2Y7BA

Crystal structure of the ph domain of human actin-binding protein anillin anln
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
134
structure length
134
Chain Sequence
VNSSVEERGFLTIFEDVSGFGAWHRRWCVLSGNCISYWTYPDDEKRKNPIGRINLANCTSRQIEPANREFCARRNTFELITVRPQREDDRETLVSQCRDTLCVTKNWLSADTKEERDLWMQKLNQVLVDIRLWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Ph Domain of Human Actin-Binding Protein Anillin Anln
rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords ACTIN-BINDING PROTEIN ANILLIN
total genus 33
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2011-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2y7bA00
1XKEA 4WSFA 3ODWA 3QIJA 3PZDA 2R09A 4NSWA 4YL8A 1EGXA 4KVGB 1GG3A 2OTXA 4L6EA 1V89A 2L1CA 2RVBB 2D9YA 2D9WA 4HDQA 3PVLA 5JP4A 2YT0A 1TQZA 5DH9B 1NTYA 2EMTA 1ZSQA 2EJ8A 2P0FA 2YS3A 1M7RA 1V5PA 5HE0A 4EJNA 2VRWB 5FI1A 3UZTA 4HAXB 2YVCA 1WI1A 5L81A 1XODA 3ODXA 1K5DB 1MK9B 2AEHA 5D3YA 2RGNB 5J3YA 4EKUA 2GCLA 4F7GA 3PVUA 3ULBA 4PNKA 2W2XD 3A8PA 3TO1A 1UNRA 4A6HA 4P7IA 3X23A 4K2PA 4HB0B 1J19A 3FM8C 1E5WA 2KGXB 1MIZB 4EMOA 2COAA 5HE1A 1X11A 3SYXA 1NU2A 1KZGA 2YF0A 2NMBA 2Y8FA 2Y8GA 3HQCA 1DBHA 2QKMA 3ML4A 4CYEA 2D10A 1X1GA 2I5FA 3KRWA 4GXBA 2CAYA 1UNQA 2UZSA 4NY0A 4ZRKA 1UPRA 1BTNA 1P3RA 1V5MA 1LB1A 3TW1A 5D27A 1GC7A 5KCVA 2GCJA 5C5BB 2W2XC 3SUZA 5C5BA 4K17A 2LG1A 2D4QA 4GMVA 4YONA 2YRYA 4MY6A 1FHXA 4KHAA 5D3XA 3U8ZA 3TVVA 2J0JA 4A5KA 3VOQA 1U5EA 2MWNB 1SHCA 4GN1A 4A6FA 4BBKA 2G35A 3O96A 1ZC3B 3CIKA 5JHGA 1UNPA 4HHVA 3PVWA 2D2QA 2J0MA 5C6RA 2V76A 1ZM0A 3AJ4A 2Q13A 4A6KA 1TJ6A 2EC1A 2DX5A 2DN6A 2ROZB 3WYFB 2JP2A 3P6AA 2J0KA 3G9WA 3AU5A 2Z0OA 4C0AA 4DXAB 2PZ1A 1U5GA 3RCPA 3BJIA 3DXEA 3VIAA 2DFKA 1OY2A 2W2WA 4D0NB 2MKRA 3M1IB 1EF1A 2N23A 4HAZB 5KQ1A 3D8DA 2IYBA 4MT7A 3MDBC 1V88A 2I1JA 2M38A 2COFA 1FHOA 1OQNA 2DHJA 3KRXA 3ZDTA 1Z87A 4KHBB 4ZRJA 2Y7BA 2VSZA 3PEGA 1WGQA 2ELBA 5CLQB 2X18A 1ISNA 1DYNA 4A6FB 2DX1A 4HB4B 3QBVB 1KI1B 1XR0B 2I1KA 2AL6A 4Z2NA 1QQGA 4CHMA 3QWMA 1TXDA 4F7HA 4WVFB 1H4RA 2KUPA 4DX8A 1XX0A 3F0WA 3FEHA 2YS5A 1Y19B 2RSGA 2DKQA 2OQBA 1FAOA 2HTHB 1N3HA 1B55A 2P0HA 1DDVA 1ZVRA 1KZ7A 3FSSA 2K2JA 2H7DA 3BINA 1WJ1A 3TFMA 3N7CA 4DBBA 1P6SA 3TCAA 3D8EA 2CY4A 3GYOA 4TKNA 5D3VA 2GS0A 1UEFA 1WGUA 4HATB 3DXCA 1V61A 2UVMA 2MDXA 1MPHA 1AWEA 4F7UP 1X05A 2CRFA 4HB3B 3WA0A 5FI0A 4HAWB 2FJLA 3D8FA 3ZVRA 1OMWA 2K2UA 1I7AA 2DLWA 2DYQA 5HE2A 2IFSA 1LW3A 2H7EA 2VKIA 4PQ0A 3U7DA 5D3WA 1W1GA 1M7EA 1U29A 3NSUA 1P5TA 2LOZA 1WJMA 4GZUA 1U5DA 3SV1A 5J3QA 2DYNA 3SNHA 3PSCA 5C16A 3GYPA 4HAVB 1WVHA 5CLLB 4IFSA 1FOEA 2D9XA 5DHFB 1WG7A 3CXBB 1EVHA 1Y5OA 1NI2A 3SO6A 1DDWA 5C79A 5DIFB 2BCJA 2COCA 2YT1A 5JHHA 3ODOA 4HDOA 3A98B 3LJUX 4DX90 5J3TA 2DTCA 1PLSA 4KHOA 2CODA 1W1DA 1UPQA 1MAIA 3PG7A 4ZRIA 4K2OA 1I2HA 1U2BA 1FGZA 5JLJB 3DXDA 2ROVA 3KZ1A 4Z2MB 1RRPB 1XD4A 2Z0QA 2QKLA 5EFXA 1DROA 5LONB 2RLOA 1DDMA 2DA0A 2LKOA 2HE7A 5DHAB 4WJ7A 1SGHA 2Z0PA 