4KAXB

Crystal structure of the grp1 ph domain in complex with arf6-gtp
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
143
structure length
143
Chain Sequence
GNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding/signaling protein
molecule keywords ADP-ribosylation factor 6
publication title Structural basis for membrane recruitment and allosteric activation of cytohesin family Arf GTPase exchange factors.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4kaxB00
1V88A 1RRPB 1GG3A 4HAWB 2CRFA 2QKLA 3GYPA 5HE0A 4HAUB 5DI9B 5EFXA 5JP4A 5HE2A 1P6SA 2J59M 2N23A 5DH9B 5JHHA 3P7ZA 4A6KA 5GOWB 2JP2A 2Z0OA 2MKRA 4A5KA 2YRYA 3ZDTA 2P0DA 4A6HA 4WVFB 1BTNA 1UNQA 4NSWA 4EMOA 1ZSQA 1UNPA 1X05A 2BCJA 3QWMA 2AEHA 3LJUX 4IFSA 2KGXB 1V5PA 5C5BA 2L2IA 2D11A 1ISNA 4KHBB 2R09A 4MK0A 5L81A 1J0WA 3MPXA 3A8PA 2D10A 2M14A 2GJYA 5CLLB 2KUPA 3CXBB 4HAZB 2I5CA 2ZPYA 3HQCA 1WJ1A 4HB3B 4DXAB 4NY0A 4WSFA 2L1CA 2K2JA 2COFA 3PVWA 1FHWA 5JLJB 3G9WA 2RUKB 2RLOA 4GZUA 1XODA 1XX0A 2RNRB 1SGHA 4HAYB 1FHOA 1M7RA 3T06A 1V89A 5FI1A 4TYZA 5D3YA 1FHXA 2AL6A 5HE1A 4TKNA 4P7IA 2YF0A 1PLSA 3AU5A 1X1FA 5JHGA 1ZC4B 1BWNA 3U8ZA 4XWXA 2EC1A 1MKEA 1ZVRA 2I1JA 3QBVB 1V5UA 5D27A 1DDMA 4EJNA 1QQGA 1XCGA 2YS3A 3F5RA 2IFSA 4F7HA 2DA0A 2DKPA 4ZRKA 2MDXA 1N3HA 1RJ2A 1TXDA 2D9WA 4CHJA 3TW1A 1MAIA 3RCPA 2NZ8B 4PNKA 1H4RA 4F7GA 3ODXA 4K2PA 2YSZA 1LB1A 3PVLA 3KSYA 2QKMA 3TFMA 1UEFA 1NTYA 2EMTA 1DDWA 2OTXA 4DBBA 1IRSA 5J3QA 1P5TA 4EKUA 2Q13A 3FSSA 2J0MA 1MK9B 3KRXA 3UZTA 1EAZA 1K5DB 4MY6A 1DBHA 2LKOA 4H8SA 1EF1A 4KHOA 1PMSA 4C0AA 2K2UA 5CLQB 3FM8C 1U29A 2DFKA 2KCJA 2P0HA 3KY9A 3SNHA 3DXEA 4WJ7A 2I5FA 2PZ1A 2EMSA 4B6HA 1ZC3B 2RVBB 3O96A 1J19A 2DX5A 1FAOA 2W2WA 3P6AA 1Y19B 1AWEA 4K17A 3TCAA 1GC7A 1P3RA 5C6RA 2Y8GA 3PSCA 1SHCA 3DXCA 2VRWB 1U5GA 4KAXB 2K00A 3D8DA 5HE3A 2DHJA 1TJ6A 2MFQA 4YONA 2UZSA 2UZRA 1WGUA 4IOYX 3TO1A 3TVVA 1DYNA 1M7EA 4A6FA 3SV1A 1U27A 2OQBA 2W2XC 4DX8A 5J3TA 2DX1A 4HAXB 1OMWA 3IVFA 2D9XA 3PG7A 3D8EA 1K5GB 5KQ1A 1X86A 1FGYA 2LOZA 5J3YA 2P0FA 2UVMA 5KCVA 1NU2A 1EGXA 3A8QA 2H7EA 2J0KA 2Y7BA 1TQZA 2NMBA 4GMXB 2CY5A 2D2QA 2D9ZA 2P8VA 1KZ7A 2HTHB 1ZM0A 4GPTB 4HAVB 1NI2A 4HB2B 4GMVA 1Q67A 3SO6A 2H7DA 2CY4A 2YS5A 5FI0A 1X11A 3PP2A 2XQNM 4GN1A 3KRWA 3U7DA 2ELBA 1UPRA 2YT1A 3WA0A 2ELAA 1X1GA 1NTVA 1I7AA 3V5WA 1LW3A 5C16A 4D0NB 2DHIA 4A6FB 3ODOA 2DN6A 1FGZA 1U2BA 3QIJA 1Y5OA 2W2XD 2D9VA 4Z2MB 1GC6A 1V61A 1KZGA 3DXDA 2LULA 1U5FA 2FJLA 2D4QA 1XD4A 2GCLA 3PEGA 3PZDA 4DX90 2GCJA 2COCA 2DYNA 2LYDA 1MK7B 2RSGA 1DROA 1U5DA 1XR0B 4K81A 1H10A 4F7UP 2G35A 1QC6A 3ZVRA 4Z2NA 2VKIA 4HATB 3VIAA 1WJMA 2IYBA 2ROZB 1BAKA 1WGQA 3WYFB 1WVHA 2X18A 1FOEA 4IAPA 3HW2B 4PQ0A 4CHMA 4BBKA 2J0JA 3AU4A 1OY2A 4KVGB 3ULCA 3BINA 2Z0PA 4ZRIA 3ULBA 4HHVA 2LG1A 4YL8A 3SYXA 4MT7A 1W1GA 1EVHA 1PFJA 4L6EA 3F0WA 1E5WA 5DHAB 2YS1A 3ODWA 5C79A 1MIZB 2DTCA 2D9YA 1UPQA 2ROVA 2V76A 2I1KA 4HDOA 3OANA 2RGNB 