2Y7BA

Crystal structure of the ph domain of human actin-binding protein anillin anln
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
134
structure length
134
Chain Sequence
b'VNSSVEERGFLTIFEDVSGFGAWHRRWCVLSGNCISYWTYPDDEKRKNPIGRINLANCTSRQIEPANREFCARRNTFELITVRPQREDDRETLVSQCRDTLCVTKNWLSADTKEERDLWMQKLNQVLVDIRLWQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ACTIN-BINDING PROTEIN ANILLIN
publication title Crystal Structure of the Ph Domain of Human Actin-Binding Protein Anillin Anln
rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 33
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2011-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2y7bA00
4HAZB 2IYBA 2R0DA 2LOZA 1V5UA 2QKMA 1AWEA 1P6SA 4IOYX 1V89A 4F7HA 1FHWA 2YT0A 1Q67A 5CLQB 5GOWB 2K2JA 4DX90 4HAYB 3A98B 4KHBB 1RJ2A 2HE7A 3P6AA 3ODWA 4EJNA 2I5CA 2ROVA 1J0WA 5D3VA 4P7IA 3RCPA 1LB1A 1WJMA 2GCLA 3DXCA 3P7ZA 1BTKA 2Z0QA 1NI2A 1J19A 1I2HA 1U5GA 2DKQA 2LULA 2UZRA 1BTNA 1XD4A 1KZGA 3A8QA 4C0AA 2P0FA 1QC6A 2BCJA 4HHVA 1PFJA 1X1FA 2ELBA 4A6FB 2LOXA 1DROA 4K17A 4GPTB 5D3YA 5HE0A 3TVVA 1EVHA 3FM8C 3HK0A 3KZ1A 3ML4A 2N23A 1I7AA 2I1KA 4GMVA 2YF0A 1SGHA 4HAWB 2Y8GA 1X1GA 4HB0B 1GC7A 1UNPA 2D11A 5KCVA 4WSFA 3GYPA 2GJYA 4TKNA 3MDBC 2YT1A 2Z0OA 2Z0PA 3OANA 1SHCA 5DHAB 1IRSA 2GS0A 4PNKA 2P0HA 1EGXA 2COAA 4WVFB 1UNRA 2RGNB 3DXDA 4HAUB 4MY6A 1MK7B 2DHKA 3M1IB 3KY9A 2YS1A 5D3WA 2MDXA 3V5WA 5JP4A 5JLJB 5JHHA 4HB4B 2DYNA 3SV1A 3PVUA 3ZVRA 3DXEA 2OTXA 5KQ4A 4NY0A 3PVLA 3KSYA 3PEGA 1U29A 2D9ZA 1ZM0A 5C5BB 2GCJA 2J59M 3KRWA 1TQZA 2G35A 2KUPA 3A8PA 5LOPB 1FGYA 4YL8A 5J3QA 3FEHA 3HQCA 5C6RA 1PLSA 3F5RA 2ZPYA 1XX0A 1KI1B 2CRFA 5DI9B 1BWNA 4WJ7A 3TW1A 2OQBA 4HB2B 4NSWA 4MT7A 1M7EA 2DYQA 1FHXA 2N0YA 1U5DA 4BBKA 1FOEA 3KRXA 1UPRA 4DX8A 5D3XA 1WGQA 4HAXB 4DXAB 1ZVRA 1E5WA 5LONB 3SO6A 4Y94A 1LW3A 1V61A 4PQ0A 4KAXB 4EMOA 2E2XA 2RSGA 1FHOA 1PMSA 3AJ4A 5FI1A 1ISNA 1MIXA 2W2XC 1MKEA 3ULCA 1GG3A 4HB3B 2W2XD 1X86A 2L2IA 4ZRIA 5C79A 2YS5A 3D8FA 5J3TA 2EMSA 2VRWB 2EC1A 3G9WA 3AU5A 3TCAA 4H8SA 1MK9B 2Y7BA 2IFSA 4HDOA 2MFQA 5HE3A 3ULBA 3PZDA 4KHOA 4L6EA 1H4RA 2UZSA 2RVBB 3CXBB 2QKLA 3FSSA 1Y5OA 2KGXB 3D8DA 4K81A 2EJ8A 2CY4A 2DHJA 2LG1A 2HTHB 2MKRA 4IAPA 3PSCA 2JP2A 5DHFB 1DDVA 3QIJA 1W1HA 2D9XA 3BINA 1GC6A 2Q13A 1RRPB 2D4QA 4HATB 3U7DA 2H7EA 2K2UA 4K2PA 2VSZA 4A6KA 1DYNA 2D9VA 5J3YA 2DX5A 3VIAA 4D0NB 1EF1A 4CHJA 2UVMA 3O96A 3PP2A 1OMWA 3ODOA 1ZSQA 2M14A 2DHIA 1DDWA 4YONA 1M7RA 3LJUX 3BJIA 1WI1A 1H10A 4MK0A 1WG7A 2ADZA 2ROZB 1TXDA 1MAIA 4TYZA 1FB8A 3SYXA 5HE1A 1MIZB 2KCJA 3TO1A 2COCA 1DDMA 3QBVB 2NMBA 2I1JA 3NSUA 3VOQA 2YS3A 2RUKB 2YSZA 4GN1A 1W1DA 1WGUA 2DX1A 1V88A 3SUZA 2YRYA 4A6HA 5L81A 1KZ7A 3U8ZA 2R09A 1DBHA 4GXBA 1AQCA 2CY5A 2EMTA 4Z2MB 1X05A 2L1CA 4CYEA 2FJLA 2X18A 4B6HA 4HDQA 2RLOA 1U2BA 4HAVB 4CHMA 3PG7A 2CODA 2NZ8B 4KVGB 2XQNM 1MPHA 2RNRB 4A6FA 5JHGA 2V76A 3AU4A 5FI0A 1NTYA 2W2WA 2M38A 5DIFB 1ZC3B 1FAOA 1ZC4B 