4B6HA

Structure of hdcp1a in complex with proline rich sequence of pnrc2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
130
structure length
129
Chain Sequence
b'LMEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDIEGTLFVYRRSASPYHGFTIVNRNMHNLVEPVNKDLEFQLHEPFLLYRNASLSIYSIWFYDKNDCHRIAKLMADVVEEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MRNA-DECAPPING ENZYME 1A
publication title Structural Basis of the Pnrc2-Mediated Link between Mrna Surveillance and Decapping.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/peptide
total genus 35
structure length 129
sequence length 130
chains with identical sequence B
ec nomenclature ec 3.-.-.-:
pdb deposition date 2012-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4b6hA00
2DYQA 3SNHA 2Y8GA 5JP4A 4A6HA 4GMVA 2K2UA 2OQBA 5CLQB 1UPRA 1NU2A 1RRPB 4WSFA 2Z0QA 5FI0A 4NSWA 3KY9A 4A6FA 1KZGA 2P0HA 1WVHA 2D9ZA 1KI1B 2COCA 1U5EA 2PZ1A 4KHBB 3D8DA 1ZVRA 2RVBB 2DHIA 5D3VA 2YSZA 4KVGB 2HE7A 5HE0A 2D4QA 1WJMA 1OQNA 3ML4A 3SYXA 3VOQA 2CY5A 1U5FA 3UZTA 1TQZA 1PFJA 3GYPA 4HAWB 1XR0B 2DHKA 2P8VA 5FI1A 3M1IB 1RJ2A 5J3QA 5C5BB 2XQNM 3ZVRA 4HB3B 1K5DB 1X11A 2UVMA 4HB2B 4YL8A 3MDBC 4GN1A 1QQGA 3D8FA 2W2WA 2RSGA 3X23A 4GXBA 5C5BA 1U29A 3KRWA 2M38A 2ROZB 2W2XC 3PP2A 1OMWA 2COFA 5DHFB 2YS5A 2ADZA 2I1JA 5JHHA 1FHOA 3U7DA 2P0DA 2D10A 3FEHA 4CHJA 3P7ZA 2YS1A 1ISNA 1EGXA 3DXDA 2I5FA 2AL6A 3WA0A 1Q67A 2YF0A 3ODWA 2EMSA 2V76A 3BINA 2ELAA 1WGUA 2UZRA 1V89A 1UNRA 1Z87A 1WG7A 5J3TA 3AU5A 1XCGA 2L2IA 2UZSA 3A8PA 1ZSQA 3SUZA 4CHMA 3WYFB 1ZM0A 3DXEA 2GJYA 4TKNA 2ELBA 2EC1A 4DBBA 4HAVB 3ODOA 4HB0B 3F0WA 2DYNA 1V88A 4CYEA 3ODXA 1H10A 2DKQA 4L6EA 2D9YA 3PVWA 1NTVA 4HAUB 2G35A 1ZC4B 2N23A 3BJIA 2VSZA 1MIZB 1EVHA 5J3YA 5D3WA 1H4RA 5JLJB 2VKIA 2ZPYA 2KUPA 2J0MA 4KHAA 4HAXB 3T06A 2RGNB 3PG7A 1SHCA 3ZDTA 1N3HA 5HE3A 4WVFB 4Y94A 1BTKA 2R09A 3PZDA 4HDOA 5C16A 2LOXA 1DDMA 3TO1A 2CODA 4IOYX 1SGHA 1M7EA 4K81A 1FHXA 2GCJA 1WI1A 1V61A 4EJNA 4GMXB 5CLLB 1MPHA 1EAZA 5EFXA 1QC6A 5HE2A 1WJ1A 5DHAB 4HAYB 4Z2NA 3MPXA 5HE1A 4F7UP 1U27A 2I5CA 4DX8A 1B55A 1LW3A 1V5UA 2L1CA 2M14A 4KHOA 2GCLA 4HATB 3QWMA 4A5KA 1TJ6A 2YT1A 3PSCA 3QBVB 2DKPA 4KAXB 4K2OA 1DYNA 2QKLA 4EKUA 2Z0PA 1DROA 2YVCA 2MDXA 1IRSA 1WGQA 1NI2A 2NZ8B 1P5TA 2J0KA 2CRFA 2KCJA 2W2XD 3HQCA 3V5WA 5KQ1A 4MT7A 4NY0A 4DXAB 5GOWB 3U8ZA 3O96A 1U5GA 3TVVA 1FOEA 2J59M 4IFSA 1MKEA 1W1GA 3HK0A 1X86A 3A98B 1J19A 1XX0A 3TFMA 2AEHA 2GS0A 1FGYA 4H8SA 2Q13A 3HW2B 4ZRJA 2CAYA 1FB8A 3QIJA 1EF1A 3LJUX 3N7CA 3G9WA 4ZRKA 4A6KA 3PVLA 3KRXA 1KZ7A 4DX90 1UNQA 2DFKA 4IAPA 4MY6A 2KGXB 1MIXA 3FSSA 2MFQA 2VRWB 2D9XA 3AJ4A 1FHWA 1W1DA 2YS3A 2Y8FA 2DTCA 2JP2A 2RLOA 1V5MA 1Y5OA 1XKEA 3KZ1A 5LOPB 3AU4A 2LOZA 1I7AA 3ULBA 1DBHA 1UPQA 4HAZB 1U2BA 3PEGA 2ROVA 2YRYA 2RNRB 5D27A 2DX1A 1TXDA 1X1GA 1AWEA 2Z0OA 2MKRA 2K00A 3F5RA 5C79A 2HTHB 2LKOA 2I1KA 1X1FA 5KQ4A 4Z2MB 2DHJA 3TCAA 4P7IA 1I2HA 2BCJA 1P6SA 5L81A 1NTYA 4B6HA 1XODA 1AQCA 