P0HA 2Z0OA 5KQ4A 2MDXA 1Q67A 5GOWB 2Y8FA 2COCA 2LOXA 4KHAA 3A8QA 5DHAB 2GCJA 4DX8A 4IOYX 3PVLA 1XODA 3PVWA 1ZC3B 2KUPA 1XCGA 3U8ZA 4EJNA 2N0YA 3HQCA 2J0JA 1W1HA 2FJLA 2QKLA 2YT1A 3DXEA 5J3QA 5D3WA 4HDQA 2DHJA 3D8EA 2BCJA 4IAPA 2L1CA 3P6AA 2IFSA 3WA0A 2D9VA 3AU4A 1I7AA 1ZSQA 4BBKA 4C0AA 3TVVA 2RUKB 1NI2A 4IFSA 4A5KA 4K81A 1X05A 5JHGA 2DLWA 1MAIA 2I1KA 5FI1A 2CAYA 2AL6A 1X86A 4GXBA 1XKEA 3LJUX 1LB1A 3N7CA 3SV1A 2P8VA 2YS1A 1P3RA 3U7DA 5C5BA 1GG3A 2EMTA 1RRPB 4P7IA 3AJ4A 2K00A 1NTYA 4KHOA 2D9XA 2JP2A 3ULCA 3ML4A 5C5BB 2CODA 4Z2MB 2D9WA 3PSCA 2RNRB 3TFMA 5D3VA 3SO6A 3HK0A 1XX0A 3X23A 4L6EA 1MIZB 3F5RA 1WGUA 3CIKA 4GN1A 2EC1A 1UPRA 3ODWA 4F7HA 2M38A 1UNPA 2GS0A 4DXAB 3PVUA 1X1FA 3ULBA 4B6HA 4A6FB 1PFJA 2UZRA 1Y5OA 1DROA 3ODOA 3MPXA 1WI1A 1WJMA 5LOPB 3P7ZA 5KQ1A 3ODXA 1K5DB 2DX1A 2D9YA 3ZVRA 4D0NB 3IVFA 2GJYA 2DA0A 5KCVA 1BTKA 4XWXA 1AWEA 2EJ8A 3FM8C 2YF0A 4KVGB 3PG7A 2LOZA 2DYQA 3KZ1A 4NY0A 1MPHA 1X11A 1TQZA 2H7EA 1XD4A 4K2PA 2ROVA 2DN6A 2Y8GA 1W1DA 5D3YA 2ADZA 2YT0A 5DHFB 2ROZB 1U29A 3GYOA 4GMXB 4MT7A 3PP2A 1U5EA 4H8SA 1FB8A 1J0WA 2J0MA 5C16A 4HATB 2X18A 4HAUB 3QBVB 1N3HA 3A98B 4HDOA 4YL8A 1GC6A 2DTCA 5JHHA 2E2XA 1M7EA 3KY9A 5JP4A 2OTXA 2EMSA 3FSSA 3UZTA 4EMOA 4MK0A 4ZRJA 2PZ1A 2RLOA 2YVCA 1U27A 1OY2A 2D2QA 2Y7BA 3SNHA 4KAXB 3QWMA 5J3YA 2K2UA 4HAWB 4WJ7A 1DYNA 1MIXA 2CY4A 3OANA 2CRFA 4HB3B 5HE3A 1FOEA 3F0WA 4NSWA 2DYNA 2I1JA 1ZVRA 3QIJA 5DIFB 1UEFA 2NZ8B 1WVHA 1WG7A 3MDBC 1Y19B 4HAVB 1OQNA 4CHJA 2DHKA 5J3TA 3D8DA 5DI9B 2V76A 1V5MA 2L2IA 1BAKA 5DH9B 1KZGA 5CLLB 5CLQB 2UVMA 2VKIA 2KCJA 2Z0QA 4F7GA 1GC7A 2RVBB 4GMVA 1WGQA 2IYBA 2W2XC 3FEHA 4K2OA 3KRWA 4GPTB 1U5FA 1MK9B 2MFQA 3HW2B 1EF1A 1UNRA 2LG1A 1PMSA 1KI1B 3G9WA 2Q13A 1DDVA 1E5WA 3BJIA 2HE7A 3D8FA 1LW3A 5C6RA 2P0FA 2R0DA 4K17A 2LYDA 2MWNB 2YRYA 1W1GA 1UNQA 2ZPYA 1V88A 2ELAA 2D11A 1J19A 1I2HA 2GCLA 5HE0A 1TJ6A 1V89A 3T06A 1MKEA 3RCPA 1QC6A 3TO1A 1BTNA 3TW1A 1V5PA 2COAA 4HAZB 5L81A 5EFXA 2QKMA 2DFKA 1AQCA 3KSYA 2J59M 4F7UP 1DBHA 2OQBA 3GYPA 1U2BA 1PLSA 1H10A 3M1IB 2YSZA 4GZUA 1K5GB 2J0KA 1FGYA 2I5FA 2RGNB 4CYEA 1U5GA 1EGXA 4Z2NA 5JLJB 3A8PA 2M14A 4YONA 2LKOA 2G35A 2YS5A 5D3XA 4PNKA 2D10A 4HAYB 2DX5A 1TXDA 2KGXB 4PQ0A 2YS3A 4WVFB 1FHXA 4DX90 4TKNA 2DHIA 2I5CA 1DDWA 3DXCA
chains in the Genus database with same CATH superfamily
3ZDTA 2N23A 1UPQA 4HB4B 1DDMA 2UZSA 2DKPA 1QQGA 2Z0PA 1SGHA 2CY5A 1B55A 1U5DA 3SUZA 4EKUA 3NSUA 4L1RA 5I2SA 3WYFB 1M7RA 1ZM0A 4A6KA 2R09A 4DBBA 4KHBA 4ZRIA 3VIAA 1XR0B 1MK7B 2ELBA 5LONB 2LULA 3DXDA 4OSNA 1NTVA 4A6HA 5HE1A 2P0DA 4KHBB 5HE2A 2D9ZA 3PZDA 3TCAA 4HB0B 4HB2B 5D27A 1V61A 3BINA 4Y94A 2AEHA 2RSGA 4CHMA 2HTHB 3PEGA 4HAXB 1FAOA 1EAZA 4GNKB 1BWNA 1IRSA 1ZC4B 2KIGA 1NU2A 4A6FA 1Z87A 4WSFA 1H4RA 1SHCA 1V5UA 1P5TA 5M4YB 2K2JA 