2I5FA 1XR0B 1TJ6A 4Z2NA 2COFA 1U27A 1V5PA 2YVCA 3QWMA 2DN6A 2J0JA 2D9YA 3F0WA 2LYDA 5HE2A 1NTVA 1XCGA 3N7CA 3TFMA 1QQGA 1EAZA 3UZTA 2D10A 4A5KA 1K5GB 1N3HA 2CAYA 3MPXA 2Y8FA 2DLWA 1BAKA 1W1GA 2DFKA 2AL6A 1UPQA 4ZRJA 3D8EA 3T06A 2H7DA 3CIKA 4ZRKA 1OY2A 2DTCA 2PZ1A 4GZUA 3WYFB 1P5TA 2D9WA 1WVHA 2AEHA 5C16A 1XKEA 1V5MA 2MWNB 3WA0A 1FGZA 4IFSA 4XWXA 3ZDTA 5D27A 1K5DB 2ELAA 4GMXB 1XODA 3ODXA 4K2OA 5CLLB 4DBBA 3IVFA 2D2QA 2LKOA 2J0MA 1Y19B 4KHAA 3PVWA 2DA0A 1OQNA 1P3RA 3SNHA 2K00A 4F7UP 2DKPA 2J0KA 3HW2B 5C5BA 2VKIA 1NU2A 1UNQA 2P8VA 5DH9B 1UEFA 3X23A 3GYOA 1B55A 1U5FA 4F7GA 1X11A 2P0DA 5KQ1A 5EFXA 1U5EA 1WJ1A 1Z87A 4EKUA
chains in the Genus database with same CATH superfamily
4HAZB 2IYBA 2R0DA 2LOZA 1V5UA 2QKMA 1AWEA 1P6SA 4IOYX 1V89A 4F7HA 1FHWA 2YT0A 1Q67A 5CLQB 5GOWB 2K2JA 4DX90 4HAYB 3A98B 4KHBB 1RJ2A 2HE7A 2NBVA 3P6AA 3ODWA 4EJNA 2I5CA 2ROVA 1J0WA 5D3VA 4P7IA 3HIEA 3RCPA 5I2SA 1LB1A 1WJMA 2GCLA 3DXCA 3P7ZA 1BTKA 2RRFA 2Z0QA 1NI2A 1J19A 1I2HA 3NW8A 1U5GA 2DKQA 2LULA 2UZRA 1BTNA 1XD4A 1KZGA 3A8QA 4L1RA 4C0AA 2P0FA 1QC6A 2BCJA 4CSQA 4HHVA 1PFJA 1X1FA 2ELBA 4A6FB 2FJUB 2LOXA 1DROA 4K17A 4GPTB 5D3YA 5HE0A 3TVVA 1EVHA 3FM8C 3HK0A 2R2YA 3KZ1A 5I2MA 3ML4A 2N23A 1I7AA 2I1KA 4GMVA 2YF0A 1SGHA 4HAWB 2Y8GA 1X1GA 4HB0B 1GC7A 1UNPA 2D11A 5KCVA 4WSFA 3GYPA 2GJYA 4TKNA 3MDBC 2YT1A 4QJ5B 2Z0OA 2Z0PA 3OANA 1SHCA 5DHAB 1IRSA 2GS0A 4PNKA 2P0HA 1EGXA 2COAA 4WVFB 1UNRA 2RGNB 3DXDA 4D6WA 4HAUB 4MY6A 1MK7B 2DHKA 3M1IB 3KY9A 2YS1A 5M4YB 5D3WA 2MDXA 3V5WA 5JP4A 5JLJB 5JHHA 3B77A 4HB4B 2DYNA 3SV1A 3PVUA 3NWDA 3ZVRA 3DXEA 2OTXA 5KQ4A 4NY0A 3PVLA 3KSYA 3PEGA 1U29A 2D9ZA 1ZM0A 5C5BB 2GCJA 2J59M 3KRWA 1TQZA 2G35A 2KUPA 3A8PA 5LOPB 1FGYA 4OT1A 3FVCA 4YL8A 5J3QA 3FEHA 3HQCA 5C6RA 1PLSA 3F5RA 2ZPYA 4GNKB 1XX0A 2YT2A 3U12A 1KI1B 2CRFA 5DI9B 1BWNA 4WJ7A 3TW1A 2OQBA 4HB2B 4NSWA 4MT7A 1M7EA 4OSNA 2DYQA 1FHXA 2N0YA 2Z13A 1U5DA 4BBKA 1FOEA 3KRXA 1UPRA 4DX8A 5D3XA 1WGQA 4HAXB 4DXAB 1ZVRA 1E5WA 4DIXA 5LONB 3SO6A 4Y94A 3NWAA 1LW3A 1V61A 4PQ0A 4KAXB 4EMOA 2E2XA 2RSGA 1FHOA 1PMSA 3AJ4A 5FI1A 1ISNA 1MIXA 2W2XC 1MKEA 3ULCA 1GG3A 4HB3B 2W2XD 2KIGA 3NWFA 1X86A 2L2IA 4ZRIA 5C79A 2YS5A 3D8FA 5J3TA 2EMSA 2VRWB 2EC1A 3G9WA 3AU5A 3TCAA 4H8SA 1MK9B 2Y7BA 2IFSA 4HDOA 2MFQA 5HE3A 3ULBA 3PZDA 4KHOA 4L6EA 1H4RA 2UZSA 2RVBB 3CXBB 2QKLA 3FSSA 1Y5OA 2KGXB 3D8DA 4K81A 2EJ8A 2CY4A 2DHJA 2Z59A 2LG1A 2HTHB 2MKRA 4IAPA 3PSCA 2K49A 2JP2A 5DHFB 1DDVA 3QIJA 1W1HA 2D9XA 3BINA 1GC6A 2Q13A 1RRPB 2D4QA 4HATB 3U7DA 2H7EA 2K2UA 4K2PA 2VSZA 4A6KA 1DYNA 2D9VA 5J3YA 2DX5A 3VIAA 4D0NB 1EF1A 4CHJA 2UVMA 3O96A 3A58A 3PP2A 1OMWA 3ODOA 1ZSQA 2M14A 2DHIA 1DDWA 4YONA 1M7RA 3LJUX 3BJIA 1WI1A 1H10A 4MK0A 1WG7A 1T77A 2ADZA 2ROZB 1TXDA 1MAIA 4TYZA 1FB8A 2GUMA 3SYXA 5HE1A 1MIZB 2KCJA 3TO1A 2COCA 1DDMA 1MI1A 3QBVB 2NMBA 2I1JA 3NSUA 3VOQA 2YS3A 2RUKB 2YSZA 4GN1A 1W1DA 2Z14A 1WGUA 2DX1A 1V88A 3SUZA 2YRYA 4A6HA 5L81A 1KZ7A 3U8ZA 2R09A 1DBHA 