1UEFA 1K5GB 1X05A 2QKMA 2J0JA 2LULA 1XD4A 1OY2A 3TW1A 1U5DA 1GC7A 1Y19B 1UNPA 1GG3A 2P0FA 2YT0A 2D2QA 1V5PA 3P6AA 2COAA 2IYBA 1PMSA 4HHVA 4YONA 4D0NB 4F7HA 1J0WA 2K2JA 4K17A 4GZUA 4HB4B 1MAIA 4BBKA 1LB1A 3KSYA 2DLWA 4ZRIA 5D3YA 2OTXA 3PVUA 3NSUA 2DA0A 1M7RA 1MK7B 1ZC3B 1BAKA 2IFSA 3RCPA 4K2PA 5KCVA 2CY4A 2R0DA 1FAOA 5DI9B 2DX5A 2RUKB 1GC6A 1DDWA 3D8EA 5C6RA 4PNKA 4GPTB 2NMBA 4WJ7A 5JHGA 3GYOA 4TYZA 1W1HA 5DIFB 4C0AA 4XWXA 2H7DA 2LG1A 1MK9B 2MWNB 3CIKA 2EJ8A 1P3RA 5LONB 3IVFA 3OANA 2D9WA 3DXCA 4HDQA 3CXBB 1BWNA 1FGZA 1E5WA 3A8QA 3VIAA 2E2XA 2D9VA 1PLSA 4MK0A 4EMOA 2EMTA 5DH9B 3SV1A 4F7GA 2N0YA 2LYDA 2Y7BA 2FJLA 3FM8C 2H7EA 4A6FB 4PQ0A 2D11A 3SO6A 2X18A 1DDVA 1BTNA 5D3XA 3ULCA 2DN6A
chains in the Genus database with same CATH superfamily
2DYQA 3SNHA 2Y8GA 5JP4A 4A6HA 4GMVA 2K2UA 2OQBA 5CLQB 1UPRA 1NU2A 1RRPB 4WSFA 2Z0QA 5FI0A 4NSWA 3KY9A 4GOUA 4A6FA 4DIXA 2ZKMX 1KZGA 2P0HA 1WVHA 2D9ZA 1KI1B 2COCA 1U5EA 2Z59A 2PZ1A 4KHBB 3D8DA 1ZVRA 2RVBB 2DHIA 5D3VA 2YSZA 4KVGB 2HE7A 5HE0A 2D4QA 1WJMA 1OQNA 3ML4A 3SYXA 3VOQA 2CY5A 1U5FA 3UZTA 1TQZA 1PFJA 3GYPA 4HAWB 1XR0B 2DHKA 2P8VA 5FI1A 3FVCA 3M1IB 4KHBA 1RJ2A 5J3QA 5C5BB 4GNKB 5I2SA 5LG4B 2XQNM 3ZVRA 4HB3B 1K5DB 1X11A 2UVMA 4HB2B 4YL8A 3MDBC 4GN1A 1QQGA 3D8FA 2W2WA 2RSGA 3X23A 4GXBA 5C5BA 1U29A 2KUQA 2M38A 2ROZB 2W2XC 3KRWA 3PP2A 1OMWA 2COFA 5DHFB 2YS5A 2ADZA 2I1JA 5JHHA 1FHOA 3U7DA 2P0DA 2D10A 3FEHA 4CHJA 3P7ZA 2YS1A 1ISNA 2FJUB 1EGXA 3DXDA 2I5FA 1ZYIA 2AL6A 3WA0A 1Q67A 2YF0A 3ODWA 2EMSA 2V76A 3BINA 2ELAA 1WGUA 2UZRA 1V89A 1UNRA 1Z87A 1WG7A 5J3TA 3AU5A 1XCGA 2L2IA 2UZSA 3A8PA 1ZSQA 3SUZA 4CHMA 3WYFB 1ZM0A 3DXEA 2GJYA 4TKNA 2ELBA 2EC1A 4DBBA 4HAVB 3ODOA 4HB0B 2GUMA 3F0WA 2DYNA 2R2YA 1V88A 4CYEA 3ODXA 1H10A 2DKQA 4L6EA 2D9YA 3PVWA 1NTVA 4HAUB 3A58A 2G35A 4CSQA 1ZC4B 2N23A 3BJIA 4HSIA 2VSZA 1MIZB 1T77A 1EVHA 5J3YA 5D3WA 1H4RA 5JLJB 2VKIA 2ZPYA 2KUPA 2J0MA 4KHAA 4HAXB 3T06A 2RGNB 3PG7A 1SHCA 3ZDTA 1N3HA 5HE3A 4WVFB 4Y94A 1BTKA 2R09A 3PZDA 4HDOA 5C16A 2LOXA 1DDMA 3TO1A 2CODA 4IOYX 3HSAA 1SGHA 1M7EA 4K81A 1FHXA 2GCJA 1WI1A 1V61A 4EJNA 3U12A 4GMXB 5CLLB 1MPHA 1EAZA 5EFXA 1QC6A 5HE2A 1WJ1A 5DHAB 4HAYB 4Z2NA 3MPXA 5HE1A 4F7UP 1U27A 2I5CA 4DX8A 1B55A 5IRSA 1LW3A 2YT2A 1V5UA 2L1CA 2M14A 4KHOA 2GCLA 4HATB 3QWMA 4A5KA 1TJ6A 2YT1A 3PSCA 3OHMB 3QBVB 2DKPA 4KAXB 2KR0A 4K2OA 1DYNA 2QKLA 4EKUA 2Z0PA 1DROA 2YVCA 2MDXA 1IRSA 1WGQA 1NI2A 2NZ8B 1P5TA 2J0KA 2CRFA 2KCJA 2W2XD 3HQCA 3V5WA 5KQ1A 4MT7A 2RRFA 4NY0A 4DXAB 3HIEA 5GOWB 3U8ZA 3O96A 1U5GA 3TVVA 1FOEA 2J59M 4IFSA 1MKEA 1W1GA 3HK0A 4L1RA 1X86A 3A98B 1J19A 1XX0A 3TFMA 2AEHA 2GS0A 1FGYA 4H8SA 2Q13A 2Z14A 3HW2B 4ZRJA 2CAYA 1FB8A 3QIJA 2KIGA 1EF1A 3LJUX 3N7CA 3G9WA 4ZRKA 5M4YB 4A6KA 3PVLA 3KRXA 1KZ7A 4DX90 1UNQA 2Z13A 2DFKA 4IAPA 4MY6A 2KGXB 1MIXA 3FSSA 2MFQA 2VRWB 2D9XA 3AJ4A 1FHWA 3NWAA 1W1DA 2YS3A 4QJ3B 2Y8FA 2DTCA 2JP2A 2RLOA 4OT1A 1V5MA 1Y5OA 1XKEA 4QJ4B 3KZ1A 5LOPB 3AU4A 2LOZA 1I7AA 3ULBA 