4B6HA

Structure of hdcp1a in complex with proline rich sequence of pnrc2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
130
structure length
129
Chain Sequence
LMEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDIEGTLFVYRRSASPYHGFTIVNRNMHNLVEPVNKDLEFQLHEPFLLYRNASLSIYSIWFYDKNDCHRIAKLMADVVEEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of the Pnrc2-Mediated Link between Mrna Surveillance and Decapping.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/peptide
molecule keywords MRNA-DECAPPING ENZYME 1A
total genus 35
structure length 129
sequence length 130
chains with identical sequence B
ec nomenclature ec 3.-.-.-:
pdb deposition date 2012-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4b6hA00
3U7DA 1M7RA 3KSYA 2W2XD 4K2OA 2R09A 4A6HA 5C6RA 1TJ6A 1FOEA 1J0WA 2V76A 2YS5A 1W1DA 4HAVB 1MK9B 1ZC4B 2ADZA 4Y94A 3D8DA 2D10A 4MY6A 3TVVA 1FB8A 3FSSA 2P0DA 1PMSA 2VRWB 3VIAA 2DHKA 2Z0OA 2I1JA 2N23A 2K00A 2G35A 3PVWA 1U29A 3TCAA 5L81A 3SNHA 2DFKA 2QKLA 1U5DA 1FHXA 2DKQA 2EC1A 1J19A 1KI1B 4EMOA 5J3QA 3ULBA 3O96A 5HE0A 3ML4A 5FI0A 3A98B 5JHGA 2EMTA 2RGNB 2MDXA 1M7EA 2KCJA 4HHVA 2ROVA 1ZC3B 2X18A 3QBVB 1E5WA 2DX1A 2GS0A 5J3YA 4A5KA 1DDVA 1I7AA 2UZSA 2DLWA 4MK0A 1DROA 4GMVA 2J0JA 1W1GA 2P0FA 3DXDA 2CY4A 5C79A 2UVMA 4K81A 5DI9B 1EF1A 4HAWB 2AEHA 2DKPA 5GOWB 1U5GA 3WYFB 4HDQA 2R0DA 4H8SA 2YS3A 1TQZA 2COCA 1BTNA 1MK7B 1FAOA 1U5EA 3PVLA 4A6KA 4CHJA 1WG7A 2DTCA 1UPQA 1DYNA 1AQCA 1W1HA 2RUKB 1TXDA 2LOZA 4WVFB 2P0HA 1RRPB 2YT0A 4A6FB 4F7GA 3TW1A 1EGXA 4EJNA 1PFJA 5KQ4A 3ODOA 4GMXB 1UNRA 2ELBA 4ZRJA 2XQNM 3NSUA 3PVUA 3KRWA 1X11A 2DYNA 2Y7BA 1Z87A 5DH9B 2YSZA 1WI1A 1WVHA 4PQ0A 1FHOA 2L1CA 2I5CA 1BTKA 4HAYB 3D8FA 5FI1A 2CODA 3SUZA 2H7EA 1Q67A 2YS1A 1XD4A 3ODXA 1WJ1A 2OQBA 1X1FA 2W2XC 1U2BA 4GPTB 1FGYA 1GG3A 2KGXB 1XX0A 2MWNB 3OANA 2DHIA 1KZGA 2IYBA 4K17A 1Y19B 2YF0A 3FEHA 1RJ2A 2GJYA 4K2PA 1X05A 1U5FA 4HAUB 3IVFA 5CLQB 3MPXA 2Z0QA 1IRSA 3DXCA 4HAXB 2LG1A 2RNRB 4YL8A 3RCPA 2GCJA 3CIKA 2MKRA 1I2HA 1P6SA 4KVGB 4HDOA 5C5BA 3TFMA 5J3TA 2COAA 2EJ8A 3SV1A 3ZVRA 5JP4A 1NI2A 3A8QA 1PLSA 5D3YA 5EFXA 1B55A 1V5UA 4WJ7A 5D27A 2MFQA 2RLOA 2ELAA 1U27A 4DX90 1QQGA 1V5MA 2D2QA 2M14A 3P6AA 3CXBB 1XODA 2D11A 1ISNA 2YT1A 2NZ8B 3GYPA 2LKOA 3KRXA 1P5TA 4Z2MB 2CY5A 3F0WA 1NTVA 1QC6A 1GC7A 2UZRA 2Q13A 4CYEA 2D4QA 2PZ1A 5LONB 1K5DB 2D9XA 2W2WA 2Z0PA 5HE1A 1H10A 4GN1A 5D3XA 1V89A 1K5GB 4KHOA 5KQ1A 3M1IB 1ZVRA 1WJMA 1FGZA 2CRFA 4BBKA 2H7DA 3D8EA 3QIJA 3LJUX 2I1KA 4MT7A 4ZRIA 3T06A 5KCVA 2DN6A 2E2XA 3MDBC 3PZDA 2K2JA 1XKEA 4C0AA 2DX5A 1XR0B 2LYDA 4L6EA 3BJIA 2CAYA 4P7IA 2COFA 3SO6A 4IAPA 2D9VA 3X23A 5DHAB 2JP2A 5DHFB 1GC6A 3FM8C 3TO1A 3ZDTA 3HK0A 1WGUA 1MIXA 1LW3A 1EVHA 1BWNA 3PEGA 4KHAA 4Z2NA 4HB3B 1SGHA 2YVCA 4XWXA 1EAZA 2RVBB 1DDWA 2ROZB 1DDMA 1V5PA 3V5WA 1ZM0A 3SYXA 1X86A 2AL6A 2D9YA 2YRYA 2LOXA 1FHWA 3G9WA 2RSGA 3DXEA 4B6HA 3KY9A 2P8VA 4WSFA 4IFSA 1XCGA 4GZUA 5DIFB 2K2UA 2L2IA 