4HB4B 2YT0A 5D3XA 5DIFB 3X23A 2HE7A 1BTKA 4HDQA 3AJ4A 5D3VA 3ML4A 3N7CA 1W1DA 3GYOA 2VSZA 1V5MA 2COAA 2E2XA 2MWNB 2CAYA 1FB8A 4CYEA 1MIXA 3CIKA 1I2HA 5LOPB 2EJ8A 4Y94A 2DKQA 1W1HA 2Z0QA 1WI1A 2DLWA 1B55A 1KI1B 4KHAA 3D8FA 1XKEA 4K2OA 1OQNA 2Y8FA 3HK0A 2LOXA 5KQ4A 3KZ1A 5LONB 5C5BB 1Z87A 2GS0A 3NSUA 1WG7A 2DYQA 2YVCA 5D3WA 3A98B 2R0DA 3SUZA 1AQCA 1UNRA 5DHFB 3BJIA 4ZRJA 2DHKA 1MPHA 3FEHA 2ADZA 1U5EA 2N0YA 3M1IB 2CODA 3PVUA 1DDVA 2M38A 4GXBA 3MDBC 3VOQA 4HB0B
chains in the Genus database with same CATH superfamily
1V88A 1RRPB 1GG3A 4HAWB 3OHMB 2CRFA 2QKLA 3GYPA 5HE0A 4HAUB 5DI9B 5EFXA 5JP4A 5HE2A 1P6SA 2J59M 2N23A 5DH9B 5JHHA 3P7ZA 4A6KA 5GOWB 2JP2A 2Z0OA 2MKRA 4A5KA 2YRYA 3ZDTA 2P0DA 4A6HA 4WVFB 1BTNA 1UNQA 4NSWA 4EMOA 1ZSQA 2K8EA 1UNPA 1X05A 4CSQA 2BCJA 2NBVA 3QWMA 2AEHA 2Z14A 4OT1A 3LJUX 4IFSA 2KGXB 1V5PA 5C5BA 2L2IA 2D11A 1ISNA 4KHBB 2R09A 4MK0A 5L81A 1J0WA 3MPXA 3A8PA 5I2MA 2D10A 2M14A 3NWDA 2GJYA 5CLLB 2KUPA 3CXBB 4HAZB 2I5CA 2ZPYA 3HQCA 1WJ1A 2ZKMX 4HB3B 4DXAB 4NY0A 4WSFA 2L1CA 2K2JA 2COFA 3PVWA 1FHWA 5JLJB 3G9WA 2RUKB 2RLOA 4GZUA 1XODA 1XX0A 2RNRB 1SGHA 4HAYB 1FHOA 1M7RA 3T06A 1V89A 5FI1A 4TYZA 5D3YA 1FHXA 2AL6A 5HE1A 4TKNA 4P7IA 2YF0A 1PLSA 3AU5A 1X1FA 5JHGA 1ZC4B 1BWNA 3U8ZA 4XWXA 2EC1A 1MKEA 1ZVRA 2I1JA 3QBVB 1V5UA 5D27A 1DDMA 4EJNA 5IRSA 1QQGA 1XCGA 2YS3A 3F5RA 2IFSA 4F7HA 2DA0A 2DKPA 4ZRKA 2MDXA 1N3HA 1RJ2A 1TXDA 2D9WA 4CHJA 3TW1A 1MAIA 2FJUB 3RCPA 2NZ8B 4DIXA 4PNKA 1H4RA 2Z4DA 3ODXA 4F7GA 4K2PA 1MI1A 2YSZA 1LB1A 2RRFA 3PVLA 3NWAA 3KSYA 2QKMA 3TFMA 1UEFA 1NTYA 2EMTA 1DDWA 2OTXA 4DBBA 1IRSA 5J3QA 1P5TA 4EKUA 2Q13A 3FSSA 2J0MA 1MK9B 3KRXA 3UZTA 1EAZA 1K5DB 4MY6A 1DBHA 2LKOA 4H8SA 1EF1A 4GNKB 4KHOA 1PMSA 4C0AA 4D6WA 2K2UA 5CLQB 2Z59A 3FM8C 1U29A 2DFKA 2KR0A 2KCJA 2P0HA 3KY9A 3SNHA 3DXEA 4WJ7A 2I5FA 3A58A 2PZ1A 2EMSA 4OSNA 4B6HA 1ZC3B 2RVBB 3O96A 1J19A 4QJ3B 2DX5A 1FAOA 2W2WA 3P6AA 1Y19B 1AWEA 4K17A 3TCAA 1GC7A 1P3RA 5C6RA 2Y8GA 3PSCA 1SHCA 3DXCA 2VRWB 1U5GA 4KAXB 2K00A 3D8DA 5HE3A 2DHJA 3B77A 1TJ6A 2MFQA 4YONA 2UZSA 2UZRA 1WGUA 4IOYX 3TO1A 3TVVA 1DYNA 1M7EA 2KIEA 4A6FA 3SV1A 1U27A 2OQBA 2W2XC 3DCXA 4DX8A 5J3TA 2DX1A 4HAXB 1OMWA 3IVFA 2D9XA 3PG7A 3D8EA 1K5GB 5KQ1A 1X86A 1FGYA 1ZYIA 2LOZA 5J3YA 2P0FA 2UVMA 5KCVA 1NU2A 1EGXA 1T77A 3A8QA 2H7EA 5M4YB 2J0KA 2Y7BA 1TQZA 2NMBA 4GMXB 4QJ5B 2CY5A 4QXAB 5LG4B 3U12A 2D2QA 2D9ZA 2P8VA 1KZ7A 2HTHB 1ZM0A 4GPTB 4HAVB 1NI2A 4HB2B 4GMVA 1Q67A 3SO6A 2H7DA 2CY4A 2YS5A 5FI0A 1X11A 3PP2A 2XQNM 4GN1A 3KRWA 3U7DA 2ELBA 1UPRA 2YT1A 3NW8A 3WA0A 2ELAA 1X1GA 1NTVA 1I7AA 3V5WA 1LW3A 5C16A 4D0NB 2DHIA 3NWFA 4A6FB 3ODOA 2DN6A 1FGZA 1U2BA 3QIJA 1Y5OA 2W2XD 2D9VA 5I2SA 4Z2MB 1GC6A 1V61A 1KZGA 3DXDA 2LULA 1U5FA 2FJLA 2D4QA 1XD4A 2GCLA 3PEGA 3PZDA 4DX90 2GCJA 2COCA 2DYNA 2LYDA 1MK7B 2RSGA 1DROA 1U5DA 1XR0B 4K81A 1H10A 2KIGA 4F7UP 2G35A 4QJ4B 1QC6A 3ZVRA 4Z2NA 2VKIA 4HATB 3VIAA 1WJMA 2IYBA 2ROZB 3HIEA 1BAKA 