4B6HA

Structure of hdcp1a in complex with proline rich sequence of pnrc2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
130
structure length
129
Chain Sequence
LMEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDIEGTLFVYRRSASPYHGFTIVNRNMHNLVEPVNKDLEFQLHEPFLLYRNASLSIYSIWFYDKNDCHRIAKLMADVVEEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/peptide
molecule keywords MRNA-DECAPPING ENZYME 1A
publication title Structural Basis of the Pnrc2-Mediated Link between Mrna Surveillance and Decapping.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 129
sequence length 130
chains with identical sequence B
ec nomenclature ec 3.-.-.-:
pdb deposition date 2012-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4b6hA00
1K5GB 4P7IA 1XD4A 5GOWB 2DHKA 3WA0A 3MPXA 5LOPB 1V88A 1X1GA 5HE0A 5HE3A 1FGYA 3LJUX 1DBHA 1WJ1A 1DDVA 4L6EA 3KZ1A 2COCA 1KI1B 4D0NB 1DDMA 2ELBA 2Z0OA 2AEHA 4H8SA 3G9WA 1PFJA 2H7EA 2LULA 2ROZB 4HAUB 4KAXB 2NZ8B 3KY9A 1OQNA 1Y19B 1XCGA 1XR0B 4F7UP 1MK7B 4EKUA 2J59M 2EJ8A 4BBKA 5C79A 2RLOA 2DX5A 2Y8FA 5FI1A 3TVVA 3M1IB 2OQBA 1MK9B 2DKQA 3X23A 5D3WA 4A6FA 2D9YA 2M38A 4HAWB 3D8FA 3TW1A 1TXDA 3TFMA 4DBBA 4IAPA 5DHFB 4ZRKA 1K5DB 4HB0B 5C6RA 5DI9B 2J0JA 1GG3A 4WJ7A 1EVHA 4HAVB 2G35A 2VRWB 4K81A 1V89A 2K00A 4EJNA 3A8QA 1B55A 1KZGA 2I1KA 1N3HA 5DH9B 4TKNA 2P8VA 1QQGA 4GZUA 1KZ7A 4Z2NA 2UVMA 2EMTA 2MKRA 5JHGA 3F5RA 4KHBB 2I1JA 2Z0PA 2N23A 4GMVA 2DHJA 2AL6A 1UNRA 2DA0A 1ZM0A 2QKLA 2P0FA 2EC1A 3V5WA 1OY2A 1X05A 5CLLB 4A6HA 2DX1A 4HB4B 3O96A 1FAOA 4KHOA 2COAA 5J3YA 3VIAA 4GMXB 4GN1A 2J0MA 1U2BA 4DXAB 1U5FA 2L2IA 5J3TA 2MFQA 1GC7A 1V5UA 1Q67A 3A8PA 1TQZA 1OMWA 2RVBB 1WGUA 2YS3A 5CLQB 2K2JA 2I5FA 2Y7BA 3QIJA 1FHOA 1IRSA 1MIXA 1P6SA 3D8EA 2VSZA 4ZRIA 2DHIA 4K2OA 4K2PA 1SGHA 2COFA 5KCVA 3ZDTA 2UZRA 3SYXA 1AWEA 4TYZA 3PVUA 3ML4A 3P7ZA 4XWXA 4MY6A 2IYBA 1ZC4B 2CRFA 3KRWA 3FEHA 3AU5A 3SUZA 1DYNA 2E2XA 2Q13A 3N7CA 3D8DA 3AU4A 2YS1A 4IOYX 2D9WA 5HE1A 2VKIA 2KCJA 4HDQA 2EMSA 1W1DA 1ISNA 2DFKA 1P5TA 3SO6A 2MDXA 1FHWA 1U5EA 1MPHA 1FHXA 3PSCA 5L81A 4HHVA 4IFSA 1PLSA 2JP2A 3FSSA 3HW2B 2UZSA 2K2UA 2HTHB 5JHHA 2HE7A 2J0KA 3NSUA 3ODXA 4CHMA 2GCJA 2GJYA 3SNHA 2X18A 3HQCA 5C5BB 1W1HA 4A6KA 2DYNA 3VOQA 2KUPA 2R09A 4HAYB 2CODA 2YS5A 1UPRA 2DTCA 1LB1A 2IFSA 2QKMA 3ODWA 3RCPA 3SV1A 1X1FA 2D9ZA 2ELAA 1ZC3B 1NTYA 3ULCA 3UZTA 2DLWA 3P6AA 3CIKA 2D10A 1ZVRA 3PZDA 5KQ1A 1XODA 1FB8A 3AJ4A 5DHAB 1U29A 5D27A 4Z2MB 2NMBA 2LYDA 4F7GA 5DIFB 1TJ6A 5D3VA 2V76A 1V5MA 2L1CA 1RJ2A 2N0YA 1DROA 3DXEA 1UPQA 3HK0A 4YL8A 1E5WA 4GXBA 1LW3A 3KRXA 1I2HA 1WG7A 2RGNB 3PG7A 1Y5OA 2CAYA 1X11A 2YT1A 4NY0A 1WI1A 1GC6A 2W2XC 3A98B 2Z0QA 5JLJB 3BINA 1U5GA 4WSFA 4EMOA 1PMSA 4A6FB 2Y8GA 3BJIA 1WGQA 4YONA 4KHAA 2LG1A 2RSGA 5J3QA 1H10A 1UNQA 3ODOA 1WVHA 3TCAA 2P0HA 4KVGB 3U8ZA 2DYQA 4ZRJA 3MDBC 4DX90 1RRPB 2LKOA 1FOEA 1U5DA 2ADZA 2D9VA 4DX8A 1NTVA 5C16A 2RUKB 4HAZB 1M7EA 1H4RA 2ZPYA 1QC6A 1XKEA 1M7RA 2YVCA 3QWMA 