4IAPA 1K5GB 4KAXB 5GOWB 2LYDA 2DHIA 2D9VA 1MK7B 1U5FA 1FHWA 4B6HA 1PFJA 1PMSA 4HB2B 3OANA 4H8SA 2P0DA 1X86A 3MPXA 1FB8A 2DKPA 1NTVA 1W1HA 2K00A 2N0YA 5DI9B 2ZPYA 1H10A 3V5WA 1FGYA 4TYZA 1MIXA 1ZC4B 2YS1A 2E2XA 2RUKB 2D9ZA 3KY9A 1BAKA 2XQNM 1BWNA 4K81A 1J0WA 1V5UA 1IRSA 3P7ZA 2CY5A 2LOXA 2P8VA 2KCJA 2MFQA 2EMSA 2I5CA 2R0DA 3F5RA 2NZ8B 4HAYB 2D11A 1GC6A 2UZRA 3HW2B 2ADZA 1EAZA 4IOYX 1XCGA 2ELAA 2LULA 3T06A 1AQCA 1BTKA 2J59M 3ULCA 2YSZA 1QC6A 3IVFA 5HE3A 4CHJA 4MK0A 1X1FA 2DHKA 4GMXB 5KQ4A 2M14A 4Y94A 1U27A 3KSYA 1MKEA 4XWXA 2RNRB 4HAUB 1Q67A 4GPTB 3A8QA 3HK0A 5LOPB 3PP2A 1RJ2A 2GJYA 2L2IA 3AU4A
chains in the Genus database with same CATH superfamily
1XKEA 4WSFA 3ODWA 3QIJA 3PZDA 3NWDA 2R09A 4NSWA 4YL8A 1EGXA 4KVGB 1GG3A 2OTXA 4L6EA 1V89A 2L1CA 2RVBB 2D9YA 2D9WA 4HDQA 3PVLA 4QJ5B 5JP4A 2YT0A 1TQZA 5DH9B 1NTYA 2EMTA 1ZSQA 2EJ8A 2P0FA 2YS3A 1M7RA 1V5PA 5HE0A 4EJNA 2VRWB 5FI1A 4HSIA 3UZTA 4HAXB 2YVCA 1WI1A 5L81A 1XODA 3ODXA 1K5DB 1MK9B 2AEHA 5D3YA 2RGNB 5J3YA 4EKUA 2GCLA 4F7GA 3PVUA 3ULBA 4PNKA 2W2XD 3A8PA 3TO1A 1UNRA 2R2YA 4A6HA 4P7IA 3X23A 4K2PA 4HB0B 1J19A 3FM8C 1E5WA 2KGXB 1MIZB 4EMOA 2COAA 5HE1A 1X11A 3SYXA 1NU2A 1KZGA 2KIEA 2RRFA 2NMBA 2Y8FA 2Y8GA 2YF0A 3HQCA 1DBHA 2QKMA 3ML4A 4CYEA 2D10A 1X1GA 3NWFA 2I5FA 3KRWA 4GXBA 5LG4B 2CAYA 1UNQA 2UZSA 4NY0A 4ZRKA 1UPRA 1BTNA 1P3RA 1V5MA 1LB1A 3TW1A 5D27A 1GC7A 5KCVA 2GCJA 5C5BB 2W2XC 3SUZA 5C5BA 4K17A 2LG1A 3B77A 2GUMA 2Z13A 2D4QA 4GMVA 4YONA 2YRYA 4MY6A 1FHXA 4KHAA 5D3XA 3U8ZA 3TVVA 2J0JA 4A5KA 3VOQA 1U5EA 2MWNB 1SHCA 4GN1A 4A6FA 4BBKA 2G35A 3O96A 1ZC3B 3CIKA 5JHGA 2ZKMX 1UNPA 4HHVA 3PVWA 2D2QA 2J0MA 5C6RA 3NWAA 2V76A 1ZM0A 3AJ4A 2Q13A 4A6KA 1TJ6A 2EC1A 2DX5A 2DN6A 2ROZB 3WYFB 2JP2A 3P6AA 2J0KA 3G9WA 3AU5A 2Z0OA 2KR0A 4C0AA 4DXAB 2PZ1A 1U5GA 3RCPA 3BJIA 3DXEA 3VIAA 2DFKA 1OY2A 2W2WA 4D0NB 2MKRA 3M1IB 1EF1A 2N23A 4HAZB 5KQ1A 3D8DA 2IYBA 4MT7A 3MDBC 1V88A 2I1JA 2M38A 2COFA 1FHOA 1OQNA 2DHJA 3KRXA 3ZDTA 1Z87A 4KHBB 4ZRJA 2Y7BA 2VSZA 3PEGA 5IRSA 1WGQA 2ELBA 5CLQB 2X18A 2YT2A 1ISNA 1DYNA 5I2MA 4A6FB 2DX1A 4HB4B 3QBVB 1KI1B 1XR0B 2I1KA 2KUQA 2AL6A 4Z2NA 1QQGA 4QJ4B 4CHMA 3QWMA 1TXDA 4F7HA 4WVFB 3A58A 1H4RA 2KUPA 4DX8A 1XX0A 3F0WA 3FEHA 2YS5A 1Y19B 2RSGA 2DKQA 2OQBA 1FAOA 2HTHB 2Z59A 4QXAB 1N3HA 1B55A 2P0HA 1DDVA 1ZVRA 1KZ7A 3FSSA 2K2JA 2H7DA 3BINA 1WJ1A 3TFMA 3N7CA 4DBBA 1P6SA 3TCAA 3D8EA 5I2SA 2CY4A 3GYOA 1ZYIA 4TKNA 5D3VA 2GS0A 1UEFA 1WGUA 4HATB 3DXCA 3HIEA 2K49A 1V61A 2UVMA 2MDXA 1MPHA 1AWEA 4F7UP 1X05A 2CRFA 4HB3B 3WA0A 5FI0A 3FVCA 4HAWB 2FJLA 3D8FA 3ZVRA 1OMWA 2K2UA 1I7AA 3U12A 2DLWA 2DYQA 5HE2A 2IFSA 1LW3A 2H7EA 2VKIA 4PQ0A 3U7DA 5D3WA 1W1GA 1M7EA 3DCXA 1U29A 3NSUA 1P5TA 2LOZA 1WJMA 4GZUA 1U5DA 3SV1A 5J3QA 2DYNA 3SNHA 3PSCA 5C16A 4GNKB 4OT1A 3GYPA 4HAVB 1WVHA 2NBVA 5CLLB 4IFSA 1FOEA 2D9XA 5DHFB 1WG7A 3CXBB 1EVHA 1Y5OA 1NI2A 3SO6A 1DDWA 5C79A 5DIFB 2BCJA 2COCA 2YT1A 5JHHA 3ODOA 4HDOA 3A98B 3LJUX 4DX90 5J3TA 