4B6HA

Structure of hdcp1a in complex with proline rich sequence of pnrc2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
130
structure length
129
Chain Sequence
LMEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDIEGTLFVYRRSASPYHGFTIVNRNMHNLVEPVNKDLEFQLHEPFLLYRNASLSIYSIWFYDKNDCHRIAKLMADVVEEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MRNA-DECAPPING ENZYME 1A
publication title Structural Basis of the Pnrc2-Mediated Link between Mrna Surveillance and Decapping.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/peptide
total genus 35
structure length 129
sequence length 130
chains with identical sequence B
ec nomenclature ec 3.-.-.-:
pdb deposition date 2012-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4b6hA00
1MK7B 1MIXA 4YONA 5FI1A 2P0FA 3PVWA 1ZVRA 4CYEA 1DYNA 4Z2MB 2CRFA 4Z2NA 3G9WA 2EC1A 2UZRA 3FM8C 2KUPA 3ULCA 2D9XA 2Y8GA 3NSUA 1WI1A 2K2UA 4GN1A 1X1FA 5CLLB 2D11A 3TVVA 3O96A 2AEHA 4BBKA 3TW1A 4HHVA 1SGHA 2MKRA 4MK0A 1FAOA 1M7RA 1X05A 3QWMA 1WJMA 3PG7A 5DI9B 1TXDA 5JLJB 1XKEA 1K5DB 4K81A 2M38A 2YF0A 1PFJA 1MKEA 4P7IA 3QBVB 3A8PA 2DHIA 4K17A 1N3HA 2KGXB 2RNRB 2DKPA 1X1GA 1PMSA 1Y5OA 1W1HA 1E5WA 1XODA 1SHCA 1ISNA 2DYQA 2J0MA 1V5MA 1ZC4B 4K2PA 4K2OA 3D8DA 3U8ZA 4GPTB 1UNQA 3VOQA 2COAA 3N7CA 1ZM0A 3ODXA 1EAZA 2GCJA 2YSZA 1XD4A 5C5BA 1UPRA 2CY4A 5JHHA 3PP2A 3OANA 2DYNA 2VRWB 4D0NB 4F7HA 2EJ8A 1LB1A 5FI0A 2GCLA 2D9YA 4EMOA 2GS0A 3KSYA 2MFQA 1PLSA 3HW2B 3HK0A 3MDBC 4CHJA 2R0DA 1LW3A 5HE1A 1NTVA 1I2HA 5J3YA 1OQNA 1U2BA 4HAXB 3SUZA 1UEFA 2XQNM 3PSCA 4HAYB 5LOPB 3T06A 2RGNB 2LOXA 2D2QA 4NY0A 2COFA 2I1KA 1GG3A 1X86A 4GMXB 1EGXA 1J19A 4GMVA 4DXAB 4TKNA 3FSSA 2NMBA 1FHWA 3SV1A 5HE3A 3PZDA 4H8SA 4A6FA 1NTYA 5D3YA 1QQGA 2CAYA 2D9ZA 2Z0PA 1DDMA 1P3RA 2AL6A 3KZ1A 2V76A 2BCJA 4KAXB 3ZDTA 3KRXA 2HE7A 2J0KA 3M1IB 3CIKA 4IOYX 1U5GA 3FEHA 2OQBA 2L1CA 4MY6A 1QC6A 5EFXA 4HDOA 2YRYA 4A6HA 3ODOA 1XR0B 1J0WA 1ZC3B 1Q67A 4WSFA 1FGYA 1NU2A 2RSGA 5HE0A 1IRSA 2EMTA 4HB0B 4ZRIA 1XCGA 3P7ZA 3WA0A 1Z87A 1DDVA 1W1GA 2P0DA 4IFSA 5DHFB 1RJ2A 4PQ0A 1U5DA 5J3TA 1OY2A 3A8QA 4A5KA 1AQCA 5DH9B 3KRWA 5D27A 2LOZA 2LULA 2YT1A 4KHAA 2ZPYA 2G35A 2ELAA 2Y8FA 4DBBA 2HTHB 1U5EA 2X18A 1TJ6A 3SO6A 5LONB 3PEGA 1K5GB 3SNHA 1ZSQA 2LKOA 3ULBA 1X11A 1GC7A 2VKIA 2KCJA 3V5WA 4TYZA 1MPHA 3VIAA 1KI1B 1DBHA 4EKUA 1P5TA 4DX8A 2ROZB 3QIJA 2MDXA 2YS3A 2DKQA 2K00A 2W2XD 5CLQB 3P6AA 3BJIA 2DTCA 2VSZA 2RVBB 5JP4A 2DX5A 2Q13A 4F7GA 2D9WA 2IFSA 3UZTA 3U7DA 2CODA 3WYFB 3ODWA 1U27A 4DX90 3DXEA 2JP2A 5L81A 5KCVA 1W1DA 2PZ1A 3PVUA 2MWNB 2DN6A 2GJYA 1KZ7A 1FOEA 1Y19B 3A98B 4HAVB 2YS5A 2K2JA 1GC6A 1V88A 4XWXA 4HAWB 5JHGA 2E2XA 2YVCA 3CXBB 2EMSA 3DXDA 2OTXA 5KQ1A 4HAZB 3KY9A 1U5FA 2LG1A 1FGZA 2COCA 1V5PA 3BINA 4KHOA 2I5CA 1EF1A 2D9VA 1U29A 2W2WA 2RUKB 2I1JA 3ZVRA 3TCAA 1TQZA 4PNKA 4L6EA 4C0AA 2Z0OA 4GZUA 4MT7A 1BTKA 4F7UP 2IYBA 4HAUB 1FHXA 2N23A 2Z0QA 3F5RA 3ML4A 3IVFA 2J0JA 2I5FA 3TO1A 1H4RA 2DX1A 2H7DA 