1RJ2A 1EVHA 1P6SA 2H7DA 2VSZA 5FI0A 2XQNM 3CXBB 3V5WA 1ZYIA 4HHVA 3SYXA 1FGZA 2K49A 2Z4DA 2W2XD 4QJ4B 2W2WA 1KZ7A 2D4QA 2MKRA 5C79A 1OMWA 4MY6A 1WJ1A 1FHWA 2NMBA 4ZRKA 3VOQA 3KRXA 3O96A 2COFA 4TYZA 3AU5A 1ISNA 2DKQA 3NW8A 1X1GA 3U12A 2VRWB 1FHOA 2P0HA 2ZKMX 2Z0OA 5KQ4A 2MDXA 1Q67A 5GOWB 2Y8FA 2COCA 2LOXA 4KHAA 3A8QA 5DHAB 2GCJA 3B77A 4DX8A 4QXAB 4IOYX 3PVLA 1XODA 3PVWA 1ZC3B 2KUPA 1XCGA 3U8ZA 4EJNA 2N0YA 3HQCA 2J0JA 1W1HA 2FJLA 2QKLA 2YT1A 3DXEA 2RRFA 5J3QA 3NWAA 5D3WA 4HDQA 2DHJA 3D8EA 2BCJA 4IAPA 2L1CA 3P6AA 2IFSA 3WA0A 4OT1A 2D9VA 3AU4A 1I7AA 3DCXA 2FJUB 1ZSQA 4BBKA 4GOUA 4C0AA 3TVVA 2RUKB 1NI2A 4IFSA 4A5KA 4K81A 1X05A 5JHGA 2DLWA 1MAIA 2I1KA 5FI1A 2CAYA 2AL6A 1X86A 4GXBA 1XKEA 3LJUX 1LB1A 3N7CA 3SV1A 2P8VA 2YS1A 1P3RA 3NWFA 3U7DA 5C5BA 1GG3A 2EMTA 1RRPB 4P7IA 3AJ4A 2K00A 1NTYA 4KHOA 2D9XA 2JP2A 3ULCA 3ML4A 5C5BB 2CODA 4Z2MB 2D9WA 2KUQA 3PSCA 2RNRB 4D6WA 3TFMA 5D3VA 3SO6A 3FVCA 5IRSA 3HK0A 1XX0A 3X23A 4L6EA 1MIZB 3F5RA 1WGUA 2NBVA 2YT2A 3CIKA 4GN1A 2EC1A 1UPRA 3ODWA 4F7HA 2M38A 3NWDA 1UNPA 2GS0A 4DXAB 3PVUA 1X1FA 3ULBA 4B6HA 4A6FB 1PFJA 2UZRA 1Y5OA 1DROA 3ODOA 3MPXA 1WI1A 1WJMA 5LOPB 3P7ZA 5KQ1A 3ODXA 1K5DB 2DX1A 2D9YA 3ZVRA 4D0NB 3IVFA 2GJYA 2DA0A 3OHMB 5KCVA 1BTKA 4XWXA 1AWEA 2EJ8A 3FM8C 2YF0A 4KVGB 3PG7A 2LOZA 2DYQA 3KZ1A 4NY0A 1MPHA 1X11A 1TQZA 2H7EA 1XD4A 4K2PA 2ROVA 2DN6A 2Y8GA 1W1DA 5D3YA 2ADZA 2YT0A 5DHFB 2ROZB 3HIEA 1U29A 3GYOA 4GMXB 4MT7A 1T77A 3PP2A 2Z13A 1U5EA 4H8SA 1FB8A 1J0WA 2J0MA 5C16A 4HATB 2X18A 4HAUB 3HSAA 3QBVB 1N3HA 3A98B 3A58A 4HDOA 4YL8A 1GC6A 2DTCA 5JHHA 2E2XA 4CSQA 1M7EA 3KY9A 5JP4A 2OTXA 2EMSA 3FSSA 2KR0A 3UZTA 4EMOA 4MK0A 4ZRJA 2PZ1A 2RLOA 2YVCA 2Z14A 1U27A 1OY2A 2D2QA 2Y7BA 3SNHA 4KAXB 3QWMA 5J3YA 5LG4B 2K2UA 4HAWB 4WJ7A 1DYNA 1MIXA 2CY4A 3OANA 2CRFA 4HB3B 5HE3A 1FOEA 3F0WA 4NSWA 4HSIA 2DYNA 2I1JA 1ZVRA 3QIJA 5DIFB 1UEFA 2NZ8B 1MI1A 1WVHA 1WG7A 3MDBC 1Y19B 4HAVB 1OQNA 4CHJA 2DHKA 5J3TA 3D8DA 5DI9B 2V76A 1V5MA 2L2IA 1BAKA 2R2YA 5DH9B 1KZGA 5CLLB 5CLQB 2UVMA 2VKIA 2KCJA 2Z0QA 4F7GA 2KIEA 1GC7A 2RVBB 4GMVA 1WGQA 2IYBA 2W2XC 3FEHA 4K2OA 3KRWA 4GPTB 1MK9B 1U5FA 2MFQA 3HW2B 1EF1A 1UNRA 2LG1A 1PMSA 1KI1B 3G9WA 2Q13A 1DDVA 1E5WA 4QJ5B 3BJIA 2HE7A 3D8FA 1LW3A 5C6RA 2P0FA 2R0DA 4K17A 2LYDA 2MWNB 2YRYA 1W1GA 1UNQA 2ZPYA 1V88A 2ELAA 2D11A 1J19A 1I2HA 2GCLA 4QJ3B 5HE0A 5I2MA 1TJ6A 1V89A 2Z59A 3T06A 1MKEA 3RCPA 1QC6A 3TO1A 1BTNA 3TW1A 1V5PA 2COAA 4HAZB 5L81A 5EFXA 2QKMA 2DFKA 1AQCA 3KSYA 2J59M 4F7UP 1DBHA 2OQBA 3GYPA 1U2BA 1PLSA 1H10A 3M1IB 2YSZA 4GZUA 1K5GB 2J0KA 1FGYA 2I5FA 2RGNB 4CYEA 1U5GA 1EGXA 4Z2NA 5JLJB 3A8PA 2M14A 4YONA 2LKOA 2G35A 2YS5A 5D3XA 4PNKA 2D10A 4HAYB 2DX5A 1TXDA 2KGXB 4PQ0A 2YS3A 4WVFB 4DIXA 2K8EA 1FHXA 4DX90 4TKNA 2GUMA 2DHIA 2I5CA 1DDWA 3DXCA