2DTCA 1PLSA 1MI1A 4KHOA 2FJUB 2CODA 1W1DA 1UPQA 1MAIA 3PG7A 4ZRIA 4K2OA 1I2HA 1U2BA 1FGZA 5JLJB 3DXDA 2ROVA 3KZ1A 4Z2MB 1RRPB 1XD4A 2Z0QA 2QKLA 5EFXA 1DROA 5LONB 2RLOA 1DDMA 2DA0A 2LKOA 5M4YB 2K8EA 2HE7A 5DHAB 4WJ7A 1SGHA 2Z0PA 4IAPA 4OSNA 1K5GB 4KAXB 4CSQA 5GOWB 4KHBA 2LYDA 2DHIA 2D9VA 1MK7B 1U5FA 1FHWA 2KIGA 4B6HA 1PFJA 1PMSA 4HB2B 3OANA 4H8SA 2P0DA 1X86A 3MPXA 1FB8A 2DKPA 1NTVA 1W1HA 2K00A 2N0YA 5DI9B 2ZPYA 1H10A 3V5WA 3HSAA 1FGYA 4TYZA 1MIXA 1ZC4B 2YS1A 4GOUA 2E2XA 2RUKB 2D9ZA 3KY9A 1BAKA 2XQNM 4QJ3B 1BWNA 4K81A 1J0WA 1V5UA 1IRSA 3NW8A 1T77A 2Z4DA 3P7ZA 2CY5A 2LOXA 4L1RA 2P8VA 2KCJA 2MFQA 2EMSA 2I5CA 3OHMB 4DIXA 2R0DA 3F5RA 2NZ8B 4HAYB 2D11A 1GC6A 2UZRA 3HW2B 2ADZA 1EAZA 4IOYX 1XCGA 2ELAA 2LULA 3T06A 1AQCA 1BTKA 2J59M 3ULCA 2YSZA 2Z14A 1QC6A 3IVFA 5HE3A 4CHJA 4MK0A 1X1FA 2DHKA 4GMXB 5KQ4A 2M14A 4Y94A 1U27A 3KSYA 4D6WA 1MKEA 4XWXA 2RNRB 4HAUB 1Q67A 3A8QA 3HK0A 4GPTB 5LOPB 3PP2A 1RJ2A 2GJYA 2L2IA 3AU4A
chains in the Genus database with same CATH topology
1XKEA 4WSFA 3ODWA 3QIJA 3PZDA 2R09A 4NSWA 4YL8A 1EGXA 4KVGB 1GG3A 2OTXA 4L6EA 1V89A 2L1CA 2RVBB 2D9YA 2D9WA 4HDQA 3PVLA 5JP4A 2YT0A 1TQZA 5DH9B 1NTYA 2EMTA 1ZSQA 2EJ8A 2P0FA 2YS3A 1M7RA 1V5PA 5HE0A 4EJNA 2VRWB 5FI1A 3UZTA 4HAXB 2YVCA 1WI1A 5L81A 1XODA 3ODXA 1K5DB 1MK9B 2AEHA 5D3YA 2RGNB 5J3YA 4EKUA 2GCLA 4F7GA 3PVUA 3ULBA 4PNKA 2W2XD 3A8PA 3TO1A 1UNRA 4A6HA 4P7IA 3X23A 4K2PA 4HB0B 1J19A 3FM8C 1E5WA 2KGXB 1MIZB 4EMOA 2COAA 5HE1A 1X11A 3SYXA 1NU2A 1KZGA 2YF0A 2NMBA 2Y8FA 2Y8GA 3HQCA 1DBHA 2QKMA 3ML4A 4CYEA 2D10A 1X1GA 2I5FA 3KRWA 4GXBA 2CAYA 1UNQA 2UZSA 4NY0A 4ZRKA 1UPRA 1BTNA 1P3RA 1V5MA 1LB1A 3TW1A 5D27A 1GC7A 5KCVA 2GCJA 5C5BB 2W2XC 3SUZA 5C5BA 4K17A 2LG1A 2D4QA 4GMVA 4YONA 2YRYA 4MY6A 1FHXA 4KHAA 5D3XA 3U8ZA 3TVVA 2J0JA 4A5KA 3VOQA 1U5EA 2MWNB 1SHCA 4GN1A 4A6FA 4BBKA 2G35A 3O96A 1ZC3B 3CIKA 5JHGA 1UNPA 4HHVA 3PVWA 2D2QA 2J0MA 5C6RA 2V76A 1ZM0A 3AJ4A 2Q13A 4A6KA 1TJ6A 2EC1A 2DX5A 2DN6A 2ROZB 3WYFB 2JP2A 3P6AA 2J0KA 3G9WA 3AU5A 2Z0OA 4C0AA 4DXAB 2PZ1A 1U5GA 3RCPA 3BJIA 3DXEA 3VIAA 2DFKA 1OY2A 2W2WA 4D0NB 2MKRA 3M1IB 1EF1A 2N23A 4HAZB 5KQ1A 3D8DA 2IYBA 4MT7A 3MDBC 1V88A 2I1JA 2M38A 2COFA 1FHOA 1OQNA 2DHJA 3KRXA 3ZDTA 1Z87A 4KHBB 4ZRJA 2Y7BA 2VSZA 3PEGA 1WGQA 2ELBA 5CLQB 2X18A 1ISNA 1DYNA 4A6FB 2DX1A 4HB4B 3QBVB 1KI1B 1XR0B 2I1KA 2AL6A 4Z2NA 1QQGA 4CHMA 3QWMA 1TXDA 4F7HA 4WVFB 1H4RA 2KUPA 4DX8A 1XX0A 3F0WA 3FEHA 2YS5A 1Y19B 2RSGA 2DKQA 2OQBA 1FAOA 2HTHB 1N3HA 1B55A 2P0HA 1DDVA 1ZVRA 1KZ7A 3FSSA 2K2JA 2H7DA 3BINA 1WJ1A 3TFMA 3N7CA 4DBBA 1P6SA 3TCAA 3D8EA 2CY4A 3GYOA 4TKNA 5D3VA 2GS0A 1UEFA 1WGUA 4HATB 3DXCA 1V61A 2UVMA 2MDXA 1MPHA 1AWEA 4F7UP 1X05A 2CRFA 4HB3B 3WA0A 5FI0A 4HAWB 2FJLA 3D8FA 3ZVRA 1OMWA 2K2UA 1I7AA 2DLWA 2DYQA 5HE2A 2IFSA 1LW3A 2H7EA 2VKIA 4PQ0A 3U7DA 5D3WA 1W1GA 1M7EA 1U29A 3NSUA 1P5TA 2LOZA 1WJMA 4GZUA 1U5DA 3SV1A 5J3QA 2DYNA 3SNHA 3PSCA 5C16A 3GYPA 4HAVB 1WVHA 5CLLB 4IFSA 1FOEA 