4HB2B 1BAKA 4GXBA 3HQCA 1DDWA 2DHKA 1WG7A 1V5UA 4ZRJA 3RCPA 4A6FB 5HE2A 3AJ4A 1EVHA 3TFMA 2P0HA 1FHOA 1WJ1A 1NI2A 5C16A 2CY5A 1MAIA 1P6SA 5C6RA 4WJ7A 4KHBB 4A6KA 2L2IA 2M14A 5D3XA 1H10A 2DFKA 4Y94A 2D4QA 2P8VA 4B6HA 1FB8A 3SYXA 5KQ4A 4EJNA 2UZSA 2DA0A 4ZRKA 5DIFB 4YL8A 3DXCA 3X23A 1BTNA 2QKLA 3PVLA 3D8EA 1DROA 1WGUA 2ELBA 1RRPB 3MPXA 2YS1A 1BWNA 1MIZB 3AU5A 2LYDA 4NSWA 1WVHA 2R09A 2D10A 2FJLA 2N0YA 1M7EA 3D8FA 1UNPA 4HB3B 1XX0A 2H7EA 2QKMA 2UVMA 5J3QA 4HB4B 2NZ8B 2DLWA 5D3VA 3F0WA 4HDQA 4CHMA 1B55A 2DHJA 2ROVA 4KVGB 1OMWA 1I7AA 4HATB 2W2XC 4WVFB 5C5BB 1V61A 1KZGA 5C79A 2YT0A 3AU4A 1UPQA 2Y7BA 1MK9B 1V89A 1UNRA 2ADZA 2RLOA 5DHAB 3LJUX 1AWEA 5D3WA 4IAPA 2J59M 3GYPA 5GOWB 3GYOA 1WGQA
chains in the Genus database with same CATH superfamily
1MK7B 1MIXA 4YONA 5FI1A 2P0FA 3PVWA 1ZVRA 4CYEA 1DYNA 3B77A 4Z2MB 2CRFA 4Z2NA 3G9WA 2EC1A 4QJ3B 2UZRA 4KHBA 3FM8C 2KUPA 3ULCA 2D9XA 2Y8GA 3NSUA 1WI1A 2K2UA 4GN1A 1X1FA 5CLLB 2D11A 3TVVA 3O96A 2AEHA 4BBKA 3TW1A 4HHVA 1SGHA 2MKRA 4MK0A 1FAOA 1M7RA 1X05A 3QWMA 1WJMA 3PG7A 5DI9B 1TXDA 3NWDA 5JLJB 1XKEA 1K5DB 4K81A 2M38A 2YF0A 1PFJA 1MKEA 4P7IA 3QBVB 3A8PA 2DHIA 4K17A 1N3HA 2KGXB 2RNRB 2DKPA 1X1GA 1PMSA 1Y5OA 1W1HA 5I2MA 1E5WA 4OT1A 1XODA 1SHCA 1ISNA 2DYQA 2J0MA 1V5MA 5IRSA 1ZC4B 4K2PA 4K2OA 3D8DA 3U8ZA 4GPTB 1UNQA 3VOQA 2COAA 3N7CA 4GOUA 1ZM0A 3ODXA 1EAZA 2GCJA 2YSZA 1XD4A 5C5BA 1UPRA 3U12A 2CY4A 5JHHA 3PP2A 3OANA 2DYNA 2VRWB 4D0NB 4F7HA 2EJ8A 1LB1A 5FI0A 2GCLA 2D9YA 3HIEA 4EMOA 2GS0A 3KSYA 2MFQA 1PLSA 3HW2B 3HK0A 3MDBC 4CHJA 2KIEA 2R0DA 1LW3A 5HE1A 1NTVA 1I2HA 5J3YA 1OQNA 1U2BA 4HAXB 3SUZA 1UEFA 2XQNM 3PSCA 4HAYB 5LOPB 3T06A 2RGNB 2LOXA 2D2QA 2NBVA 4NY0A 2COFA 2I1KA 1GG3A 1X86A 4GMXB 1EGXA 1J19A 4GMVA 4DXAB 4TKNA 3FSSA 2NMBA 1FHWA 3SV1A 5HE3A 3PZDA 4H8SA 4A6FA 1NTYA 5D3YA 1QQGA 2CAYA 2D9ZA 2Z0PA 1DDMA 1P3RA 2AL6A 2V76A 3KZ1A 2BCJA 4KAXB 3ZDTA 3KRXA 2HE7A 2J0KA 3M1IB 4QXAB 3CIKA 4IOYX 1U5GA 3FEHA 4CSQA 2OQBA 2L1CA 4MY6A 1QC6A 5EFXA 4HDOA 2YRYA 4A6HA 3ODOA 1XR0B 1J0WA 2K8EA 1ZC3B 1Q67A 4WSFA 1FGYA 1NU2A 2RSGA 5HE0A 1IRSA 2Z59A 2EMTA 4HB0B 4ZRIA 1XCGA 3P7ZA 3WA0A 1Z87A 1DDVA 1W1GA 2P0DA 4IFSA 5DHFB 1RJ2A 2Z13A 4PQ0A 1U5DA 5J3TA 1OY2A 2RRFA 3A8QA 4A5KA 1AQCA 5DH9B 3KRWA 5D27A 2LOZA 2LULA 3HSAA 2YT1A 4KHAA 2ZPYA 2G35A 2ELAA 2Y8FA 4DBBA 2HTHB 1U5EA 4HSIA 2X18A 1TJ6A 3SO6A 5LONB 3PEGA 1K5GB 3SNHA 1ZSQA 2LKOA 3ULBA 1X11A 1GC7A 2VKIA 2KCJA 3V5WA 4TYZA 5LG4B 1MPHA 3VIAA 1KI1B 1DBHA 4EKUA 1P5TA 4DX8A 2ROZB 3QIJA 4QJ5B 2MDXA 2YS3A 2DKQA 2K00A 2W2XD 5CLQB 3P6AA 3BJIA 2DTCA 2VSZA 2RVBB 5JP4A 2DX5A 2Q13A 4F7GA 2D9WA 2IFSA 3UZTA 3U7DA 2CODA 3WYFB 3ODWA 1U27A 4DX90 3DXEA 2JP2A 5L81A 5KCVA 1W1DA 2PZ1A 3PVUA 2MWNB 1MI1A 2DN6A 2YT2A 4GNKB 2GJYA 1KZ7A 2FJUB 1FOEA 1Y19B 2Z14A 3A98B 4HAVB 2YS5A 2K2JA 1GC6A 1V88A 4XWXA 4HAWB 5JHGA 2E2XA 2KIGA 2YVCA 5M4YB 1T77A 3CXBB 2EMSA 3DXDA 2OTXA 5KQ1A 2ZKMX 2R2YA 4HAZB 3KY9A 1U5FA 2LG1A 1FGZA 2COCA 1V5PA 3BINA 4KHOA 