1DBHA 1UPQA 4HAZB 2K8EA 1U2BA 3PEGA 2ROVA 2YRYA 2RNRB 5D27A 2DX1A 1TXDA 1X1GA 1AWEA 2Z0OA 2MKRA 4OSNA 3NWDA 2K00A 3F5RA 5C79A 2HTHB 2LKOA 2I1KA 2KIEA 1X1FA 5KQ4A 4Z2MB 2DHJA 3TCAA 4P7IA 1I2HA 2BCJA 1P6SA 5L81A 1NTYA 4B6HA 1XODA 3NW8A 1AQCA 1UEFA 1K5GB 1X05A 2QKMA 2J0JA 2LULA 1XD4A 1OY2A 3TW1A 1U5DA 4QXAB 1GC7A 1Y19B 1UNPA 1GG3A 2P0FA 2YT0A 2D2QA 1V5PA 3P6AA 2COAA 2IYBA 1PMSA 4HHVA 4YONA 4D0NB 4F7HA 1J0WA 2K2JA 4K17A 4GZUA 4HB4B 1MAIA 4BBKA 1LB1A 3KSYA 2DLWA 4ZRIA 5D3YA 3B77A 2OTXA 3PVUA 3NSUA 2DA0A 1M7RA 1MK7B 1ZC3B 1BAKA 2IFSA 5I2MA 3RCPA 4K2PA 5KCVA 2CY4A 2R0DA 1FAOA 5DI9B 2DX5A 2RUKB 1GC6A 1DDWA 3D8EA 5C6RA 4PNKA 4GPTB 2NMBA 4WJ7A 5JHGA 3GYOA 4TYZA 1W1HA 3DCXA 2NBVA 2Z4DA 5DIFB 4C0AA 4XWXA 2H7DA 2LG1A 1MK9B 2MWNB 3CIKA 2EJ8A 1P3RA 5LONB 2K49A 3IVFA 4QJ5B 3NWFA 3OANA 1MI1A 2D9WA 3DXCA 4HDQA 3CXBB 1BWNA 1FGZA 1E5WA 3A8QA 3VIAA 2E2XA 2D9VA 1PLSA 4MK0A 4EMOA 2EMTA 5DH9B 3SV1A 4F7GA 2N0YA 2LYDA 2Y7BA 2FJLA 4D6WA 3FM8C 2H7EA 4A6FB 4PQ0A 2D11A 3SO6A 2X18A 1DDVA 1BTNA 5D3XA 3ULCA 2DN6A
chains in the Genus database with same CATH topology
2DYQA 3SNHA 2Y8GA 5JP4A 4A6HA 4GMVA 2K2UA 2OQBA 5CLQB 1UPRA 1NU2A 1RRPB 4WSFA 2Z0QA 5FI0A 4NSWA 3KY9A 4A6FA 1KZGA 2P0HA 1WVHA 2D9ZA 1KI1B 2COCA 1U5EA 2PZ1A 4KHBB 3D8DA 1ZVRA 2RVBB 2DHIA 5D3VA 2YSZA 4KVGB 2HE7A 5HE0A 2D4QA 1WJMA 1OQNA 3ML4A 3SYXA 3VOQA 2CY5A 1U5FA 3UZTA 1TQZA 1PFJA 3GYPA 4HAWB 1XR0B 2DHKA 2P8VA 5FI1A 3M1IB 1RJ2A 5J3QA 5C5BB 2XQNM 3ZVRA 4HB3B 1K5DB 1X11A 2UVMA 4HB2B 4YL8A 3MDBC 4GN1A 1QQGA 3D8FA 2W2WA 2RSGA 3X23A 4GXBA 5C5BA 1U29A 3KRWA 2M38A 2ROZB 2W2XC 3PP2A 1OMWA 2COFA 5DHFB 2YS5A 2ADZA 2I1JA 5JHHA 1FHOA 3U7DA 2P0DA 2D10A 3FEHA 4CHJA 3P7ZA 2YS1A 1ISNA 1EGXA 3DXDA 2I5FA 2AL6A 3WA0A 1Q67A 2YF0A 3ODWA 2EMSA 2V76A 3BINA 2ELAA 1WGUA 2UZRA 1V89A 1UNRA 1Z87A 1WG7A 5J3TA 3AU5A 1XCGA 2L2IA 2UZSA 3A8PA 1ZSQA 3SUZA 4CHMA 3WYFB 1ZM0A 3DXEA 2GJYA 4TKNA 2ELBA 2EC1A 4DBBA 4HAVB 3ODOA 4HB0B 3F0WA 2DYNA 1V88A 4CYEA 3ODXA 1H10A 2DKQA 4L6EA 2D9YA 3PVWA 1NTVA 4HAUB 2G35A 1ZC4B 2N23A 3BJIA 2VSZA 1MIZB 1EVHA 5J3YA 5D3WA 1H4RA 5JLJB 2VKIA 2ZPYA 2KUPA 2J0MA 4KHAA 4HAXB 3T06A 2RGNB 3PG7A 1SHCA 3ZDTA 1N3HA 5HE3A 4WVFB 4Y94A 1BTKA 2R09A 3PZDA 4HDOA 5C16A 2LOXA 1DDMA 3TO1A 2CODA 4IOYX 1SGHA 1M7EA 4K81A 1FHXA 2GCJA 1WI1A 1V61A 4EJNA 4GMXB 5CLLB 1MPHA 1EAZA 5EFXA 1QC6A 5HE2A 1WJ1A 5DHAB 4HAYB 4Z2NA 3MPXA 5HE1A 4F7UP 1U27A 2I5CA 4DX8A 1B55A 1LW3A 1V5UA 2L1CA 2M14A 4KHOA 2GCLA 4HATB 3QWMA 4A5KA 1TJ6A 2YT1A 3PSCA 3QBVB 2DKPA 4KAXB 4K2OA 1DYNA 2QKLA 4EKUA 2Z0PA 1DROA 2YVCA 2MDXA 1IRSA 1WGQA 1NI2A 2NZ8B 1P5TA 2J0KA 2CRFA 2KCJA 2W2XD 3HQCA 3V5WA 5KQ1A 4MT7A 4NY0A 4DXAB 5GOWB 3U8ZA 3O96A 1U5GA 3TVVA 1FOEA 2J59M 4IFSA 1MKEA 1W1GA 3HK0A 1X86A 3A98B 1J19A 1XX0A 3TFMA 2AEHA 2GS0A 1FGYA 4H8SA 2Q13A 3HW2B 4ZRJA 2CAYA 1FB8A 3QIJA 1EF1A 3LJUX 3N7CA 3G9WA 4ZRKA 4A6KA 3PVLA 3KRXA 1KZ7A 4DX90 1UNQA 2DFKA 4IAPA 4MY6A 2KGXB 1MIXA 3FSSA 2MFQA 2VRWB 2D9XA 3AJ4A 