4GXBA 1AQCA 2CY5A 2EMTA 4QXAB 4Z2MB 1X05A 2L1CA 4CYEA 2FJLA 2X18A 4B6HA 4HDQA 2RLOA 1U2BA 4HAVB 3DCXA 4CHMA 3PG7A 2CODA 2NZ8B 4KVGB 2XQNM 1MPHA 2RNRB 4A6FA 5JHGA 2V76A 3AU4A 5FI0A 1NTYA 2W2WA 2M38A 5DIFB 1ZC3B 1FAOA 1ZC4B 2I5FA 1XR0B 1TJ6A 4Z2NA 2COFA 1U27A 1V5PA 2YVCA 3QWMA 2DN6A 2KIEA 2J0JA 2D9YA 2ZKMX 3F0WA 2LYDA 5HE2A 1NTVA 1XCGA 3HSAA 1ZYIA 3N7CA 3TFMA 3OHMB 1QQGA 1EAZA 3UZTA 2D10A 4A5KA 1K5GB 1N3HA 2CAYA 3MPXA 2Y8FA 4QJ3B 4HSIA 2DLWA 1BAKA 2KUQA 1W1GA 2DFKA 2AL6A 1UPQA 4ZRJA 3D8EA 3T06A 2H7DA 3CIKA 4ZRKA 1OY2A 2DTCA 2PZ1A 4GZUA 3WYFB 1P5TA 2D9WA 1WVHA 2AEHA 5C16A 1XKEA 1V5MA 2MWNB 3WA0A 1FGZA 4IFSA 4XWXA 3ZDTA 5D27A 1K5DB 2ELAA 4GMXB 2K8EA 1XODA 3ODXA 4QJ4B 4K2OA 5CLLB 2Z4DA 3IVFA 4DBBA 2D2QA 2LKOA 2J0MA 1Y19B 4KHAA 3PVWA 2DA0A 1OQNA 1P3RA 3SNHA 2K00A 4F7UP 4GOUA 2DKPA 2J0KA 3HW2B 5C5BA 2VKIA 1NU2A 1UNQA 2P8VA 5DH9B 1UEFA 3X23A 3GYOA 1B55A 1U5FA 4F7GA 1X11A 2KR0A 2P0DA 4KHBA 5KQ1A 5IRSA 5EFXA 1U5EA 5LG4B 1WJ1A 1Z87A 4EKUA
chains in the Genus database with same CATH topology
4HAZB 2IYBA 2R0DA 2LOZA 1V5UA 2QKMA 1AWEA 1P6SA 4IOYX 1V89A 4F7HA 1FHWA 2YT0A 1Q67A 5CLQB 5GOWB 2K2JA 4DX90 4HAYB 3A98B 4KHBB 1RJ2A 2HE7A 3P6AA 3ODWA 4EJNA 2I5CA 2ROVA 1J0WA 5D3VA 4P7IA 3RCPA 1LB1A 1WJMA 2GCLA 3DXCA 3P7ZA 1BTKA 2Z0QA 1NI2A 1J19A 1I2HA 1U5GA 2DKQA 2LULA 2UZRA 1BTNA 1XD4A 1KZGA 3A8QA 4C0AA 2P0FA 1QC6A 2BCJA 4HHVA 1PFJA 1X1FA 2ELBA 4A6FB 2LOXA 1DROA 4K17A 4GPTB 5D3YA 5HE0A 3TVVA 1EVHA 3FM8C 3HK0A 3KZ1A 3ML4A 2N23A 1I7AA 2I1KA 4GMVA 2YF0A 1SGHA 4HAWB 2Y8GA 1X1GA 4HB0B 1GC7A 1UNPA 2D11A 5KCVA 4WSFA 3GYPA 2GJYA 4TKNA 3MDBC 2YT1A 2Z0OA 2Z0PA 3OANA 1SHCA 5DHAB 1IRSA 2GS0A 4PNKA 2P0HA 1EGXA 2COAA 4WVFB 1UNRA 2RGNB 3DXDA 4HAUB 4MY6A 1MK7B 2DHKA 3M1IB 3KY9A 2YS1A 5D3WA 2MDXA 3V5WA 5JP4A 5JLJB 5JHHA 4HB4B 2DYNA 3SV1A 3PVUA 3ZVRA 3DXEA 2OTXA 5KQ4A 4NY0A 3PVLA 3KSYA 3PEGA 1U29A 2D9ZA 1ZM0A 5C5BB 2GCJA 2J59M 3KRWA 1TQZA 2G35A 2KUPA 3A8PA 5LOPB 1FGYA 4YL8A 5J3QA 3FEHA 3HQCA 5C6RA 1PLSA 3F5RA 2ZPYA 1XX0A 1KI1B 2CRFA 5DI9B 1BWNA 4WJ7A 3TW1A 2OQBA 4HB2B 4NSWA 4MT7A 1M7EA 2DYQA 1FHXA 2N0YA 1U5DA 4BBKA 1FOEA 3KRXA 1UPRA 4DX8A 5D3XA 1WGQA 4HAXB 4DXAB 1ZVRA 1E5WA 5LONB 3SO6A 4Y94A 1LW3A 1V61A 4PQ0A 4KAXB 4EMOA 2E2XA 2RSGA 1FHOA 1PMSA 3AJ4A 5FI1A 1ISNA 1MIXA 2W2XC 1MKEA 3ULCA 1GG3A 4HB3B 2W2XD 1X86A 2L2IA 4ZRIA 5C79A 2YS5A 3D8FA 5J3TA 2EMSA 2VRWB 2EC1A 3G9WA 3AU5A 3TCAA 4H8SA 1MK9B 2Y7BA 2IFSA 4HDOA 2MFQA 5HE3A 3ULBA 3PZDA 4KHOA 4L6EA 1H4RA 2UZSA 2RVBB 3CXBB 2QKLA 3FSSA 1Y5OA 2KGXB 3D8DA 4K81A 2EJ8A 2CY4A 2DHJA 2LG1A 2HTHB 2MKRA 4IAPA 3PSCA 2JP2A 5DHFB 1DDVA 3QIJA 1W1HA 2D9XA 3BINA 1GC6A 2Q13A 1RRPB 2D4QA 4HATB 3U7DA 2H7EA 2K2UA 4K2PA 2VSZA 4A6KA 1DYNA 2D9VA 5J3YA 2DX5A 3VIAA 4D0NB 1EF1A 4CHJA 2UVMA 3O96A 3PP2A 1OMWA 3ODOA 1ZSQA 2M14A 2DHIA 1DDWA 4YONA 1M7RA 3LJUX 3BJIA 1WI1A 1H10A 4MK0A 1WG7A 2ADZA 2ROZB 1TXDA 1MAIA 4TYZA 1FB8A 3SYXA 5HE1A 1MIZB 2KCJA 3TO1A 2COCA 1DDMA 3QBVB 2NMBA 