2I5CA 1EF1A 2D9VA 1U29A 2W2WA 2RUKB 2I1JA 3ZVRA 3TCAA 1TQZA 4PNKA 4L6EA 4C0AA 2Z0OA 4GZUA 4MT7A 2K49A 1BTKA 4F7UP 2IYBA 4HAUB 1FHXA 2N23A 2Z0QA 3F5RA 3ML4A 3IVFA 2J0JA 2I5FA 3TO1A 4D6WA 1H4RA 2DX1A 2H7DA 4HB2B 1BAKA 4GXBA 2Z4DA 3HQCA 1DDWA 2DHKA 2KR0A 1WG7A 1V5UA 4ZRJA 3RCPA 4A6FB 5HE2A 3AJ4A 1EVHA 3TFMA 2P0HA 1FHOA 1WJ1A 3NWFA 1NI2A 5C16A 2CY5A 1MAIA 1P6SA 5C6RA 4WJ7A 4KHBB 4A6KA 2L2IA 2M14A 5D3XA 1H10A 2DFKA 4Y94A 2D4QA 2P8VA 4OSNA 4B6HA 1FB8A 3SYXA 5KQ4A 4L1RA 4EJNA 2UZSA 2DA0A 4ZRKA 4DIXA 5DIFB 3NW8A 3DXCA 4YL8A 3X23A 1BTNA 2QKLA 3PVLA 3D8EA 1DROA 1WGUA 2ELBA 1RRPB 3A58A 3MPXA 2YS1A 1BWNA 1MIZB 3AU5A 2LYDA 3FVCA 4NSWA 1ZYIA 1WVHA 2R09A 2D10A 2FJLA 2N0YA 1M7EA 3D8FA 2KUQA 1UNPA 4HB3B 1XX0A 2H7EA 2QKMA 2UVMA 3OHMB 5J3QA 4HB4B 2NZ8B 2DLWA 5D3VA 3F0WA 4HDQA 4CHMA 1B55A 3DCXA 2DHJA 2ROVA 3NWAA 4KVGB 1OMWA 1I7AA 4HATB 5I2SA 2W2XC 4WVFB 5C5BB 1V61A 1KZGA 5C79A 2YT0A 3AU4A 1UPQA 2Y7BA 1MK9B 1V89A 1UNRA 2ADZA 2RLOA 5DHAB 3LJUX 1AWEA 5D3WA 4IAPA 2J59M 4QJ4B 3GYPA 2GUMA 5GOWB 3GYOA 1WGQA
chains in the Genus database with same CATH topology
1MK7B 1MIXA 4YONA 5FI1A 2P0FA 3PVWA 1ZVRA 4CYEA 1DYNA 4Z2MB 2CRFA 4Z2NA 3G9WA 2EC1A 2UZRA 3FM8C 2KUPA 3ULCA 2D9XA 2Y8GA 3NSUA 1WI1A 2K2UA 4GN1A 1X1FA 5CLLB 2D11A 3TVVA 3O96A 2AEHA 4BBKA 3TW1A 4HHVA 1SGHA 2MKRA 4MK0A 1FAOA 1M7RA 1X05A 3QWMA 1WJMA 3PG7A 5DI9B 1TXDA 5JLJB 1XKEA 1K5DB 4K81A 2M38A 2YF0A 1PFJA 1MKEA 4P7IA 3QBVB 3A8PA 2DHIA 4K17A 1N3HA 2KGXB 2RNRB 2DKPA 1X1GA 1PMSA 1Y5OA 1W1HA 1E5WA 1XODA 1SHCA 1ISNA 2DYQA 2J0MA 1V5MA 1ZC4B 4K2PA 4K2OA 3D8DA 3U8ZA 4GPTB 1UNQA 3VOQA 2COAA 3N7CA 1ZM0A 3ODXA 1EAZA 2GCJA 2YSZA 1XD4A 5C5BA 1UPRA 2CY4A 5JHHA 3PP2A 3OANA 2DYNA 2VRWB 4D0NB 4F7HA 2EJ8A 1LB1A 5FI0A 2GCLA 2D9YA 4EMOA 2GS0A 3KSYA 2MFQA 1PLSA 3HW2B 3HK0A 3MDBC 4CHJA 2R0DA 1LW3A 5HE1A 1NTVA 1I2HA 5J3YA 1OQNA 1U2BA 4HAXB 3SUZA 1UEFA 2XQNM 3PSCA 4HAYB 5LOPB 3T06A 2RGNB 2LOXA 2D2QA 4NY0A 2COFA 2I1KA 1GG3A 1X86A 4GMXB 1EGXA 1J19A 4GMVA 4DXAB 4TKNA 3FSSA 2NMBA 1FHWA 3SV1A 5HE3A 3PZDA 4H8SA 4A6FA 1NTYA 5D3YA 1QQGA 2CAYA 2D9ZA 2Z0PA 1DDMA 1P3RA 2AL6A 3KZ1A 2V76A 2BCJA 4KAXB 3ZDTA 3KRXA 2HE7A 2J0KA 3M1IB 3CIKA 4IOYX 1U5GA 3FEHA 2OQBA 2L1CA 4MY6A 1QC6A 5EFXA 4HDOA 2YRYA 4A6HA 3ODOA 1XR0B 1J0WA 1ZC3B 1Q67A 4WSFA 1FGYA 1NU2A 2RSGA 5HE0A 1IRSA 2EMTA 4HB0B 4ZRIA 1XCGA 3P7ZA 3WA0A 1Z87A 1DDVA 1W1GA 2P0DA 4IFSA 5DHFB 1RJ2A 4PQ0A 1U5DA 5J3TA 1OY2A 3A8QA 4A5KA 1AQCA 5DH9B 3KRWA 5D27A 2LOZA 2LULA 2YT1A 4KHAA 2ZPYA 2G35A 2ELAA 2Y8FA 4DBBA 2HTHB 1U5EA 2X18A 1TJ6A 3SO6A 5LONB 3PEGA 1K5GB 3SNHA 1ZSQA 2LKOA 3ULBA 1X11A 1GC7A 2VKIA 2KCJA 3V5WA 4TYZA 1MPHA 3VIAA 1KI1B 1DBHA 4EKUA 1P5TA 4DX8A 2ROZB 3QIJA 2MDXA 2YS3A 2DKQA 2K00A 2W2XD 5CLQB 3P6AA 3BJIA 2DTCA 2VSZA 2RVBB 5JP4A 2DX5A 2Q13A 4F7GA 2D9WA 2IFSA 3UZTA 3U7DA 2CODA 3WYFB 3ODWA 1U27A 4DX90 3DXEA 2JP2A 5L81A 5KCVA 1W1DA 2PZ1A 3PVUA 2MWNB 2DN6A 2GJYA 1KZ7A 1FOEA 1Y19B 3A98B 4HAVB 2YS5A 2K2JA 1GC6A 1V88A 4XWXA 