1FHWA 1W1DA 2YS3A 2Y8FA 2DTCA 2JP2A 2RLOA 1V5MA 1Y5OA 1XKEA 3KZ1A 5LOPB 3AU4A 2LOZA 1I7AA 3ULBA 1DBHA 1UPQA 4HAZB 1U2BA 3PEGA 2ROVA 2YRYA 2RNRB 5D27A 2DX1A 1TXDA 1X1GA 1AWEA 2Z0OA 2MKRA 2K00A 3F5RA 5C79A 2HTHB 2LKOA 2I1KA 1X1FA 5KQ4A 4Z2MB 2DHJA 3TCAA 4P7IA 1I2HA 2BCJA 1P6SA 5L81A 1NTYA 4B6HA 1XODA 1AQCA 1UEFA 1K5GB 1X05A 2QKMA 2J0JA 2LULA 1XD4A 1OY2A 3TW1A 1U5DA 1GC7A 1Y19B 1UNPA 1GG3A 2P0FA 2YT0A 2D2QA 1V5PA 3P6AA 2COAA 2IYBA 1PMSA 4HHVA 4YONA 4D0NB 4F7HA 1J0WA 2K2JA 4K17A 4GZUA 4HB4B 1MAIA 4BBKA 1LB1A 3KSYA 2DLWA 4ZRIA 5D3YA 2OTXA 3PVUA 3NSUA 2DA0A 1M7RA 1MK7B 1ZC3B 1BAKA 2IFSA 3RCPA 4K2PA 5KCVA 2CY4A 2R0DA 1FAOA 5DI9B 2DX5A 2RUKB 1GC6A 1DDWA 3D8EA 5C6RA 4PNKA 4GPTB 2NMBA 4WJ7A 5JHGA 3GYOA 4TYZA 1W1HA 5DIFB 4C0AA 4XWXA 2H7DA 2LG1A 1MK9B 2MWNB 3CIKA 2EJ8A 1P3RA 5LONB 3IVFA 3OANA 2D9WA 3DXCA 4HDQA 3CXBB 1BWNA 1FGZA 1E5WA 3A8QA 3VIAA 2E2XA 2D9VA 1PLSA 4MK0A 4EMOA 2EMTA 5DH9B 3SV1A 4F7GA 2N0YA 2LYDA 2Y7BA 2FJLA 3FM8C 2H7EA 4A6FB 4PQ0A 2D11A 3SO6A 2X18A 1DDVA 1BTNA 5D3XA 3ULCA 2DN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYQ A;  3SNH A;  2Y8G A;  5JP4 A;  4A6H A;  4GMV A;  2K2U A;  2OQB A;  5CLQ B;  1UPR A;  1NU2 A;  1RRP B;  4WSF A;  2Z0Q A;  5FI0 A;  4NSW A;  3KY9 A;  4A6F A;  1KZG A;  2P0H A;  1WVH A;  2D9Z A;  1KI1 B;  2COC A;  1U5E A;  2PZ1 A;  4KHB B;  3D8D A;  1ZVR A;  2RVB B;  2DHI A;  5D3V A;  2YSZ A;  4KVG B;  2HE7 A;  5HE0 A;  2D4Q A;  1WJM A;  1OQN A;  3ML4 A;  3SYX A;  3VOQ A;  2CY5 A;  1U5F A;  3UZT A;  1TQZ A;  1PFJ A;  3GYP A;  4HAW B;  1XR0 B;  2DHK A;  2P8V A;  5FI1 A;  3M1I B;  1RJ2 A;  5J3Q A;  5C5B B;  2XQN M;  3ZVR A;  4HB3 B;  1K5D B;  1X11 A;  2UVM A;  4HB2 B;  4YL8 A;  3MDB C;  4GN1 A;  1QQG A;  3D8F A;  2W2W A;  2RSG A;  3X23 A;  4GXB A;  5C5B A;  1U29 A;  3KRW A;  2M38 A;  2ROZ B;  2W2X C;  3PP2 A;  1OMW A;  2COF A;  5DHF B;  2YS5 A;  2ADZ A;  2I1J A;  5JHH A;  1FHO A;  3U7D A;  2P0D A;  2D10 A;  3FEH A;  4CHJ A;  3P7Z A;  2YS1 A;  1ISN A;  1EGX A;  3DXD A;  2I5F A;  2AL6 A;  3WA0 A;  1Q67 A;  2YF0 A;  3ODW A;  2EMS A;  2V76 A;  3BIN A;  2ELA A;  1WGU A;  2UZR A;  1V89 A;  1UNR A;  1Z87 A;  1WG7 A;  5J3T A;  3AU5 A;  1XCG A;  2L2I A;  2UZS A;  3A8P A;  1ZSQ A;  3SUZ A;  4CHM A;  3WYF B;  1ZM0 A;  3DXE A;  2GJY A;  4TKN A;  2ELB A;  2EC1 A;  4DBB A;  4HAV B;  3ODO A;  4HB0 B;  3F0W A;  2DYN A;  1V88 A;  4CYE A;  3ODX A;  1H10 A;  2DKQ A;  4L6E A;  2D9Y A;  3PVW A;  1NTV A;  4HAU B;  2G35 A;  1ZC4 B;  2N23 A;  3BJI A;  2VSZ A;  1MIZ B;  1EVH A;  5J3Y A;  5D3W A;  1H4R A;  5JLJ B;  2VKI A;  2ZPY A;  2KUP A;  2J0M A;  4KHA A;  4HAX B;  3T06 A;  2RGN B;  3PG7 A;  1SHC A;  3ZDT A;  1N3H A;  5HE3 A;  4WVF B;  4Y94 A;  1BTK A;  2R09 A;  3PZD A;  4HDO A;  5C16 A;  2LOX A;  1DDM A;  3TO1 A;  2COD A;  4IOY X;  1SGH A;  1M7E A;  4K81 A;  1FHX A;  2GCJ A;  1WI1 A;  1V61 A;  4EJN A;  4GMX B;  5CLL B;  1MPH A;  1EAZ A;  5EFX A;  1QC6 A;  5HE2 