chains in the Genus database with same CATH topology
3ZDTA 2N23A 1UPQA 4HB4B 1DDMA 2UZSA 2DKPA 1QQGA 2Z0PA 1SGHA 2CY5A 1B55A 1U5DA 3SUZA 4EKUA 3NSUA 3WYFB 1M7RA 1ZM0A 4A6KA 2R09A 4DBBA 4ZRIA 3VIAA 1XR0B 1MK7B 2ELBA 5LONB 2LULA 3DXDA 1NTVA 4A6HA 5HE1A 2P0DA 4KHBB 5HE2A 2D9ZA 3PZDA 3TCAA 4HB0B 4HB2B 5D27A 1V61A 3BINA 4Y94A 2AEHA 2RSGA 4CHMA 2HTHB 3PEGA 4HAXB 1FAOA 1EAZA 1BWNA 1IRSA 1ZC4B 1NU2A 4A6FA 1Z87A 4WSFA 1H4RA 1SHCA 1V5UA 1P5TA 2K2JA 1RJ2A 1EVHA 1P6SA 2H7DA 2VSZA 5FI0A 2XQNM 3CXBB 3V5WA 4HHVA 3SYXA 1FGZA 2W2XD 2W2WA 1KZ7A 2D4QA 2MKRA 5C79A 1OMWA 4MY6A 1WJ1A 1FHWA 2NMBA 4ZRKA 3VOQA 3KRXA 3O96A 2COFA 4TYZA 3AU5A 1ISNA 2DKQA 1X1GA 2VRWB 1FHOA 2P0HA 2Z0OA 5KQ4A 2MDXA 1Q67A 5GOWB 2Y8FA 2COCA 2LOXA 4KHAA 3A8QA 5DHAB 2GCJA 4DX8A 4IOYX 3PVLA 1XODA 3PVWA 1ZC3B 2KUPA 1XCGA 3U8ZA 4EJNA 2N0YA 3HQCA 2J0JA 1W1HA 2FJLA 2QKLA 2YT1A 3DXEA 5J3QA 5D3WA 4HDQA 2DHJA 3D8EA 2BCJA 4IAPA 2L1CA 3P6AA 2IFSA 3WA0A 2D9VA 3AU4A 1I7AA 1ZSQA 4BBKA 4C0AA 3TVVA 2RUKB 1NI2A 4IFSA 4A5KA 4K81A 1X05A 5JHGA 2DLWA 1MAIA 2I1KA 5FI1A 2CAYA 2AL6A 1X86A 4GXBA 1XKEA 3LJUX 1LB1A 3N7CA 3SV1A 2P8VA 2YS1A 1P3RA 3U7DA 5C5BA 1GG3A 2EMTA 1RRPB 4P7IA 3AJ4A 2K00A 1NTYA 4KHOA 2D9XA 2JP2A 3ULCA 3ML4A 5C5BB 2CODA 4Z2MB 2D9WA 3PSCA 2RNRB 3TFMA 5D3VA 3SO6A 3HK0A 1XX0A 3X23A 4L6EA 1MIZB 3F5RA 1WGUA 3CIKA 4GN1A 2EC1A 1UPRA 3ODWA 4F7HA 2M38A 1UNPA 2GS0A 4DXAB 3PVUA 1X1FA 3ULBA 4B6HA 4A6FB 1PFJA 2UZRA 1Y5OA 1DROA 3ODOA 3MPXA 1WI1A 1WJMA 5LOPB 3P7ZA 5KQ1A 3ODXA 1K5DB 2DX1A 2D9YA 3ZVRA 4D0NB 3IVFA 2GJYA 2DA0A 5KCVA 1BTKA 4XWXA 1AWEA 2EJ8A 3FM8C 2YF0A 4KVGB 3PG7A 2LOZA 2DYQA 3KZ1A 4NY0A 1MPHA 1X11A 1TQZA 2H7EA 1XD4A 4K2PA 2ROVA 2DN6A 2Y8GA 1W1DA 5D3YA 2ADZA 2YT0A 5DHFB 2ROZB 1U29A 3GYOA 4GMXB 4MT7A 3PP2A 1U5EA 4H8SA 1FB8A 1J0WA 2J0MA 5C16A 4HATB 2X18A 4HAUB 3QBVB 1N3HA 3A98B 4HDOA 4YL8A 1GC6A 2DTCA 5JHHA 2E2XA 1M7EA 3KY9A 5JP4A 2OTXA 2EMSA 3FSSA 3UZTA 4EMOA 4MK0A 4ZRJA 2PZ1A 2RLOA 2YVCA 1U27A 1OY2A 2D2QA 2Y7BA 3SNHA 4KAXB 3QWMA 5J3YA 2K2UA 4HAWB 4WJ7A 1DYNA 1MIXA 2CY4A 3OANA 2CRFA 4HB3B 5HE3A 1FOEA 3F0WA 4NSWA 2DYNA 2I1JA 1ZVRA 3QIJA 5DIFB 1UEFA 2NZ8B 1WVHA 1WG7A 3MDBC 1Y19B 4HAVB 1OQNA 4CHJA 2DHKA 5J3TA 3D8DA 5DI9B 2V76A 1V5MA 2L2IA 1BAKA 5DH9B 1KZGA 5CLLB 5CLQB 2UVMA 2VKIA 2KCJA 2Z0QA 4F7GA 1GC7A 2RVBB 4GMVA 1WGQA 2IYBA 2W2XC 3FEHA 4K2OA 3KRWA 4GPTB 1U5FA 1MK9B 2MFQA 3HW2B 1EF1A 1UNRA 2LG1A 1PMSA 1KI1B 3G9WA 2Q13A 1DDVA 1E5WA 3BJIA 2HE7A 3D8FA 1LW3A 5C6RA 2P0FA 2R0DA 4K17A 2LYDA 2MWNB 2YRYA 1W1GA 1UNQA 2ZPYA 1V88A 2ELAA 2D11A 1J19A 1I2HA 2GCLA 5HE0A 1TJ6A 1V89A 3T06A 1MKEA 3RCPA 1QC6A 3TO1A 1BTNA 3TW1A 1V5PA 2COAA 4HAZB 5L81A 5EFXA 2QKMA 2DFKA 1AQCA 3KSYA 2J59M 4F7UP 1DBHA 2OQBA 3GYPA 1U2BA 1PLSA 1H10A 3M1IB 2YSZA 4GZUA 1K5GB 2J0KA 1FGYA 2I5FA 2RGNB 4CYEA 1U5GA 1EGXA 