2HTHB 3VOQA 3KZ1A 4PNKA 1AWEA 3P7ZA 2IFSA 4TKNA 4A6FA 4EKUA 2DYQA 3HQCA 3U8ZA 4NY0A 2J0MA 2D9WA 2FJLA 2Y8GA 1MIZB 3ULCA 4HB4B 3A8PA 3AU4A 2VSZA 2I5FA 5JHHA 3QWMA 1DBHA 1UEFA 4GXBA 2N0YA 3N7CA 5C16A 5LOPB 3PG7A 4IOYX 2LULA 3AU5A 4YONA 3PP2A 1KZ7A 5HE3A 1V88A 5CLLB 4DBBA 3BINA 2Y8FA 4F7HA 3HW2B 4TYZA 2DHJA 1MKEA 5HE2A 1H4RA 2BCJA 2ZPYA 4HAZB 1OMWA 1MPHA 3AJ4A 3ODWA 4D0NB 1SHCA 1P3RA 1ZSQA 1BAKA 4KHBB 4DX8A 3GYOA 2J0KA 5D3WA 2NMBA 1X1GA 2HE7A 3F5RA 4KAXB 1MAIA 4NSWA 2OTXA 2EMSA 4F7UP 1UNPA 2D9ZA 5JLJB 1UNQA 1N3HA 4DXAB 2KUPA 1UPRA 5C5BB 4HATB 2VKIA 4HB2B 2QKMA 4ZRKA 4CHMA 2M38A 5D3VA 1NU2A 1Y5OA 1WGQA 3PSCA 1OQNA 3UZTA 1V61A 1OY2A 3WA0A 2GCLA 2J59M 2DA0A 1NTYA 1LB1A 4HB0B
chains in the Genus database with same CATH superfamily
3U7DA 1M7RA 3KSYA 2W2XD 4K2OA 2R09A 4A6HA 5C6RA 1TJ6A 1FOEA 1J0WA 2V76A 2YS5A 1W1DA 4HAVB 1MK9B 1ZC4B 2ADZA 1ZYIA 4Y94A 3D8DA 2D10A 4MY6A 3TVVA 1FB8A 3FSSA 2P0DA 1PMSA 2VRWB 3VIAA 2DHKA 2Z0OA 2I1JA 2N23A 2K00A 2G35A 3PVWA 1U29A 3TCAA 5L81A 3SNHA 2DFKA 3HIEA 2QKLA 1U5DA 1FHXA 2DKQA 2EC1A 1J19A 1KI1B 4EMOA 5J3QA 3ULBA 3O96A 5HE0A 4HSIA 4GOUA 3ML4A 5FI0A 3FVCA 3A98B 5JHGA 2EMTA 2RGNB 2MDXA 1M7EA 2K49A 2KCJA 4HHVA 5M4YB 2ROVA 1ZC3B 2X18A 2GUMA 1E5WA 2DX1A 3QBVB 2GS0A 5J3YA 4A5KA 1DDVA 1I7AA 2UZSA 2DLWA 4MK0A 1DROA 4GMVA 4OSNA 2Z59A 2J0JA 1W1GA 2P0FA 3DXDA 2CY4A 2KIEA 5C79A 2UVMA 4K81A 5DI9B 1EF1A 4HAWB 2AEHA 2KUQA 2DKPA 5GOWB 1U5GA 5I2SA 3WYFB 4HDQA 2R0DA 4H8SA 2YS3A 1TQZA 2COCA 1BTNA 1MK7B 1FAOA 1U5EA 3PVLA 4A6KA 4CHJA 1WG7A 2DTCA 1UPQA 1DYNA 1AQCA 1W1HA 2RUKB 1TXDA 2LOZA 4WVFB 2P0HA 1RRPB 2YT0A 4A6FB 4F7GA 3TW1A 1EGXA 4EJNA 1PFJA 5KQ4A 3ODOA 4GMXB 1UNRA 2ELBA 4ZRJA 2XQNM 3NSUA 3PVUA 3KRWA 1X11A 2DYNA 2Y7BA 1Z87A 5DH9B 3HSAA 2YSZA 1WI1A 1WVHA 4PQ0A 1FHOA 2L1CA 2I5CA 1BTKA 4HAYB 3D8FA 5FI1A 2CODA 3SUZA 2H7EA 1Q67A 2YS1A 1XD4A 3ODXA 1WJ1A 2NBVA 2OQBA 1X1FA 2W2XC 1U2BA 4GPTB 1FGYA 1GG3A 2KGXB 1XX0A 2MWNB 3OANA 2DHIA 1KZGA 3DCXA 2IYBA 3NW8A 4K17A 1Y19B 2ZKMX 2R2YA 2YF0A 3FEHA 1RJ2A 2GJYA 4K2PA 1X05A 1U5FA 4HAUB 3IVFA 5CLQB 3MPXA 2Z0QA 4QJ5B 1IRSA 3DXCA 4HAXB 2LG1A 2RNRB 4YL8A 3RCPA 2GCJA 3CIKA 2MKRA 1I2HA 1P6SA 4KVGB 4HDOA 5C5BA 3TFMA 5J3TA 2COAA 2EJ8A 3SV1A 3ZVRA 5JP4A 1NI2A 3A8QA 1PLSA 3U12A 5D3YA 5EFXA 1B55A 1V5UA 4DIXA 4WJ7A 5D27A 2MFQA 2RLOA 2ELAA 4L1RA 1U27A 4DX90 1QQGA 1V5MA 2D2QA 2M14A 3P6AA 3CXBB 4CSQA 1XODA 2D11A 1ISNA 2YT1A 2NZ8B 1MI1A 3GYPA 2LKOA 3KRXA 1P5TA 4Z2MB 2CY5A 3F0WA 1NTVA 1QC6A 1GC7A 2UZRA 2Q13A 4CYEA 2D4QA 2PZ1A 5I2MA 5LONB 1K5DB 2D9XA 2KIGA 2W2WA 2Z0PA 5HE1A 1H10A 4GN1A 5D3XA 1V89A 1K5GB 4KHOA 5KQ1A 3M1IB 1ZVRA 1WJMA 1FGZA 2CRFA 4BBKA 2H7DA 3D8EA 3QIJA 3LJUX 2I1KA 4MT7A 4ZRIA 2YT2A 3T06A 5KCVA 2DN6A 2E2XA 3MDBC 3PZDA 2K2JA 1XKEA 4C0AA 2DX5A 1XR0B 2LYDA 4L6EA 3BJIA 2CAYA 4P7IA 2COFA 3SO6A 4IAPA 2D9VA 2FJUB 3X23A 5DHAB 2JP2A 5DHFB 1GC6A 3FM8C 3TO1A 4OT1A 2RRFA 3ZDTA 3HK0A 1WGUA 1MIXA 1LW3A 1EVHA 1BWNA 3PEGA 4KHAA 4Z2NA 4HB3B 