4KAXB

Crystal structure of the grp1 ph domain in complex with arf6-gtp
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
143
structure length
143
Chain Sequence
GNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADP-ribosylation factor 6
publication title Structural basis for membrane recruitment and allosteric activation of cytohesin family Arf GTPase exchange factors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/signaling protein
total genus 36
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4kaxB00
3SUZA 1P3RA 1Q67A 2KGXB 5DH9B 1ZC4B 1WJ1A 2YS5A 4HAZB 3QWMA 2YT0A 4WVFB 3AU5A 1V88A 2CRFA 4HDOA 1LW3A 1MAIA 2FJLA 1LB1A 4F7GA 1DYNA 4HHVA 2LKOA 2H7EA 4TKNA 1U27A 2Y8GA 2YS1A 4ZRJA 1FOEA 2LULA 2YVCA 2RNRB 5DHFB 1FHWA 3ODWA 1BAKA 1X05A 3TFMA 5KQ4A 1UNPA 5KQ1A 2RSGA 2K2UA 4HB3B 1U5GA 3CXBB 1PLSA 2IFSA 3PEGA 4CHJA 3PVUA 2P0DA 4F7UP 3KSYA 2EJ8A 5DI9B 2J59M 2D9ZA 3X23A 5J3TA 2N23A 2ZPYA 2P8VA 4HAXB 4NSWA 4A6HA 1SGHA 2J0MA 1K5GB 3KRWA 1BTNA 4DX90 5D27A 2YT1A 1J19A 2VRWB 3ML4A 2RVBB 1DBHA 3P6AA 1WI1A 3PVWA 2CAYA 3KY9A 1QQGA 5HE3A 2DHKA 5EFXA 2DA0A 4F7HA 5D3XA 1M7RA 2COCA 1GC6A 4GMXB 4ZRIA 4K81A 3T06A 2W2WA 1Y5OA 2DYQA 4BBKA 5J3YA 3KRXA 3ZVRA 2CODA 3GYOA 1DROA 2JP2A 2COAA 4GMVA 5KCVA 3D8DA 3TCAA 3QBVB 2PZ1A 1MKEA 4Z2NA 4PQ0A 2EMTA 5JHGA 1U5FA 4GPTB 2ADZA 5D3YA 1ZSQA 1MPHA 4D0NB 4A6KA 3D8EA 2LYDA 1XR0B 2GCJA 4CYEA 1I2HA 3P7ZA 1DDWA 4HB2B 3KZ1A 1J0WA 2ROVA 2LOXA 2GS0A 2EC1A 1TJ6A 1FGZA 1UPQA 1RJ2A 1NTYA 1N3HA 1WJMA 4MY6A 4XWXA 3F5RA 4HAWB 3SNHA 2DX1A 2OQBA 3N7CA 1XODA 3OANA 1ISNA 3AJ4A 5HE2A 4KHBB 3ZDTA 4GZUA 1NI2A 2DYNA 2VKIA 2COFA 4IOYX 5C5BB 1QC6A 1RRPB 1P5TA 5JHHA 5GOWB 1W1GA 2RGNB 3ODXA 1U5DA 2GJYA 2UVMA 1MK9B 4HATB 2RLOA 1P6SA 1H4RA 1U5EA 4C0AA 3SV1A 1NU2A 5LONB 4Z2MB 2MFQA 1PMSA 5C6RA 3UZTA 3NSUA 2W2XD 1X11A 1FAOA 3BINA 5J3QA 4MK0A 2I5FA 5D3VA 3A8PA 3O96A 2D9VA 3FSSA 2N0YA 3FEHA 5C16A 5DIFB 4DXAB 1DDVA 2D11A 2YF0A 2K00A 3U7DA 3U8ZA 3FM8C 3PZDA 1GG3A 2R09A 1ZC3B 4A6FB 3A8QA 2DFKA 3CIKA 1V61A 1UPRA 1PFJA 5FI0A 4DX8A 2H7DA 2I1KA 2KCJA 1XCGA 1V5PA 1W1HA 2KUPA 5DHAB 1UEFA 2DKQA 1KZGA 2L1CA 1MIXA 2IYBA 2L2IA 3VOQA 2K2JA 2MWNB 2OTXA 3IVFA 3V5WA 4HAVB 1OMWA 1IRSA 3PSCA 4EMOA 3GYPA 3BJIA 5D3WA 2GCLA 4KHOA 2NMBA 2NZ8B 4WJ7A 2QKLA 1WG7A 4KVGB 2I1JA 2HTHB 4CHMA 4A5KA 2G35A 2AEHA 2J0KA 2D2QA 2P0FA 3TW1A 4EJNA 3PP2A 1XD4A 3MPXA 2MKRA 4EKUA 1GC7A 3RCPA 4K17A 1DDMA 2E2XA 4Y94A 2ELBA 1WVHA 2DKPA 2RUKB 5CLQB 1V5MA 1X86A 3DXDA 3TO1A 3PVLA 3DXCA 2DTCA 2D4QA 2J0JA 4A6FA 2BCJA 4YONA 4K2PA 1W1DA 2D9WA 4K2OA 2I5CA 1X1FA 1OY2A 3MDBC 1EVHA 3DXEA 1EF1A 1OQNA 2M14A 2DHJA 3WYFB 2ELAA 2YSZA 3D8FA 5FI1A 5HE0A 1K5DB 4GN1A 1WGUA 4NY0A 1U2BA 2Z0PA 4P7IA 1UNRA 2Z0QA 2DHIA 1MK7B 1NTVA 3VIAA 2DX5A 2XQNM 2Y7BA 4HB0B 2YRYA 3HK0A 4GXBA 1X1GA 1TXDA 2D9YA 5CLLB 5HE1A 4DBBA 2ROZB 2DLWA 2M38A 3PG7A 3AU4A 3F0WA 3HQCA 3ULBA 5JLJB 1AQCA 2UZSA 2LG1A 2EMSA 1AWEA 1I7AA 1Y19B 1KI1B 3SO6A 1KZ7A 1TQZA 1UNQA 5LOPB 2D10A 4KHAA 1BWNA 4WSFA 2QKMA 1U29A 4L6EA 3ODOA 1H10A 1ZVRA 2VSZA 2AL6A 4H8SA 1SHCA 2R0DA 4IFSA 1E5WA 4B6HA 1ZM0A 2Y8FA 1FHOA 2CY4A 5C5BA 4IAPA 2CY5A 1EGXA 3LJUX 1V5UA 4HDQA 4HB4B 1M7EA 5JP4A 3A98B 2YS3A 1EAZA 4HAUB 2W2XC 4ZRKA 2MDXA 3ULCA 3SYXA 2HE7A 1BTKA 2DN6A 2UZRA 1FGYA 4YL8A 1MIZB 1Z87A 1V89A 2P0HA 3M1IB 2Z0OA 4PNKA 1WGQA 4KAXB 4TYZA 5C79A 3G9WA 3WA0A 2D9XA 2LOZA 2V76A 1XX0A 3TVVA 1XKEA 4MT7A 3HW2B 4HAYB 3QIJA 1FB8A 1B55A 5L81A 2Q13A 2X18A 1FHXA
chains in the Genus database with same CATH superfamily