1WGQA 3WYFB 1WVHA 2X18A 1FOEA 4IAPA 3HW2B 4PQ0A 4CHMA 4BBKA 2J0JA 3AU4A 1OY2A 4KVGB 3ULCA 3BINA 2Z13A 2Z0PA 4ZRIA 3ULBA 4HHVA 2LG1A 4YL8A 3SYXA 4MT7A 1W1GA 1EVHA 1PFJA 4L6EA 3HSAA 3F0WA 1E5WA 5DHAB 2YS1A 3ODWA 5C79A 1MIZB 2DTCA 2D9YA 1UPQA 2ROVA 2V76A 2YT2A 2I1KA 4HDOA 3OANA 2RGNB 4HB4B 2YT0A 5D3XA 5DIFB 3X23A 2HE7A 1BTKA 4HDQA 3AJ4A 2R2YA 5D3VA 3ML4A 2GUMA 3N7CA 1W1DA 3GYOA 2VSZA 1V5MA 4HSIA 2COAA 2E2XA 2MWNB 2KUQA 2CAYA 1FB8A 4CYEA 1MIXA 3CIKA 1I2HA 5LOPB 2EJ8A 4Y94A 2DKQA 1W1HA 2Z0QA 1WI1A 2DLWA 1B55A 1KI1B 4KHAA 3D8FA 1XKEA 4K2OA 1OQNA 2Y8FA 3HK0A 2LOXA 3FVCA 5KQ4A 3KZ1A 5LONB 5C5BB 1Z87A 2GS0A 3NSUA 4KHBA 1WG7A 2DYQA 2YVCA 5D3WA 3A98B 2R0DA 3SUZA 1AQCA 1UNRA 5DHFB 3BJIA 2K49A 4ZRJA 4GOUA 2DHKA 1MPHA 3FEHA 2ADZA 1U5EA 2N0YA 4L1RA 3M1IB 2CODA 3PVUA 1DDVA 2M38A 4GXBA 3MDBC 3VOQA 4HB0B
chains in the Genus database with same CATH topology
1V88A 1RRPB 1GG3A 4HAWB 2CRFA 2QKLA 3GYPA 5HE0A 4HAUB 5DI9B 5EFXA 5JP4A 5HE2A 1P6SA 2J59M 2N23A 5DH9B 5JHHA 3P7ZA 4A6KA 5GOWB 2JP2A 2Z0OA 2MKRA 4A5KA 2YRYA 3ZDTA 2P0DA 4A6HA 4WVFB 1BTNA 1UNQA 4NSWA 4EMOA 1ZSQA 1UNPA 1X05A 2BCJA 3QWMA 2AEHA 3LJUX 4IFSA 2KGXB 1V5PA 5C5BA 2L2IA 2D11A 1ISNA 4KHBB 2R09A 4MK0A 5L81A 1J0WA 3MPXA 3A8PA 2D10A 2M14A 2GJYA 5CLLB 2KUPA 3CXBB 4HAZB 2I5CA 2ZPYA 3HQCA 1WJ1A 4HB3B 4DXAB 4NY0A 4WSFA 2L1CA 2K2JA 2COFA 3PVWA 1FHWA 5JLJB 3G9WA 2RUKB 2RLOA 4GZUA 1XODA 1XX0A 2RNRB 1SGHA 4HAYB 1FHOA 1M7RA 3T06A 1V89A 5FI1A 4TYZA 5D3YA 1FHXA 2AL6A 5HE1A 4TKNA 4P7IA 2YF0A 1PLSA 3AU5A 1X1FA 5JHGA 1ZC4B 1BWNA 3U8ZA 4XWXA 2EC1A 1MKEA 1ZVRA 2I1JA 3QBVB 1V5UA 5D27A 1DDMA 4EJNA 1QQGA 1XCGA 2YS3A 3F5RA 2IFSA 4F7HA 2DA0A 2DKPA 4ZRKA 2MDXA 1N3HA 1RJ2A 1TXDA 2D9WA 4CHJA 3TW1A 1MAIA 3RCPA 2NZ8B 4PNKA 1H4RA 4F7GA 3ODXA 4K2PA 2YSZA 1LB1A 3PVLA 3KSYA 2QKMA 3TFMA 1UEFA 1NTYA 2EMTA 1DDWA 2OTXA 4DBBA 1IRSA 5J3QA 1P5TA 4EKUA 2Q13A 3FSSA 2J0MA 1MK9B 3KRXA 3UZTA 1EAZA 1K5DB 4MY6A 1DBHA 2LKOA 4H8SA 1EF1A 4KHOA 1PMSA 4C0AA 2K2UA 5CLQB 3FM8C 1U29A 2DFKA 2KCJA 2P0HA 3KY9A 3SNHA 3DXEA 4WJ7A 2I5FA 2PZ1A 2EMSA 4B6HA 1ZC3B 2RVBB 3O96A 1J19A 2DX5A 1FAOA 2W2WA 3P6AA 1Y19B 1AWEA 4K17A 3TCAA 1GC7A 1P3RA 5C6RA 2Y8GA 3PSCA 1SHCA 3DXCA 2VRWB 1U5GA 4KAXB 2K00A 3D8DA 5HE3A 2DHJA 1TJ6A 2MFQA 4YONA 2UZSA 2UZRA 1WGUA 4IOYX 3TO1A 3TVVA 1DYNA 1M7EA 4A6FA 3SV1A 1U27A 2OQBA 2W2XC 4DX8A 5J3TA 2DX1A 4HAXB 1OMWA 3IVFA 2D9XA 3PG7A 3D8EA 1K5GB 5KQ1A 1X86A 1FGYA 2LOZA 5J3YA 2P0FA 2UVMA 5KCVA 1NU2A 1EGXA 3A8QA 2H7EA 2J0KA 2Y7BA 1TQZA 2NMBA 4GMXB 2CY5A 2D2QA 2D9ZA 2P8VA 1KZ7A 2HTHB 1ZM0A 4GPTB 4HAVB 1NI2A 4HB2B 4GMVA 1Q67A 3SO6A 2H7DA 2CY4A 2YS5A 5FI0A 1X11A 3PP2A 2XQNM 4GN1A 3KRWA 3U7DA 2ELBA 1UPRA 2YT1A 3WA0A 2ELAA 1X1GA 1NTVA 1I7AA 3V5WA 1LW3A 5C16A 4D0NB 2DHIA 4A6FB 3ODOA 2DN6A 1FGZA 1U2BA 3QIJA 1Y5OA 2W2XD 2D9VA 4Z2MB 1GC6A 1V61A 1KZGA 3DXDA 2LULA 1U5FA 2FJLA 2D4QA 1XD4A 2GCLA 3PEGA 3PZDA 4DX90 2GCJA 2COCA 2DYNA 2LYDA 1MK7B 2RSGA 