1SGHA 2YVCA 4XWXA 3NWAA 1EAZA 2RVBB 1DDWA 2ROZB 3A58A 3B77A 1DDMA 1V5PA 3V5WA 1ZM0A 3SYXA 1X86A 2AL6A 2D9YA 2YRYA 2LOXA 1FHWA 3G9WA 5LG4B 2RSGA 3DXEA 4B6HA 3KY9A 2P8VA 4WSFA 4IFSA 1XCGA 4GZUA 5DIFB 2K2UA 2L2IA 2HTHB 3VOQA 3KZ1A 4PNKA 1AWEA 3P7ZA 2IFSA 4TKNA 4A6FA 4EKUA 2DYQA 3HQCA 3U8ZA 4NY0A 2J0MA 2D9WA 2FJLA 3OHMB 2Y8GA 2Z14A 1MIZB 2Z13A 4QXAB 4QJ4B 3ULCA 4HB4B 3A8PA 3AU4A 2VSZA 2I5FA 5JHHA 4D6WA 2Z4DA 3QWMA 1DBHA 1UEFA 4GXBA 2N0YA 3N7CA 5C16A 5LOPB 1T77A 3PG7A 4IOYX 2LULA 3NWFA 4GNKB 3AU5A 4YONA 3PP2A 1KZ7A 5HE3A 1V88A 5CLLB 4DBBA 3BINA 2Y8FA 4F7HA 3HW2B 4TYZA 2DHJA 1MKEA 5HE2A 1H4RA 2BCJA 2ZPYA 4HAZB 1OMWA 1MPHA 3AJ4A 3ODWA 4D0NB 1SHCA 1P3RA 1ZSQA 1BAKA 4KHBB 4DX8A 3GYOA 2J0KA 5D3WA 5IRSA 2NMBA 1X1GA 2HE7A 3F5RA 4KAXB 1MAIA 4NSWA 2OTXA 2EMSA 4F7UP 1UNPA 2D9ZA 5JLJB 1UNQA 1N3HA 4DXAB 2KUPA 1UPRA 3NWDA 5C5BB 4HATB 2VKIA 4HB2B 4KHBA 2QKMA 4ZRKA 4CHMA 2M38A 5D3VA 1NU2A 2K8EA 1Y5OA 1WGQA 3PSCA 1OQNA 3UZTA 1V61A 1OY2A 3WA0A 2GCLA 2J59M 4QJ3B 2DA0A 2KR0A 1NTYA 1LB1A 4HB0B
chains in the Genus database with same CATH topology
3U7DA 1M7RA 3KSYA 2W2XD 4K2OA 2R09A 4A6HA 5C6RA 1TJ6A 1FOEA 1J0WA 2V76A 2YS5A 1W1DA 4HAVB 1MK9B 1ZC4B 2ADZA 4Y94A 3D8DA 2D10A 4MY6A 3TVVA 1FB8A 3FSSA 2P0DA 1PMSA 2VRWB 3VIAA 2DHKA 2Z0OA 2I1JA 2N23A 2K00A 2G35A 3PVWA 1U29A 3TCAA 5L81A 3SNHA 2DFKA 2QKLA 1U5DA 1FHXA 2DKQA 2EC1A 1J19A 1KI1B 4EMOA 5J3QA 3ULBA 3O96A 5HE0A 3ML4A 5FI0A 3A98B 5JHGA 2EMTA 2RGNB 2MDXA 1M7EA 2KCJA 4HHVA 2ROVA 1ZC3B 2X18A 3QBVB 1E5WA 2DX1A 2GS0A 5J3YA 4A5KA 1DDVA 1I7AA 2UZSA 2DLWA 4MK0A 1DROA 4GMVA 2J0JA 1W1GA 2P0FA 3DXDA 2CY4A 5C79A 2UVMA 4K81A 5DI9B 1EF1A 4HAWB 2AEHA 2DKPA 5GOWB 1U5GA 3WYFB 4HDQA 2R0DA 4H8SA 2YS3A 1TQZA 2COCA 1BTNA 1MK7B 1FAOA 1U5EA 3PVLA 4A6KA 4CHJA 1WG7A 2DTCA 1UPQA 1DYNA 1AQCA 1W1HA 2RUKB 1TXDA 2LOZA 4WVFB 2P0HA 1RRPB 2YT0A 4A6FB 4F7GA 3TW1A 1EGXA 4EJNA 1PFJA 5KQ4A 3ODOA 4GMXB 1UNRA 2ELBA 4ZRJA 2XQNM 3NSUA 3PVUA 3KRWA 1X11A 2DYNA 2Y7BA 1Z87A 5DH9B 2YSZA 1WI1A 1WVHA 4PQ0A 1FHOA 2L1CA 2I5CA 1BTKA 4HAYB 3D8FA 5FI1A 2CODA 3SUZA 2H7EA 1Q67A 2YS1A 1XD4A 3ODXA 1WJ1A 2OQBA 1X1FA 2W2XC 1U2BA 4GPTB 1FGYA 1GG3A 2KGXB 1XX0A 2MWNB 3OANA 2DHIA 1KZGA 2IYBA 4K17A 1Y19B 2YF0A 3FEHA 1RJ2A 2GJYA 4K2PA 1X05A 1U5FA 4HAUB 3IVFA 5CLQB 3MPXA 2Z0QA 1IRSA 3DXCA 4HAXB 2LG1A 2RNRB 4YL8A 3RCPA 2GCJA 3CIKA 2MKRA 1I2HA 1P6SA 4KVGB 4HDOA 5C5BA 3TFMA 5J3TA 2COAA 2EJ8A 3SV1A 3ZVRA 5JP4A 1NI2A 3A8QA 1PLSA 5D3YA 5EFXA 1B55A 1V5UA 4WJ7A 5D27A 2MFQA 2RLOA 2ELAA 1U27A 4DX90 1QQGA 1V5MA 2D2QA 2M14A 3P6AA 3CXBB 1XODA 2D11A 1ISNA 2YT1A 2NZ8B 3GYPA 2LKOA 3KRXA 1P5TA 4Z2MB 2CY5A 3F0WA 1NTVA 1QC6A 1GC7A 2UZRA 2Q13A 4CYEA 2D4QA 2PZ1A 5LONB 1K5DB 2D9XA 2W2WA 2Z0PA 5HE1A 1H10A 4GN1A 5D3XA 1V89A 1K5GB 4KHOA 5KQ1A 3M1IB 1ZVRA 1WJMA 1FGZA 2CRFA 4BBKA 2H7DA 3D8EA 3QIJA 3LJUX 2I1KA 4MT7A 4ZRIA 3T06A 5KCVA 2DN6A 2E2XA 3MDBC 3PZDA 2K2JA 1XKEA 4C0AA 2DX5A 1XR0B 2LYDA 4L6EA 3BJIA 2CAYA 4P7IA 2COFA 3SO6A 4IAPA 