1I7AA 2PZ1A 3IVFA 1MAIA 3PVWA 2DKPA 2OTXA 3ULBA 2XQNM 4WVFB 2D4QA 3WYFB 1EF1A 2FJLA 3TO1A 2CY5A 2MWNB 1P3RA 3F0WA 1EGXA 3PVLA 4MK0A 5LONB 2D9XA 3ZVRA 2DN6A 4Y94A 4C0AA 1U27A 1MIZB 4F7HA 2M14A 4MT7A 4NSWA 3CXBB 3GYOA 1V5PA 4HB2B 3KSYA 2GCLA 1UNPA 4K17A 2YSZA 3DXDA 1J0WA 1WJMA 3QBVB 2D2QA 1UEFA 2YRYA 1BAKA 1MKEA 2ROVA 5FI0A 1W1GA 1J19A 4CYEA 4HDOA 2W2XD 4CHJA 2KGXB 3FM8C 3PP2A 3PEGA 1X86A 1Z87A 3T06A 2YT0A 4HAXB 2LOXA 1NU2A 2I5CA 5HE2A 1BTNA 1FGZA 1V61A 5JP4A 1BTKA 1DDWA 4HATB 2R0DA 2GS0A 3OANA 2LOZA 2CY4A 4PQ0A 2RNRB 2P0DA 1ZSQA 3U7DA 5KQ4A 5D3YA 5C5BA 1XX0A 3DXCA 5D3XA 1SHCA 4GPTB 5EFXA 2D11A 1NI2A 1AQCA 3GYPA 4PNKA 4HB3B 2W2WA 1BWNA 2H7DA 4B6HA 2YF0A 1EAZA 4A5KA 2BCJA
chains in the Genus database with same CATH superfamily
1K5GB 4P7IA 1XD4A 5GOWB 2DHKA 3WA0A 3FVCA 3MPXA 5LOPB 1V88A 1X1GA 5HE0A 5HE3A 1FGYA 3LJUX 1DBHA 4CSQA 1WJ1A 1DDVA 4L6EA 3KZ1A 2COCA 1KI1B 4D0NB 1DDMA 2ELBA 2Z0OA 2AEHA 4H8SA 3G9WA 1PFJA 2Z13A 2H7EA 2LULA 2ROZB 4HAUB 3DCXA 4KAXB 2NZ8B 3KY9A 2NBVA 4QJ3B 2FJUB 1OQNA 1Y19B 1XCGA 1XR0B 4F7UP 1MK7B 4EKUA 2J59M 2EJ8A 4BBKA 5C79A 2RLOA 2DX5A 2Y8FA 5FI1A 3TVVA 3M1IB 2OQBA 1MK9B 2DKQA 3X23A 3NWDA 1T77A 5D3WA 4A6FA 2D9YA 2M38A 4HAWB 3D8FA 3TW1A 1TXDA 3B77A 3TFMA 4DBBA 4IAPA 5DHFB 4ZRKA 1K5DB 4HB0B 5C6RA 5DI9B 2J0JA 1GG3A 4WJ7A 1EVHA 4HAVB 2G35A 2K49A 2VRWB 4K81A 1V89A 2K00A 4EJNA 3A8QA 1B55A 1KZGA 2I1KA 1N3HA 5DH9B 4TKNA 2P8VA 1QQGA 4GZUA 1KZ7A 4Z2NA 2UVMA 2EMTA 2MKRA 5JHGA 3F5RA 4KHBB 2I1JA 2Z0PA 2N23A 4GMVA 2DHJA 2AL6A 1UNRA 2DA0A 1ZM0A 2QKLA 2P0FA 2EC1A 3V5WA 1OY2A 1X05A 5CLLB 4A6HA 2DX1A 4HB4B 3O96A 1FAOA 4KHOA 4GOUA 2COAA 5J3YA 3VIAA 4GMXB 4GN1A 2J0MA 1U2BA 4DXAB 1U5FA 2L2IA 5J3TA 2MFQA 1GC7A 1V5UA 1Q67A 3A8PA 1TQZA 2RRFA 1OMWA 2RVBB 1WGUA 2YS3A 5CLQB 3NWFA 2K2JA 2I5FA 2Y7BA 3QIJA 1FHOA 1IRSA 1MIXA 1P6SA 1MI1A 3D8EA 2YT2A 2VSZA 4ZRIA 3A58A 2DHIA 4K2OA 4K2PA 1SGHA 2COFA 5KCVA 3ZDTA 2UZRA 3SYXA 1AWEA 4TYZA 3PVUA 3ML4A 3P7ZA 4XWXA 4MY6A 2IYBA 1ZC4B 2CRFA 2KIGA 3KRWA 3FEHA 3AU5A 3SUZA 1DYNA 2E2XA 2Q13A 2Z59A 3N7CA 3D8DA 3AU4A 2YS1A 4IOYX 2D9WA 5HE1A 2VKIA 2KCJA 3NW8A 4HDQA 2EMSA 1W1DA 2R2YA 1ISNA 2DFKA 1P5TA 3SO6A 2MDXA 1FHWA 1U5EA 1MPHA 1FHXA 3PSCA 5L81A 4HHVA 4IFSA 1PLSA 2JP2A 3FSSA 3HW2B 2UZSA 2K2UA 4OT1A 2HTHB 5JHHA 2HE7A 2J0KA 3NSUA 3ODXA 4CHMA 2GCJA 2GJYA 3SNHA 2X18A 3HQCA 4OSNA 5C5BB 1W1HA 4A6KA 2DYNA 3VOQA 2KUPA 2R09A 4HAYB 2CODA 2YS5A 1UPRA 2DTCA 5LG4B 1LB1A 2IFSA 2QKMA 3ODWA 4QJ4B 3RCPA 3SV1A 1X1FA 2D9ZA 2ELAA 1ZC3B 1NTYA 3ULCA 3UZTA 2DLWA 3P6AA 3CIKA 2D10A 1ZVRA 3PZDA 5KQ1A 4QJ5B 1XODA 1FB8A 3AJ4A 5DHAB 1U29A 5D27A 4Z2MB 2NMBA 2LYDA 4F7GA 5DIFB 1TJ6A 5D3VA 2V76A 1V5MA 2L1CA 1RJ2A 2N0YA 2GUMA 1DROA 3DXEA 1UPQA 3HK0A 4YL8A 1E5WA 4GXBA 5IRSA 1LW3A 3KRXA 1I2HA 4L1RA 1WG7A 2RGNB 3PG7A 1Y5OA 2CAYA 1X11A 2YT1A 4NY0A 1WI1A 1GC6A 2W2XC 3A98B 2Z0QA 4KHBA 5JLJB 3OHMB 3BINA 1U5GA 4WSFA 4EMOA 2KUQA 1PMSA 4A6FB 2Y8GA 3BJIA 1WGQA 4YONA 2KR0A 4KHAA 2LG1A 