1DROA 1U5DA 1XR0B 4K81A 1H10A 4F7UP 2G35A 1QC6A 3ZVRA 4Z2NA 2VKIA 4HATB 3VIAA 1WJMA 2IYBA 2ROZB 1BAKA 1WGQA 3WYFB 1WVHA 2X18A 1FOEA 4IAPA 3HW2B 4PQ0A 4CHMA 4BBKA 2J0JA 3AU4A 1OY2A 4KVGB 3ULCA 3BINA 2Z0PA 4ZRIA 3ULBA 4HHVA 2LG1A 4YL8A 3SYXA 4MT7A 1W1GA 1EVHA 1PFJA 4L6EA 3F0WA 1E5WA 5DHAB 2YS1A 3ODWA 5C79A 1MIZB 2DTCA 2D9YA 1UPQA 2ROVA 2V76A 2I1KA 4HDOA 3OANA 2RGNB 4HB4B 2YT0A 5D3XA 5DIFB 3X23A 2HE7A 1BTKA 4HDQA 3AJ4A 5D3VA 3ML4A 3N7CA 1W1DA 3GYOA 2VSZA 1V5MA 2COAA 2E2XA 2MWNB 2CAYA 1FB8A 4CYEA 1MIXA 3CIKA 1I2HA 5LOPB 2EJ8A 4Y94A 2DKQA 1W1HA 2Z0QA 1WI1A 2DLWA 1B55A 1KI1B 4KHAA 3D8FA 1XKEA 4K2OA 1OQNA 2Y8FA 3HK0A 2LOXA 5KQ4A 3KZ1A 5LONB 5C5BB 1Z87A 2GS0A 3NSUA 1WG7A 2DYQA 2YVCA 5D3WA 3A98B 2R0DA 3SUZA 1AQCA 1UNRA 5DHFB 3BJIA 4ZRJA 2DHKA 1MPHA 3FEHA 2ADZA 1U5EA 2N0YA 3M1IB 2CODA 3PVUA 1DDVA 2M38A 4GXBA 3MDBC 3VOQA 4HB0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V88 A;  1RRP B;  1GG3 A;  4HAW B;  2CRF A;  2QKL A;  3GYP A;  5HE0 A;  4HAU B;  5DI9 B;  5EFX A;  5JP4 A;  5HE2 A;  1P6S A;  2J59 M;  2N23 A;  5DH9 B;  5JHH A;  3P7Z A;  4A6K A;  5GOW B;  2JP2 A;  2Z0O A;  2MKR A;  4A5K A;  2YRY A;  3ZDT A;  2P0D A;  4A6H A;  4WVF B;  1BTN A;  1UNQ A;  4NSW A;  4EMO A;  1ZSQ A;  1UNP A;  1X05 A;  2BCJ A;  3QWM A;  2AEH A;  3LJU X;  4IFS A;  2KGX B;  1V5P A;  5C5B A;  2L2I A;  2D11 A;  1ISN A;  4KHB B;  2R09 A;  4MK0 A;  5L81 A;  1J0W A;  3MPX A;  3A8P A;  2D10 A;  2M14 A;  2GJY A;  5CLL B;  2KUP A;  3CXB B;  4HAZ B;  2I5C A;  2ZPY A;  3HQC A;  1WJ1 A;  4HB3 B;  4DXA B;  4NY0 A;  4WSF A;  2L1C A;  2K2J A;  2COF A;  3PVW A;  1FHW A;  5JLJ B;  3G9W A;  2RUK B;  2RLO A;  4GZU A;  1XOD A;  1XX0 A;  2RNR B;  1SGH A;  4HAY B;  1FHO A;  1M7R A;  3T06 A;  1V89 A;  5FI1 A;  4TYZ A;  5D3Y A;  1FHX A;  2AL6 A;  5HE1 A;  4TKN A;  4P7I A;  2YF0 A;  1PLS A;  3AU5 A;  1X1F A;  5JHG A;  1ZC4 B;  1BWN A;  3U8Z A;  4XWX A;  2EC1 A;  1MKE A;  1ZVR A;  2I1J A;  3QBV B;  1V5U A;  5D27 A;  1DDM A;  4EJN A;  1QQG A;  1XCG A;  2YS3 A;  3F5R A;  2IFS A;  4F7H A;  2DA0 A;  2DKP A;  4ZRK A;  2MDX A;  1N3H A;  1RJ2 A;  1TXD A;  2D9W A;  4CHJ A;  3TW1 A;  1MAI A;  3RCP A;  2NZ8 B;  4PNK A;  1H4R A;  4F7G A;  3ODX A;  4K2P A;  2YSZ A;  1LB1 A;  3PVL A;  3KSY A;  2QKM A;  3TFM A;  1UEF A;  1NTY A;  2EMT A;  1DDW A;  2OTX A;  4DBB A;  1IRS A;  5J3Q A;  1P5T A;  4EKU A;  2Q13 A;  3FSS A;  2J0M A;  1MK9 B;  3KRX A;  3UZT A;  1EAZ A;  1K5D B;  4MY6 A;  1DBH A;  2LKO A;  4H8S A;  1EF1 A;  4KHO A;  1PMS A;  4C0A A;  2K2U A;  5CLQ B;  3FM8 C;  1U29 A;  2DFK A;  2KCJ A;  2P0H A;  3KY9 A;  3SNH A;  3DXE A;  4WJ7 A;  2I5F A;  2PZ1 A;  2EMS A;  4B6H A;  1ZC3 B;  2RVB B;  3O96 A;  1J19 A;  2DX5 A;  1FAO A;  2W2W A;  3P6A A;  1Y19 B;  1AWE A;  4K17 A;  3TCA A;  1GC7 A;  1P3R A;  5C6R A;  2Y8G A;  3PSC A;  1SHC A;  3DXC A;  2VRW B;  1U5G A;  4KAX B;  2K00 A;  3D8D A;  5HE3 A;  