2I1JA 3NSUA 3VOQA 2YS3A 2RUKB 2YSZA 4GN1A 1W1DA 1WGUA 2DX1A 1V88A 3SUZA 2YRYA 4A6HA 5L81A 1KZ7A 3U8ZA 2R09A 1DBHA 4GXBA 1AQCA 2CY5A 2EMTA 4Z2MB 1X05A 2L1CA 4CYEA 2FJLA 2X18A 4B6HA 4HDQA 2RLOA 1U2BA 4HAVB 4CHMA 3PG7A 2CODA 2NZ8B 4KVGB 2XQNM 1MPHA 2RNRB 4A6FA 5JHGA 2V76A 3AU4A 5FI0A 1NTYA 2W2WA 2M38A 5DIFB 1ZC3B 1FAOA 1ZC4B 2I5FA 1XR0B 1TJ6A 4Z2NA 2COFA 1U27A 1V5PA 2YVCA 3QWMA 2DN6A 2J0JA 2D9YA 3F0WA 2LYDA 5HE2A 1NTVA 1XCGA 3N7CA 3TFMA 1QQGA 1EAZA 3UZTA 2D10A 4A5KA 1K5GB 1N3HA 2CAYA 3MPXA 2Y8FA 2DLWA 1BAKA 1W1GA 2DFKA 2AL6A 1UPQA 4ZRJA 3D8EA 3T06A 2H7DA 3CIKA 4ZRKA 1OY2A 2DTCA 2PZ1A 4GZUA 3WYFB 1P5TA 2D9WA 1WVHA 2AEHA 5C16A 1XKEA 1V5MA 2MWNB 3WA0A 1FGZA 4IFSA 4XWXA 3ZDTA 5D27A 1K5DB 2ELAA 4GMXB 1XODA 3ODXA 4K2OA 5CLLB 4DBBA 3IVFA 2D2QA 2LKOA 2J0MA 1Y19B 4KHAA 3PVWA 2DA0A 1OQNA 1P3RA 3SNHA 2K00A 4F7UP 2DKPA 2J0KA 3HW2B 5C5BA 2VKIA 1NU2A 1UNQA 2P8VA 5DH9B 1UEFA 3X23A 3GYOA 1B55A 1U5FA 4F7GA 1X11A 2P0DA 5KQ1A 5EFXA 1U5EA 1WJ1A 1Z87A 4EKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HAZ B;  2IYB A;  2R0D A;  2LOZ A;  1V5U A;  2QKM A;  1AWE A;  1P6S A;  4IOY X;  1V89 A;  4F7H A;  1FHW A;  2YT0 A;  1Q67 A;  5CLQ B;  5GOW B;  2K2J A;  4DX9 0;  4HAY B;  3A98 B;  4KHB B;  1RJ2 A;  2HE7 A;  3P6A A;  3ODW A;  4EJN A;  2I5C A;  2ROV A;  1J0W A;  5D3V A;  4P7I A;  3RCP A;  1LB1 A;  1WJM A;  2GCL A;  3DXC A;  3P7Z A;  1BTK A;  2Z0Q A;  1NI2 A;  1J19 A;  1I2H A;  1U5G A;  2DKQ A;  2LUL A;  2UZR A;  1BTN A;  1XD4 A;  1KZG A;  3A8Q A;  4C0A A;  2P0F A;  1QC6 A;  2BCJ A;  4HHV A;  1PFJ A;  1X1F A;  2ELB A;  4A6F B;  2LOX A;  1DRO A;  4K17 A;  4GPT B;  5D3Y A;  5HE0 A;  3TVV A;  1EVH A;  3FM8 C;  3HK0 A;  3KZ1 A;  3ML4 A;  2N23 A;  1I7A A;  2I1K A;  4GMV A;  2YF0 A;  1SGH A;  4HAW B;  2Y8G A;  1X1G A;  4HB0 B;  1GC7 A;  1UNP A;  2D11 A;  5KCV A;  4WSF A;  3GYP A;  2GJY A;  4TKN A;  3MDB C;  2YT1 A;  2Z0O A;  2Z0P A;  3OAN A;  1SHC A;  5DHA B;  1IRS A;  2GS0 A;  4PNK A;  2P0H A;  1EGX A;  2COA A;  4WVF B;  1UNR A;  2RGN B;  3DXD A;  4HAU B;  4MY6 A;  1MK7 B;  2DHK A;  3M1I B;  3KY9 A;  2YS1 A;  5D3W A;  2MDX A;  3V5W A;  5JP4 A;  5JLJ B;  5JHH A;  4HB4 B;  2DYN A;  3SV1 A;  3PVU A;  3ZVR A;  3DXE A;  2OTX A;  5KQ4 A;  4NY0 A;  3PVL A;  3KSY A;  3PEG A;  1U29 A;  2D9Z A;  1ZM0 A;  5C5B B;  2GCJ A;  2J59 M;  3KRW A;  1TQZ A;  2G35 A;  2KUP A;  3A8P A;  5LOP B;  1FGY A;  4YL8 A;  5J3Q A;  3FEH A;  3HQC A;  5C6R A;  1PLS A;  3F5R A;  2ZPY A;  1XX0 A;  1KI1 B;  2CRF A;  5DI9 B;  1BWN A;  4WJ7 A;  3TW1 A;  2OQB A;  4HB2 B;  4NSW A;  4MT7 A;  1M7E A;  2DYQ A;  1FHX A;  2N0Y A;  1U5D A;  4BBK A;  1FOE A;  3KRX A;  1UPR A;  4DX8 A;  5D3X A;  1WGQ A;  4HAX B;  4DXA B;  1ZVR A;  1E5W A;  5LON B;  3SO6 A;  4Y94 A;  1LW3 A;  1V61 A;  4PQ0 A;  4KAX B;  4EMO A;  2E2X A;  2RSG A;  1FHO A;  1PMS A;  3AJ4 A;  5FI1 A;  1ISN A;  1MIX A;  2W2X C;  1MKE A;  3ULC A;  1GG3 A;  4HB3 B;  2W2X