4HAWB 5JHGA 2E2XA 2YVCA 3CXBB 2EMSA 3DXDA 2OTXA 5KQ1A 4HAZB 3KY9A 1U5FA 2LG1A 1FGZA 2COCA 1V5PA 3BINA 4KHOA 2I5CA 1EF1A 2D9VA 1U29A 2W2WA 2RUKB 2I1JA 3ZVRA 3TCAA 1TQZA 4PNKA 4L6EA 4C0AA 2Z0OA 4GZUA 4MT7A 1BTKA 4F7UP 2IYBA 4HAUB 1FHXA 2N23A 2Z0QA 3F5RA 3ML4A 3IVFA 2J0JA 2I5FA 3TO1A 1H4RA 2DX1A 2H7DA 4HB2B 1BAKA 4GXBA 3HQCA 1DDWA 2DHKA 1WG7A 1V5UA 4ZRJA 3RCPA 4A6FB 5HE2A 3AJ4A 1EVHA 3TFMA 2P0HA 1FHOA 1WJ1A 1NI2A 5C16A 2CY5A 1MAIA 1P6SA 5C6RA 4WJ7A 4KHBB 4A6KA 2L2IA 2M14A 5D3XA 1H10A 2DFKA 4Y94A 2D4QA 2P8VA 4B6HA 1FB8A 3SYXA 5KQ4A 4EJNA 2UZSA 2DA0A 4ZRKA 5DIFB 4YL8A 3DXCA 3X23A 1BTNA 2QKLA 3PVLA 3D8EA 1DROA 1WGUA 2ELBA 1RRPB 3MPXA 2YS1A 1BWNA 1MIZB 3AU5A 2LYDA 4NSWA 1WVHA 2R09A 2D10A 2FJLA 2N0YA 1M7EA 3D8FA 1UNPA 4HB3B 1XX0A 2H7EA 2QKMA 2UVMA 5J3QA 4HB4B 2NZ8B 2DLWA 5D3VA 3F0WA 4HDQA 4CHMA 1B55A 2DHJA 2ROVA 4KVGB 1OMWA 1I7AA 4HATB 2W2XC 4WVFB 5C5BB 1V61A 1KZGA 5C79A 2YT0A 3AU4A 1UPQA 2Y7BA 1MK9B 1V89A 1UNRA 2ADZA 2RLOA 5DHAB 3LJUX 1AWEA 5D3WA 4IAPA 2J59M 3GYPA 5GOWB 3GYOA 1WGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MK7 B;  1MIX A;  4YON A;  5FI1 A;  2P0F A;  3PVW A;  1ZVR A;  4CYE A;  1DYN A;  4Z2M B;  2CRF A;  4Z2N A;  3G9W A;  2EC1 A;  2UZR A;  3FM8 C;  2KUP A;  3ULC A;  2D9X A;  2Y8G A;  3NSU A;  1WI1 A;  2K2U A;  4GN1 A;  1X1F A;  5CLL B;  2D11 A;  3TVV A;  3O96 A;  2AEH A;  4BBK A;  3TW1 A;  4HHV A;  1SGH A;  2MKR A;  4MK0 A;  1FAO A;  1M7R A;  1X05 A;  3QWM A;  1WJM A;  3PG7 A;  5DI9 B;  1TXD A;  5JLJ B;  1XKE A;  1K5D B;  4K81 A;  2M38 A;  2YF0 A;  1PFJ A;  1MKE A;  4P7I A;  3QBV B;  3A8P A;  2DHI A;  4K17 A;  1N3H A;  2KGX B;  2RNR B;  2DKP A;  1X1G A;  1PMS A;  1Y5O A;  1W1H A;  1E5W A;  1XOD A;  1SHC A;  1ISN A;  2DYQ A;  2J0M A;  1V5M A;  1ZC4 B;  4K2P A;  4K2O A;  3D8D A;  3U8Z A;  4GPT B;  1UNQ A;  3VOQ A;  2COA A;  3N7C A;  1ZM0 A;  3ODX A;  1EAZ A;  2GCJ A;  2YSZ A;  1XD4 A;  5C5B A;  1UPR A;  2CY4 A;  5JHH A;  3PP2 A;  3OAN A;  2DYN A;  2VRW B;  4D0N B;  4F7H A;  2EJ8 A;  1LB1 A;  5FI0 A;  2GCL A;  2D9Y A;  4EMO A;  2GS0 A;  3KSY A;  2MFQ A;  1PLS A;  3HW2 B;  3HK0 A;  3MDB C;  4CHJ A;  2R0D A;  1LW3 A;  5HE1 A;  1NTV A;  1I2H A;  5J3Y A;  1OQN A;  1U2B A;  4HAX B;  3SUZ A;  1UEF A;  2XQN M;  3PSC A;  4HAY B;  5LOP B;  3T06 A;  2RGN B;  2LOX A;  2D2Q A;  4NY0 A;  2COF A;  2I1K A;  1GG3 A;  1X86 A;  4GMX B;  1EGX A;  1J19 A;  4GMV A;  4DXA B;  4TKN A;  3FSS A;  2NMB A;  1FHW A;  3SV1 A;  5HE3 A;  3PZD A;  4H8S A;  4A6F A;  1NTY A;  5D3Y A;  1QQG A;  2CAY A;  2D9Z A;  2Z0P A;  1DDM A;  1P3R A;  2AL6 A;  3KZ1 A;  2V76 A;  2BCJ A;  4KAX B;  3ZDT A;  3KRX A;  2HE7 A;  2J0K A;  3M1I B;  3CIK A;  4IOY X;  1U5G A;  3FEH A;  2OQB A;  2L1C A;  4MY6 A;  1QC6 A;  5EFX A;  4HDO A;  2YRY A;  4A6H A;  3ODO A;  1XR0 B;  1J0W A;  1ZC3 B;  1Q67 A;  4WSF A;  1FGY A;  1NU2 A;  2RSG A;  5HE0 A;  1IRS A;  2EMT A;  4HB0 B;  4ZRI A;  1XCG A;  3P7Z A;  3WA0 