2DHJ A;  1TJ6 A;  2MFQ A;  4YON A;  2UZS A;  2UZR A;  1WGU A;  4IOY X;  3TO1 A;  3TVV A;  1DYN A;  1M7E A;  4A6F A;  3SV1 A;  1U27 A;  2OQB A;  2W2X C;  4DX8 A;  5J3T A;  2DX1 A;  4HAX B;  1OMW A;  3IVF A;  2D9X A;  3PG7 A;  3D8E A;  1K5G B;  5KQ1 A;  1X86 A;  1FGY A;  2LOZ A;  5J3Y A;  2P0F A;  2UVM A;  5KCV A;  1NU2 A;  1EGX A;  3A8Q A;  2H7E A;  2J0K A;  2Y7B A;  1TQZ A;  2NMB A;  4GMX B;  2CY5 A;  2D2Q A;  2D9Z A;  2P8V A;  1KZ7 A;  2HTH B;  1ZM0 A;  4GPT B;  4HAV B;  1NI2 A;  4HB2 B;  4GMV A;  1Q67 A;  3SO6 A;  2H7D A;  2CY4 A;  2YS5 A;  5FI0 A;  1X11 A;  3PP2 A;  2XQN M;  4GN1 A;  3KRW A;  3U7D A;  2ELB A;  1UPR A;  2YT1 A;  3WA0 A;  2ELA A;  1X1G A;  1NTV A;  1I7A A;  3V5W A;  1LW3 A;  5C16 A;  4D0N B;  2DHI A;  4A6F B;  3ODO A;  2DN6 A;  1FGZ A;  1U2B A;  3QIJ A;  1Y5O A;  2W2X D;  2D9V A;  4Z2M B;  1GC6 A;  1V61 A;  1KZG A;  3DXD A;  2LUL A;  1U5F A;  2FJL A;  2D4Q A;  1XD4 A;  2GCL A;  3PEG A;  3PZD A;  4DX9 0;  2GCJ A;  2COC A;  2DYN A;  2LYD A;  1MK7 B;  2RSG A;  1DRO A;  1U5D A;  1XR0 B;  4K81 A;  1H10 A;  4F7U P;  2G35 A;  1QC6 A;  3ZVR A;  4Z2N A;  2VKI A;  4HAT B;  3VIA A;  1WJM A;  2IYB A;  2ROZ B;  1BAK A;  1WGQ A;  3WYF B;  1WVH A;  2X18 A;  1FOE A;  4IAP A;  3HW2 B;  4PQ0 A;  4CHM A;  4BBK A;  2J0J A;  3AU4 A;  1OY2 A;  4KVG B;  3ULC A;  3BIN A;  2Z0P A;  4ZRI A;  3ULB A;  4HHV A;  2LG1 A;  4YL8 A;  3SYX A;  4MT7 A;  1W1G A;  1EVH A;  1PFJ A;  4L6E A;  3F0W A;  1E5W A;  5DHA B;  2YS1 A;  3ODW A;  5C79 A;  1MIZ B;  2DTC A;  2D9Y A;  1UPQ A;  2ROV A;  2V76 A;  2I1K A;  4HDO A;  3OAN A;  2RGN B;  4HB4 B;  2YT0 A;  5D3X A;  5DIF B;  3X23 A;  2HE7 A;  1BTK A;  4HDQ A;  3AJ4 A;  5D3V A;  3ML4 A;  3N7C A;  1W1D A;  3GYO A;  2VSZ A;  1V5M A;  2COA A;  2E2X A;  2MWN B;  2CAY A;  1FB8 A;  4CYE A;  1MIX A;  3CIK A;  1I2H A;  5LOP B;  2EJ8 A;  4Y94 A;  2DKQ A;  1W1H A;  2Z0Q A;  1WI1 A;  2DLW A;  1B55 A;  1KI1 B;  4KHA A;  3D8F A;  1XKE A;  4K2O A;  1OQN A;  2Y8F A;  3HK0 A;  2LOX A;  5KQ4 A;  3KZ1 A;  5LON B;  5C5B B;  1Z87 A;  2GS0 A;  3NSU A;  1WG7 A;  2DYQ A;  2YVC A;  5D3W A;  3A98 B;  2R0D A;  3SUZ A;  1AQC A;  1UNR A;  5DHF B;  3BJI A;  4ZRJ A;  2DHK A;  1MPH A;  3FEH A;  2ADZ A;  1U5E A;  2N0Y A;  3M1I B;  2COD A;  3PVU A;  1DDV A;  2M38 A;  4GXB A;  3MDB C;  3VOQ A;  4HB0 B; 
#chains in the Genus database with same CATH topology
 1V88 A;  1RRP B;  1GG3 A;  4HAW B;  3OHM B;  2CRF A;  2QKL A;  3GYP A;  5HE0 A;  4HAU B;  5DI9 B;  5EFX A;  5JP4 A;  5HE2 A;  1P6S A;  2J59 M;  2N23 A;  5DH9 B;  5JHH A;  3P7Z A;  4A6K A;  5GOW B;  2JP2 A;  2Z0O A;  2MKR A;  4A5K A;  2YRY A;  3ZDT A;  2P0D A;  4A6H A;  4WVF B;  1BTN A;  1UNQ A;  4NSW A;  4EMO A;  1ZSQ A;  2K8E A;  1UNP A;  1X05 A;  4CSQ A;  2BCJ A;  2NBV A;  3QWM A;  2AEH A;  2Z14 A;  4OT1 A;  3LJU X;  4IFS A;  2KGX B;  1V5P A;  5C5B A;  2L2I A;  2D11 A;  1ISN A;  4KHB B;  