2D9VA 3X23A 5DHAB 2JP2A 5DHFB 1GC6A 3FM8C 3TO1A 3ZDTA 3HK0A 1WGUA 1MIXA 1LW3A 1EVHA 1BWNA 3PEGA 4KHAA 4Z2NA 4HB3B 1SGHA 2YVCA 4XWXA 1EAZA 2RVBB 1DDWA 2ROZB 1DDMA 1V5PA 3V5WA 1ZM0A 3SYXA 1X86A 2AL6A 2D9YA 2YRYA 2LOXA 1FHWA 3G9WA 2RSGA 3DXEA 4B6HA 3KY9A 2P8VA 4WSFA 4IFSA 1XCGA 4GZUA 5DIFB 2K2UA 2L2IA 2HTHB 3VOQA 3KZ1A 4PNKA 1AWEA 3P7ZA 2IFSA 4TKNA 4A6FA 4EKUA 2DYQA 3HQCA 3U8ZA 4NY0A 2J0MA 2D9WA 2FJLA 2Y8GA 1MIZB 3ULCA 4HB4B 3A8PA 3AU4A 2VSZA 2I5FA 5JHHA 3QWMA 1DBHA 1UEFA 4GXBA 2N0YA 3N7CA 5C16A 5LOPB 3PG7A 4IOYX 2LULA 3AU5A 4YONA 3PP2A 1KZ7A 5HE3A 1V88A 5CLLB 4DBBA 3BINA 2Y8FA 4F7HA 3HW2B 4TYZA 2DHJA 1MKEA 5HE2A 1H4RA 2BCJA 2ZPYA 4HAZB 1OMWA 1MPHA 3AJ4A 3ODWA 4D0NB 1SHCA 1P3RA 1ZSQA 1BAKA 4KHBB 4DX8A 3GYOA 2J0KA 5D3WA 2NMBA 1X1GA 2HE7A 3F5RA 4KAXB 1MAIA 4NSWA 2OTXA 2EMSA 4F7UP 1UNPA 2D9ZA 5JLJB 1UNQA 1N3HA 4DXAB 2KUPA 1UPRA 5C5BB 4HATB 2VKIA 4HB2B 2QKMA 4ZRKA 4CHMA 2M38A 5D3VA 1NU2A 1Y5OA 1WGQA 3PSCA 1OQNA 3UZTA 1V61A 1OY2A 3WA0A 2GCLA 2J59M 2DA0A 1NTYA 1LB1A 4HB0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U7D A;  1M7R A;  3KSY A;  2W2X D;  4K2O A;  2R09 A;  4A6H A;  5C6R A;  1TJ6 A;  1FOE A;  1J0W A;  2V76 A;  2YS5 A;  1W1D A;  4HAV B;  1MK9 B;  1ZC4 B;  2ADZ A;  4Y94 A;  3D8D A;  2D10 A;  4MY6 A;  3TVV A;  1FB8 A;  3FSS A;  2P0D A;  1PMS A;  2VRW B;  3VIA A;  2DHK A;  2Z0O A;  2I1J A;  2N23 A;  2K00 A;  2G35 A;  3PVW A;  1U29 A;  3TCA A;  5L81 A;  3SNH A;  2DFK A;  2QKL A;  1U5D A;  1FHX A;  2DKQ A;  2EC1 A;  1J19 A;  1KI1 B;  4EMO A;  5J3Q A;  3ULB A;  3O96 A;  5HE0 A;  3ML4 A;  5FI0 A;  3A98 B;  5JHG A;  2EMT A;  2RGN B;  2MDX A;  1M7E A;  2KCJ A;  4HHV A;  2ROV A;  1ZC3 B;  2X18 A;  3QBV B;  1E5W A;  2DX1 A;  2GS0 A;  5J3Y A;  4A5K A;  1DDV A;  1I7A A;  2UZS A;  2DLW A;  4MK0 A;  1DRO A;  4GMV A;  2J0J A;  1W1G A;  2P0F A;  3DXD A;  2CY4 A;  5C79 A;  2UVM A;  4K81 A;  5DI9 B;  1EF1 A;  4HAW B;  2AEH A;  2DKP A;  5GOW B;  1U5G A;  3WYF B;  4HDQ A;  2R0D A;  4H8S A;  2YS3 A;  1TQZ A;  2COC A;  1BTN A;  1MK7 B;  1FAO A;  1U5E A;  3PVL A;  4A6K A;  4CHJ A;  1WG7 A;  2DTC A;  1UPQ A;  1DYN A;  1AQC A;  1W1H A;  2RUK B;  1TXD A;  2LOZ A;  4WVF B;  2P0H A;  1RRP B;  2YT0 A;  4A6F B;  4F7G A;  3TW1 A;  1EGX A;  4EJN A;  1PFJ A;  5KQ4 A;  3ODO A;  4GMX B;  1UNR A;  2ELB A;  4ZRJ A;  2XQN M;  3NSU A;  3PVU A;  3KRW A;  1X11 A;  2DYN A;  2Y7B A;  1Z87 A;  5DH9 B;  2YSZ A;  1WI1 A;  1WVH A;  4PQ0 A;  1FHO A;  2L1C A;  2I5C A;  1BTK A;  4HAY B;  3D8F A;  5FI1 A;  2COD A;  3SUZ A;  2H7E A;  1Q67 A;  2YS1 A;  1XD4 A;  3ODX A;  1WJ1 A;  2OQB A;  1X1F A;  2W2X C;  1U2B A;  4GPT B;  1FGY A;  1GG3 A;  2KGX B;  1XX0 A;  2MWN B;  3OAN A;  2DHI A;  1KZG A;  2IYB A;  4K17 A;  1Y19 B;  2YF0 A;  3FEH A;  1RJ2 A;  2GJY A;  4K2P A;  1X05 A;  1U5F A;  4HAU B;  3IVF A;  5CLQ B;  3MPX A;  2Z0Q A;  1IRS A;  3DXC A;  4HAX B;  2LG1 A;  2RNR B;  4YL8 A;  3RCP A;  2GCJ A;  3CIK