4Z2NA 5JLJB 3A8PA 2M14A 4YONA 2LKOA 2G35A 2YS5A 5D3XA 4PNKA 2D10A 4HAYB 2DX5A 1TXDA 2KGXB 4PQ0A 2YS3A 4WVFB 1FHXA 4DX90 4TKNA 2DHIA 2I5CA 1DDWA 3DXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZDT A;  2N23 A;  1UPQ A;  4HB4 B;  1DDM A;  2UZS A;  2DKP A;  1QQG A;  2Z0P A;  1SGH A;  2CY5 A;  1B55 A;  1U5D A;  3SUZ A;  4EKU A;  3NSU A;  3WYF B;  1M7R A;  1ZM0 A;  4A6K A;  2R09 A;  4DBB A;  4ZRI A;  3VIA A;  1XR0 B;  1MK7 B;  2ELB A;  5LON B;  2LUL A;  3DXD A;  1NTV A;  4A6H A;  5HE1 A;  2P0D A;  4KHB B;  5HE2 A;  2D9Z A;  3PZD A;  3TCA A;  4HB0 B;  4HB2 B;  5D27 A;  1V61 A;  3BIN A;  4Y94 A;  2AEH A;  2RSG A;  4CHM A;  2HTH B;  3PEG A;  4HAX B;  1FAO A;  1EAZ A;  1BWN A;  1IRS A;  1ZC4 B;  1NU2 A;  4A6F A;  1Z87 A;  4WSF A;  1H4R A;  1SHC A;  1V5U A;  1P5T A;  2K2J A;  1RJ2 A;  1EVH A;  1P6S A;  2H7D A;  2VSZ A;  5FI0 A;  2XQN M;  3CXB B;  3V5W A;  4HHV A;  3SYX A;  1FGZ A;  2W2X D;  2W2W A;  1KZ7 A;  2D4Q A;  2MKR A;  5C79 A;  1OMW A;  4MY6 A;  1WJ1 A;  1FHW A;  2NMB A;  4ZRK A;  3VOQ A;  3KRX A;  3O96 A;  2COF A;  4TYZ A;  3AU5 A;  1ISN A;  2DKQ A;  1X1G A;  2VRW B;  1FHO A;  2P0H A;  2Z0O A;  5KQ4 A;  2MDX A;  1Q67 A;  5GOW B;  2Y8F A;  2COC A;  2LOX A;  4KHA A;  3A8Q A;  5DHA B;  2GCJ A;  4DX8 A;  4IOY X;  3PVL A;  1XOD A;  3PVW A;  1ZC3 B;  2KUP A;  1XCG A;  3U8Z A;  4EJN A;  2N0Y A;  3HQC A;  2J0J A;  1W1H A;  2FJL A;  2QKL A;  2YT1 A;  3DXE A;  5J3Q A;  5D3W A;  4HDQ A;  2DHJ A;  3D8E A;  2BCJ A;  4IAP A;  2L1C A;  3P6A A;  2IFS A;  3WA0 A;  2D9V A;  3AU4 A;  1I7A A;  1ZSQ A;  4BBK A;  4C0A A;  3TVV A;  2RUK B;  1NI2 A;  4IFS A;  4A5K A;  4K81 A;  1X05 A;  5JHG A;  2DLW A;  1MAI A;  2I1K A;  5FI1 A;  2CAY A;  2AL6 A;  1X86 A;  4GXB A;  1XKE A;  3LJU X;  1LB1 A;  3N7C A;  3SV1 A;  2P8V A;  2YS1 A;  1P3R A;  3U7D A;  5C5B A;  1GG3 A;  2EMT A;  1RRP B;  4P7I A;  3AJ4 A;  2K00 A;  1NTY A;  4KHO A;  2D9X A;  2JP2 A;  3ULC A;  3ML4 A;  5C5B B;  2COD A;  4Z2M B;  2D9W A;  3PSC A;  2RNR B;  3TFM A;  5D3V A;  3SO6 A;  3HK0 A;  1XX0 A;  3X23 A;  4L6E A;  1MIZ B;  3F5R A;  1WGU A;  3CIK A;  4GN1 A;  2EC1 A;  1UPR A;  3ODW A;  4F7H A;  2M38 A;  1UNP A;  2GS0 A;  4DXA B;  3PVU A;  1X1F A;  3ULB A;  4B6H A;  4A6F B;  1PFJ A;  2UZR A;  1Y5O A;  1DRO A;  3ODO A;  3MPX A;  1WI1 A;  1WJM A;  5LOP B;  3P7Z A;  5KQ1 A;  3ODX A;  1K5D B;  2DX1 A;  2D9Y A;  3ZVR A;  4D0N B;  3IVF A;  2GJY A;  2DA0 A;  5KCV A;  1BTK A;  4XWX A;  1AWE A;  2EJ8 A;  3FM8 C;  2YF0 A;  4KVG B;  3PG7 A;  2LOZ A;  2DYQ A;  3KZ1 A;  4NY0 A;  1MPH A;  1X11 A;  1TQZ A;  2H7E A;  1XD4 A;  4K2P A;  2ROV A;  2DN6 A;  2Y8G A;  1W1D A;  5D3Y A;  2ADZ A;  2YT0 A;  5DHF B;  2ROZ B;  1U29 A;  3GYO A;  4GMX B;  4MT7 A;  3PP2 A;  1U5E A;  4H8S