2R09 A;  4MK0 A;  5L81 A;  1J0W A;  3MPX A;  3A8P A;  5I2M A;  2D10 A;  2M14 A;  3NWD A;  2GJY A;  5CLL B;  2KUP A;  3CXB B;  4HAZ B;  2I5C A;  2ZPY A;  3HQC A;  1WJ1 A;  2ZKM X;  4HB3 B;  4DXA B;  4NY0 A;  4WSF A;  2L1C A;  2K2J A;  2COF A;  3PVW A;  1FHW A;  5JLJ B;  3G9W A;  2RUK B;  2RLO A;  4GZU A;  1XOD A;  1XX0 A;  2RNR B;  1SGH A;  4HAY B;  1FHO A;  1M7R A;  3T06 A;  1V89 A;  5FI1 A;  4TYZ A;  5D3Y A;  1FHX A;  2AL6 A;  5HE1 A;  4TKN A;  4P7I A;  2YF0 A;  1PLS A;  3AU5 A;  1X1F A;  5JHG A;  1ZC4 B;  1BWN A;  3U8Z A;  4XWX A;  2EC1 A;  1MKE A;  1ZVR A;  2I1J A;  3QBV B;  1V5U A;  5D27 A;  1DDM A;  4EJN A;  5IRS A;  1QQG A;  1XCG A;  2YS3 A;  3F5R A;  2IFS A;  4F7H A;  2DA0 A;  2DKP A;  4ZRK A;  2MDX A;  1N3H A;  1RJ2 A;  1TXD A;  2D9W A;  4CHJ A;  3TW1 A;  1MAI A;  2FJU B;  3RCP A;  2NZ8 B;  4DIX A;  4PNK A;  1H4R A;  2Z4D A;  3ODX A;  4F7G A;  4K2P A;  1MI1 A;  2YSZ A;  1LB1 A;  2RRF A;  3PVL A;  3NWA A;  3KSY A;  2QKM A;  3TFM A;  1UEF A;  1NTY A;  2EMT A;  1DDW A;  2OTX A;  4DBB A;  1IRS A;  5J3Q A;  1P5T A;  4EKU A;  2Q13 A;  3FSS A;  2J0M A;  1MK9 B;  3KRX A;  3UZT A;  1EAZ A;  1K5D B;  4MY6 A;  1DBH A;  2LKO A;  4H8S A;  1EF1 A;  4GNK B;  4KHO A;  1PMS A;  4C0A A;  4D6W A;  2K2U A;  5CLQ B;  2Z59 A;  3FM8 C;  1U29 A;  2DFK A;  2KR0 A;  2KCJ A;  2P0H A;  3KY9 A;  3SNH A;  3DXE A;  4WJ7 A;  2I5F A;  3A58 A;  2PZ1 A;  2EMS A;  4OSN A;  4B6H A;  1ZC3 B;  2RVB B;  3O96 A;  1J19 A;  4QJ3 B;  2DX5 A;  1FAO A;  2W2W A;  3P6A A;  1Y19 B;  1AWE A;  4K17 A;  3TCA A;  1GC7 A;  1P3R A;  5C6R A;  2Y8G A;  3PSC A;  1SHC A;  3DXC A;  2VRW B;  1U5G A;  4KAX B;  2K00 A;  3D8D A;  5HE3 A;  2DHJ A;  3B77 A;  1TJ6 A;  2MFQ A;  4YON A;  2UZS A;  2UZR A;  1WGU A;  4IOY X;  3TO1 A;  3TVV A;  1DYN A;  1M7E A;  2KIE A;  4A6F A;  3SV1 A;  1U27 A;  2OQB A;  2W2X C;  3DCX A;  4DX8 A;  5J3T A;  2DX1 A;  4HAX B;  1OMW A;  3IVF A;  2D9X A;  3PG7 A;  3D8E A;  1K5G B;  5KQ1 A;  1X86 A;  1FGY A;  1ZYI A;  2LOZ A;  5J3Y A;  2P0F A;  2UVM A;  5KCV A;  1NU2 A;  1EGX A;  1T77 A;  3A8Q A;  2H7E A;  5M4Y B;  2J0K A;  2Y7B A;  1TQZ A;  2NMB A;  4GMX B;  4QJ5 B;  2CY5 A;  4QXA B;  5LG4 B;  3U12 A;  2D2Q A;  2D9Z A;  2P8V A;  1KZ7 A;  2HTH B;  1ZM0 A;  4GPT B;  4HAV B;  1NI2 A;  4HB2 B;  4GMV A;  1Q67 A;  3SO6 A;  2H7D A;  2CY4 A;  2YS5 A;  5FI0 A;  1X11 A;  3PP2 A;  2XQN M;  4GN1 A;  3KRW A;  3U7D A;  2ELB A;  1UPR A;  2YT1 A;  3NW8 A;  3WA0 A;  2ELA A;  1X1G A;  1NTV A;  1I7A A;  3V5W A;  1LW3 A;  5C16 A;  4D0N B;  2DHI A;  3NWF A;  4A6F B;  3ODO A;  2DN6 A;  1FGZ A;  1U2B A;  3QIJ A;  1Y5O A;  2W2X D;  2D9V A;  5I2S A;  4Z2M B;  1GC6 A;  1V61 A;  1KZG A;  3DXD A;  2LUL A;  1U5F A;  2FJL A;  2D4Q A;  1XD4 A;  2GCL A;  3PEG A;  3PZD A;  4DX9 0;  2GCJ A;  2COC A;  2DYN A;  2LYD A;  1MK7 B;  2RSG A;  1DRO A;  1U5D A;  1XR0 B;  4K81 A;  1H10 A;  2KIG A;  4F7U