2D9XA 5DHFB 1WG7A 3CXBB 1EVHA 1Y5OA 1NI2A 3SO6A 1DDWA 5C79A 5DIFB 2BCJA 2COCA 2YT1A 5JHHA 3ODOA 4HDOA 3A98B 3LJUX 4DX90 5J3TA 2DTCA 1PLSA 4KHOA 2CODA 1W1DA 1UPQA 1MAIA 3PG7A 4ZRIA 4K2OA 1I2HA 1U2BA 1FGZA 5JLJB 3DXDA 2ROVA 3KZ1A 4Z2MB 1RRPB 1XD4A 2Z0QA 2QKLA 5EFXA 1DROA 5LONB 2RLOA 1DDMA 2DA0A 2LKOA 2HE7A 5DHAB 4WJ7A 1SGHA 2Z0PA 4IAPA 1K5GB 4KAXB 5GOWB 2LYDA 2DHIA 2D9VA 1MK7B 1U5FA 1FHWA 4B6HA 1PFJA 1PMSA 4HB2B 3OANA 4H8SA 2P0DA 1X86A 3MPXA 1FB8A 2DKPA 1NTVA 1W1HA 2K00A 2N0YA 5DI9B 2ZPYA 1H10A 3V5WA 1FGYA 4TYZA 1MIXA 1ZC4B 2YS1A 2E2XA 2RUKB 2D9ZA 3KY9A 1BAKA 2XQNM 1BWNA 4K81A 1J0WA 1V5UA 1IRSA 3P7ZA 2CY5A 2LOXA 2P8VA 2KCJA 2MFQA 2EMSA 2I5CA 2R0DA 3F5RA 2NZ8B 4HAYB 2D11A 1GC6A 2UZRA 3HW2B 2ADZA 1EAZA 4IOYX 1XCGA 2ELAA 2LULA 3T06A 1AQCA 1BTKA 2J59M 3ULCA 2YSZA 1QC6A 3IVFA 5HE3A 4CHJA 4MK0A 1X1FA 2DHKA 4GMXB 5KQ4A 2M14A 4Y94A 1U27A 3KSYA 1MKEA 4XWXA 2RNRB 4HAUB 1Q67A 4GPTB 3A8QA 3HK0A 5LOPB 3PP2A 1RJ2A 2GJYA 2L2IA 3AU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XKE A;  4WSF A;  3ODW A;  3QIJ A;  3PZD A;  2R09 A;  4NSW A;  4YL8 A;  1EGX A;  4KVG B;  1GG3 A;  2OTX A;  4L6E A;  1V89 A;  2L1C A;  2RVB B;  2D9Y A;  2D9W A;  4HDQ A;  3PVL A;  5JP4 A;  2YT0 A;  1TQZ A;  5DH9 B;  1NTY A;  2EMT A;  1ZSQ A;  2EJ8 A;  2P0F A;  2YS3 A;  1M7R A;  1V5P A;  5HE0 A;  4EJN A;  2VRW B;  5FI1 A;  3UZT A;  4HAX B;  2YVC A;  1WI1 A;  5L81 A;  1XOD A;  3ODX A;  1K5D B;  1MK9 B;  2AEH A;  5D3Y A;  2RGN B;  5J3Y A;  4EKU A;  2GCL A;  4F7G A;  3PVU A;  3ULB A;  4PNK A;  2W2X D;  3A8P A;  3TO1 A;  1UNR A;  4A6H A;  4P7I A;  3X23 A;  4K2P A;  4HB0 B;  1J19 A;  3FM8 C;  1E5W A;  2KGX B;  1MIZ B;  4EMO A;  2COA A;  5HE1 A;  1X11 A;  3SYX A;  1NU2 A;  1KZG A;  2YF0 A;  2NMB A;  2Y8F A;  2Y8G A;  3HQC A;  1DBH A;  2QKM A;  3ML4 A;  4CYE A;  2D10 A;  1X1G A;  2I5F A;  3KRW A;  4GXB A;  2CAY A;  1UNQ A;  2UZS A;  4NY0 A;  4ZRK A;  1UPR A;  1BTN A;  1P3R A;  1V5M A;  1LB1 A;  3TW1 A;  5D27 A;  1GC7 A;  5KCV A;  2GCJ A;  5C5B B;  2W2X C;  3SUZ A;  5C5B A;  4K17 A;  2LG1 A;  2D4Q A;  4GMV A;  4YON A;  2YRY A;  4MY6 A;  1FHX A;  4KHA A;  5D3X A;  3U8Z A;  3TVV A;  2J0J A;  4A5K A;  3VOQ A;  1U5E A;  2MWN B;  1SHC A;  4GN1 A;  4A6F A;  4BBK A;  2G35 A;  3O96 A;  1ZC3 B;  3CIK A;  5JHG A;  1UNP A;  4HHV A;  3PVW A;  2D2Q A;  2J0M A;  5C6R A;  2V76 A;  1ZM0 A;  3AJ4 A;  2Q13 A;  4A6K A;  1TJ6 A;  2EC1 A;  2DX5 A;  2DN6 A;  2ROZ B;  3WYF B;  2JP2 A;  3P6A A;  2J0K A;  3G9W A;  3AU5 A;  2Z0O A;  4C0A A;  4DXA B;  2PZ1 A;  1U5G A;  3RCP A;  3BJI A;  3DXE A;  3VIA A;  2DFK A;  1OY2 A;  2W2W A;  4D0N B;  2MKR A;  3M1I B;  1EF1 A;  2N23 A;  4HAZ B;  5KQ1 A;  3D8D A;  2IYB A;  4MT7 A;  3MDB C;  1V88 A;  2I1J A;  2M38 A;  2COF A;  1FHO A;  1OQN A;  2DHJ A;  3KRX A;  3ZDT A;  1Z87 A;  4KHB B;  4ZRJ A;  2Y7B A;  2VSZ A;  3PEG A;  1WGQ A;  2ELB A;  5CLQ B;  2X18 A;  1ISN A;  1DYN A;  4A6F B;  2DX1 