2RSGA 5J3QA 1H10A 1UNQA 3ODOA 1WVHA 3TCAA 2Z14A 4GNKB 2P0HA 4KVGB 3U8ZA 2DYQA 4ZRJA 3MDBC 4DX90 5M4YB 1RRPB 2LKOA 1FOEA 3U12A 1U5DA 3NWAA 2ADZA 2D9VA 4DX8A 1NTVA 5C16A 2RUKB 4HAZB 4QXAB 1M7EA 1H4RA 2ZPYA 1QC6A 1XKEA 1M7RA 2YVCA 3QWMA 1I7AA 2PZ1A 3IVFA 1MAIA 3PVWA 2DKPA 2OTXA 3ULBA 2XQNM 4WVFB 2D4QA 3WYFB 1EF1A 2FJLA 3TO1A 4DIXA 2CY5A 2MWNB 1P3RA 3F0WA 1EGXA 3PVLA 4MK0A 5LONB 2D9XA 3ZVRA 2DN6A 4Y94A 4D6WA 4C0AA 1U27A 1MIZB 4F7HA 2M14A 4MT7A 4NSWA 3CXBB 3GYOA 1V5PA 4HB2B 3KSYA 2GCLA 2ZKMX 1UNPA 4K17A 2YSZA 3DXDA 1J0WA 1WJMA 3QBVB 2D2QA 1UEFA 3HSAA 2YRYA 1BAKA 1MKEA 2ROVA 5FI0A 1W1GA 1J19A 4CYEA 5I2SA 4HDOA 2W2XD 5I2MA 4CHJA 2KGXB 3FM8C 3PP2A 2K8EA 3PEGA 1X86A 1ZYIA 1Z87A 3T06A 2YT0A 4HAXB 2LOXA 1NU2A 2I5CA 5HE2A 2KIEA 1BTNA 1FGZA 1V61A 5JP4A 1BTKA 1DDWA 4HATB 2R0DA 2GS0A 3OANA 2LOZA 2CY4A 2Z4DA 4PQ0A 2RNRB 2P0DA 1ZSQA 3U7DA 5KQ4A 5D3YA 5C5BA 1XX0A 3DXCA 5D3XA 1SHCA 4GPTB 5EFXA 2D11A 1NI2A 1AQCA 3GYPA 4PNKA 4HB3B 4HSIA 2W2WA 1BWNA 2H7DA 4B6HA 2YF0A 1EAZA 3HIEA 4A5KA 2BCJA
chains in the Genus database with same CATH topology
1K5GB 4P7IA 1XD4A 5GOWB 2DHKA 3WA0A 3MPXA 5LOPB 1V88A 1X1GA 5HE0A 5HE3A 1FGYA 3LJUX 1DBHA 1WJ1A 1DDVA 4L6EA 3KZ1A 2COCA 1KI1B 4D0NB 1DDMA 2ELBA 2Z0OA 2AEHA 4H8SA 3G9WA 1PFJA 2H7EA 2LULA 2ROZB 4HAUB 4KAXB 2NZ8B 3KY9A 1OQNA 1Y19B 1XCGA 1XR0B 4F7UP 1MK7B 4EKUA 2J59M 2EJ8A 4BBKA 5C79A 2RLOA 2DX5A 2Y8FA 5FI1A 3TVVA 3M1IB 2OQBA 1MK9B 2DKQA 3X23A 5D3WA 4A6FA 2D9YA 2M38A 4HAWB 3D8FA 3TW1A 1TXDA 3TFMA 4DBBA 4IAPA 5DHFB 4ZRKA 1K5DB 4HB0B 5C6RA 5DI9B 2J0JA 1GG3A 4WJ7A 1EVHA 4HAVB 2G35A 2VRWB 4K81A 1V89A 2K00A 4EJNA 3A8QA 1B55A 1KZGA 2I1KA 1N3HA 5DH9B 4TKNA 2P8VA 1QQGA 4GZUA 1KZ7A 4Z2NA 2UVMA 2EMTA 2MKRA 5JHGA 3F5RA 4KHBB 2I1JA 2Z0PA 2N23A 4GMVA 2DHJA 2AL6A 1UNRA 2DA0A 1ZM0A 2QKLA 2P0FA 2EC1A 3V5WA 1OY2A 1X05A 5CLLB 4A6HA 2DX1A 4HB4B 3O96A 1FAOA 4KHOA 2COAA 5J3YA 3VIAA 4GMXB 4GN1A 2J0MA 1U2BA 4DXAB 1U5FA 2L2IA 5J3TA 2MFQA 1GC7A 1V5UA 1Q67A 3A8PA 1TQZA 1OMWA 2RVBB 1WGUA 2YS3A 5CLQB 2K2JA 2I5FA 2Y7BA 3QIJA 1FHOA 1IRSA 1MIXA 1P6SA 3D8EA 2VSZA 4ZRIA 2DHIA 4K2OA 4K2PA 1SGHA 2COFA 5KCVA 3ZDTA 2UZRA 3SYXA 1AWEA 4TYZA 3PVUA 3ML4A 3P7ZA 4XWXA 4MY6A 2IYBA 1ZC4B 2CRFA 3KRWA 3FEHA 3AU5A 3SUZA 1DYNA 2E2XA 2Q13A 3N7CA 3D8DA 3AU4A 2YS1A 4IOYX 2D9WA 5HE1A 2VKIA 2KCJA 4HDQA 2EMSA 1W1DA 1ISNA 2DFKA 1P5TA 3SO6A 2MDXA 1FHWA 1U5EA 1MPHA 1FHXA 3PSCA 5L81A 4HHVA 4IFSA 1PLSA 2JP2A 3FSSA 3HW2B 2UZSA 2K2UA 2HTHB 5JHHA 2HE7A 2J0KA 3NSUA 3ODXA 4CHMA 2GCJA 2GJYA 3SNHA 2X18A 3HQCA 5C5BB 1W1HA 4A6KA 2DYNA 3VOQA 2KUPA 2R09A 4HAYB 2CODA 2YS5A 1UPRA 2DTCA 1LB1A 2IFSA 2QKMA 3ODWA 3RCPA 3SV1A 1X1FA 2D9ZA 2ELAA 1ZC3B 1NTYA 3ULCA 3UZTA 2DLWA 3P6AA 3CIKA 2D10A 1ZVRA 3PZDA 5KQ1A 1XODA 1FB8A 3AJ4A 5DHAB 1U29A 5D27A 4Z2MB 2NMBA 2LYDA 4F7GA 5DIFB 1TJ6A 5D3VA 2V76A 1V5MA 2L1CA 1RJ2A 2N0YA 1DROA 3DXEA 1UPQA 3HK0A 4YL8A 1E5WA 4GXBA 1LW3A 3KRXA 1I2HA 1WG7A 2RGNB 3PG7A 1Y5OA 2CAYA 1X11A 2YT1A 4NY0A 