P;  2G35 A;  4QJ4 B;  1QC6 A;  3ZVR A;  4Z2N A;  2VKI A;  4HAT B;  3VIA A;  1WJM A;  2IYB A;  2ROZ B;  3HIE A;  1BAK A;  1WGQ A;  3WYF B;  1WVH A;  2X18 A;  1FOE A;  4IAP A;  3HW2 B;  4PQ0 A;  4CHM A;  4BBK A;  2J0J A;  3AU4 A;  1OY2 A;  4KVG B;  3ULC A;  3BIN A;  2Z13 A;  2Z0P A;  4ZRI A;  3ULB A;  4HHV A;  2LG1 A;  4YL8 A;  3SYX A;  4MT7 A;  1W1G A;  1EVH A;  1PFJ A;  4L6E A;  3HSA A;  3F0W A;  1E5W A;  5DHA B;  2YS1 A;  3ODW A;  5C79 A;  1MIZ B;  2DTC A;  2D9Y A;  1UPQ A;  2ROV A;  2V76 A;  2YT2 A;  2I1K A;  4HDO A;  3OAN A;  2RGN B;  4HB4 B;  2YT0 A;  5D3X A;  5DIF B;  3X23 A;  2HE7 A;  1BTK A;  4HDQ A;  3AJ4 A;  2R2Y A;  5D3V A;  3ML4 A;  2GUM A;  3N7C A;  1W1D A;  3GYO A;  2VSZ A;  1V5M A;  4HSI A;  2COA A;  2E2X A;  2MWN B;  2KUQ A;  2CAY A;  1FB8 A;  4CYE A;  1MIX A;  3CIK A;  1I2H A;  5LOP B;  2EJ8 A;  4Y94 A;  2DKQ A;  1W1H A;  2Z0Q A;  1WI1 A;  2DLW A;  1B55 A;  1KI1 B;  4KHA A;  3D8F A;  1XKE A;  4K2O A;  1OQN A;  2Y8F A;  3HK0 A;  2LOX A;  3FVC A;  5KQ4 A;  3KZ1 A;  5LON B;  5C5B B;  1Z87 A;  2GS0 A;  3NSU A;  4KHB A;  1WG7 A;  2DYQ A;  2YVC A;  5D3W A;  3A98 B;  2R0D A;  3SUZ A;  1AQC A;  1UNR A;  5DHF B;  3BJI A;  2K49 A;  4ZRJ A;  4GOU A;  2DHK A;  1MPH A;  3FEH A;  2ADZ A;  1U5E A;  2N0Y A;  4L1R A;  3M1I B;  2COD A;  3PVU A;  1DDV A;  2M38 A;  4GXB A;  3MDB C;  3VOQ A;  4HB0 B; 
#chains in the Genus database with same CATH homology
 1V88 A;  1RRP B;  1GG3 A;  4HAW B;  2CRF A;  2QKL A;  3GYP A;  5HE0 A;  4HAU B;  5DI9 B;  5EFX A;  5JP4 A;  5HE2 A;  1P6S A;  2J59 M;  2N23 A;  5DH9 B;  5JHH A;  3P7Z A;  4A6K A;  5GOW B;  2JP2 A;  2Z0O A;  2MKR A;  4A5K A;  2YRY A;  3ZDT A;  2P0D A;  4A6H A;  4WVF B;  1BTN A;  1UNQ A;  4NSW A;  4EMO A;  1ZSQ A;  1UNP A;  1X05 A;  2BCJ A;  3QWM A;  2AEH A;  3LJU X;  4IFS A;  2KGX B;  1V5P A;  5C5B A;  2L2I A;  2D11 A;  1ISN A;  4KHB B;  2R09 A;  4MK0 A;  5L81 A;  1J0W A;  3MPX A;  3A8P A;  2D10 A;  2M14 A;  2GJY A;  5CLL B;  2KUP A;  3CXB B;  4HAZ B;  2I5C A;  2ZPY A;  3HQC A;  1WJ1 A;  4HB3 B;  4DXA B;  4NY0 A;  4WSF A;  2L1C A;  2K2J A;  2COF A;  3PVW A;  1FHW A;  5JLJ B;  3G9W A;  2RUK B;  2RLO A;  4GZU A;  1XOD A;  1XX0 A;  2RNR B;  1SGH A;  4HAY B;  1FHO A;  1M7R A;  3T06 A;  1V89 A;  5FI1 A;  4TYZ A;  5D3Y A;  1FHX A;  2AL6 A;  5HE1 A;  4TKN A;  4P7I A;  2YF0 A;  1PLS A;  3AU5 A;  1X1F A;  5JHG A;  1ZC4 B;  1BWN A;  3U8Z A;  4XWX A;  2EC1 A;  1MKE A;  1ZVR A;  2I1J A;  3QBV B;  1V5U A;  5D27 A;  1DDM A;  4EJN A;  1QQG A;  1XCG A;  2YS3 A;  3F5R A;  2IFS A;  4F7H A;  2DA0 A;  2DKP A;  4ZRK A;  2MDX A;  1N3H A;  1RJ2 A;  1TXD A;  2D9W A;  4CHJ A;  3TW1 A;  1MAI A;  3RCP A;  2NZ8 B;  4PNK A;  1H4R A;  4F7G A;  3ODX A;  4K2P A;  2YSZ A;  1LB1 A;  3PVL A;  3KSY A;  2QKM A;  3TFM A;  1UEF A;  1NTY A;  2EMT A;  1DDW A;  2OTX A;  4DBB A;  1IRS A;  5J3Q A;  1P5T A;  4EKU A;  2Q13 A;  