A;  1Z87 A;  1DDV A;  1W1G A;  2P0D A;  4IFS A;  5DHF B;  1RJ2 A;  4PQ0 A;  1U5D A;  5J3T A;  1OY2 A;  3A8Q A;  4A5K A;  1AQC A;  5DH9 B;  3KRW A;  5D27 A;  2LOZ A;  2LUL A;  2YT1 A;  4KHA A;  2ZPY A;  2G35 A;  2ELA A;  2Y8F A;  4DBB A;  2HTH B;  1U5E A;  2X18 A;  1TJ6 A;  3SO6 A;  5LON B;  3PEG A;  1K5G B;  3SNH A;  1ZSQ A;  2LKO A;  3ULB A;  1X11 A;  1GC7 A;  2VKI A;  2KCJ A;  3V5W A;  4TYZ A;  1MPH A;  3VIA A;  1KI1 B;  1DBH A;  4EKU A;  1P5T A;  4DX8 A;  2ROZ B;  3QIJ A;  2MDX A;  2YS3 A;  2DKQ A;  2K00 A;  2W2X D;  5CLQ B;  3P6A A;  3BJI A;  2DTC A;  2VSZ A;  2RVB B;  5JP4 A;  2DX5 A;  2Q13 A;  4F7G A;  2D9W A;  2IFS A;  3UZT A;  3U7D A;  2COD A;  3WYF B;  3ODW A;  1U27 A;  4DX9 0;  3DXE A;  2JP2 A;  5L81 A;  5KCV A;  1W1D A;  2PZ1 A;  3PVU A;  2MWN B;  2DN6 A;  2GJY A;  1KZ7 A;  1FOE A;  1Y19 B;  3A98 B;  4HAV B;  2YS5 A;  2K2J A;  1GC6 A;  1V88 A;  4XWX A;  4HAW B;  5JHG A;  2E2X A;  2YVC A;  3CXB B;  2EMS A;  3DXD A;  2OTX A;  5KQ1 A;  4HAZ B;  3KY9 A;  1U5F A;  2LG1 A;  1FGZ A;  2COC A;  1V5P A;  3BIN A;  4KHO A;  2I5C A;  1EF1 A;  2D9V A;  1U29 A;  2W2W A;  2RUK B;  2I1J A;  3ZVR A;  3TCA A;  1TQZ A;  4PNK A;  4L6E A;  4C0A A;  2Z0O A;  4GZU A;  4MT7 A;  1BTK A;  4F7U P;  2IYB A;  4HAU B;  1FHX A;  2N23 A;  2Z0Q A;  3F5R A;  3ML4 A;  3IVF A;  2J0J A;  2I5F A;  3TO1 A;  1H4R A;  2DX1 A;  2H7D A;  4HB2 B;  1BAK A;  4GXB A;  3HQC A;  1DDW A;  2DHK A;  1WG7 A;  1V5U A;  4ZRJ A;  3RCP A;  4A6F B;  5HE2 A;  3AJ4 A;  1EVH A;  3TFM A;  2P0H A;  1FHO A;  1WJ1 A;  1NI2 A;  5C16 A;  2CY5 A;  1MAI A;  1P6S A;  5C6R A;  4WJ7 A;  4KHB B;  4A6K A;  2L2I A;  2M14 A;  5D3X A;  1H10 A;  2DFK A;  4Y94 A;  2D4Q A;  2P8V A;  4B6H A;  1FB8 A;  3SYX A;  5KQ4 A;  4EJN A;  2UZS A;  2DA0 A;  4ZRK A;  5DIF B;  4YL8 A;  3DXC A;  3X23 A;  1BTN A;  2QKL A;  3PVL A;  3D8E A;  1DRO A;  1WGU A;  2ELB A;  1RRP B;  3MPX A;  2YS1 A;  1BWN A;  1MIZ B;  3AU5 A;  2LYD A;  4NSW A;  1WVH A;  2R09 A;  2D10 A;  2FJL A;  2N0Y A;  1M7E A;  3D8F A;  1UNP A;  4HB3 B;  1XX0 A;  2H7E A;  2QKM A;  2UVM A;  5J3Q A;  4HB4 B;  2NZ8 B;  2DLW A;  5D3V A;  3F0W A;  4HDQ A;  4CHM A;  1B55 A;  2DHJ A;  2ROV A;  4KVG B;  1OMW A;  1I7A A;  4HAT B;  2W2X C;  4WVF B;  5C5B B;  1V61 A;  1KZG A;  5C79 A;  2YT0 A;  3AU4 A;  1UPQ A;  2Y7B A;  1MK9 B;  1V89 A;  1UNR A;  2ADZ A;  2RLO A;  5DHA B;  3LJU X;  1AWE A;  5D3W A;  4IAP A;  2J59 M;  3GYP A;  5GOW B;  3GYO A;  1WGQ A; 
#chains in the Genus database with same CATH topology