A;  1FB8 A;  1J0W A;  2J0M A;  5C16 A;  4HAT B;  2X18 A;  4HAU B;  3QBV B;  1N3H A;  3A98 B;  4HDO A;  4YL8 A;  1GC6 A;  2DTC A;  5JHH A;  2E2X A;  1M7E A;  3KY9 A;  5JP4 A;  2OTX A;  2EMS A;  3FSS A;  3UZT A;  4EMO A;  4MK0 A;  4ZRJ A;  2PZ1 A;  2RLO A;  2YVC A;  1U27 A;  1OY2 A;  2D2Q A;  2Y7B A;  3SNH A;  4KAX B;  3QWM A;  5J3Y A;  2K2U A;  4HAW B;  4WJ7 A;  1DYN A;  1MIX A;  2CY4 A;  3OAN A;  2CRF A;  4HB3 B;  5HE3 A;  1FOE A;  3F0W A;  4NSW A;  2DYN A;  2I1J A;  1ZVR A;  3QIJ A;  5DIF B;  1UEF A;  2NZ8 B;  1WVH A;  1WG7 A;  3MDB C;  1Y19 B;  4HAV B;  1OQN A;  4CHJ A;  2DHK A;  5J3T A;  3D8D A;  5DI9 B;  2V76 A;  1V5M A;  2L2I A;  1BAK A;  5DH9 B;  1KZG A;  5CLL B;  5CLQ B;  2UVM A;  2VKI A;  2KCJ A;  2Z0Q A;  4F7G A;  1GC7 A;  2RVB B;  4GMV A;  1WGQ A;  2IYB A;  2W2X C;  3FEH A;  4K2O A;  3KRW A;  4GPT B;  1U5F A;  1MK9 B;  2MFQ A;  3HW2 B;  1EF1 A;  1UNR A;  2LG1 A;  1PMS A;  1KI1 B;  3G9W A;  2Q13 A;  1DDV A;  1E5W A;  3BJI A;  2HE7 A;  3D8F A;  1LW3 A;  5C6R A;  2P0F A;  2R0D A;  4K17 A;  2LYD A;  2MWN B;  2YRY A;  1W1G A;  1UNQ A;  2ZPY A;  1V88 A;  2ELA A;  2D11 A;  1J19 A;  1I2H A;  2GCL A;  5HE0 A;  1TJ6 A;  1V89 A;  3T06 A;  1MKE A;  3RCP A;  1QC6 A;  3TO1 A;  1BTN A;  3TW1 A;  1V5P A;  2COA A;  4HAZ B;  5L81 A;  5EFX A;  2QKM A;  2DFK A;  1AQC A;  3KSY A;  2J59 M;  4F7U P;  1DBH A;  2OQB A;  3GYP A;  1U2B A;  1PLS A;  1H10 A;  3M1I B;  2YSZ A;  4GZU A;  1K5G B;  2J0K A;  1FGY A;  2I5F A;  2RGN B;  4CYE A;  1U5G A;  1EGX A;  4Z2N A;  5JLJ B;  3A8P A;  2M14 A;  4YON A;  2LKO A;  2G35 A;  2YS5 A;  5D3X A;  4PNK A;  2D10 A;  4HAY B;  2DX5 A;  1TXD A;  2KGX B;  4PQ0 A;  2YS3 A;  4WVF B;  1FHX A;  4DX9 0;  4TKN A;  2DHI A;  2I5C A;  1DDW A;  3DXC A; 
#chains in the Genus database with same CATH topology
 3ZDT A;  2N23 A;  1UPQ A;  4HB4 B;  1DDM A;  2UZS A;  2DKP A;  1QQG A;  2Z0P A;  1SGH A;  2CY5 A;  1B55 A;  1U5D A;  3SUZ A;  4EKU A;  3NSU A;  4L1R A;  5I2S A;  3WYF B;  1M7R A;  1ZM0 A;  4A6K A;  2R09 A;  4DBB A;  4KHB A;  4ZRI A;  3VIA A;  1XR0 B;  1MK7 B;  2ELB A;  5LON B;  2LUL A;  3DXD A;  4OSN A;  1NTV A;  4A6H A;  5HE1 A;  2P0D A;  4KHB B;  5HE2 A;  2D9Z A;  3PZD A;  3TCA A;  4HB0 B;  4HB2 B;  5D27 A;  1V61 A;  3BIN A;  4Y94 A;  2AEH A;  2RSG A;  4CHM A;  2HTH B;  3PEG A;  4HAX B;  1FAO A;  1EAZ A;  4GNK B;  1BWN A;  1IRS A;  1ZC4 B;  2KIG A;  1NU2 A;  4A6F A;  1Z87 A;  4WSF A;  1H4R A;  1SHC A;  1V5U A;  1P5T A;  5M4Y B;  2K2J A;  1RJ2 A;  1EVH A;  1P6S A;  2H7D A;  2VSZ A;  5FI0 A;  2XQN M;  3CXB B;  3V5W A;  1ZYI A;  4HHV A;  3SYX A;  1FGZ A;  2K49 A;  2Z4D A;  2W2X D;  4QJ4 B;  2W2W A;  1KZ7 A;  2D4Q A;  2MKR A;  5C79 A;  1OMW A;  4MY6 A;  1WJ1 A;  1FHW A;  2NMB A;  4ZRK A;  