1WI1A 1GC6A 2W2XC 3A98B 2Z0QA 5JLJB 3BINA 1U5GA 4WSFA 4EMOA 1PMSA 4A6FB 2Y8GA 3BJIA 1WGQA 4YONA 4KHAA 2LG1A 2RSGA 5J3QA 1H10A 1UNQA 3ODOA 1WVHA 3TCAA 2P0HA 4KVGB 3U8ZA 2DYQA 4ZRJA 3MDBC 4DX90 1RRPB 2LKOA 1FOEA 1U5DA 2ADZA 2D9VA 4DX8A 1NTVA 5C16A 2RUKB 4HAZB 1M7EA 1H4RA 2ZPYA 1QC6A 1XKEA 1M7RA 2YVCA 3QWMA 1I7AA 2PZ1A 3IVFA 1MAIA 3PVWA 2DKPA 2OTXA 3ULBA 2XQNM 4WVFB 2D4QA 3WYFB 1EF1A 2FJLA 3TO1A 2CY5A 2MWNB 1P3RA 3F0WA 1EGXA 3PVLA 4MK0A 5LONB 2D9XA 3ZVRA 2DN6A 4Y94A 4C0AA 1U27A 1MIZB 4F7HA 2M14A 4MT7A 4NSWA 3CXBB 3GYOA 1V5PA 4HB2B 3KSYA 2GCLA 1UNPA 4K17A 2YSZA 3DXDA 1J0WA 1WJMA 3QBVB 2D2QA 1UEFA 2YRYA 1BAKA 1MKEA 2ROVA 5FI0A 1W1GA 1J19A 4CYEA 4HDOA 2W2XD 4CHJA 2KGXB 3FM8C 3PP2A 3PEGA 1X86A 1Z87A 3T06A 2YT0A 4HAXB 2LOXA 1NU2A 2I5CA 5HE2A 1BTNA 1FGZA 1V61A 5JP4A 1BTKA 1DDWA 4HATB 2R0DA 2GS0A 3OANA 2LOZA 2CY4A 4PQ0A 2RNRB 2P0DA 1ZSQA 3U7DA 5KQ4A 5D3YA 5C5BA 1XX0A 3DXCA 5D3XA 1SHCA 4GPTB 5EFXA 2D11A 1NI2A 1AQCA 3GYPA 4PNKA 4HB3B 2W2WA 1BWNA 2H7DA 4B6HA 2YF0A 1EAZA 4A5KA 2BCJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K5G B;  4P7I A;  1XD4 A;  5GOW B;  2DHK A;  3WA0 A;  3MPX A;  5LOP B;  1V88 A;  1X1G A;  5HE0 A;  5HE3 A;  1FGY A;  3LJU X;  1DBH A;  1WJ1 A;  1DDV A;  4L6E A;  3KZ1 A;  2COC A;  1KI1 B;  4D0N B;  1DDM A;  2ELB A;  2Z0O A;  2AEH A;  4H8S A;  3G9W A;  1PFJ A;  2H7E A;  2LUL A;  2ROZ B;  4HAU B;  4KAX B;  2NZ8 B;  3KY9 A;  1OQN A;  1Y19 B;  1XCG A;  1XR0 B;  4F7U P;  1MK7 B;  4EKU A;  2J59 M;  2EJ8 A;  4BBK A;  5C79 A;  2RLO A;  2DX5 A;  2Y8F A;  5FI1 A;  3TVV A;  3M1I B;  2OQB A;  1MK9 B;  2DKQ A;  3X23 A;  5D3W A;  4A6F A;  2D9Y A;  2M38 A;  4HAW B;  3D8F A;  3TW1 A;  1TXD A;  3TFM A;  4DBB A;  4IAP A;  5DHF B;  4ZRK A;  1K5D B;  4HB0 B;  5C6R A;  5DI9 B;  2J0J A;  1GG3 A;  4WJ7 A;  1EVH A;  4HAV B;  2G35 A;  2VRW B;  4K81 A;  1V89 A;  2K00 A;  4EJN A;  3A8Q A;  1B55 A;  1KZG A;  2I1K A;  1N3H A;  5DH9 B;  4TKN A;  2P8V A;  1QQG A;  4GZU A;  1KZ7 A;  4Z2N A;  2UVM A;  2EMT A;  2MKR A;  5JHG A;  3F5R A;  4KHB B;  2I1J A;  2Z0P A;  2N23 A;  4GMV A;  2DHJ A;  2AL6 A;  1UNR A;  2DA0 A;  1ZM0 A;  2QKL A;  2P0F A;  2EC1 A;  3V5W A;  1OY2 A;  1X05 A;  5CLL B;  4A6H A;  2DX1 A;  4HB4 B;  3O96 A;  1FAO A;  4KHO A;  2COA A;  5J3Y A;  3VIA A;  4GMX B;  4GN1 A;  2J0M A;  1U2B A;  4DXA B;  1U5F A;  2L2I A;  5J3T A;  2MFQ A;  1GC7 A;  1V5U A;  1Q67 A;  3A8P A;  1TQZ A;  1OMW A;  2RVB B;  1WGU A;  2YS3 A;  5CLQ B;  2K2J A;  2I5F A;  2Y7B A;  3QIJ A;  1FHO A;  1IRS A;  1MIX A;  1P6S A;  3D8E A;  2VSZ A;  4ZRI A;  2DHI A;  4K2O A;  4K2P A;  1SGH A;  2COF A;  5KCV A;  3ZDT A;  2UZR A;  3SYX A;  1AWE A;  4TYZ A;  3PVU A;  3ML4 A;  3P7Z A;  4XWX A;  4MY6 A;  2IYB A;  1ZC4 B;  2CRF A;  3KRW A;  3FEH A;  3AU5 A;  3SUZ A;  1DYN A;  2E2X A;  2Q13 A;  3N7C A;  3D8D A;  3AU4 A;  2YS1 A;  4IOY X;  2D9W A;  5HE1 A;  2VKI A;  2KCJ A;  4HDQ A;  2EMS A;  1W1D A;  1ISN A;  2DFK