A;  1WJ1 A;  5DHA B;  4HAY B;  4Z2N A;  3MPX A;  5HE1 A;  4F7U P;  1U27 A;  2I5C A;  4DX8 A;  1B55 A;  1LW3 A;  1V5U A;  2L1C A;  2M14 A;  4KHO A;  2GCL A;  4HAT B;  3QWM A;  4A5K A;  1TJ6 A;  2YT1 A;  3PSC A;  3QBV B;  2DKP A;  4KAX B;  4K2O A;  1DYN A;  2QKL A;  4EKU A;  2Z0P A;  1DRO A;  2YVC A;  2MDX A;  1IRS A;  1WGQ A;  1NI2 A;  2NZ8 B;  1P5T A;  2J0K A;  2CRF A;  2KCJ A;  2W2X D;  3HQC A;  3V5W A;  5KQ1 A;  4MT7 A;  4NY0 A;  4DXA B;  5GOW B;  3U8Z A;  3O96 A;  1U5G A;  3TVV A;  1FOE A;  2J59 M;  4IFS A;  1MKE A;  1W1G A;  3HK0 A;  1X86 A;  3A98 B;  1J19 A;  1XX0 A;  3TFM A;  2AEH A;  2GS0 A;  1FGY A;  4H8S A;  2Q13 A;  3HW2 B;  4ZRJ A;  2CAY A;  1FB8 A;  3QIJ A;  1EF1 A;  3LJU X;  3N7C A;  3G9W A;  4ZRK A;  4A6K A;  3PVL A;  3KRX A;  1KZ7 A;  4DX9 0;  1UNQ A;  2DFK A;  4IAP A;  4MY6 A;  2KGX B;  1MIX A;  3FSS A;  2MFQ A;  2VRW B;  2D9X A;  3AJ4 A;  1FHW A;  1W1D A;  2YS3 A;  2Y8F A;  2DTC A;  2JP2 A;  2RLO A;  1V5M A;  1Y5O A;  1XKE A;  3KZ1 A;  5LOP B;  3AU4 A;  2LOZ A;  1I7A A;  3ULB A;  1DBH A;  1UPQ A;  4HAZ B;  1U2B A;  3PEG A;  2ROV A;  2YRY A;  2RNR B;  5D27 A;  2DX1 A;  1TXD A;  1X1G A;  1AWE A;  2Z0O A;  2MKR A;  2K00 A;  3F5R A;  5C79 A;  2HTH B;  2LKO A;  2I1K A;  1X1F A;  5KQ4 A;  4Z2M B;  2DHJ A;  3TCA A;  4P7I A;  1I2H A;  2BCJ A;  1P6S A;  5L81 A;  1NTY A;  4B6H A;  1XOD A;  1AQC A;  1UEF A;  1K5G B;  1X05 A;  2QKM A;  2J0J A;  2LUL A;  1XD4 A;  1OY2 A;  3TW1 A;  1U5D A;  1GC7 A;  1Y19 B;  1UNP A;  1GG3 A;  2P0F A;  2YT0 A;  2D2Q A;  1V5P A;  3P6A A;  2COA A;  2IYB A;  1PMS A;  4HHV A;  4YON A;  4D0N B;  4F7H A;  1J0W A;  2K2J A;  4K17 A;  4GZU A;  4HB4 B;  1MAI A;  4BBK A;  1LB1 A;  3KSY A;  2DLW A;  4ZRI A;  5D3Y A;  2OTX A;  3PVU A;  3NSU A;  2DA0 A;  1M7R A;  1MK7 B;  1ZC3 B;  1BAK A;  2IFS A;  3RCP A;  4K2P A;  5KCV A;  2CY4 A;  2R0D A;  1FAO A;  5DI9 B;  2DX5 A;  2RUK B;  1GC6 A;  1DDW A;  3D8E A;  5C6R A;  4PNK A;  4GPT B;  2NMB A;  4WJ7 A;  5JHG A;  3GYO A;  4TYZ A;  1W1H A;  5DIF B;  4C0A A;  4XWX A;  2H7D A;  2LG1 A;  1MK9 B;  2MWN B;  3CIK A;  2EJ8 A;  1P3R A;  5LON B;  3IVF A;  3OAN A;  2D9W A;  3DXC A;  4HDQ A;  3CXB B;  1BWN A;  1FGZ A;  1E5W A;  3A8Q A;  3VIA A;  2E2X A;  2D9V A;  1PLS A;  4MK0 A;  4EMO A;  2EMT A;  5DH9 B;  3SV1 A;  4F7G A;  2N0Y A;  2LYD A;  2Y7B A;  2FJL A;  3FM8 C;  2H7E A;  4A6F B;  4PQ0 A;  2D11 A;  3SO6 A;  2X18 A;  1DDV A;  1BTN A;  5D3X A;  3ULC A;  2DN6 A; 
#chains in the Genus database with same CATH topology