A;  4HB4 B;  3QBV B;  1KI1 B;  1XR0 B;  2I1K A;  2AL6 A;  4Z2N A;  1QQG A;  4CHM A;  3QWM A;  1TXD A;  4F7H A;  4WVF B;  1H4R A;  2KUP A;  4DX8 A;  1XX0 A;  3F0W A;  3FEH A;  2YS5 A;  1Y19 B;  2RSG A;  2DKQ A;  2OQB A;  1FAO A;  2HTH B;  1N3H A;  1B55 A;  2P0H A;  1DDV A;  1ZVR A;  1KZ7 A;  3FSS A;  2K2J A;  2H7D A;  3BIN A;  1WJ1 A;  3TFM A;  3N7C A;  4DBB A;  1P6S A;  3TCA A;  3D8E A;  2CY4 A;  3GYO A;  4TKN A;  5D3V A;  2GS0 A;  1UEF A;  1WGU A;  4HAT B;  3DXC A;  1V61 A;  2UVM A;  2MDX A;  1MPH A;  1AWE A;  4F7U P;  1X05 A;  2CRF A;  4HB3 B;  3WA0 A;  5FI0 A;  4HAW B;  2FJL A;  3D8F A;  3ZVR A;  1OMW A;  2K2U A;  1I7A A;  2DLW A;  2DYQ A;  5HE2 A;  2IFS A;  1LW3 A;  2H7E A;  2VKI A;  4PQ0 A;  3U7D A;  5D3W A;  1W1G A;  1M7E A;  1U29 A;  3NSU A;  1P5T A;  2LOZ A;  1WJM A;  4GZU A;  1U5D A;  3SV1 A;  5J3Q A;  2DYN A;  3SNH A;  3PSC A;  5C16 A;  3GYP A;  4HAV B;  1WVH A;  5CLL B;  4IFS A;  1FOE A;  2D9X A;  5DHF B;  1WG7 A;  3CXB B;  1EVH A;  1Y5O A;  1NI2 A;  3SO6 A;  1DDW A;  5C79 A;  5DIF B;  2BCJ A;  2COC A;  2YT1 A;  5JHH A;  3ODO A;  4HDO A;  3A98 B;  3LJU X;  4DX9 0;  5J3T A;  2DTC A;  1PLS A;  4KHO A;  2COD A;  1W1D A;  1UPQ A;  1MAI A;  3PG7 A;  4ZRI A;  4K2O A;  1I2H A;  1U2B A;  1FGZ A;  5JLJ B;  3DXD A;  2ROV A;  3KZ1 A;  4Z2M B;  1RRP B;  1XD4 A;  2Z0Q A;  2QKL A;  5EFX A;  1DRO A;  5LON B;  2RLO A;  1DDM A;  2DA0 A;  2LKO A;  2HE7 A;  5DHA B;  4WJ7 A;  1SGH A;  2Z0P A;  4IAP A;  1K5G B;  4KAX B;  5GOW B;  2LYD A;  2DHI A;  2D9V A;  1MK7 B;  1U5F A;  1FHW A;  4B6H A;  1PFJ A;  1PMS A;  4HB2 B;  3OAN A;  4H8S A;  2P0D A;  1X86 A;  3MPX A;  1FB8 A;  2DKP A;  1NTV A;  1W1H A;  2K00 A;  2N0Y A;  5DI9 B;  2ZPY A;  1H10 A;  3V5W A;  1FGY A;  4TYZ A;  1MIX A;  1ZC4 B;  2YS1 A;  2E2X A;  2RUK B;  2D9Z A;  3KY9 A;  1BAK A;  2XQN M;  1BWN A;  4K81 A;  1J0W A;  1V5U A;  1IRS A;  3P7Z A;  2CY5 A;  2LOX A;  2P8V A;  2KCJ A;  2MFQ A;  2EMS A;  2I5C A;  2R0D A;  3F5R A;  2NZ8 B;  4HAY B;  2D11 A;  1GC6 A;  2UZR A;  3HW2 B;  2ADZ A;  1EAZ A;  4IOY X;  1XCG A;  2ELA A;  2LUL A;  3T06 A;  1AQC A;  1BTK A;  2J59 M;  3ULC A;  2YSZ A;  1QC6 A;  3IVF A;  5HE3 A;  4CHJ A;  4MK0 A;  1X1F A;  2DHK A;  4GMX B;  5KQ4 A;  2M14 A;  4Y94 A;  1U27 A;  3KSY A;  1MKE A;  4XWX A;  2RNR B;  4HAU B;  1Q67 A;  4GPT B;  3A8Q A;  3HK0 A;  5LOP B;  3PP2 A;  1RJ2 A;  2GJY A;  2L2I A;  3AU4 A; 
#chains in the Genus database with same CATH topology
 1XKE A;  4WSF A;  3ODW A;  3QIJ A;  3PZD A;  3NWD A;  2R09 A;  4NSW A;  4YL8 A;  1EGX A;  4KVG B;  1GG3 A;  2OTX A;  4L6E A;  1V89 A;  2L1C A;  2RVB B;  2D9Y A;  2D9W A;  4HDQ A;  3PVL A;  4QJ5 B;  5JP4 A;  2YT0 A;  1TQZ A;  5DH9 B;  1NTY A;  2EMT A;  1ZSQ A;  2EJ8 A;  2P0F A;  2YS3 A;  1M7R A;  1V5P A;  5HE0 A;  4EJN A;  2VRW B;  5FI1 A;  4HSI A;  3UZT A;  4HAX B;  2YVC A;  1WI1 A;  5L81 A;  1XOD A;  3ODX A;  1K5D B;  1MK9 B;  