A;  2MKR A;  1I2H A;  1P6S A;  4KVG B;  4HDO A;  5C5B A;  3TFM A;  5J3T A;  2COA A;  2EJ8 A;  3SV1 A;  3ZVR A;  5JP4 A;  1NI2 A;  3A8Q A;  1PLS A;  5D3Y A;  5EFX A;  1B55 A;  1V5U A;  4WJ7 A;  5D27 A;  2MFQ A;  2RLO A;  2ELA A;  1U27 A;  4DX9 0;  1QQG A;  1V5M A;  2D2Q A;  2M14 A;  3P6A A;  3CXB B;  1XOD A;  2D11 A;  1ISN A;  2YT1 A;  2NZ8 B;  3GYP A;  2LKO A;  3KRX A;  1P5T A;  4Z2M B;  2CY5 A;  3F0W A;  1NTV A;  1QC6 A;  1GC7 A;  2UZR A;  2Q13 A;  4CYE A;  2D4Q A;  2PZ1 A;  5LON B;  1K5D B;  2D9X A;  2W2W A;  2Z0P A;  5HE1 A;  1H10 A;  4GN1 A;  5D3X A;  1V89 A;  1K5G B;  4KHO A;  5KQ1 A;  3M1I B;  1ZVR A;  1WJM A;  1FGZ A;  2CRF A;  4BBK A;  2H7D A;  3D8E A;  3QIJ A;  3LJU X;  2I1K A;  4MT7 A;  4ZRI A;  3T06 A;  5KCV A;  2DN6 A;  2E2X A;  3MDB C;  3PZD A;  2K2J A;  1XKE A;  4C0A A;  2DX5 A;  1XR0 B;  2LYD A;  4L6E A;  3BJI A;  2CAY A;  4P7I A;  2COF A;  3SO6 A;  4IAP A;  2D9V A;  3X23 A;  5DHA B;  2JP2 A;  5DHF B;  1GC6 A;  3FM8 C;  3TO1 A;  3ZDT A;  3HK0 A;  1WGU A;  1MIX A;  1LW3 A;  1EVH A;  1BWN A;  3PEG A;  4KHA A;  4Z2N A;  4HB3 B;  1SGH A;  2YVC A;  4XWX A;  1EAZ A;  2RVB B;  1DDW A;  2ROZ B;  1DDM A;  1V5P A;  3V5W A;  1ZM0 A;  3SYX A;  1X86 A;  2AL6 A;  2D9Y A;  2YRY A;  2LOX A;  1FHW A;  3G9W A;  2RSG A;  3DXE A;  4B6H A;  3KY9 A;  2P8V A;  4WSF A;  4IFS A;  1XCG A;  4GZU A;  5DIF B;  2K2U A;  2L2I A;  2HTH B;  3VOQ A;  3KZ1 A;  4PNK A;  1AWE A;  3P7Z A;  2IFS A;  4TKN A;  4A6F A;  4EKU A;  2DYQ A;  3HQC A;  3U8Z A;  4NY0 A;  2J0M A;  2D9W A;  2FJL A;  2Y8G A;  1MIZ B;  3ULC A;  4HB4 B;  3A8P A;  3AU4 A;  2VSZ A;  2I5F A;  5JHH A;  3QWM A;  1DBH A;  1UEF A;  4GXB A;  2N0Y A;  3N7C A;  5C16 A;  5LOP B;  3PG7 A;  4IOY X;  2LUL A;  3AU5 A;  4YON A;  3PP2 A;  1KZ7 A;  5HE3 A;  1V88 A;  5CLL B;  4DBB A;  3BIN A;  2Y8F A;  4F7H A;  3HW2 B;  4TYZ A;  2DHJ A;  1MKE A;  5HE2 A;  1H4R A;  2BCJ A;  2ZPY A;  4HAZ B;  1OMW A;  1MPH A;  3AJ4 A;  3ODW A;  4D0N B;  1SHC A;  1P3R A;  1ZSQ A;  1BAK A;  4KHB B;  4DX8 A;  3GYO A;  2J0K A;  5D3W A;  2NMB A;  1X1G A;  2HE7 A;  3F5R A;  4KAX B;  1MAI A;  4NSW A;  2OTX A;  2EMS A;  4F7U P;  1UNP A;  2D9Z A;  5JLJ B;  1UNQ A;  1N3H A;  4DXA B;  2KUP A;  1UPR A;  5C5B B;  4HAT B;  2VKI A;  4HB2 B;  2QKM A;  4ZRK A;  4CHM A;  2M38 A;  5D3V A;  1NU2 A;  1Y5O A;  1WGQ A;  3PSC A;  1OQN A;  3UZT A;  1V61 A;  1OY2 A;  3WA0 A;  2GCL A;  2J59 M;  2DA0 A;  1NTY A;  1LB1 A;  4HB0 B; 
#chains in the Genus database with same CATH topology