 2DYQ A;  3SNH A;  2Y8G A;  5JP4 A;  4A6H A;  4GMV A;  2K2U A;  2OQB A;  5CLQ B;  1UPR A;  1NU2 A;  1RRP B;  4WSF A;  2Z0Q A;  5FI0 A;  4NSW A;  3KY9 A;  4GOU A;  4A6F A;  4DIX A;  2ZKM X;  1KZG A;  2P0H A;  1WVH A;  2D9Z A;  1KI1 B;  2COC A;  1U5E A;  2Z59 A;  2PZ1 A;  4KHB B;  3D8D A;  1ZVR A;  2RVB B;  2DHI A;  5D3V A;  2YSZ A;  4KVG B;  2HE7 A;  5HE0 A;  2D4Q A;  1WJM A;  1OQN A;  3ML4 A;  3SYX A;  3VOQ A;  2CY5 A;  1U5F A;  3UZT A;  1TQZ A;  1PFJ A;  3GYP A;  4HAW B;  1XR0 B;  2DHK A;  2P8V A;  5FI1 A;  3FVC A;  3M1I B;  4KHB A;  1RJ2 A;  5J3Q A;  5C5B B;  4GNK B;  5I2S A;  5LG4 B;  2XQN M;  3ZVR A;  4HB3 B;  1K5D B;  1X11 A;  2UVM A;  4HB2 B;  4YL8 A;  3MDB C;  4GN1 A;  1QQG A;  3D8F A;  2W2W A;  2RSG A;  3X23 A;  4GXB A;  5C5B A;  1U29 A;  2KUQ A;  2M38 A;  2ROZ B;  2W2X C;  3KRW A;  3PP2 A;  1OMW A;  2COF A;  5DHF B;  2YS5 A;  2ADZ A;  2I1J A;  5JHH A;  1FHO A;  3U7D A;  2P0D A;  2D10 A;  3FEH A;  4CHJ A;  3P7Z A;  2YS1 A;  1ISN A;  2FJU B;  1EGX A;  3DXD A;  2I5F A;  1ZYI A;  2AL6 A;  3WA0 A;  1Q67 A;  2YF0 A;  3ODW A;  2EMS A;  2V76 A;  3BIN A;  2ELA A;  1WGU A;  2UZR A;  1V89 A;  1UNR A;  1Z87 A;  1WG7 A;  5J3T A;  3AU5 A;  1XCG A;  2L2I A;  2UZS A;  3A8P A;  1ZSQ A;  3SUZ A;  4CHM A;  3WYF B;  1ZM0 A;  3DXE A;  2GJY A;  4TKN A;  2ELB A;  2EC1 A;  4DBB A;  4HAV B;  3ODO A;  4HB0 B;  2GUM A;  3F0W A;  2DYN A;  2R2Y A;  1V88 A;  4CYE A;  3ODX A;  1H10 A;  2DKQ A;  4L6E A;  2D9Y A;  3PVW A;  1NTV A;  4HAU B;  3A58 A;  2G35 A;  4CSQ A;  1ZC4 B;  2N23 A;  3BJI A;  4HSI A;  2VSZ A;  1MIZ B;  1T77 A;  1EVH A;  5J3Y A;  5D3W A;  1H4R A;  5JLJ B;  2VKI A;  2ZPY A;  2KUP A;  2J0M A;  4KHA A;  4HAX B;  3T06 A;  2RGN B;  3PG7 A;  1SHC A;  3ZDT A;  1N3H A;  5HE3 A;  4WVF B;  4Y94 A;  1BTK A;  2R09 A;  3PZD A;  4HDO A;  5C16 A;  2LOX A;  1DDM A;  3TO1 A;  2COD A;  4IOY X;  3HSA A;  1SGH A;  1M7E A;  4K81 A;  1FHX A;  2GCJ A;  1WI1 A;  1V61 A;  4EJN A;  3U12 A;  4GMX B;  5CLL B;  1MPH A;  1EAZ A;  5EFX A;  1QC6 A;  5HE2 A;  1WJ1 A;  5DHA B;  4HAY B;  4Z2N A;  3MPX A;  5HE1 A;  4F7U P;  1U27 A;  2I5C A;  4DX8 A;  1B55 A;  5IRS A;  1LW3 A;  2YT2 A;  1V5U A;  2L1C A;  2M14 A;  4KHO A;  2GCL A;  4HAT B;  3QWM A;  4A5K A;  1TJ6 A;  2YT1 A;  3PSC A;  3OHM B;  3QBV B;  2DKP A;  4KAX B;  2KR0 A;  4K2O A;  1DYN A;  2QKL A;  4EKU A;  2Z0P A;  1DRO A;  2YVC A;  2MDX A;  1IRS A;  1WGQ A;  1NI2 A;  2NZ8 B;  1P5T A;  2J0K A;  2CRF A;  2KCJ A;  2W2X D;  3HQC A;  3V5W A;  5KQ1 A;  4MT7 A;  2RRF A;  4NY0 A;  4DXA B;  3HIE A;  5GOW B;  3U8Z A;  3O96 A;  1U5G A;  3TVV A;  1FOE A;  2J59 M;  4IFS A;  1MKE A;  1W1G A;  3HK0 A;  4L1R A;  1X86 A;  3A98 B;  1J19 A;  1XX0 A;  3TFM A;  2AEH A;  2GS0 A;  1FGY A;  4H8S A;  2Q13 A;  2Z14 A;  3HW2 B;  4ZRJ A;  2CAY A;  1FB8 A;  3QIJ A;  2KIG A;  1EF1 A;  3LJU X;  3N7C A;  3G9W A;  4ZRK A;  5M4Y B;  4A6K A;  3PVL A;  3KRX A;  1KZ7 A;  4DX9 0;  1UNQ A;  2Z13 A;  2DFK A;  4IAP A;  4MY6 A;  2KGX B;  1MIX A;  3FSS A;  2MFQ A;  2VRW B;  2D9X A;  3AJ4 A;  1FHW A;  3NWA A;  1W1D A;  2YS3 A;  4QJ3 B;  2Y8F A;  2DTC A;  2JP2 A;  2RLO A;  4OT1 A;  1V5M A;  1Y5O A;  1XKE A;  4QJ4 B;  3KZ1 A;  5LOP B;  3AU4 A;  2LOZ A;  1I7A A;  3ULB A;  1DBH A;  1UPQ A;  4HAZ B;  2K8E A;  1U2B A;  3PEG A;  2ROV A;  2YRY A;  2RNR B;  5D27 A;  2DX1 A;  1TXD A;  