A;  1P5T A;  3SO6 A;  2MDX A;  1FHW A;  1U5E A;  1MPH A;  1FHX A;  3PSC A;  5L81 A;  4HHV A;  4IFS A;  1PLS A;  2JP2 A;  3FSS A;  3HW2 B;  2UZS A;  2K2U A;  2HTH B;  5JHH A;  2HE7 A;  2J0K A;  3NSU A;  3ODX A;  4CHM A;  2GCJ A;  2GJY A;  3SNH A;  2X18 A;  3HQC A;  5C5B B;  1W1H A;  4A6K A;  2DYN A;  3VOQ A;  2KUP A;  2R09 A;  4HAY B;  2COD A;  2YS5 A;  1UPR A;  2DTC A;  1LB1 A;  2IFS A;  2QKM A;  3ODW A;  3RCP A;  3SV1 A;  1X1F A;  2D9Z A;  2ELA A;  1ZC3 B;  1NTY A;  3ULC A;  3UZT A;  2DLW A;  3P6A A;  3CIK A;  2D10 A;  1ZVR A;  3PZD A;  5KQ1 A;  1XOD A;  1FB8 A;  3AJ4 A;  5DHA B;  1U29 A;  5D27 A;  4Z2M B;  2NMB A;  2LYD A;  4F7G A;  5DIF B;  1TJ6 A;  5D3V A;  2V76 A;  1V5M A;  2L1C A;  1RJ2 A;  2N0Y A;  1DRO A;  3DXE A;  1UPQ A;  3HK0 A;  4YL8 A;  1E5W A;  4GXB A;  1LW3 A;  3KRX A;  1I2H A;  1WG7 A;  2RGN B;  3PG7 A;  1Y5O A;  2CAY A;  1X11 A;  2YT1 A;  4NY0 A;  1WI1 A;  1GC6 A;  2W2X C;  3A98 B;  2Z0Q A;  5JLJ B;  3BIN A;  1U5G A;  4WSF A;  4EMO A;  1PMS A;  4A6F B;  2Y8G A;  3BJI A;  1WGQ A;  4YON A;  4KHA A;  2LG1 A;  2RSG A;  5J3Q A;  1H10 A;  1UNQ A;  3ODO A;  1WVH A;  3TCA A;  2P0H A;  4KVG B;  3U8Z A;  2DYQ A;  4ZRJ A;  3MDB C;  4DX9 0;  1RRP B;  2LKO A;  1FOE A;  1U5D A;  2ADZ A;  2D9V A;  4DX8 A;  1NTV A;  5C16 A;  2RUK B;  4HAZ B;  1M7E A;  1H4R A;  2ZPY A;  1QC6 A;  1XKE A;  1M7R A;  2YVC A;  3QWM A;  1I7A A;  2PZ1 A;  3IVF A;  1MAI A;  3PVW A;  2DKP A;  2OTX A;  3ULB A;  2XQN M;  4WVF B;  2D4Q A;  3WYF B;  1EF1 A;  2FJL A;  3TO1 A;  2CY5 A;  2MWN B;  1P3R A;  3F0W A;  1EGX A;  3PVL A;  4MK0 A;  5LON B;  2D9X A;  3ZVR A;  2DN6 A;  4Y94 A;  4C0A A;  1U27 A;  1MIZ B;  4F7H A;  2M14 A;  4MT7 A;  4NSW A;  3CXB B;  3GYO A;  1V5P A;  4HB2 B;  3KSY A;  2GCL A;  1UNP A;  4K17 A;  2YSZ A;  3DXD A;  1J0W A;  1WJM A;  3QBV B;  2D2Q A;  1UEF A;  2YRY A;  1BAK A;  1MKE A;  2ROV A;  5FI0 A;  1W1G A;  1J19 A;  4CYE A;  4HDO A;  2W2X D;  4CHJ A;  2KGX B;  3FM8 C;  3PP2 A;  3PEG A;  1X86 A;  1Z87 A;  3T06 A;  2YT0 A;  4HAX B;  2LOX A;  1NU2 A;  2I5C A;  5HE2 A;  1BTN A;  1FGZ A;  1V61 A;  5JP4 A;  1BTK A;  1DDW A;  4HAT B;  2R0D A;  2GS0 A;  3OAN A;  2LOZ A;  2CY4 A;  4PQ0 A;  2RNR B;  2P0D A;  1ZSQ A;  3U7D A;  5KQ4 A;  5D3Y A;  5C5B A;  1XX0 A;  3DXC A;  5D3X A;  1SHC A;  4GPT B;  5EFX A;  2D11 A;  1NI2 A;  1AQC A;  3GYP A;  4PNK A;  4HB3 B;  2W2W A;  1BWN A;  2H7D A;  4B6H A;  2YF0 A;  1EAZ A;  4A5K A;  2BCJ A; 
#chains in the Genus database with same CATH topology