3FSS A;  2J0M A;  1MK9 B;  3KRX A;  3UZT A;  1EAZ A;  1K5D B;  4MY6 A;  1DBH A;  2LKO A;  4H8S A;  1EF1 A;  4KHO A;  1PMS A;  4C0A A;  2K2U A;  5CLQ B;  3FM8 C;  1U29 A;  2DFK A;  2KCJ A;  2P0H A;  3KY9 A;  3SNH A;  3DXE A;  4WJ7 A;  2I5F A;  2PZ1 A;  2EMS A;  4B6H A;  1ZC3 B;  2RVB B;  3O96 A;  1J19 A;  2DX5 A;  1FAO A;  2W2W A;  3P6A A;  1Y19 B;  1AWE A;  4K17 A;  3TCA A;  1GC7 A;  1P3R A;  5C6R A;  2Y8G A;  3PSC A;  1SHC A;  3DXC A;  2VRW B;  1U5G A;  4KAX B;  2K00 A;  3D8D A;  5HE3 A;  2DHJ A;  1TJ6 A;  2MFQ A;  4YON A;  2UZS A;  2UZR A;  1WGU A;  4IOY X;  3TO1 A;  3TVV A;  1DYN A;  1M7E A;  4A6F A;  3SV1 A;  1U27 A;  2OQB A;  2W2X C;  4DX8 A;  5J3T A;  2DX1 A;  4HAX B;  1OMW A;  3IVF A;  2D9X A;  3PG7 A;  3D8E A;  1K5G B;  5KQ1 A;  1X86 A;  1FGY A;  2LOZ A;  5J3Y A;  2P0F A;  2UVM A;  5KCV A;  1NU2 A;  1EGX A;  3A8Q A;  2H7E A;  2J0K A;  2Y7B A;  1TQZ A;  2NMB A;  4GMX B;  2CY5 A;  2D2Q A;  2D9Z A;  2P8V A;  1KZ7 A;  2HTH B;  1ZM0 A;  4GPT B;  4HAV B;  1NI2 A;  4HB2 B;  4GMV A;  1Q67 A;  3SO6 A;  2H7D A;  2CY4 A;  2YS5 A;  5FI0 A;  1X11 A;  3PP2 A;  2XQN M;  4GN1 A;  3KRW A;  3U7D A;  2ELB A;  1UPR A;  2YT1 A;  3WA0 A;  2ELA A;  1X1G A;  1NTV A;  1I7A A;  3V5W A;  1LW3 A;  5C16 A;  4D0N B;  2DHI A;  4A6F B;  3ODO A;  2DN6 A;  1FGZ A;  1U2B A;  3QIJ A;  1Y5O A;  2W2X D;  2D9V A;  4Z2M B;  1GC6 A;  1V61 A;  1KZG A;  3DXD A;  2LUL A;  1U5F A;  2FJL A;  2D4Q A;  1XD4 A;  2GCL A;  3PEG A;  3PZD A;  4DX9 0;  2GCJ A;  2COC A;  2DYN A;  2LYD A;  1MK7 B;  2RSG A;  1DRO A;  1U5D A;  1XR0 B;  4K81 A;  1H10 A;  4F7U P;  2G35 A;  1QC6 A;  3ZVR A;  4Z2N A;  2VKI A;  4HAT B;  3VIA A;  1WJM A;  2IYB A;  2ROZ B;  1BAK A;  1WGQ A;  3WYF B;  1WVH A;  2X18 A;  1FOE A;  4IAP A;  3HW2 B;  4PQ0 A;  4CHM A;  4BBK A;  2J0J A;  3AU4 A;  1OY2 A;  4KVG B;  3ULC A;  3BIN A;  2Z0P A;  4ZRI A;  3ULB A;  4HHV A;  2LG1 A;  4YL8 A;  3SYX A;  4MT7 A;  1W1G A;  1EVH A;  1PFJ A;  4L6E A;  3F0W A;  1E5W A;  5DHA B;  2YS1 A;  3ODW A;  5C79 A;  1MIZ B;  2DTC A;  2D9Y A;  1UPQ A;  2ROV A;  2V76 A;  2I1K A;  4HDO A;  3OAN A;  2RGN B;  4HB4 B;  2YT0 A;  5D3X A;  5DIF B;  3X23 A;  2HE7 A;  1BTK A;  4HDQ A;  3AJ4 A;  5D3V A;  3ML4 A;  3N7C A;  1W1D A;  3GYO A;  2VSZ A;  1V5M A;  2COA A;  2E2X A;  2MWN B;  2CAY A;  1FB8 A;  4CYE A;  1MIX A;  3CIK A;  1I2H A;  5LOP B;  2EJ8 A;  4Y94 A;  2DKQ A;  1W1H A;  2Z0Q A;  1WI1 A;  2DLW A;  1B55 A;  1KI1 B;  4KHA A;  3D8F A;  1XKE A;  4K2O A;  1OQN A;  2Y8F A;  3HK0 A;  2LOX A;  5KQ4 A;  3KZ1 A;  5LON B;  5C5B B;  1Z87 A;  2GS0 A;  3NSU A;  1WG7 A;  2DYQ A;  2YVC A;  5D3W A;  3A98 B;  2R0D A;  3SUZ A;  1AQC A;  1UNR A;  5DHF B;  3BJI A;  4ZRJ A;  2DHK A;  1MPH A;  3FEH A;  2ADZ A;  1U5E A;  2N0Y A;  3M1I B;  2COD A;  3PVU A;  1DDV A;  2M38 A;  4GXB A;  3MDB C;  3VOQ A;  4HB0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...