1X1G A;  1AWE A;  2Z0O A;  2MKR A;  4OSN A;  3NWD A;  2K00 A;  3F5R A;  5C79 A;  2HTH B;  2LKO A;  2I1K A;  2KIE A;  1X1F A;  5KQ4 A;  4Z2M B;  2DHJ A;  3TCA A;  4P7I A;  1I2H A;  2BCJ A;  1P6S A;  5L81 A;  1NTY A;  4B6H A;  1XOD A;  3NW8 A;  1AQC A;  1UEF A;  1K5G B;  1X05 A;  2QKM A;  2J0J A;  2LUL A;  1XD4 A;  1OY2 A;  3TW1 A;  1U5D A;  4QXA B;  1GC7 A;  1Y19 B;  1UNP A;  1GG3 A;  2P0F A;  2YT0 A;  2D2Q A;  1V5P A;  3P6A A;  2COA A;  2IYB A;  1PMS A;  4HHV A;  4YON A;  4D0N B;  4F7H A;  1J0W A;  2K2J A;  4K17 A;  4GZU A;  4HB4 B;  1MAI A;  4BBK A;  1LB1 A;  3KSY A;  2DLW A;  4ZRI A;  5D3Y A;  3B77 A;  2OTX A;  3PVU A;  3NSU A;  2DA0 A;  1M7R A;  1MK7 B;  1ZC3 B;  1BAK A;  2IFS A;  5I2M A;  3RCP A;  4K2P A;  5KCV A;  2CY4 A;  2R0D A;  1FAO A;  5DI9 B;  2DX5 A;  2RUK B;  1GC6 A;  1DDW A;  3D8E A;  5C6R A;  4PNK A;  4GPT B;  2NMB A;  4WJ7 A;  5JHG A;  3GYO A;  4TYZ A;  1W1H A;  3DCX A;  2NBV A;  2Z4D A;  5DIF B;  4C0A A;  4XWX A;  2H7D A;  2LG1 A;  1MK9 B;  2MWN B;  3CIK A;  2EJ8 A;  1P3R A;  5LON B;  2K49 A;  3IVF A;  4QJ5 B;  3NWF A;  3OAN A;  1MI1 A;  2D9W A;  3DXC A;  4HDQ A;  3CXB B;  1BWN A;  1FGZ A;  1E5W A;  3A8Q A;  3VIA A;  2E2X A;  2D9V A;  1PLS A;  4MK0 A;  4EMO A;  2EMT A;  5DH9 B;  3SV1 A;  4F7G A;  2N0Y A;  2LYD A;  2Y7B A;  2FJL A;  4D6W A;  3FM8 C;  2H7E A;  4A6F B;  4PQ0 A;  2D11 A;  3SO6 A;  2X18 A;  1DDV A;  1BTN A;  5D3X A;  3ULC A;  2DN6 A; 
#chains in the Genus database with same CATH homology
 2DYQ A;  3SNH A;  2Y8G A;  5JP4 A;  4A6H A;  4GMV A;  2K2U A;  2OQB A;  5CLQ B;  1UPR A;  1NU2 A;  1RRP B;  4WSF A;  2Z0Q A;  5FI0 A;  4NSW A;  3KY9 A;  4A6F A;  1KZG A;  2P0H A;  1WVH A;  2D9Z A;  1KI1 B;  2COC A;  1U5E A;  2PZ1 A;  4KHB B;  3D8D A;  1ZVR A;  2RVB B;  2DHI A;  5D3V A;  2YSZ A;  4KVG B;  2HE7 A;  5HE0 A;  2D4Q A;  1WJM A;  1OQN A;  3ML4 A;  3SYX A;  3VOQ A;  2CY5 A;  1U5F A;  3UZT A;  1TQZ A;  1PFJ A;  3GYP A;  4HAW B;  1XR0 B;  2DHK A;  2P8V A;  5FI1 A;  3M1I B;  1RJ2 A;  5J3Q A;  5C5B B;  2XQN M;  3ZVR A;  4HB3 B;  1K5D B;  1X11 A;  2UVM A;  4HB2 B;  4YL8 A;  3MDB C;  4GN1 A;  1QQG A;  3D8F A;  2W2W A;  2RSG A;  3X23 A;  4GXB A;  5C5B A;  1U29 A;  3KRW A;  2M38 A;  2ROZ B;  2W2X C;  3PP2 A;  1OMW A;  2COF A;  5DHF B;  2YS5 A;  2ADZ A;  2I1J A;  5JHH A;  1FHO A;  3U7D A;  2P0D A;  2D10 A;  3FEH A;  4CHJ A;  3P7Z A;  2YS1 A;  1ISN A;  1EGX A;  3DXD A;  2I5F A;  2AL6 A;  3WA0 A;  1Q67 A;  2YF0 A;  3ODW A;  2EMS A;  2V76 A;  3BIN A;  2ELA A;  1WGU A;  2UZR A;  1V89 A;  1UNR A;  1Z87 A;  1WG7 A;  5J3T A;  3AU5 A;  1XCG A;  2L2I A;  2UZS A;  3A8P A;  1ZSQ A;  3SUZ A;  4CHM A;  3WYF B;  1ZM0 A;  3DXE A;  2GJY A;  4TKN A;  2ELB A;  2EC1 A;  4DBB A;  4HAV B;  3ODO A;  4HB0 B;  3F0W A;  2DYN A;  1V88 A;  4CYE A;  3ODX A;  1H10 A;  2DKQ A;  4L6E A;  2D9Y A;  3PVW A;  1NTV A;  4HAU B;  2G35 A;  1ZC4 B;  2N23 A;  3BJI A;  2VSZ A;  1MIZ B;  