3VOQ A;  3KRX A;  3O96 A;  2COF A;  4TYZ A;  3AU5 A;  1ISN A;  2DKQ A;  3NW8 A;  1X1G A;  3U12 A;  2VRW B;  1FHO A;  2P0H A;  2ZKM X;  2Z0O A;  5KQ4 A;  2MDX A;  1Q67 A;  5GOW B;  2Y8F A;  2COC A;  2LOX A;  4KHA A;  3A8Q A;  5DHA B;  2GCJ A;  3B77 A;  4DX8 A;  4QXA B;  4IOY X;  3PVL A;  1XOD A;  3PVW A;  1ZC3 B;  2KUP A;  1XCG A;  3U8Z A;  4EJN A;  2N0Y A;  3HQC A;  2J0J A;  1W1H A;  2FJL A;  2QKL A;  2YT1 A;  3DXE A;  2RRF A;  5J3Q A;  3NWA A;  5D3W A;  4HDQ A;  2DHJ A;  3D8E A;  2BCJ A;  4IAP A;  2L1C A;  3P6A A;  2IFS A;  3WA0 A;  4OT1 A;  2D9V A;  3AU4 A;  1I7A A;  3DCX A;  2FJU B;  1ZSQ A;  4BBK A;  4GOU A;  4C0A A;  3TVV A;  2RUK B;  1NI2 A;  4IFS A;  4A5K A;  4K81 A;  1X05 A;  5JHG A;  2DLW A;  1MAI A;  2I1K A;  5FI1 A;  2CAY A;  2AL6 A;  1X86 A;  4GXB A;  1XKE A;  3LJU X;  1LB1 A;  3N7C A;  3SV1 A;  2P8V A;  2YS1 A;  1P3R A;  3NWF A;  3U7D A;  5C5B A;  1GG3 A;  2EMT A;  1RRP B;  4P7I A;  3AJ4 A;  2K00 A;  1NTY A;  4KHO A;  2D9X A;  2JP2 A;  3ULC A;  3ML4 A;  5C5B B;  2COD A;  4Z2M B;  2D9W A;  2KUQ A;  3PSC A;  2RNR B;  4D6W A;  3TFM A;  5D3V A;  3SO6 A;  3FVC A;  5IRS A;  3HK0 A;  1XX0 A;  3X23 A;  4L6E A;  1MIZ B;  3F5R A;  1WGU A;  2NBV A;  2YT2 A;  3CIK A;  4GN1 A;  2EC1 A;  1UPR A;  3ODW A;  4F7H A;  2M38 A;  3NWD A;  1UNP A;  2GS0 A;  4DXA B;  3PVU A;  1X1F A;  3ULB A;  4B6H A;  4A6F B;  1PFJ A;  2UZR A;  1Y5O A;  1DRO A;  3ODO A;  3MPX A;  1WI1 A;  1WJM A;  5LOP B;  3P7Z A;  5KQ1 A;  3ODX A;  1K5D B;  2DX1 A;  2D9Y A;  3ZVR A;  4D0N B;  3IVF A;  2GJY A;  2DA0 A;  3OHM B;  5KCV A;  1BTK A;  4XWX A;  1AWE A;  2EJ8 A;  3FM8 C;  2YF0 A;  4KVG B;  3PG7 A;  2LOZ A;  2DYQ A;  3KZ1 A;  4NY0 A;  1MPH A;  1X11 A;  1TQZ A;  2H7E A;  1XD4 A;  4K2P A;  2ROV A;  2DN6 A;  2Y8G A;  1W1D A;  5D3Y A;  2ADZ A;  2YT0 A;  5DHF B;  2ROZ B;  3HIE A;  1U29 A;  3GYO A;  4GMX B;  4MT7 A;  1T77 A;  3PP2 A;  2Z13 A;  1U5E A;  4H8S A;  1FB8 A;  1J0W A;  2J0M A;  5C16 A;  4HAT B;  2X18 A;  4HAU B;  3HSA A;  3QBV B;  1N3H A;  3A98 B;  3A58 A;  4HDO A;  4YL8 A;  1GC6 A;  2DTC A;  5JHH A;  2E2X A;  4CSQ A;  1M7E A;  3KY9 A;  5JP4 A;  2OTX A;  2EMS A;  3FSS A;  2KR0 A;  3UZT A;  4EMO A;  4MK0 A;  4ZRJ A;  2PZ1 A;  2RLO A;  2YVC A;  2Z14 A;  1U27 A;  1OY2 A;  2D2Q A;  2Y7B A;  3SNH A;  4KAX B;  3QWM A;  5J3Y A;  5LG4 B;  2K2U A;  4HAW B;  4WJ7 A;  1DYN A;  1MIX A;  2CY4 A;  3OAN A;  2CRF A;  4HB3 B;  5HE3 A;  1FOE A;  3F0W A;  4NSW A;  4HSI A;  2DYN A;  2I1J A;  1ZVR A;  3QIJ A;  5DIF B;  1UEF A;  2NZ8 B;  1MI1 A;  1WVH A;  1WG7 A;  3MDB C;  1Y19 B;  4HAV B;  1OQN A;  4CHJ A;  2DHK A;  5J3T A;  3D8D A;  5DI9 B;  2V76 A;  1V5M A;  2L2I A;  1BAK A;  2R2Y A;  5DH9 B;  1KZG A;  5CLL B;  5CLQ B;  2UVM A;  2VKI A;  2KCJ A;  2Z0Q A;  4F7G A;  2KIE A;  1GC7 A;  2RVB B;  4GMV A;  1WGQ A;  2IYB A;  2W2X C;  3FEH A;  4K2O A;  3KRW A;  4GPT B;  1MK9 B;  1U5F A;  2MFQ A;  3HW2 B;  1EF1 A;  1UNR A;  2LG1 A;  1PMS A;  1KI1 B;  3G9W A;  2Q13 A;  1DDV A;  1E5W A;  4QJ5 B;  3BJI A;  2HE7 A;  3D8F A;  1LW3 A;  5C6R A;  2P0F A;  2R0D A;  4K17 A;  2LYD A;  2MWN B;  2YRY A;  1W1G A;  1UNQ A;  2ZPY A;  1V88 A;  2ELA A;  2D11 A;  1J19 A;  1I2H A;  2GCL A;  4QJ3 B;  5HE0 A;  5I2M A;  1TJ6 A;  1V89 A;  2Z59 A;  3T06 A;  1MKE A;  3RCP A;  1QC6 A;  3TO1 A;  1BTN A;  3TW1 A;  1V5P A;  2COA A;  4HAZ B;  5L81 A;  5EFX A;  2QKM A;  2DFK A;  1AQC A;  3KSY A;  2J59 M;  4F7U P;  1DBH A;  2OQB A;  3GYP A;  1U2B A;  1PLS A;  1H10 A;  3M1I B;  2YSZ A;  4GZU A;  1K5G B;  2J0K A;  1FGY A;  2I5F A;  2RGN B;  4CYE A;  1U5G A;  1EGX A;  4Z2N A;  5JLJ B;  3A8P A;  2M14 A;  4YON A;  2LKO A;  2G35 A;  2YS5 A;  5D3X A;  4PNK A;  2D10 A;  4HAY B;  2DX5 A;  1TXD A;  2KGX B;  4PQ0 A;  2YS3 A;  4WVF B;  4DIX A;  2K8E A;  1FHX A;  4DX9 0;  4TKN A;  2GUM A;  2DHI A;  2I5C A;  1DDW A;  3DXC A; 
#chains in the Genus database with same CATH homology
 3ZDT A;  2N23 A;  1UPQ A;  4HB4 B;  1DDM A;  2UZS A;  2DKP A;  1QQG A;  2Z0P A;  1SGH A;  2CY5 A;  1B55 A;  1U5D A;  3SUZ A;  4EKU A;  3NSU A;  3WYF B;  1M7R A;  1ZM0 A;  4A6K A;  2R09 A;  4DBB A;  4ZRI A;  3VIA A;  1XR0 B;  1MK7 B;  2ELB A;  5LON B;  2LUL A;  3DXD A;  1NTV A;  4A6H A;  5HE1 A;  2P0D A;  4KHB B;  5HE2 A;  2D9Z A;  3PZD A;  3TCA A;  4HB0 B;  4HB2 B;  5D27 A;  1V61 A;  3BIN A;  4Y94 A;  2AEH A;  2RSG A;  4CHM A;  2HTH B;  3PEG A;  4HAX B;  1FAO A;  1EAZ A;  1BWN A;  1IRS A;  1ZC4 B;  1NU2 A;  4A6F A;  1Z87 A;  4WSF A;  1H4R A;  1SHC A;  1V5U A;  1P5T A;  2K2J A;  1RJ2 A;  1EVH A;  1P6S A;  2H7D A;  2VSZ A;  5FI0 A;  2XQN M;  3CXB B;  3V5W A;  4HHV A;  3SYX A;  1FGZ A;  2W2X D;  2W2W A;  1KZ7 A;  2D4Q A;  2MKR A;  5C79 A;  1OMW A;  4MY6 A;  1WJ1 A;  1FHW A;  2NMB A;  4ZRK A;  3VOQ A;  3KRX A;  3O96 A;  2COF A;  4TYZ A;  3AU5 A;  1ISN A;  2DKQ A;  1X1G A;  2VRW B;  1FHO A;  2P0H A;  2Z0O A;  5KQ4 A;  2MDX A;  1Q67 A;  5GOW B;  2Y8F A;  2COC A;  2LOX A;  4KHA A;  3A8Q A;  5DHA B;  2GCJ A;  4DX8 A;  4IOY X;  3PVL A;  1XOD A;  3PVW A;  1ZC3 B;  2KUP A;  1XCG A;  3U8Z A;  4EJN A;  2N0Y A;  3HQC A;  2J0J A;  1W1H A;  2FJL A;  2QKL A;  2YT1 A;  3DXE A;  5J3Q A;  5D3W A;  4HDQ A;  2DHJ A;  3D8E A;  2BCJ A;  4IAP A;  2L1C A;  3P6A A;  2IFS A;  3WA0 A;  2D9V A;  3AU4 A;  1I7A A;  1ZSQ A;  4BBK A;  4C0A A;  3TVV A;  2RUK B;  1NI2 A;  4IFS A;  4A5K A;  4K81 A;  1X05 A;  5JHG A;  2DLW A;  1MAI A;  2I1K A;  5FI1 A;  2CAY A;  2AL6 A;  1X86 A;  4GXB A;  1XKE A;  3LJU X;  1LB1 A;  3N7C A;  3SV1 A;  2P8V A;  2YS1 A;  