 3U7D A;  1M7R A;  3KSY A;  2W2X D;  4K2O A;  2R09 A;  4A6H A;  5C6R A;  1TJ6 A;  1FOE A;  1J0W A;  2V76 A;  2YS5 A;  1W1D A;  4HAV B;  1MK9 B;  1ZC4 B;  2ADZ A;  1ZYI A;  4Y94 A;  3D8D A;  2D10 A;  4MY6 A;  3TVV A;  1FB8 A;  3FSS A;  2P0D A;  1PMS A;  2VRW B;  3VIA A;  2DHK A;  2Z0O A;  2I1J A;  2N23 A;  2K00 A;  2G35 A;  3PVW A;  1U29 A;  3TCA A;  5L81 A;  3SNH A;  2DFK A;  3HIE A;  2QKL A;  1U5D A;  1FHX A;  2DKQ A;  2EC1 A;  1J19 A;  1KI1 B;  4EMO A;  5J3Q A;  3ULB A;  3O96 A;  5HE0 A;  4HSI A;  4GOU A;  3ML4 A;  5FI0 A;  3FVC A;  3A98 B;  5JHG A;  2EMT A;  2RGN B;  2MDX A;  1M7E A;  2K49 A;  2KCJ A;  4HHV A;  5M4Y B;  2ROV A;  1ZC3 B;  2X18 A;  2GUM A;  1E5W A;  2DX1 A;  3QBV B;  2GS0 A;  5J3Y A;  4A5K A;  1DDV A;  1I7A A;  2UZS A;  2DLW A;  4MK0 A;  1DRO A;  4GMV A;  4OSN A;  2Z59 A;  2J0J A;  1W1G A;  2P0F A;  3DXD A;  2CY4 A;  2KIE A;  5C79 A;  2UVM A;  4K81 A;  5DI9 B;  1EF1 A;  4HAW B;  2AEH A;  2KUQ A;  2DKP A;  5GOW B;  1U5G A;  5I2S A;  3WYF B;  4HDQ A;  2R0D A;  4H8S A;  2YS3 A;  1TQZ A;  2COC A;  1BTN A;  1MK7 B;  1FAO A;  1U5E A;  3PVL A;  4A6K A;  4CHJ A;  1WG7 A;  2DTC A;  1UPQ A;  1DYN A;  1AQC A;  1W1H A;  2RUK B;  1TXD A;  2LOZ A;  4WVF B;  2P0H A;  1RRP B;  2YT0 A;  4A6F B;  4F7G A;  3TW1 A;  1EGX A;  4EJN A;  1PFJ A;  5KQ4 A;  3ODO A;  4GMX B;  1UNR A;  2ELB A;  4ZRJ A;  2XQN M;  3NSU A;  3PVU A;  3KRW A;  1X11 A;  2DYN A;  2Y7B A;  1Z87 A;  5DH9 B;  3HSA A;  2YSZ A;  1WI1 A;  1WVH A;  4PQ0 A;  1FHO A;  2L1C A;  2I5C A;  1BTK A;  4HAY B;  3D8F A;  5FI1 A;  2COD A;  3SUZ A;  2H7E A;  1Q67 A;  2YS1 A;  1XD4 A;  3ODX A;  1WJ1 A;  2NBV A;  2OQB A;  1X1F A;  2W2X C;  1U2B A;  4GPT B;  1FGY A;  1GG3 A;  2KGX B;  1XX0 A;  2MWN B;  3OAN A;  2DHI A;  1KZG A;  3DCX A;  2IYB A;  3NW8 A;  4K17 A;  1Y19 B;  2ZKM X;  2R2Y A;  2YF0 A;  3FEH A;  1RJ2 A;  2GJY A;  4K2P A;  1X05 A;  1U5F A;  4HAU B;  3IVF A;  5CLQ B;  3MPX A;  2Z0Q A;  4QJ5 B;  1IRS A;  3DXC A;  4HAX B;  2LG1 A;  2RNR B;  4YL8 A;  3RCP A;  2GCJ A;  3CIK A;  2MKR A;  1I2H A;  1P6S A;  4KVG B;  4HDO A;  5C5B A;  3TFM A;  5J3T A;  2COA A;  2EJ8 A;  3SV1 A;  3ZVR A;  5JP4 A;  1NI2 A;  3A8Q A;  1PLS A;  3U12 A;  5D3Y A;  5EFX A;  1B55 A;  1V5U A;  4DIX A;  4WJ7 A;  5D27 A;  2MFQ A;  2RLO A;  2ELA A;  4L1R A;  1U27 A;  4DX9 0;  1QQG A;  1V5M A;  2D2Q A;  2M14 A;  3P6A A;  3CXB B;  4CSQ A;  1XOD A;  2D11 A;  1ISN A;  2YT1 A;  2NZ8 B;  1MI1 A;  3GYP A;  2LKO A;  3KRX A;  1P5T A;  4Z2M B;  2CY5 A;  3F0W A;  1NTV A;  1QC6 A;  1GC7 A;  2UZR A;  2Q13 A;  4CYE A;  2D4Q A;  2PZ1 A;  5I2M A;  5LON B;  1K5D B;  2D9X A;  2KIG A;  2W2W A;  2Z0P A;  5HE1 A;  1H10 A;  4GN1 A;  5D3X A;  1V89 A;  1K5G B;  4KHO A;  5KQ1 A;  3M1I B;  1ZVR A;  1WJM A;  1FGZ A;  2CRF A;  4BBK A;  2H7D A;  3D8E A;  3QIJ A;  3LJU X;  2I1K A;  4MT7 A;  4ZRI A;  2YT2 A;  3T06 A;  5KCV A;  2DN6 A;  2E2X A;  3MDB C;  3PZD A;  2K2J A;  1XKE A;  4C0A A;  2DX5 A;  1XR0 B;  2LYD A;  4L6E A;  3BJI A;  2CAY A;  4P7I A;  2COF A;  3SO6 A;  4IAP A;  2D9V A;  2FJU B;  3X23 A;  5DHA B;  2JP2 A;  5DHF B;  1GC6 A;  3FM8 C;  3TO1 A;  4OT1 A;  2RRF A;  3ZDT A;  3HK0 A;  1WGU A;  1MIX A;  1LW3 A;  1EVH A;  1BWN A;  3PEG A;  4KHA A;  4Z2N A;  4HB3 B;  1SGH A;  2YVC A;  4XWX A;  3NWA A;  1EAZ A;  2RVB B;  1DDW A;  2ROZ B;  3A58 A;  3B77 A;  1DDM