 1MK7 B;  1MIX A;  4YON A;  5FI1 A;  2P0F A;  3PVW A;  1ZVR A;  4CYE A;  1DYN A;  3B77 A;  4Z2M B;  2CRF A;  4Z2N A;  3G9W A;  2EC1 A;  4QJ3 B;  2UZR A;  4KHB A;  3FM8 C;  2KUP A;  3ULC A;  2D9X A;  2Y8G A;  3NSU A;  1WI1 A;  2K2U A;  4GN1 A;  1X1F A;  5CLL B;  2D11 A;  3TVV A;  3O96 A;  2AEH A;  4BBK A;  3TW1 A;  4HHV A;  1SGH A;  2MKR A;  4MK0 A;  1FAO A;  1M7R A;  1X05 A;  3QWM A;  1WJM A;  3PG7 A;  5DI9 B;  1TXD A;  3NWD A;  5JLJ B;  1XKE A;  1K5D B;  4K81 A;  2M38 A;  2YF0 A;  1PFJ A;  1MKE A;  4P7I A;  3QBV B;  3A8P A;  2DHI A;  4K17 A;  1N3H A;  2KGX B;  2RNR B;  2DKP A;  1X1G A;  1PMS A;  1Y5O A;  1W1H A;  5I2M A;  1E5W A;  4OT1 A;  1XOD A;  1SHC A;  1ISN A;  2DYQ A;  2J0M A;  1V5M A;  5IRS A;  1ZC4 B;  4K2P A;  4K2O A;  3D8D A;  3U8Z A;  4GPT B;  1UNQ A;  3VOQ A;  2COA A;  3N7C A;  4GOU A;  1ZM0 A;  3ODX A;  1EAZ A;  2GCJ A;  2YSZ A;  1XD4 A;  5C5B A;  1UPR A;  3U12 A;  2CY4 A;  5JHH A;  3PP2 A;  3OAN A;  2DYN A;  2VRW B;  4D0N B;  4F7H A;  2EJ8 A;  1LB1 A;  5FI0 A;  2GCL A;  2D9Y A;  3HIE A;  4EMO A;  2GS0 A;  3KSY A;  2MFQ A;  1PLS A;  3HW2 B;  3HK0 A;  3MDB C;  4CHJ A;  2KIE A;  2R0D A;  1LW3 A;  5HE1 A;  1NTV A;  1I2H A;  5J3Y A;  1OQN A;  1U2B A;  4HAX B;  3SUZ A;  1UEF A;  2XQN M;  3PSC A;  4HAY B;  5LOP B;  3T06 A;  2RGN B;  2LOX A;  2D2Q A;  2NBV A;  4NY0 A;  2COF A;  2I1K A;  1GG3 A;  1X86 A;  4GMX B;  1EGX A;  1J19 A;  4GMV A;  4DXA B;  4TKN A;  3FSS A;  2NMB A;  1FHW A;  3SV1 A;  5HE3 A;  3PZD A;  4H8S A;  4A6F A;  1NTY A;  5D3Y A;  1QQG A;  2CAY A;  2D9Z A;  2Z0P A;  1DDM A;  1P3R A;  2AL6 A;  2V76 A;  3KZ1 A;  2BCJ A;  4KAX B;  3ZDT A;  3KRX A;  2HE7 A;  2J0K A;  3M1I B;  4QXA B;  3CIK A;  4IOY X;  1U5G A;  3FEH A;  4CSQ A;  2OQB A;  2L1C A;  4MY6 A;  1QC6 A;  5EFX A;  4HDO A;  2YRY A;  4A6H A;  3ODO A;  1XR0 B;  1J0W A;  2K8E A;  1ZC3 B;  1Q67 A;  4WSF A;  1FGY A;  1NU2 A;  2RSG A;  5HE0 A;  1IRS A;  2Z59 A;  2EMT A;  4HB0 B;  4ZRI A;  1XCG A;  3P7Z A;  3WA0 A;  1Z87 A;  1DDV A;  1W1G A;  2P0D A;  4IFS A;  5DHF B;  1RJ2 A;  2Z13 A;  4PQ0 A;  1U5D A;  5J3T A;  1OY2 A;  2RRF A;  3A8Q A;  4A5K A;  1AQC A;  5DH9 B;  3KRW A;  5D27 A;  2LOZ A;  2LUL A;  3HSA A;  2YT1 A;  4KHA A;  2ZPY A;  2G35 A;  2ELA A;  2Y8F A;  4DBB A;  2HTH B;  1U5E A;  4HSI A;  2X18 A;  1TJ6 A;  3SO6 A;  5LON B;  3PEG A;  1K5G B;  3SNH A;  1ZSQ A;  2LKO A;  3ULB A;  1X11 A;  1GC7 A;  2VKI A;  2KCJ A;  3V5W A;  4TYZ A;  5LG4 B;  1MPH A;  3VIA A;  1KI1 B;  1DBH A;  4EKU A;  1P5T A;  4DX8 A;  2ROZ B;  3QIJ A;  4QJ5 B;  2MDX A;  2YS3 A;  2DKQ A;  2K00 A;  2W2X D;  5CLQ B;  3P6A A;  3BJI A;  2DTC A;  2VSZ A;  2RVB B;  5JP4 A;  2DX5 A;  2Q13 A;  4F7G A;  2D9W A;  2IFS A;  3UZT A;  3U7D A;  2COD A;  3WYF B;  3ODW A;  1U27 A;  4DX9 0;  3DXE A;  2JP2 A;  5L81 A;  5KCV A;  1W1D A;  2PZ1 A;  3PVU A;  2MWN B;  1MI1 A;  2DN6 A;  2YT2 A;  4GNK B;  2GJY A;  1KZ7 A;  2FJU B;  1FOE A;  1Y19 B;  2Z14 A;  3A98 B;  4HAV B;  2YS5 A;  2K2J A;  1GC6 A;  1V88 A;  4XWX A;  4HAW B;  5JHG A;  2E2X A;  2KIG A;  2YVC A;  5M4Y B;  1T77 A;  3CXB B;  2EMS A;  3DXD A;  2OTX A;  5KQ1 A;  2ZKM X;  2R2Y A;  4HAZ B;  3KY9 A;  1U5F A;  2LG1 A;  1FGZ A;  2COC A;  1V5P A;  3BIN A;  4KHO A;  2I5C A;  1EF1 A;  2D9V A;  1U29 A;  2W2W A;  2RUK B;  2I1J A;  3ZVR A;  3TCA A;  1TQZ A;  4PNK A;  4L6E A;  