1EVH A;  5J3Y A;  5D3W A;  1H4R A;  5JLJ B;  2VKI A;  2ZPY A;  2KUP A;  2J0M A;  4KHA A;  4HAX B;  3T06 A;  2RGN B;  3PG7 A;  1SHC A;  3ZDT A;  1N3H A;  5HE3 A;  4WVF B;  4Y94 A;  1BTK A;  2R09 A;  3PZD A;  4HDO A;  5C16 A;  2LOX A;  1DDM A;  3TO1 A;  2COD A;  4IOY X;  1SGH A;  1M7E A;  4K81 A;  1FHX A;  2GCJ A;  1WI1 A;  1V61 A;  4EJN A;  4GMX B;  5CLL B;  1MPH A;  1EAZ A;  5EFX A;  1QC6 A;  5HE2 A;  1WJ1 A;  5DHA B;  4HAY B;  4Z2N A;  3MPX A;  5HE1 A;  4F7U P;  1U27 A;  2I5C A;  4DX8 A;  1B55 A;  1LW3 A;  1V5U A;  2L1C A;  2M14 A;  4KHO A;  2GCL A;  4HAT B;  3QWM A;  4A5K A;  1TJ6 A;  2YT1 A;  3PSC A;  3QBV B;  2DKP A;  4KAX B;  4K2O A;  1DYN A;  2QKL A;  4EKU A;  2Z0P A;  1DRO A;  2YVC A;  2MDX A;  1IRS A;  1WGQ A;  1NI2 A;  2NZ8 B;  1P5T A;  2J0K A;  2CRF A;  2KCJ A;  2W2X D;  3HQC A;  3V5W A;  5KQ1 A;  4MT7 A;  4NY0 A;  4DXA B;  5GOW B;  3U8Z A;  3O96 A;  1U5G A;  3TVV A;  1FOE A;  2J59 M;  4IFS A;  1MKE A;  1W1G A;  3HK0 A;  1X86 A;  3A98 B;  1J19 A;  1XX0 A;  3TFM A;  2AEH A;  2GS0 A;  1FGY A;  4H8S A;  2Q13 A;  3HW2 B;  4ZRJ A;  2CAY A;  1FB8 A;  3QIJ A;  1EF1 A;  3LJU X;  3N7C A;  3G9W A;  4ZRK A;  4A6K A;  3PVL A;  3KRX A;  1KZ7 A;  4DX9 0;  1UNQ A;  2DFK A;  4IAP A;  4MY6 A;  2KGX B;  1MIX A;  3FSS A;  2MFQ A;  2VRW B;  2D9X A;  3AJ4 A;  1FHW A;  1W1D A;  2YS3 A;  2Y8F A;  2DTC A;  2JP2 A;  2RLO A;  1V5M A;  1Y5O A;  1XKE A;  3KZ1 A;  5LOP B;  3AU4 A;  2LOZ A;  1I7A A;  3ULB A;  1DBH A;  1UPQ A;  4HAZ B;  1U2B A;  3PEG A;  2ROV A;  2YRY A;  2RNR B;  5D27 A;  2DX1 A;  1TXD A;  1X1G A;  1AWE A;  2Z0O A;  2MKR A;  2K00 A;  3F5R A;  5C79 A;  2HTH B;  2LKO A;  2I1K A;  1X1F A;  5KQ4 A;  4Z2M B;  2DHJ A;  3TCA A;  4P7I A;  1I2H A;  2BCJ A;  1P6S A;  5L81 A;  1NTY A;  4B6H A;  1XOD A;  1AQC A;  1UEF A;  1K5G B;  1X05 A;  2QKM A;  2J0J A;  2LUL A;  1XD4 A;  1OY2 A;  3TW1 A;  1U5D A;  1GC7 A;  1Y19 B;  1UNP A;  1GG3 A;  2P0F A;  2YT0 A;  2D2Q A;  1V5P A;  3P6A A;  2COA A;  2IYB A;  1PMS A;  4HHV A;  4YON A;  4D0N B;  4F7H A;  1J0W A;  2K2J A;  4K17 A;  4GZU A;  4HB4 B;  1MAI A;  4BBK A;  1LB1 A;  3KSY A;  2DLW A;  4ZRI A;  5D3Y A;  2OTX A;  3PVU A;  3NSU A;  2DA0 A;  1M7R A;  1MK7 B;  1ZC3 B;  1BAK A;  2IFS A;  3RCP A;  4K2P A;  5KCV A;  2CY4 A;  2R0D A;  1FAO A;  5DI9 B;  2DX5 A;  2RUK B;  1GC6 A;  1DDW A;  3D8E A;  5C6R A;  4PNK A;  4GPT B;  2NMB A;  4WJ7 A;  5JHG A;  3GYO A;  4TYZ A;  1W1H A;  5DIF B;  4C0A A;  4XWX A;  2H7D A;  2LG1 A;  1MK9 B;  2MWN B;  3CIK A;  2EJ8 A;  1P3R A;  5LON B;  3IVF A;  3OAN A;  2D9W A;  3DXC A;  4HDQ A;  3CXB B;  1BWN A;  1FGZ A;  1E5W A;  3A8Q A;  3VIA A;  2E2X A;  2D9V A;  1PLS A;  4MK0 A;  4EMO A;  2EMT A;  5DH9 B;  3SV1 A;  4F7G A;  2N0Y A;  2LYD A;  2Y7B A;  2FJL A;  3FM8 C;  2H7E A;  4A6F B;  4PQ0 A;  2D11 A;  3SO6 A;  2X18 A;  1DDV A;  1BTN A;  5D3X A;  3ULC A;  2DN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...