D;  1X86 A;  2L2I A;  4ZRI A;  5C79 A;  2YS5 A;  3D8F A;  5J3T A;  2EMS A;  2VRW B;  2EC1 A;  3G9W A;  3AU5 A;  3TCA A;  4H8S A;  1MK9 B;  2Y7B A;  2IFS A;  4HDO A;  2MFQ A;  5HE3 A;  3ULB A;  3PZD A;  4KHO A;  4L6E A;  1H4R A;  2UZS A;  2RVB B;  3CXB B;  2QKL A;  3FSS A;  1Y5O A;  2KGX B;  3D8D A;  4K81 A;  2EJ8 A;  2CY4 A;  2DHJ A;  2LG1 A;  2HTH B;  2MKR A;  4IAP A;  3PSC A;  2JP2 A;  5DHF B;  1DDV A;  3QIJ A;  1W1H A;  2D9X A;  3BIN A;  1GC6 A;  2Q13 A;  1RRP B;  2D4Q A;  4HAT B;  3U7D A;  2H7E A;  2K2U A;  4K2P A;  2VSZ A;  4A6K A;  1DYN A;  2D9V A;  5J3Y A;  2DX5 A;  3VIA A;  4D0N B;  1EF1 A;  4CHJ A;  2UVM A;  3O96 A;  3PP2 A;  1OMW A;  3ODO A;  1ZSQ A;  2M14 A;  2DHI A;  1DDW A;  4YON A;  1M7R A;  3LJU X;  3BJI A;  1WI1 A;  1H10 A;  4MK0 A;  1WG7 A;  2ADZ A;  2ROZ B;  1TXD A;  1MAI A;  4TYZ A;  1FB8 A;  3SYX A;  5HE1 A;  1MIZ B;  2KCJ A;  3TO1 A;  2COC A;  1DDM A;  3QBV B;  2NMB A;  2I1J A;  3NSU A;  3VOQ A;  2YS3 A;  2RUK B;  2YSZ A;  4GN1 A;  1W1D A;  1WGU A;  2DX1 A;  1V88 A;  3SUZ A;  2YRY A;  4A6H A;  5L81 A;  1KZ7 A;  3U8Z A;  2R09 A;  1DBH A;  4GXB A;  1AQC A;  2CY5 A;  2EMT A;  4Z2M B;  1X05 A;  2L1C A;  4CYE A;  2FJL A;  2X18 A;  4B6H A;  4HDQ A;  2RLO A;  1U2B A;  4HAV B;  4CHM A;  3PG7 A;  2COD A;  2NZ8 B;  4KVG B;  2XQN M;  1MPH A;  2RNR B;  4A6F A;  5JHG A;  2V76 A;  3AU4 A;  5FI0 A;  1NTY A;  2W2W A;  2M38 A;  5DIF B;  1ZC3 B;  1FAO A;  1ZC4 B;  2I5F A;  1XR0 B;  1TJ6 A;  4Z2N A;  2COF A;  1U27 A;  1V5P A;  2YVC A;  3QWM A;  2DN6 A;  2J0J A;  2D9Y A;  3F0W A;  2LYD A;  5HE2 A;  1NTV A;  1XCG A;  3N7C A;  3TFM A;  1QQG A;  1EAZ A;  3UZT A;  2D10 A;  4A5K A;  1K5G B;  1N3H A;  2CAY A;  3MPX A;  2Y8F A;  2DLW A;  1BAK A;  1W1G A;  2DFK A;  2AL6 A;  1UPQ A;  4ZRJ A;  3D8E A;  3T06 A;  2H7D A;  3CIK A;  4ZRK A;  1OY2 A;  2DTC A;  2PZ1 A;  4GZU A;  3WYF B;  1P5T A;  2D9W A;  1WVH A;  2AEH A;  5C16 A;  1XKE A;  1V5M A;  2MWN B;  3WA0 A;  1FGZ A;  4IFS A;  4XWX A;  3ZDT A;  5D27 A;  1K5D B;  2ELA A;  4GMX B;  1XOD A;  3ODX A;  4K2O A;  5CLL B;  4DBB A;  3IVF A;  2D2Q A;  2LKO A;  2J0M A;  1Y19 B;  4KHA A;  3PVW A;  2DA0 A;  1OQN A;  1P3R A;  3SNH A;  2K00 A;  4F7U P;  2DKP A;  2J0K A;  3HW2 B;  5C5B A;  2VKI A;  1NU2 A;  1UNQ A;  2P8V A;  5DH9 B;  1UEF A;  3X23 A;  3GYO A;  1B55 A;  1U5F A;  4F7G A;  1X11 A;  2P0D A;  5KQ1 A;  5EFX A;  1U5E A;  1WJ1 A;  1Z87 A;  4EKU A; 
#chains in the Genus database with same CATH topology
 4HAZ B;  2IYB A;  2R0D A;  2LOZ A;  1V5U A;  2QKM A;  1AWE A;  1P6S A;  4IOY X;  1V89 A;  4F7H A;  1FHW A;  2YT0 A;  1Q67 A;  5CLQ B;  5GOW B;  2K2J A;  4DX9 0;  4HAY B;  3A98 B;  4KHB B;  1RJ2 A;  2HE7 A;  2NBV A;  3P6A A;  3ODW A;  4EJN A;  2I5C A;  2ROV A;  1J0W A;  5D3V A;  4P7I A;  3HIE A;  3RCP A;  5I2S A;  1LB1 A;  1WJM A;  2GCL A;  3DXC A;  3P7Z A;  1BTK A;  2RRF A;  2Z0Q A;  1NI2 A;  1J19 A;  1I2H A;  3NW8 A;  