A;  1V5P A;  3V5W A;  1ZM0 A;  3SYX A;  1X86 A;  2AL6 A;  2D9Y A;  2YRY A;  2LOX A;  1FHW A;  3G9W A;  5LG4 B;  2RSG A;  3DXE A;  4B6H A;  3KY9 A;  2P8V A;  4WSF A;  4IFS A;  1XCG A;  4GZU A;  5DIF B;  2K2U A;  2L2I A;  2HTH B;  3VOQ A;  3KZ1 A;  4PNK A;  1AWE A;  3P7Z A;  2IFS A;  4TKN A;  4A6F A;  4EKU A;  2DYQ A;  3HQC A;  3U8Z A;  4NY0 A;  2J0M A;  2D9W A;  2FJL A;  3OHM B;  2Y8G A;  2Z14 A;  1MIZ B;  2Z13 A;  4QXA B;  4QJ4 B;  3ULC A;  4HB4 B;  3A8P A;  3AU4 A;  2VSZ A;  2I5F A;  5JHH A;  4D6W A;  2Z4D A;  3QWM A;  1DBH A;  1UEF A;  4GXB A;  2N0Y A;  3N7C A;  5C16 A;  5LOP B;  1T77 A;  3PG7 A;  4IOY X;  2LUL A;  3NWF A;  4GNK B;  3AU5 A;  4YON A;  3PP2 A;  1KZ7 A;  5HE3 A;  1V88 A;  5CLL B;  4DBB A;  3BIN A;  2Y8F A;  4F7H A;  3HW2 B;  4TYZ A;  2DHJ A;  1MKE A;  5HE2 A;  1H4R A;  2BCJ A;  2ZPY A;  4HAZ B;  1OMW A;  1MPH A;  3AJ4 A;  3ODW A;  4D0N B;  1SHC A;  1P3R A;  1ZSQ A;  1BAK A;  4KHB B;  4DX8 A;  3GYO A;  2J0K A;  5D3W A;  5IRS A;  2NMB A;  1X1G A;  2HE7 A;  3F5R A;  4KAX B;  1MAI A;  4NSW A;  2OTX A;  2EMS A;  4F7U P;  1UNP A;  2D9Z A;  5JLJ B;  1UNQ A;  1N3H A;  4DXA B;  2KUP A;  1UPR A;  3NWD A;  5C5B B;  4HAT B;  2VKI A;  4HB2 B;  4KHB A;  2QKM A;  4ZRK A;  4CHM A;  2M38 A;  5D3V A;  1NU2 A;  2K8E A;  1Y5O A;  1WGQ A;  3PSC A;  1OQN A;  3UZT A;  1V61 A;  1OY2 A;  3WA0 A;  2GCL A;  2J59 M;  4QJ3 B;  2DA0 A;  2KR0 A;  1NTY A;  1LB1 A;  4HB0 B; 
#chains in the Genus database with same CATH homology
 3U7D A;  1M7R A;  3KSY A;  2W2X D;  4K2O A;  2R09 A;  4A6H A;  5C6R A;  1TJ6 A;  1FOE A;  1J0W A;  2V76 A;  2YS5 A;  1W1D A;  4HAV B;  1MK9 B;  1ZC4 B;  2ADZ A;  4Y94 A;  3D8D A;  2D10 A;  4MY6 A;  3TVV A;  1FB8 A;  3FSS A;  2P0D A;  1PMS A;  2VRW B;  3VIA A;  2DHK A;  2Z0O A;  2I1J A;  2N23 A;  2K00 A;  2G35 A;  3PVW A;  1U29 A;  3TCA A;  5L81 A;  3SNH A;  2DFK A;  2QKL A;  1U5D A;  1FHX A;  2DKQ A;  2EC1 A;  1J19 A;  1KI1 B;  4EMO A;  5J3Q A;  3ULB A;  3O96 A;  5HE0 A;  3ML4 A;  5FI0 A;  3A98 B;  5JHG A;  2EMT A;  2RGN B;  2MDX A;  1M7E A;  2KCJ A;  4HHV A;  2ROV A;  1ZC3 B;  2X18 A;  3QBV B;  1E5W A;  2DX1 A;  2GS0 A;  5J3Y A;  4A5K A;  1DDV A;  1I7A A;  2UZS A;  2DLW A;  4MK0 A;  1DRO A;  4GMV A;  2J0J A;  1W1G A;  2P0F A;  3DXD A;  2CY4 A;  5C79 A;  2UVM A;  4K81 A;  5DI9 B;  1EF1 A;  4HAW B;  2AEH A;  2DKP A;  5GOW B;  1U5G A;  3WYF B;  4HDQ A;  2R0D A;  4H8S A;  2YS3 A;  1TQZ A;  2COC A;  1BTN A;  1MK7 B;  1FAO A;  1U5E A;  3PVL A;  4A6K A;  4CHJ A;  1WG7 A;  2DTC A;  1UPQ A;  1DYN A;  1AQC A;  1W1H A;  2RUK B;  1TXD A;  2LOZ A;  4WVF B;  2P0H A;  1RRP B;  2YT0 A;  4A6F B;  4F7G A;  3TW1 A;  1EGX A;  4EJN A;  1PFJ A;  5KQ4 A;  3ODO A;  4GMX B;  1UNR A;  2ELB A;  4ZRJ A;  2XQN M;  3NSU A;  3PVU A;  3KRW A;  1X11 A;  2DYN A;  2Y7B A;  1Z87 A;  5DH9 B;  2YSZ A;  1WI1 A;  1WVH A;  4PQ0 A;  1FHO A;  2L1C A;  2I5C A;  1BTK A;  4HAY B;  3D8F A;  5FI1 