 1K5G B;  4P7I A;  1XD4 A;  5GOW B;  2DHK A;  3WA0 A;  3FVC A;  3MPX A;  5LOP B;  1V88 A;  1X1G A;  5HE0 A;  5HE3 A;  1FGY A;  3LJU X;  1DBH A;  4CSQ A;  1WJ1 A;  1DDV A;  4L6E A;  3KZ1 A;  2COC A;  1KI1 B;  4D0N B;  1DDM A;  2ELB A;  2Z0O A;  2AEH A;  4H8S A;  3G9W A;  1PFJ A;  2Z13 A;  2H7E A;  2LUL A;  2ROZ B;  4HAU B;  3DCX A;  4KAX B;  2NZ8 B;  3KY9 A;  2NBV A;  4QJ3 B;  2FJU B;  1OQN A;  1Y19 B;  1XCG A;  1XR0 B;  4F7U P;  1MK7 B;  4EKU A;  2J59 M;  2EJ8 A;  4BBK A;  5C79 A;  2RLO A;  2DX5 A;  2Y8F A;  5FI1 A;  3TVV A;  3M1I B;  2OQB A;  1MK9 B;  2DKQ A;  3X23 A;  3NWD A;  1T77 A;  5D3W A;  4A6F A;  2D9Y A;  2M38 A;  4HAW B;  3D8F A;  3TW1 A;  1TXD A;  3B77 A;  3TFM A;  4DBB A;  4IAP A;  5DHF B;  4ZRK A;  1K5D B;  4HB0 B;  5C6R A;  5DI9 B;  2J0J A;  1GG3 A;  4WJ7 A;  1EVH A;  4HAV B;  2G35 A;  2K49 A;  2VRW B;  4K81 A;  1V89 A;  2K00 A;  4EJN A;  3A8Q A;  1B55 A;  1KZG A;  2I1K A;  1N3H A;  5DH9 B;  4TKN A;  2P8V A;  1QQG A;  4GZU A;  1KZ7 A;  4Z2N A;  2UVM A;  2EMT A;  2MKR A;  5JHG A;  3F5R A;  4KHB B;  2I1J A;  2Z0P A;  2N23 A;  4GMV A;  2DHJ A;  2AL6 A;  1UNR A;  2DA0 A;  1ZM0 A;  2QKL A;  2P0F A;  2EC1 A;  3V5W A;  1OY2 A;  1X05 A;  5CLL B;  4A6H A;  2DX1 A;  4HB4 B;  3O96 A;  1FAO A;  4KHO A;  4GOU A;  2COA A;  5J3Y A;  3VIA A;  4GMX B;  4GN1 A;  2J0M A;  1U2B A;  4DXA B;  1U5F A;  2L2I A;  5J3T A;  2MFQ A;  1GC7 A;  1V5U A;  1Q67 A;  3A8P A;  1TQZ A;  2RRF A;  1OMW A;  2RVB B;  1WGU A;  2YS3 A;  5CLQ B;  3NWF A;  2K2J A;  2I5F A;  2Y7B A;  3QIJ A;  1FHO A;  1IRS A;  1MIX A;  1P6S A;  1MI1 A;  3D8E A;  2YT2 A;  2VSZ A;  4ZRI A;  3A58 A;  2DHI A;  4K2O A;  4K2P A;  1SGH A;  2COF A;  5KCV A;  3ZDT A;  2UZR A;  3SYX A;  1AWE A;  4TYZ A;  3PVU A;  3ML4 A;  3P7Z A;  4XWX A;  4MY6 A;  2IYB A;  1ZC4 B;  2CRF A;  2KIG A;  3KRW A;  3FEH A;  3AU5 A;  3SUZ A;  1DYN A;  2E2X A;  2Q13 A;  2Z59 A;  3N7C A;  3D8D A;  3AU4 A;  2YS1 A;  4IOY X;  2D9W A;  5HE1 A;  2VKI A;  2KCJ A;  3NW8 A;  4HDQ A;  2EMS A;  1W1D A;  2R2Y A;  1ISN A;  2DFK A;  1P5T A;  3SO6 A;  2MDX A;  1FHW A;  1U5E A;  1MPH A;  1FHX A;  3PSC A;  5L81 A;  4HHV A;  4IFS A;  1PLS A;  2JP2 A;  3FSS A;  3HW2 B;  2UZS A;  2K2U A;  4OT1 A;  2HTH B;  5JHH A;  2HE7 A;  2J0K A;  3NSU A;  3ODX A;  4CHM A;  2GCJ A;  2GJY A;  3SNH A;  2X18 A;  3HQC A;  4OSN A;  5C5B B;  1W1H A;  4A6K A;  2DYN A;  3VOQ A;  2KUP A;  2R09 A;  4HAY B;  2COD A;  2YS5 A;  1UPR A;  2DTC A;  5LG4 B;  1LB1 A;  2IFS A;  2QKM A;  3ODW A;  4QJ4 B;  3RCP A;  3SV1 A;  1X1F A;  2D9Z A;  2ELA A;  1ZC3 B;  1NTY A;  3ULC A;  3UZT A;  2DLW A;  3P6A A;  3CIK A;  2D10 A;  1ZVR A;  3PZD A;  5KQ1 A;  4QJ5 B;  1XOD A;  1FB8 A;  3AJ4 A;  5DHA B;  1U29 A;  5D27 A;  4Z2M B;  2NMB A;  2LYD A;  4F7G A;  5DIF B;  1TJ6 A;  5D3V A;  2V76 A;  1V5M A;  2L1C A;  1RJ2 A;  2N0Y A;  2GUM A;  1DRO A;  3DXE A;  1UPQ A;  3HK0 A;  4YL8 A;  1E5W A;  4GXB A;  5IRS A;  1LW3 A;  3KRX A;  1I2H A;  4L1R A;  1WG7 A;  2RGN B;  3PG7 A;  1Y5O A;  2CAY A;  1X11 A;  2YT1 A;  4NY0 A;  1WI1 A;  1GC6 A;  2W2X C;  3A98 B;  2Z0Q A;  4KHB A;  5JLJ B;  3OHM B;  3BIN A;  1U5G A;  4WSF A;  4EMO A;  2KUQ A;  1PMS A;  4A6F B;  2Y8G A;  3BJI A;  1WGQ A;  4YON A;  2KR0 A;  4KHA A;  2LG1 A;  2RSG A;  5J3Q A;  1H10 A;  1UNQ A;  3ODO A;  1WVH A;  3TCA A;  2Z14 A;  4GNK B;  2P0H A;  4KVG