1U5G A;  2DKQ A;  2LUL A;  2UZR A;  1BTN A;  1XD4 A;  1KZG A;  3A8Q A;  4L1R A;  4C0A A;  2P0F A;  1QC6 A;  2BCJ A;  4CSQ A;  4HHV A;  1PFJ A;  1X1F A;  2ELB A;  4A6F B;  2FJU B;  2LOX A;  1DRO A;  4K17 A;  4GPT B;  5D3Y A;  5HE0 A;  3TVV A;  1EVH A;  3FM8 C;  3HK0 A;  2R2Y A;  3KZ1 A;  5I2M A;  3ML4 A;  2N23 A;  1I7A A;  2I1K A;  4GMV A;  2YF0 A;  1SGH A;  4HAW B;  2Y8G A;  1X1G A;  4HB0 B;  1GC7 A;  1UNP A;  2D11 A;  5KCV A;  4WSF A;  3GYP A;  2GJY A;  4TKN A;  3MDB C;  2YT1 A;  4QJ5 B;  2Z0O A;  2Z0P A;  3OAN A;  1SHC A;  5DHA B;  1IRS A;  2GS0 A;  4PNK A;  2P0H A;  1EGX A;  2COA A;  4WVF B;  1UNR A;  2RGN B;  3DXD A;  4D6W A;  4HAU B;  4MY6 A;  1MK7 B;  2DHK A;  3M1I B;  3KY9 A;  2YS1 A;  5M4Y B;  5D3W A;  2MDX A;  3V5W A;  5JP4 A;  5JLJ B;  5JHH A;  3B77 A;  4HB4 B;  2DYN A;  3SV1 A;  3PVU A;  3NWD A;  3ZVR A;  3DXE A;  2OTX A;  5KQ4 A;  4NY0 A;  3PVL A;  3KSY A;  3PEG A;  1U29 A;  2D9Z A;  1ZM0 A;  5C5B B;  2GCJ A;  2J59 M;  3KRW A;  1TQZ A;  2G35 A;  2KUP A;  3A8P A;  5LOP B;  1FGY A;  4OT1 A;  3FVC A;  4YL8 A;  5J3Q A;  3FEH A;  3HQC A;  5C6R A;  1PLS A;  3F5R A;  2ZPY A;  4GNK B;  1XX0 A;  2YT2 A;  3U12 A;  1KI1 B;  2CRF A;  5DI9 B;  1BWN A;  4WJ7 A;  3TW1 A;  2OQB A;  4HB2 B;  4NSW A;  4MT7 A;  1M7E A;  4OSN A;  2DYQ A;  1FHX A;  2N0Y A;  2Z13 A;  1U5D A;  4BBK A;  1FOE A;  3KRX A;  1UPR A;  4DX8 A;  5D3X A;  1WGQ A;  4HAX B;  4DXA B;  1ZVR A;  1E5W A;  4DIX A;  5LON B;  3SO6 A;  4Y94 A;  3NWA A;  1LW3 A;  1V61 A;  4PQ0 A;  4KAX B;  4EMO A;  2E2X A;  2RSG A;  1FHO A;  1PMS A;  3AJ4 A;  5FI1 A;  1ISN A;  1MIX A;  2W2X C;  1MKE A;  3ULC A;  1GG3 A;  4HB3 B;  2W2X D;  2KIG A;  3NWF A;  1X86 A;  2L2I A;  4ZRI A;  5C79 A;  2YS5 A;  3D8F A;  5J3T A;  2EMS A;  2VRW B;  2EC1 A;  3G9W A;  3AU5 A;  3TCA A;  4H8S A;  1MK9 B;  2Y7B A;  2IFS A;  4HDO A;  2MFQ A;  5HE3 A;  3ULB A;  3PZD A;  4KHO A;  4L6E A;  1H4R A;  2UZS A;  2RVB B;  3CXB B;  2QKL A;  3FSS A;  1Y5O A;  2KGX B;  3D8D A;  4K81 A;  2EJ8 A;  2CY4 A;  2DHJ A;  2Z59 A;  2LG1 A;  2HTH B;  2MKR A;  4IAP A;  3PSC A;  2K49 A;  2JP2 A;  5DHF B;  1DDV A;  3QIJ A;  1W1H A;  2D9X A;  3BIN A;  1GC6 A;  2Q13 A;  1RRP B;  2D4Q A;  4HAT B;  3U7D A;  2H7E A;  2K2U A;  4K2P A;  2VSZ A;  4A6K A;  1DYN A;  2D9V A;  5J3Y A;  2DX5 A;  3VIA A;  4D0N B;  1EF1 A;  4CHJ A;  2UVM A;  3O96 A;  3A58 A;  3PP2 A;  1OMW A;  3ODO A;  1ZSQ A;  2M14 A;  2DHI A;  1DDW A;  4YON A;  1M7R A;  3LJU X;  3BJI A;  1WI1 A;  1H10 A;  4MK0 A;  1WG7 A;  1T77 A;  2ADZ A;  2ROZ B;  1TXD A;  1MAI A;  4TYZ A;  1FB8 A;  2GUM A;  3SYX A;  5HE1 A;  1MIZ B;  2KCJ A;  3TO1 A;  2COC A;  1DDM A;  1MI1 A;  3QBV B;  2NMB A;  2I1J A;  3NSU A;  3VOQ A;  2YS3 A;  2RUK B;  2YSZ A;  4GN1 A;  1W1D A;  2Z14 A;  1WGU A;  2DX1 A;  1V88 A;  3SUZ A;  2YRY A;  4A6H A;  5L81 A;  1KZ7 A;  3U8Z A;  2R09 A;  1DBH A;  4GXB A;  1AQC A;  2CY5 A;  2EMT A;  4QXA B;  