A;  2COD A;  3SUZ A;  2H7E A;  1Q67 A;  2YS1 A;  1XD4 A;  3ODX A;  1WJ1 A;  2OQB A;  1X1F A;  2W2X C;  1U2B A;  4GPT B;  1FGY A;  1GG3 A;  2KGX B;  1XX0 A;  2MWN B;  3OAN A;  2DHI A;  1KZG A;  2IYB A;  4K17 A;  1Y19 B;  2YF0 A;  3FEH A;  1RJ2 A;  2GJY A;  4K2P A;  1X05 A;  1U5F A;  4HAU B;  3IVF A;  5CLQ B;  3MPX A;  2Z0Q A;  1IRS A;  3DXC A;  4HAX B;  2LG1 A;  2RNR B;  4YL8 A;  3RCP A;  2GCJ A;  3CIK A;  2MKR A;  1I2H A;  1P6S A;  4KVG B;  4HDO A;  5C5B A;  3TFM A;  5J3T A;  2COA A;  2EJ8 A;  3SV1 A;  3ZVR A;  5JP4 A;  1NI2 A;  3A8Q A;  1PLS A;  5D3Y A;  5EFX A;  1B55 A;  1V5U A;  4WJ7 A;  5D27 A;  2MFQ A;  2RLO A;  2ELA A;  1U27 A;  4DX9 0;  1QQG A;  1V5M A;  2D2Q A;  2M14 A;  3P6A A;  3CXB B;  1XOD A;  2D11 A;  1ISN A;  2YT1 A;  2NZ8 B;  3GYP A;  2LKO A;  3KRX A;  1P5T A;  4Z2M B;  2CY5 A;  3F0W A;  1NTV A;  1QC6 A;  1GC7 A;  2UZR A;  2Q13 A;  4CYE A;  2D4Q A;  2PZ1 A;  5LON B;  1K5D B;  2D9X A;  2W2W A;  2Z0P A;  5HE1 A;  1H10 A;  4GN1 A;  5D3X A;  1V89 A;  1K5G B;  4KHO A;  5KQ1 A;  3M1I B;  1ZVR A;  1WJM A;  1FGZ A;  2CRF A;  4BBK A;  2H7D A;  3D8E A;  3QIJ A;  3LJU X;  2I1K A;  4MT7 A;  4ZRI A;  3T06 A;  5KCV A;  2DN6 A;  2E2X A;  3MDB C;  3PZD A;  2K2J A;  1XKE A;  4C0A A;  2DX5 A;  1XR0 B;  2LYD A;  4L6E A;  3BJI A;  2CAY A;  4P7I A;  2COF A;  3SO6 A;  4IAP A;  2D9V A;  3X23 A;  5DHA B;  2JP2 A;  5DHF B;  1GC6 A;  3FM8 C;  3TO1 A;  3ZDT A;  3HK0 A;  1WGU A;  1MIX A;  1LW3 A;  1EVH A;  1BWN A;  3PEG A;  4KHA A;  4Z2N A;  4HB3 B;  1SGH A;  2YVC A;  4XWX A;  1EAZ A;  2RVB B;  1DDW A;  2ROZ B;  1DDM A;  1V5P A;  3V5W A;  1ZM0 A;  3SYX A;  1X86 A;  2AL6 A;  2D9Y A;  2YRY A;  2LOX A;  1FHW A;  3G9W A;  2RSG A;  3DXE A;  4B6H A;  3KY9 A;  2P8V A;  4WSF A;  4IFS A;  1XCG A;  4GZU A;  5DIF B;  2K2U A;  2L2I A;  2HTH B;  3VOQ A;  3KZ1 A;  4PNK A;  1AWE A;  3P7Z A;  2IFS A;  4TKN A;  4A6F A;  4EKU A;  2DYQ A;  3HQC A;  3U8Z A;  4NY0 A;  2J0M A;  2D9W A;  2FJL A;  2Y8G A;  1MIZ B;  3ULC A;  4HB4 B;  3A8P A;  3AU4 A;  2VSZ A;  2I5F A;  5JHH A;  3QWM A;  1DBH A;  1UEF A;  4GXB A;  2N0Y A;  3N7C A;  5C16 A;  5LOP B;  3PG7 A;  4IOY X;  2LUL A;  3AU5 A;  4YON A;  3PP2 A;  1KZ7 A;  5HE3 A;  1V88 A;  5CLL B;  4DBB A;  3BIN A;  2Y8F A;  4F7H A;  3HW2 B;  4TYZ A;  2DHJ A;  1MKE A;  5HE2 A;  1H4R A;  2BCJ A;  2ZPY A;  4HAZ B;  1OMW A;  1MPH A;  3AJ4 A;  3ODW A;  4D0N B;  1SHC A;  1P3R A;  1ZSQ A;  1BAK A;  4KHB B;  4DX8 A;  3GYO A;  2J0K A;  5D3W A;  2NMB A;  1X1G A;  2HE7 A;  3F5R A;  4KAX B;  1MAI A;  4NSW A;  2OTX A;  2EMS A;  4F7U P;  1UNP A;  2D9Z A;  5JLJ B;  1UNQ A;  1N3H A;  4DXA B;  2KUP A;  1UPR A;  5C5B B;  4HAT B;  2VKI A;  4HB2 B;  2QKM A;  4ZRK A;  4CHM A;  2M38 A;  5D3V A;  1NU2 A;  1Y5O A;  1WGQ A;  3PSC A;  1OQN A;  3UZT A;  1V61 A;  1OY2 A;  3WA0 A;  2GCL A;  2J59 M;  2DA0 A;  1NTY A;  1LB1 A;  4HB0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...