4C0A A;  2Z0O A;  4GZU A;  4MT7 A;  2K49 A;  1BTK A;  4F7U P;  2IYB A;  4HAU B;  1FHX A;  2N23 A;  2Z0Q A;  3F5R A;  3ML4 A;  3IVF A;  2J0J A;  2I5F A;  3TO1 A;  4D6W A;  1H4R A;  2DX1 A;  2H7D A;  4HB2 B;  1BAK A;  4GXB A;  2Z4D A;  3HQC A;  1DDW A;  2DHK A;  2KR0 A;  1WG7 A;  1V5U A;  4ZRJ A;  3RCP A;  4A6F B;  5HE2 A;  3AJ4 A;  1EVH A;  3TFM A;  2P0H A;  1FHO A;  1WJ1 A;  3NWF A;  1NI2 A;  5C16 A;  2CY5 A;  1MAI A;  1P6S A;  5C6R A;  4WJ7 A;  4KHB B;  4A6K A;  2L2I A;  2M14 A;  5D3X A;  1H10 A;  2DFK A;  4Y94 A;  2D4Q A;  2P8V A;  4OSN A;  4B6H A;  1FB8 A;  3SYX A;  5KQ4 A;  4L1R A;  4EJN A;  2UZS A;  2DA0 A;  4ZRK A;  4DIX A;  5DIF B;  3NW8 A;  3DXC A;  4YL8 A;  3X23 A;  1BTN A;  2QKL A;  3PVL A;  3D8E A;  1DRO A;  1WGU A;  2ELB A;  1RRP B;  3A58 A;  3MPX A;  2YS1 A;  1BWN A;  1MIZ B;  3AU5 A;  2LYD A;  3FVC A;  4NSW A;  1ZYI A;  1WVH A;  2R09 A;  2D10 A;  2FJL A;  2N0Y A;  1M7E A;  3D8F A;  2KUQ A;  1UNP A;  4HB3 B;  1XX0 A;  2H7E A;  2QKM A;  2UVM A;  3OHM B;  5J3Q A;  4HB4 B;  2NZ8 B;  2DLW A;  5D3V A;  3F0W A;  4HDQ A;  4CHM A;  1B55 A;  3DCX A;  2DHJ A;  2ROV A;  3NWA A;  4KVG B;  1OMW A;  1I7A A;  4HAT B;  5I2S A;  2W2X C;  4WVF B;  5C5B B;  1V61 A;  1KZG A;  5C79 A;  2YT0 A;  3AU4 A;  1UPQ A;  2Y7B A;  1MK9 B;  1V89 A;  1UNR A;  2ADZ A;  2RLO A;  5DHA B;  3LJU X;  1AWE A;  5D3W A;  4IAP A;  2J59 M;  4QJ4 B;  3GYP A;  2GUM A;  5GOW B;  3GYO A;  1WGQ A; 
#chains in the Genus database with same CATH homology
 1MK7 B;  1MIX A;  4YON A;  5FI1 A;  2P0F A;  3PVW A;  1ZVR A;  4CYE A;  1DYN A;  4Z2M B;  2CRF A;  4Z2N A;  3G9W A;  2EC1 A;  2UZR A;  3FM8 C;  2KUP A;  3ULC A;  2D9X A;  2Y8G A;  3NSU A;  1WI1 A;  2K2U A;  4GN1 A;  1X1F A;  5CLL B;  2D11 A;  3TVV A;  3O96 A;  2AEH A;  4BBK A;  3TW1 A;  4HHV A;  1SGH A;  2MKR A;  4MK0 A;  1FAO A;  1M7R A;  1X05 A;  3QWM A;  1WJM A;  3PG7 A;  5DI9 B;  1TXD A;  5JLJ B;  1XKE A;  1K5D B;  4K81 A;  2M38 A;  2YF0 A;  1PFJ A;  1MKE A;  4P7I A;  3QBV B;  3A8P A;  2DHI A;  4K17 A;  1N3H A;  2KGX B;  2RNR B;  2DKP A;  1X1G A;  1PMS A;  1Y5O A;  1W1H A;  1E5W A;  1XOD A;  1SHC A;  1ISN A;  2DYQ A;  2J0M A;  1V5M A;  1ZC4 B;  4K2P A;  4K2O A;  3D8D A;  3U8Z A;  4GPT B;  1UNQ A;  3VOQ A;  2COA A;  3N7C A;  1ZM0 A;  3ODX A;  1EAZ A;  2GCJ A;  2YSZ A;  1XD4 A;  5C5B A;  1UPR A;  2CY4 A;  5JHH A;  3PP2 A;  3OAN A;  2DYN A;  2VRW B;  4D0N B;  4F7H A;  2EJ8 A;  1LB1 A;  5FI0 A;  2GCL A;  2D9Y A;  4EMO A;  2GS0 A;  3KSY A;  2MFQ A;  1PLS A;  3HW2 B;  3HK0 A;  3MDB C;  4CHJ A;  2R0D A;  1LW3 A;  5HE1 A;  1NTV A;  1I2H A;  5J3Y A;  1OQN A;  1U2B A;  4HAX B;  3SUZ A;  1UEF A;  2XQN M;  3PSC A;  4HAY B;  5LOP B;  3T06 A;  2RGN B;  2LOX A;  2D2Q A;  4NY0 A;  2COF A;  2I1K A;  1GG3 A;  1X86 A;  4GMX B;  1EGX A;  1J19 A;  4GMV A;  4DXA B;  4TKN A;  3FSS A;  2NMB A;  1FHW A;  3SV1 A;  5HE3 A;  3PZD A;  4H8S A;  4A6F A;  1NTY A;  5D3Y A;  