4Z2M B;  1X05 A;  2L1C A;  4CYE A;  2FJL A;  2X18 A;  4B6H A;  4HDQ A;  2RLO A;  1U2B A;  4HAV B;  3DCX A;  4CHM A;  3PG7 A;  2COD A;  2NZ8 B;  4KVG B;  2XQN M;  1MPH A;  2RNR B;  4A6F A;  5JHG A;  2V76 A;  3AU4 A;  5FI0 A;  1NTY A;  2W2W A;  2M38 A;  5DIF B;  1ZC3 B;  1FAO A;  1ZC4 B;  2I5F A;  1XR0 B;  1TJ6 A;  4Z2N A;  2COF A;  1U27 A;  1V5P A;  2YVC A;  3QWM A;  2DN6 A;  2KIE A;  2J0J A;  2D9Y A;  2ZKM X;  3F0W A;  2LYD A;  5HE2 A;  1NTV A;  1XCG A;  3HSA A;  1ZYI A;  3N7C A;  3TFM A;  3OHM B;  1QQG A;  1EAZ A;  3UZT A;  2D10 A;  4A5K A;  1K5G B;  1N3H A;  2CAY A;  3MPX A;  2Y8F A;  4QJ3 B;  4HSI A;  2DLW A;  1BAK A;  2KUQ A;  1W1G A;  2DFK A;  2AL6 A;  1UPQ A;  4ZRJ A;  3D8E A;  3T06 A;  2H7D A;  3CIK A;  4ZRK A;  1OY2 A;  2DTC A;  2PZ1 A;  4GZU A;  3WYF B;  1P5T A;  2D9W A;  1WVH A;  2AEH A;  5C16 A;  1XKE A;  1V5M A;  2MWN B;  3WA0 A;  1FGZ A;  4IFS A;  4XWX A;  3ZDT A;  5D27 A;  1K5D B;  2ELA A;  4GMX B;  2K8E A;  1XOD A;  3ODX A;  4QJ4 B;  4K2O A;  5CLL B;  2Z4D A;  3IVF A;  4DBB A;  2D2Q A;  2LKO A;  2J0M A;  1Y19 B;  4KHA A;  3PVW A;  2DA0 A;  1OQN A;  1P3R A;  3SNH A;  2K00 A;  4F7U P;  4GOU A;  2DKP A;  2J0K A;  3HW2 B;  5C5B A;  2VKI A;  1NU2 A;  1UNQ A;  2P8V A;  5DH9 B;  1UEF A;  3X23 A;  3GYO A;  1B55 A;  1U5F A;  4F7G A;  1X11 A;  2KR0 A;  2P0D A;  4KHB A;  5KQ1 A;  5IRS A;  5EFX A;  1U5E A;  5LG4 B;  1WJ1 A;  1Z87 A;  4EKU A; 
#chains in the Genus database with same CATH homology
 4HAZ B;  2IYB A;  2R0D A;  2LOZ A;  1V5U A;  2QKM A;  1AWE A;  1P6S A;  4IOY X;  1V89 A;  4F7H A;  1FHW A;  2YT0 A;  1Q67 A;  5CLQ B;  5GOW B;  2K2J A;  4DX9 0;  4HAY B;  3A98 B;  4KHB B;  1RJ2 A;  2HE7 A;  3P6A A;  3ODW A;  4EJN A;  2I5C A;  2ROV A;  1J0W A;  5D3V A;  4P7I A;  3RCP A;  1LB1 A;  1WJM A;  2GCL A;  3DXC A;  3P7Z A;  1BTK A;  2Z0Q A;  1NI2 A;  1J19 A;  1I2H A;  1U5G A;  2DKQ A;  2LUL A;  2UZR A;  1BTN A;  1XD4 A;  1KZG A;  3A8Q A;  4C0A A;  2P0F A;  1QC6 A;  2BCJ A;  4HHV A;  1PFJ A;  1X1F A;  2ELB A;  4A6F B;  2LOX A;  1DRO A;  4K17 A;  4GPT B;  5D3Y A;  5HE0 A;  3TVV A;  1EVH A;  3FM8 C;  3HK0 A;  3KZ1 A;  3ML4 A;  2N23 A;  1I7A A;  2I1K A;  4GMV A;  2YF0 A;  1SGH A;  4HAW B;  2Y8G A;  1X1G A;  4HB0 B;  1GC7 A;  1UNP A;  2D11 A;  5KCV A;  4WSF A;  3GYP A;  2GJY A;  4TKN A;  3MDB C;  2YT1 A;  2Z0O A;  2Z0P A;  3OAN A;  1SHC A;  5DHA B;  1IRS A;  2GS0 A;  4PNK A;  2P0H A;  1EGX A;  2COA A;  4WVF B;  1UNR A;  2RGN B;  3DXD A;  4HAU B;  4MY6 A;  1MK7 B;  2DHK A;  3M1I B;  3KY9 A;  2YS1 A;  5D3W A;  2MDX A;  3V5W A;  5JP4 A;  5JLJ B;  5JHH A;  4HB4 B;  2DYN A;  3SV1 A;  3PVU A;  3ZVR A;  3DXE A;  2OTX A;  5KQ4 A;  4NY0 A;  3PVL A;  3KSY A;  3PEG A;  1U29 A;  2D9Z A;  1ZM0 A;  5C5B B;  2GCJ A;  2J59 M;  3KRW A;  1TQZ A;  2G35 A;  2KUP A;  3A8P A;  5LOP B;  1FGY A;  4YL8 A;  5J3Q A;  3FEH A;  3HQC A;  5C6R A;  1PLS A;  3F5R A;  2ZPY A;  1XX0 A;  1KI1 