2AEH A;  5D3Y A;  2RGN B;  5J3Y A;  4EKU A;  2GCL A;  4F7G A;  3PVU A;  3ULB A;  4PNK A;  2W2X D;  3A8P A;  3TO1 A;  1UNR A;  2R2Y A;  4A6H A;  4P7I A;  3X23 A;  4K2P A;  4HB0 B;  1J19 A;  3FM8 C;  1E5W A;  2KGX B;  1MIZ B;  4EMO A;  2COA A;  5HE1 A;  1X11 A;  3SYX A;  1NU2 A;  1KZG A;  2KIE A;  2RRF A;  2NMB A;  2Y8F A;  2Y8G A;  2YF0 A;  3HQC A;  1DBH A;  2QKM A;  3ML4 A;  4CYE A;  2D10 A;  1X1G A;  3NWF A;  2I5F A;  3KRW A;  4GXB A;  5LG4 B;  2CAY A;  1UNQ A;  2UZS A;  4NY0 A;  4ZRK A;  1UPR A;  1BTN A;  1P3R A;  1V5M A;  1LB1 A;  3TW1 A;  5D27 A;  1GC7 A;  5KCV A;  2GCJ A;  5C5B B;  2W2X C;  3SUZ A;  5C5B A;  4K17 A;  2LG1 A;  3B77 A;  2GUM A;  2Z13 A;  2D4Q A;  4GMV A;  4YON A;  2YRY A;  4MY6 A;  1FHX A;  4KHA A;  5D3X A;  3U8Z A;  3TVV A;  2J0J A;  4A5K A;  3VOQ A;  1U5E A;  2MWN B;  1SHC A;  4GN1 A;  4A6F A;  4BBK A;  2G35 A;  3O96 A;  1ZC3 B;  3CIK A;  5JHG A;  2ZKM X;  1UNP A;  4HHV A;  3PVW A;  2D2Q A;  2J0M A;  5C6R A;  3NWA A;  2V76 A;  1ZM0 A;  3AJ4 A;  2Q13 A;  4A6K A;  1TJ6 A;  2EC1 A;  2DX5 A;  2DN6 A;  2ROZ B;  3WYF B;  2JP2 A;  3P6A A;  2J0K A;  3G9W A;  3AU5 A;  2Z0O A;  2KR0 A;  4C0A A;  4DXA B;  2PZ1 A;  1U5G A;  3RCP A;  3BJI A;  3DXE A;  3VIA A;  2DFK A;  1OY2 A;  2W2W A;  4D0N B;  2MKR A;  3M1I B;  1EF1 A;  2N23 A;  4HAZ B;  5KQ1 A;  3D8D A;  2IYB A;  4MT7 A;  3MDB C;  1V88 A;  2I1J A;  2M38 A;  2COF A;  1FHO A;  1OQN A;  2DHJ A;  3KRX A;  3ZDT A;  1Z87 A;  4KHB B;  4ZRJ A;  2Y7B A;  2VSZ A;  3PEG A;  5IRS A;  1WGQ A;  2ELB A;  5CLQ B;  2X18 A;  2YT2 A;  1ISN A;  1DYN A;  5I2M A;  4A6F B;  2DX1 A;  4HB4 B;  3QBV B;  1KI1 B;  1XR0 B;  2I1K A;  2KUQ A;  2AL6 A;  4Z2N A;  1QQG A;  4QJ4 B;  4CHM A;  3QWM A;  1TXD A;  4F7H A;  4WVF B;  3A58 A;  1H4R A;  2KUP A;  4DX8 A;  1XX0 A;  3F0W A;  3FEH A;  2YS5 A;  1Y19 B;  2RSG A;  2DKQ A;  2OQB A;  1FAO A;  2HTH B;  2Z59 A;  4QXA B;  1N3H A;  1B55 A;  2P0H A;  1DDV A;  1ZVR A;  1KZ7 A;  3FSS A;  2K2J A;  2H7D A;  3BIN A;  1WJ1 A;  3TFM A;  3N7C A;  4DBB A;  1P6S A;  3TCA A;  3D8E A;  5I2S A;  2CY4 A;  3GYO A;  1ZYI A;  4TKN A;  5D3V A;  2GS0 A;  1UEF A;  1WGU A;  4HAT B;  3DXC A;  3HIE A;  2K49 A;  1V61 A;  2UVM A;  2MDX A;  1MPH A;  1AWE A;  4F7U P;  1X05 A;  2CRF A;  4HB3 B;  3WA0 A;  5FI0 A;  3FVC A;  4HAW B;  2FJL A;  3D8F A;  3ZVR A;  1OMW A;  2K2U A;  1I7A A;  3U12 A;  2DLW A;  2DYQ A;  5HE2 A;  2IFS A;  1LW3 A;  2H7E A;  2VKI A;  4PQ0 A;  3U7D A;  5D3W A;  1W1G A;  1M7E A;  3DCX A;  1U29 A;  3NSU A;  1P5T A;  2LOZ A;  1WJM A;  4GZU A;  1U5D A;  3SV1 A;  5J3Q A;  2DYN A;  3SNH A;  3PSC A;  5C16 A;  4GNK B;  4OT1 A;  3GYP A;  4HAV B;  1WVH A;  2NBV A;  5CLL B;  4IFS A;  1FOE A;  2D9X A;  5DHF B;  1WG7 A;  3CXB B;  1EVH A;  1Y5O A;  1NI2 A;  3SO6 A;  1DDW A;  5C79 A;  5DIF B;  2BCJ A;  2COC A;  2YT1 A;  5JHH A;  3ODO A;  4HDO A;  3A98 B;  3LJU X;  4DX9 0;  5J3T A;  2DTC A;  1PLS A;  