B;  3U8Z A;  2DYQ A;  4ZRJ A;  3MDB C;  4DX9 0;  5M4Y B;  1RRP B;  2LKO A;  1FOE A;  3U12 A;  1U5D A;  3NWA A;  2ADZ A;  2D9V A;  4DX8 A;  1NTV A;  5C16 A;  2RUK B;  4HAZ B;  4QXA B;  1M7E A;  1H4R A;  2ZPY A;  1QC6 A;  1XKE A;  1M7R A;  2YVC A;  3QWM A;  1I7A A;  2PZ1 A;  3IVF A;  1MAI A;  3PVW A;  2DKP A;  2OTX A;  3ULB A;  2XQN M;  4WVF B;  2D4Q A;  3WYF B;  1EF1 A;  2FJL A;  3TO1 A;  4DIX A;  2CY5 A;  2MWN B;  1P3R A;  3F0W A;  1EGX A;  3PVL A;  4MK0 A;  5LON B;  2D9X A;  3ZVR A;  2DN6 A;  4Y94 A;  4D6W A;  4C0A A;  1U27 A;  1MIZ B;  4F7H A;  2M14 A;  4MT7 A;  4NSW A;  3CXB B;  3GYO A;  1V5P A;  4HB2 B;  3KSY A;  2GCL A;  2ZKM X;  1UNP A;  4K17 A;  2YSZ A;  3DXD A;  1J0W A;  1WJM A;  3QBV B;  2D2Q A;  1UEF A;  3HSA A;  2YRY A;  1BAK A;  1MKE A;  2ROV A;  5FI0 A;  1W1G A;  1J19 A;  4CYE A;  5I2S A;  4HDO A;  2W2X D;  5I2M A;  4CHJ A;  2KGX B;  3FM8 C;  3PP2 A;  2K8E A;  3PEG A;  1X86 A;  1ZYI A;  1Z87 A;  3T06 A;  2YT0 A;  4HAX B;  2LOX A;  1NU2 A;  2I5C A;  5HE2 A;  2KIE A;  1BTN A;  1FGZ A;  1V61 A;  5JP4 A;  1BTK A;  1DDW A;  4HAT B;  2R0D A;  2GS0 A;  3OAN A;  2LOZ A;  2CY4 A;  2Z4D A;  4PQ0 A;  2RNR B;  2P0D A;  1ZSQ A;  3U7D A;  5KQ4 A;  5D3Y A;  5C5B A;  1XX0 A;  3DXC A;  5D3X A;  1SHC A;  4GPT B;  5EFX A;  2D11 A;  1NI2 A;  1AQC A;  3GYP A;  4PNK A;  4HB3 B;  4HSI A;  2W2W A;  1BWN A;  2H7D A;  4B6H A;  2YF0 A;  1EAZ A;  3HIE A;  4A5K A;  2BCJ A; 
#chains in the Genus database with same CATH homology
 1K5G B;  4P7I A;  1XD4 A;  5GOW B;  2DHK A;  3WA0 A;  3MPX A;  5LOP B;  1V88 A;  1X1G A;  5HE0 A;  5HE3 A;  1FGY A;  3LJU X;  1DBH A;  1WJ1 A;  1DDV A;  4L6E A;  3KZ1 A;  2COC A;  1KI1 B;  4D0N B;  1DDM A;  2ELB A;  2Z0O A;  2AEH A;  4H8S A;  3G9W A;  1PFJ A;  2H7E A;  2LUL A;  2ROZ B;  4HAU B;  4KAX B;  2NZ8 B;  3KY9 A;  1OQN A;  1Y19 B;  1XCG A;  1XR0 B;  4F7U P;  1MK7 B;  4EKU A;  2J59 M;  2EJ8 A;  4BBK A;  5C79 A;  2RLO A;  2DX5 A;  2Y8F A;  5FI1 A;  3TVV A;  3M1I B;  2OQB A;  1MK9 B;  2DKQ A;  3X23 A;  5D3W A;  4A6F A;  2D9Y A;  2M38 A;  4HAW B;  3D8F A;  3TW1 A;  1TXD A;  3TFM A;  4DBB A;  4IAP A;  5DHF B;  4ZRK A;  1K5D B;  4HB0 B;  5C6R A;  5DI9 B;  2J0J A;  1GG3 A;  4WJ7 A;  1EVH A;  4HAV B;  2G35 A;  2VRW B;  4K81 A;  1V89 A;  2K00 A;  4EJN A;  3A8Q A;  1B55 A;  1KZG A;  2I1K A;  1N3H A;  5DH9 B;  4TKN A;  2P8V A;  1QQG A;  4GZU A;  1KZ7 A;  4Z2N A;  2UVM A;  2EMT A;  2MKR A;  5JHG A;  3F5R A;  4KHB B;  2I1J A;  2Z0P A;  2N23 A;  4GMV A;  2DHJ A;  2AL6 A;  1UNR A;  2DA0 A;  1ZM0 A;  2QKL A;  2P0F A;  2EC1 A;  3V5W A;  1OY2 A;  1X05 A;  5CLL B;  4A6H A;  2DX1 A;  4HB4 B;  3O96 A;  1FAO A;  4KHO A;  2COA A;  5J3Y A;  3VIA A;  4GMX B;  4GN1 A;  2J0M A;  1U2B A;  4DXA B;  1U5F A;  2L2I A;  5J3T A;  2MFQ A;  1GC7 A;  1V5U A;  1Q67 A;  3A8P A;  1TQZ A;  1OMW A;  2RVB B;  1WGU A;  2YS3 A;  5CLQ B;  2K2J A;  2I5F A;  2Y7B A;  3QIJ A;  1FHO A;  1IRS