B;  2CRF A;  5DI9 B;  1BWN A;  4WJ7 A;  3TW1 A;  2OQB A;  4HB2 B;  4NSW A;  4MT7 A;  1M7E A;  2DYQ A;  1FHX A;  2N0Y A;  1U5D A;  4BBK A;  1FOE A;  3KRX A;  1UPR A;  4DX8 A;  5D3X A;  1WGQ A;  4HAX B;  4DXA B;  1ZVR A;  1E5W A;  5LON B;  3SO6 A;  4Y94 A;  1LW3 A;  1V61 A;  4PQ0 A;  4KAX B;  4EMO A;  2E2X A;  2RSG A;  1FHO A;  1PMS A;  3AJ4 A;  5FI1 A;  1ISN A;  1MIX A;  2W2X C;  1MKE A;  3ULC A;  1GG3 A;  4HB3 B;  2W2X D;  1X86 A;  2L2I A;  4ZRI A;  5C79 A;  2YS5 A;  3D8F A;  5J3T A;  2EMS A;  2VRW B;  2EC1 A;  3G9W A;  3AU5 A;  3TCA A;  4H8S A;  1MK9 B;  2Y7B A;  2IFS A;  4HDO A;  2MFQ A;  5HE3 A;  3ULB A;  3PZD A;  4KHO A;  4L6E A;  1H4R A;  2UZS A;  2RVB B;  3CXB B;  2QKL A;  3FSS A;  1Y5O A;  2KGX B;  3D8D A;  4K81 A;  2EJ8 A;  2CY4 A;  2DHJ A;  2LG1 A;  2HTH B;  2MKR A;  4IAP A;  3PSC A;  2JP2 A;  5DHF B;  1DDV A;  3QIJ A;  1W1H A;  2D9X A;  3BIN A;  1GC6 A;  2Q13 A;  1RRP B;  2D4Q A;  4HAT B;  3U7D A;  2H7E A;  2K2U A;  4K2P A;  2VSZ A;  4A6K A;  1DYN A;  2D9V A;  5J3Y A;  2DX5 A;  3VIA A;  4D0N B;  1EF1 A;  4CHJ A;  2UVM A;  3O96 A;  3PP2 A;  1OMW A;  3ODO A;  1ZSQ A;  2M14 A;  2DHI A;  1DDW A;  4YON A;  1M7R A;  3LJU X;  3BJI A;  1WI1 A;  1H10 A;  4MK0 A;  1WG7 A;  2ADZ A;  2ROZ B;  1TXD A;  1MAI A;  4TYZ A;  1FB8 A;  3SYX A;  5HE1 A;  1MIZ B;  2KCJ A;  3TO1 A;  2COC A;  1DDM A;  3QBV B;  2NMB A;  2I1J A;  3NSU A;  3VOQ A;  2YS3 A;  2RUK B;  2YSZ A;  4GN1 A;  1W1D A;  1WGU A;  2DX1 A;  1V88 A;  3SUZ A;  2YRY A;  4A6H A;  5L81 A;  1KZ7 A;  3U8Z A;  2R09 A;  1DBH A;  4GXB A;  1AQC A;  2CY5 A;  2EMT A;  4Z2M B;  1X05 A;  2L1C A;  4CYE A;  2FJL A;  2X18 A;  4B6H A;  4HDQ A;  2RLO A;  1U2B A;  4HAV B;  4CHM A;  3PG7 A;  2COD A;  2NZ8 B;  4KVG B;  2XQN M;  1MPH A;  2RNR B;  4A6F A;  5JHG A;  2V76 A;  3AU4 A;  5FI0 A;  1NTY A;  2W2W A;  2M38 A;  5DIF B;  1ZC3 B;  1FAO A;  1ZC4 B;  2I5F A;  1XR0 B;  1TJ6 A;  4Z2N A;  2COF A;  1U27 A;  1V5P A;  2YVC A;  3QWM A;  2DN6 A;  2J0J A;  2D9Y A;  3F0W A;  2LYD A;  5HE2 A;  1NTV A;  1XCG A;  3N7C A;  3TFM A;  1QQG A;  1EAZ A;  3UZT A;  2D10 A;  4A5K A;  1K5G B;  1N3H A;  2CAY A;  3MPX A;  2Y8F A;  2DLW A;  1BAK A;  1W1G A;  2DFK A;  2AL6 A;  1UPQ A;  4ZRJ A;  3D8E A;  3T06 A;  2H7D A;  3CIK A;  4ZRK A;  1OY2 A;  2DTC A;  2PZ1 A;  4GZU A;  3WYF B;  1P5T A;  2D9W A;  1WVH A;  2AEH A;  5C16 A;  1XKE A;  1V5M A;  2MWN B;  3WA0 A;  1FGZ A;  4IFS A;  4XWX A;  3ZDT A;  5D27 A;  1K5D B;  2ELA A;  4GMX B;  1XOD A;  3ODX A;  4K2O A;  5CLL B;  4DBB A;  3IVF A;  2D2Q A;  2LKO A;  2J0M A;  1Y19 B;  4KHA A;  3PVW A;  2DA0 A;  1OQN A;  1P3R A;  3SNH A;  2K00 A;  4F7U P;  2DKP A;  2J0K A;  3HW2 B;  5C5B A;  2VKI A;  1NU2 A;  1UNQ A;  2P8V A;  5DH9 B;  1UEF A;  3X23 A;  3GYO A;  1B55 A;  1U5F A;  4F7G A;  1X11 A;  2P0D A;  5KQ1 A;  5EFX A;  1U5E A;  1WJ1 A;  1Z87 A;  4EKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...