1MI1 A;  4KHO A;  2FJU B;  2COD A;  1W1D A;  1UPQ A;  1MAI A;  3PG7 A;  4ZRI A;  4K2O A;  1I2H A;  1U2B A;  1FGZ A;  5JLJ B;  3DXD A;  2ROV A;  3KZ1 A;  4Z2M B;  1RRP B;  1XD4 A;  2Z0Q A;  2QKL A;  5EFX A;  1DRO A;  5LON B;  2RLO A;  1DDM A;  2DA0 A;  2LKO A;  5M4Y B;  2K8E A;  2HE7 A;  5DHA B;  4WJ7 A;  1SGH A;  2Z0P A;  4IAP A;  4OSN A;  1K5G B;  4KAX B;  4CSQ A;  5GOW B;  4KHB A;  2LYD A;  2DHI A;  2D9V A;  1MK7 B;  1U5F A;  1FHW A;  2KIG A;  4B6H A;  1PFJ A;  1PMS A;  4HB2 B;  3OAN A;  4H8S A;  2P0D A;  1X86 A;  3MPX A;  1FB8 A;  2DKP A;  1NTV A;  1W1H A;  2K00 A;  2N0Y A;  5DI9 B;  2ZPY A;  1H10 A;  3V5W A;  3HSA A;  1FGY A;  4TYZ A;  1MIX A;  1ZC4 B;  2YS1 A;  4GOU A;  2E2X A;  2RUK B;  2D9Z A;  3KY9 A;  1BAK A;  2XQN M;  4QJ3 B;  1BWN A;  4K81 A;  1J0W A;  1V5U A;  1IRS A;  3NW8 A;  1T77 A;  2Z4D A;  3P7Z A;  2CY5 A;  2LOX A;  4L1R A;  2P8V A;  2KCJ A;  2MFQ A;  2EMS A;  2I5C A;  3OHM B;  4DIX A;  2R0D A;  3F5R A;  2NZ8 B;  4HAY B;  2D11 A;  1GC6 A;  2UZR A;  3HW2 B;  2ADZ A;  1EAZ A;  4IOY X;  1XCG A;  2ELA A;  2LUL A;  3T06 A;  1AQC A;  1BTK A;  2J59 M;  3ULC A;  2YSZ A;  2Z14 A;  1QC6 A;  3IVF A;  5HE3 A;  4CHJ A;  4MK0 A;  1X1F A;  2DHK A;  4GMX B;  5KQ4 A;  2M14 A;  4Y94 A;  1U27 A;  3KSY A;  4D6W A;  1MKE A;  4XWX A;  2RNR B;  4HAU B;  1Q67 A;  3A8Q A;  3HK0 A;  4GPT B;  5LOP B;  3PP2 A;  1RJ2 A;  2GJY A;  2L2I A;  3AU4 A; 
#chains in the Genus database with same CATH homology
 1XKE A;  4WSF A;  3ODW A;  3QIJ A;  3PZD A;  2R09 A;  4NSW A;  4YL8 A;  1EGX A;  4KVG B;  1GG3 A;  2OTX A;  4L6E A;  1V89 A;  2L1C A;  2RVB B;  2D9Y A;  2D9W A;  4HDQ A;  3PVL A;  5JP4 A;  2YT0 A;  1TQZ A;  5DH9 B;  1NTY A;  2EMT A;  1ZSQ A;  2EJ8 A;  2P0F A;  2YS3 A;  1M7R A;  1V5P A;  5HE0 A;  4EJN A;  2VRW B;  5FI1 A;  3UZT A;  4HAX B;  2YVC A;  1WI1 A;  5L81 A;  1XOD A;  3ODX A;  1K5D B;  1MK9 B;  2AEH A;  5D3Y A;  2RGN B;  5J3Y A;  4EKU A;  2GCL A;  4F7G A;  3PVU A;  3ULB A;  4PNK A;  2W2X D;  3A8P A;  3TO1 A;  1UNR A;  4A6H A;  4P7I A;  3X23 A;  4K2P A;  4HB0 B;  1J19 A;  3FM8 C;  1E5W A;  2KGX B;  1MIZ B;  4EMO A;  2COA A;  5HE1 A;  1X11 A;  3SYX A;  1NU2 A;  1KZG A;  2YF0 A;  2NMB A;  2Y8F A;  2Y8G A;  3HQC A;  1DBH A;  2QKM A;  3ML4 A;  4CYE A;  2D10 A;  1X1G A;  2I5F A;  3KRW A;  4GXB A;  2CAY A;  1UNQ A;  2UZS A;  4NY0 A;  4ZRK A;  1UPR A;  1BTN A;  1P3R A;  1V5M A;  1LB1 A;  3TW1 A;  5D27 A;  1GC7 A;  5KCV A;  2GCJ A;  5C5B B;  2W2X C;  3SUZ A;  5C5B A;  4K17 A;  2LG1 A;  2D4Q A;  4GMV A;  4YON A;  2YRY A;  4MY6 A;  1FHX A;  4KHA A;  5D3X A;  3U8Z A;  3TVV A;  2J0J A;  4A5K A;  3VOQ A;  1U5E A;  2MWN B;  1SHC A;  4GN1 A;  4A6F A;  4BBK A;  2G35 A;  3O96 A;  1ZC3 B;  3CIK A;  5JHG A;  1UNP A;  4HHV A;  3PVW A;  2D2Q A;  2J0M A;  5C6R A;  2V76 A;  1ZM0 A;  3AJ4 A;  2Q13 A;  4A6K A;  1TJ6 A;  2EC1 A;  2DX5 A;  2DN6 A;  2ROZ B;  3WYF B;  2JP2 A;  3P6A