1P3R A;  3U7D A;  5C5B A;  1GG3 A;  2EMT A;  1RRP B;  4P7I A;  3AJ4 A;  2K00 A;  1NTY A;  4KHO A;  2D9X A;  2JP2 A;  3ULC A;  3ML4 A;  5C5B B;  2COD A;  4Z2M B;  2D9W A;  3PSC A;  2RNR B;  3TFM A;  5D3V A;  3SO6 A;  3HK0 A;  1XX0 A;  3X23 A;  4L6E A;  1MIZ B;  3F5R A;  1WGU A;  3CIK A;  4GN1 A;  2EC1 A;  1UPR A;  3ODW A;  4F7H A;  2M38 A;  1UNP A;  2GS0 A;  4DXA B;  3PVU A;  1X1F A;  3ULB A;  4B6H A;  4A6F B;  1PFJ A;  2UZR A;  1Y5O A;  1DRO A;  3ODO A;  3MPX A;  1WI1 A;  1WJM A;  5LOP B;  3P7Z A;  5KQ1 A;  3ODX A;  1K5D B;  2DX1 A;  2D9Y A;  3ZVR A;  4D0N B;  3IVF A;  2GJY A;  2DA0 A;  5KCV A;  1BTK A;  4XWX A;  1AWE A;  2EJ8 A;  3FM8 C;  2YF0 A;  4KVG B;  3PG7 A;  2LOZ A;  2DYQ A;  3KZ1 A;  4NY0 A;  1MPH A;  1X11 A;  1TQZ A;  2H7E A;  1XD4 A;  4K2P A;  2ROV A;  2DN6 A;  2Y8G A;  1W1D A;  5D3Y A;  2ADZ A;  2YT0 A;  5DHF B;  2ROZ B;  1U29 A;  3GYO A;  4GMX B;  4MT7 A;  3PP2 A;  1U5E A;  4H8S A;  1FB8 A;  1J0W A;  2J0M A;  5C16 A;  4HAT B;  2X18 A;  4HAU B;  3QBV B;  1N3H A;  3A98 B;  4HDO A;  4YL8 A;  1GC6 A;  2DTC A;  5JHH A;  2E2X A;  1M7E A;  3KY9 A;  5JP4 A;  2OTX A;  2EMS A;  3FSS A;  3UZT A;  4EMO A;  4MK0 A;  4ZRJ A;  2PZ1 A;  2RLO A;  2YVC A;  1U27 A;  1OY2 A;  2D2Q A;  2Y7B A;  3SNH A;  4KAX B;  3QWM A;  5J3Y A;  2K2U A;  4HAW B;  4WJ7 A;  1DYN A;  1MIX A;  2CY4 A;  3OAN A;  2CRF A;  4HB3 B;  5HE3 A;  1FOE A;  3F0W A;  4NSW A;  2DYN A;  2I1J A;  1ZVR A;  3QIJ A;  5DIF B;  1UEF A;  2NZ8 B;  1WVH A;  1WG7 A;  3MDB C;  1Y19 B;  4HAV B;  1OQN A;  4CHJ A;  2DHK A;  5J3T A;  3D8D A;  5DI9 B;  2V76 A;  1V5M A;  2L2I A;  1BAK A;  5DH9 B;  1KZG A;  5CLL B;  5CLQ B;  2UVM A;  2VKI A;  2KCJ A;  2Z0Q A;  4F7G A;  1GC7 A;  2RVB B;  4GMV A;  1WGQ A;  2IYB A;  2W2X C;  3FEH A;  4K2O A;  3KRW A;  4GPT B;  1U5F A;  1MK9 B;  2MFQ A;  3HW2 B;  1EF1 A;  1UNR A;  2LG1 A;  1PMS A;  1KI1 B;  3G9W A;  2Q13 A;  1DDV A;  1E5W A;  3BJI A;  2HE7 A;  3D8F A;  1LW3 A;  5C6R A;  2P0F A;  2R0D A;  4K17 A;  2LYD A;  2MWN B;  2YRY A;  1W1G A;  1UNQ A;  2ZPY A;  1V88 A;  2ELA A;  2D11 A;  1J19 A;  1I2H A;  2GCL A;  5HE0 A;  1TJ6 A;  1V89 A;  3T06 A;  1MKE A;  3RCP A;  1QC6 A;  3TO1 A;  1BTN A;  3TW1 A;  1V5P A;  2COA A;  4HAZ B;  5L81 A;  5EFX A;  2QKM A;  2DFK A;  1AQC A;  3KSY A;  2J59 M;  4F7U P;  1DBH A;  2OQB A;  3GYP A;  1U2B A;  1PLS A;  1H10 A;  3M1I B;  2YSZ A;  4GZU A;  1K5G B;  2J0K A;  1FGY A;  2I5F A;  2RGN B;  4CYE A;  1U5G A;  1EGX A;  4Z2N A;  5JLJ B;  3A8P A;  2M14 A;  4YON A;  2LKO A;  2G35 A;  2YS5 A;  5D3X A;  4PNK A;  2D10 A;  4HAY B;  2DX5 A;  1TXD A;  2KGX B;  4PQ0 A;  2YS3 A;  4WVF B;  1FHX A;  4DX9 0;  4TKN A;  2DHI A;  2I5C A;  1DDW A;  3DXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...