1QQG A;  2CAY A;  2D9Z A;  2Z0P A;  1DDM A;  1P3R A;  2AL6 A;  3KZ1 A;  2V76 A;  2BCJ A;  4KAX B;  3ZDT A;  3KRX A;  2HE7 A;  2J0K A;  3M1I B;  3CIK A;  4IOY X;  1U5G A;  3FEH A;  2OQB A;  2L1C A;  4MY6 A;  1QC6 A;  5EFX A;  4HDO A;  2YRY A;  4A6H A;  3ODO A;  1XR0 B;  1J0W A;  1ZC3 B;  1Q67 A;  4WSF A;  1FGY A;  1NU2 A;  2RSG A;  5HE0 A;  1IRS A;  2EMT A;  4HB0 B;  4ZRI A;  1XCG A;  3P7Z A;  3WA0 A;  1Z87 A;  1DDV A;  1W1G A;  2P0D A;  4IFS A;  5DHF B;  1RJ2 A;  4PQ0 A;  1U5D A;  5J3T A;  1OY2 A;  3A8Q A;  4A5K A;  1AQC A;  5DH9 B;  3KRW A;  5D27 A;  2LOZ A;  2LUL A;  2YT1 A;  4KHA A;  2ZPY A;  2G35 A;  2ELA A;  2Y8F A;  4DBB A;  2HTH B;  1U5E A;  2X18 A;  1TJ6 A;  3SO6 A;  5LON B;  3PEG A;  1K5G B;  3SNH A;  1ZSQ A;  2LKO A;  3ULB A;  1X11 A;  1GC7 A;  2VKI A;  2KCJ A;  3V5W A;  4TYZ A;  1MPH A;  3VIA A;  1KI1 B;  1DBH A;  4EKU A;  1P5T A;  4DX8 A;  2ROZ B;  3QIJ A;  2MDX A;  2YS3 A;  2DKQ A;  2K00 A;  2W2X D;  5CLQ B;  3P6A A;  3BJI A;  2DTC A;  2VSZ A;  2RVB B;  5JP4 A;  2DX5 A;  2Q13 A;  4F7G A;  2D9W A;  2IFS A;  3UZT A;  3U7D A;  2COD A;  3WYF B;  3ODW A;  1U27 A;  4DX9 0;  3DXE A;  2JP2 A;  5L81 A;  5KCV A;  1W1D A;  2PZ1 A;  3PVU A;  2MWN B;  2DN6 A;  2GJY A;  1KZ7 A;  1FOE A;  1Y19 B;  3A98 B;  4HAV B;  2YS5 A;  2K2J A;  1GC6 A;  1V88 A;  4XWX A;  4HAW B;  5JHG A;  2E2X A;  2YVC A;  3CXB B;  2EMS A;  3DXD A;  2OTX A;  5KQ1 A;  4HAZ B;  3KY9 A;  1U5F A;  2LG1 A;  1FGZ A;  2COC A;  1V5P A;  3BIN A;  4KHO A;  2I5C A;  1EF1 A;  2D9V A;  1U29 A;  2W2W A;  2RUK B;  2I1J A;  3ZVR A;  3TCA A;  1TQZ A;  4PNK A;  4L6E A;  4C0A A;  2Z0O A;  4GZU A;  4MT7 A;  1BTK A;  4F7U P;  2IYB A;  4HAU B;  1FHX A;  2N23 A;  2Z0Q A;  3F5R A;  3ML4 A;  3IVF A;  2J0J A;  2I5F A;  3TO1 A;  1H4R A;  2DX1 A;  2H7D A;  4HB2 B;  1BAK A;  4GXB A;  3HQC A;  1DDW A;  2DHK A;  1WG7 A;  1V5U A;  4ZRJ A;  3RCP A;  4A6F B;  5HE2 A;  3AJ4 A;  1EVH A;  3TFM A;  2P0H A;  1FHO A;  1WJ1 A;  1NI2 A;  5C16 A;  2CY5 A;  1MAI A;  1P6S A;  5C6R A;  4WJ7 A;  4KHB B;  4A6K A;  2L2I A;  2M14 A;  5D3X A;  1H10 A;  2DFK A;  4Y94 A;  2D4Q A;  2P8V A;  4B6H A;  1FB8 A;  3SYX A;  5KQ4 A;  4EJN A;  2UZS A;  2DA0 A;  4ZRK A;  5DIF B;  4YL8 A;  3DXC A;  3X23 A;  1BTN A;  2QKL A;  3PVL A;  3D8E A;  1DRO A;  1WGU A;  2ELB A;  1RRP B;  3MPX A;  2YS1 A;  1BWN A;  1MIZ B;  3AU5 A;  2LYD A;  4NSW A;  1WVH A;  2R09 A;  2D10 A;  2FJL A;  2N0Y A;  1M7E A;  3D8F A;  1UNP A;  4HB3 B;  1XX0 A;  2H7E A;  2QKM A;  2UVM A;  5J3Q A;  4HB4 B;  2NZ8 B;  2DLW A;  5D3V A;  3F0W A;  4HDQ A;  4CHM A;  1B55 A;  2DHJ A;  2ROV A;  4KVG B;  1OMW A;  1I7A A;  4HAT B;  2W2X C;  4WVF B;  5C5B B;  1V61 A;  1KZG A;  5C79 A;  2YT0 A;  3AU4 A;  1UPQ A;  2Y7B A;  1MK9 B;  1V89 A;  1UNR A;  2ADZ A;  2RLO A;  5DHA B;  3LJU X;  1AWE A;  5D3W A;  4IAP A;  2J59 M;  3GYP A;  5GOW B;  3GYO A;  1WGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...