A;  2J0K A;  3G9W A;  3AU5 A;  2Z0O A;  4C0A A;  4DXA B;  2PZ1 A;  1U5G A;  3RCP A;  3BJI A;  3DXE A;  3VIA A;  2DFK A;  1OY2 A;  2W2W A;  4D0N B;  2MKR A;  3M1I B;  1EF1 A;  2N23 A;  4HAZ B;  5KQ1 A;  3D8D A;  2IYB A;  4MT7 A;  3MDB C;  1V88 A;  2I1J A;  2M38 A;  2COF A;  1FHO A;  1OQN A;  2DHJ A;  3KRX A;  3ZDT A;  1Z87 A;  4KHB B;  4ZRJ A;  2Y7B A;  2VSZ A;  3PEG A;  1WGQ A;  2ELB A;  5CLQ B;  2X18 A;  1ISN A;  1DYN A;  4A6F B;  2DX1 A;  4HB4 B;  3QBV B;  1KI1 B;  1XR0 B;  2I1K A;  2AL6 A;  4Z2N A;  1QQG A;  4CHM A;  3QWM A;  1TXD A;  4F7H A;  4WVF B;  1H4R A;  2KUP A;  4DX8 A;  1XX0 A;  3F0W A;  3FEH A;  2YS5 A;  1Y19 B;  2RSG A;  2DKQ A;  2OQB A;  1FAO A;  2HTH B;  1N3H A;  1B55 A;  2P0H A;  1DDV A;  1ZVR A;  1KZ7 A;  3FSS A;  2K2J A;  2H7D A;  3BIN A;  1WJ1 A;  3TFM A;  3N7C A;  4DBB A;  1P6S A;  3TCA A;  3D8E A;  2CY4 A;  3GYO A;  4TKN A;  5D3V A;  2GS0 A;  1UEF A;  1WGU A;  4HAT B;  3DXC A;  1V61 A;  2UVM A;  2MDX A;  1MPH A;  1AWE A;  4F7U P;  1X05 A;  2CRF A;  4HB3 B;  3WA0 A;  5FI0 A;  4HAW B;  2FJL A;  3D8F A;  3ZVR A;  1OMW A;  2K2U A;  1I7A A;  2DLW A;  2DYQ A;  5HE2 A;  2IFS A;  1LW3 A;  2H7E A;  2VKI A;  4PQ0 A;  3U7D A;  5D3W A;  1W1G A;  1M7E A;  1U29 A;  3NSU A;  1P5T A;  2LOZ A;  1WJM A;  4GZU A;  1U5D A;  3SV1 A;  5J3Q A;  2DYN A;  3SNH A;  3PSC A;  5C16 A;  3GYP A;  4HAV B;  1WVH A;  5CLL B;  4IFS A;  1FOE A;  2D9X A;  5DHF B;  1WG7 A;  3CXB B;  1EVH A;  1Y5O A;  1NI2 A;  3SO6 A;  1DDW A;  5C79 A;  5DIF B;  2BCJ A;  2COC A;  2YT1 A;  5JHH A;  3ODO A;  4HDO A;  3A98 B;  3LJU X;  4DX9 0;  5J3T A;  2DTC A;  1PLS A;  4KHO A;  2COD A;  1W1D A;  1UPQ A;  1MAI A;  3PG7 A;  4ZRI A;  4K2O A;  1I2H A;  1U2B A;  1FGZ A;  5JLJ B;  3DXD A;  2ROV A;  3KZ1 A;  4Z2M B;  1RRP B;  1XD4 A;  2Z0Q A;  2QKL A;  5EFX A;  1DRO A;  5LON B;  2RLO A;  1DDM A;  2DA0 A;  2LKO A;  2HE7 A;  5DHA B;  4WJ7 A;  1SGH A;  2Z0P A;  4IAP A;  1K5G B;  4KAX B;  5GOW B;  2LYD A;  2DHI A;  2D9V A;  1MK7 B;  1U5F A;  1FHW A;  4B6H A;  1PFJ A;  1PMS A;  4HB2 B;  3OAN A;  4H8S A;  2P0D A;  1X86 A;  3MPX A;  1FB8 A;  2DKP A;  1NTV A;  1W1H A;  2K00 A;  2N0Y A;  5DI9 B;  2ZPY A;  1H10 A;  3V5W A;  1FGY A;  4TYZ A;  1MIX A;  1ZC4 B;  2YS1 A;  2E2X A;  2RUK B;  2D9Z A;  3KY9 A;  1BAK A;  2XQN M;  1BWN A;  4K81 A;  1J0W A;  1V5U A;  1IRS A;  3P7Z A;  2CY5 A;  2LOX A;  2P8V A;  2KCJ A;  2MFQ A;  2EMS A;  2I5C A;  2R0D A;  3F5R A;  2NZ8 B;  4HAY B;  2D11 A;  1GC6 A;  2UZR A;  3HW2 B;  2ADZ A;  1EAZ A;  4IOY X;  1XCG A;  2ELA A;  2LUL A;  3T06 A;  1AQC A;  1BTK A;  2J59 M;  3ULC A;  2YSZ A;  1QC6 A;  3IVF A;  5HE3 A;  4CHJ A;  4MK0 A;  1X1F A;  2DHK A;  4GMX B;  5KQ4 A;  2M14 A;  4Y94 A;  1U27 A;  3KSY A;  1MKE A;  4XWX A;  2RNR B;  4HAU B;  1Q67 A;  4GPT B;  3A8Q A;  3HK0 A;  5LOP B;  3PP2 A;  1RJ2 A;  2GJY A;  2L2I A;  3AU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...