A;  1MIX A;  1P6S A;  3D8E A;  2VSZ A;  4ZRI A;  2DHI A;  4K2O A;  4K2P A;  1SGH A;  2COF A;  5KCV A;  3ZDT A;  2UZR A;  3SYX A;  1AWE A;  4TYZ A;  3PVU A;  3ML4 A;  3P7Z A;  4XWX A;  4MY6 A;  2IYB A;  1ZC4 B;  2CRF A;  3KRW A;  3FEH A;  3AU5 A;  3SUZ A;  1DYN A;  2E2X A;  2Q13 A;  3N7C A;  3D8D A;  3AU4 A;  2YS1 A;  4IOY X;  2D9W A;  5HE1 A;  2VKI A;  2KCJ A;  4HDQ A;  2EMS A;  1W1D A;  1ISN A;  2DFK A;  1P5T A;  3SO6 A;  2MDX A;  1FHW A;  1U5E A;  1MPH A;  1FHX A;  3PSC A;  5L81 A;  4HHV A;  4IFS A;  1PLS A;  2JP2 A;  3FSS A;  3HW2 B;  2UZS A;  2K2U A;  2HTH B;  5JHH A;  2HE7 A;  2J0K A;  3NSU A;  3ODX A;  4CHM A;  2GCJ A;  2GJY A;  3SNH A;  2X18 A;  3HQC A;  5C5B B;  1W1H A;  4A6K A;  2DYN A;  3VOQ A;  2KUP A;  2R09 A;  4HAY B;  2COD A;  2YS5 A;  1UPR A;  2DTC A;  1LB1 A;  2IFS A;  2QKM A;  3ODW A;  3RCP A;  3SV1 A;  1X1F A;  2D9Z A;  2ELA A;  1ZC3 B;  1NTY A;  3ULC A;  3UZT A;  2DLW A;  3P6A A;  3CIK A;  2D10 A;  1ZVR A;  3PZD A;  5KQ1 A;  1XOD A;  1FB8 A;  3AJ4 A;  5DHA B;  1U29 A;  5D27 A;  4Z2M B;  2NMB A;  2LYD A;  4F7G A;  5DIF B;  1TJ6 A;  5D3V A;  2V76 A;  1V5M A;  2L1C A;  1RJ2 A;  2N0Y A;  1DRO A;  3DXE A;  1UPQ A;  3HK0 A;  4YL8 A;  1E5W A;  4GXB A;  1LW3 A;  3KRX A;  1I2H A;  1WG7 A;  2RGN B;  3PG7 A;  1Y5O A;  2CAY A;  1X11 A;  2YT1 A;  4NY0 A;  1WI1 A;  1GC6 A;  2W2X C;  3A98 B;  2Z0Q A;  5JLJ B;  3BIN A;  1U5G A;  4WSF A;  4EMO A;  1PMS A;  4A6F B;  2Y8G A;  3BJI A;  1WGQ A;  4YON A;  4KHA A;  2LG1 A;  2RSG A;  5J3Q A;  1H10 A;  1UNQ A;  3ODO A;  1WVH A;  3TCA A;  2P0H A;  4KVG B;  3U8Z A;  2DYQ A;  4ZRJ A;  3MDB C;  4DX9 0;  1RRP B;  2LKO A;  1FOE A;  1U5D A;  2ADZ A;  2D9V A;  4DX8 A;  1NTV A;  5C16 A;  2RUK B;  4HAZ B;  1M7E A;  1H4R A;  2ZPY A;  1QC6 A;  1XKE A;  1M7R A;  2YVC A;  3QWM A;  1I7A A;  2PZ1 A;  3IVF A;  1MAI A;  3PVW A;  2DKP A;  2OTX A;  3ULB A;  2XQN M;  4WVF B;  2D4Q A;  3WYF B;  1EF1 A;  2FJL A;  3TO1 A;  2CY5 A;  2MWN B;  1P3R A;  3F0W A;  1EGX A;  3PVL A;  4MK0 A;  5LON B;  2D9X A;  3ZVR A;  2DN6 A;  4Y94 A;  4C0A A;  1U27 A;  1MIZ B;  4F7H A;  2M14 A;  4MT7 A;  4NSW A;  3CXB B;  3GYO A;  1V5P A;  4HB2 B;  3KSY A;  2GCL A;  1UNP A;  4K17 A;  2YSZ A;  3DXD A;  1J0W A;  1WJM A;  3QBV B;  2D2Q A;  1UEF A;  2YRY A;  1BAK A;  1MKE A;  2ROV A;  5FI0 A;  1W1G A;  1J19 A;  4CYE A;  4HDO A;  2W2X D;  4CHJ A;  2KGX B;  3FM8 C;  3PP2 A;  3PEG A;  1X86 A;  1Z87 A;  3T06 A;  2YT0 A;  4HAX B;  2LOX A;  1NU2 A;  2I5C A;  5HE2 A;  1BTN A;  1FGZ A;  1V61 A;  5JP4 A;  1BTK A;  1DDW A;  4HAT B;  2R0D A;  2GS0 A;  3OAN A;  2LOZ A;  2CY4 A;  4PQ0 A;  2RNR B;  2P0D A;  1ZSQ A;  3U7D A;  5KQ4 A;  5D3Y A;  5C5B A;  1XX0 A;  3DXC A;  5D3X A;  1SHC A;  4GPT B;  5EFX A;  2D11 A;  1NI2 A;  1AQC A;  3GYP A;  4PNK A;  4HB3 B;  2W2W A;  1BWN A;  2H7D A;  4B6H A;  2YF0 A;  1EAZ A;  4A5K A;  2BCJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...