4OT1A 3SUZA 1P3RA 1Q67A 2KGXB 5DH9B 1ZC4B 1WJ1A 2K8EA 2YS5A 4HAZB 3QWMA 2YT0A 4WVFB 3AU5A 1V88A 2CRFA 4HDOA 1LW3A 1MAIA 2FJLA 1LB1A 4F7GA 1DYNA 4HHVA 2ZKMX 2LKOA 2H7EA 2RRFA 4TKNA 1U27A 2Y8GA 2YS1A 4ZRJA 1FOEA 2LULA 2YVCA 2RNRB 5DHFB 1FHWA 3ODWA 1BAKA 1X05A 5IRSA 3TFMA 5KQ4A 1UNPA 5KQ1A 2RSGA 2K2UA 4HB3B 1U5GA 3CXBB 1PLSA 2IFSA 3PEGA 4CHJA 3PVUA 2P0DA 4F7UP 3KSYA 2EJ8A 5DI9B 2J59M 2D9ZA 3X23A 5J3TA 2N23A 2ZPYA 2P8VA 2GUMA 4HAXB 4NSWA 4A6HA 1SGHA 2J0MA 5LG4B 1K5GB 3KRWA 1BTNA 4DX90 2Z14A 2YT1A 5D27A 1J19A 2VRWB 3ML4A 2RVBB 1DBHA 3P6AA 1WI1A 3PVWA 2CAYA 3KY9A 3FVCA 2YT2A 1QQGA 5HE3A 2DHKA 5EFXA 2DA0A 3NWFA 1ZYIA 5D3XA 4F7HA 1M7RA 2COCA 1GC6A 4GMXB 4ZRIA 4K81A 3T06A 2W2WA 1Y5OA 2DYQA 4BBKA 5J3YA 3KRXA 3ZVRA 2CODA 3GYOA 1DROA 2JP2A 2COAA 3U12A 4GMVA 5KCVA 3D8DA 3HSAA 3TCAA 3QBVB 2PZ1A 1MKEA 4Z2NA 4PQ0A 2EMTA 5JHGA 1U5FA 4GPTB 2ADZA 5D3YA 1ZSQA 1MPHA 4D0NB 4A6KA 3D8EA 2LYDA 1XR0B 2GCJA 4CYEA 1I2HA 3P7ZA 1DDWA 4HB2B 3KZ1A 1J0WA 2ROVA 3NWAA 2LOXA 2GS0A 2KIEA 2EC1A 1TJ6A 1FGZA 1UPQA 1RJ2A 1NTYA 1N3HA 1WJMA 4MY6A 4XWXA 3F5RA 4HAWB 3SNHA 2DX1A 2OQBA 3N7CA 2Z13A 1XODA 3OANA 1ISNA 3AJ4A 5HE2A 4KHBB 3ZDTA 4CSQA 4GZUA 1NI2A 2DYNA 2VKIA 4GNKB 3DCXA 2COFA 4IOYX 5C5BB 1QC6A 1RRPB 1P5TA 5JHHA 5GOWB 1W1GA 2RGNB 3ODXA 1U5DA 2GJYA 2UVMA 1MK9B 4HATB 2RLOA 4QJ4B 1P6SA 1H4RA 1U5EA 2FJUB 2KIGA 4C0AA 3SV1A 1NU2A 5LONB 1T77A 4Z2MB 2MFQA 1PMSA 5C6RA 3UZTA 3NSUA 2W2XD 1X11A 1FAOA 3BINA 5J3QA 2K49A 4MK0A 2I5FA 5D3VA 3A8PA 3O96A 2D9VA 3FSSA 2N0YA 3FEHA 5C16A 5DIFB 4DXAB 1DDVA 2D11A 2YF0A 2K00A 3U7DA 3U8ZA 3FM8C 3B77A 3PZDA 1GG3A 2R09A 1ZC3B 4A6FB 3A8QA 2DFKA 3CIKA 1V61A 3HIEA 4L1RA 1UPRA 1PFJA 5FI0A 4DX8A 5I2SA 4KHBA 4QXAB 2H7DA 2I1KA 2KCJA 1XCGA 1V5PA 1W1HA 2KUPA 5DHAB 1UEFA 2DKQA 1KZGA 2L1CA 2Z4DA 1MIXA 2IYBA 2L2IA 3VOQA 5I2MA 2K2JA 2MWNB 2OTXA 3IVFA 3V5WA 4HAVB 2NBVA 1OMWA 1IRSA 2KUQA 3PSCA 4EMOA 3GYPA 3BJIA 5D3WA 2Z59A 2GCLA 4KHOA 2NMBA 2NZ8B 4WJ7A 2QKLA 1WG7A 4GOUA 3NWDA 4KVGB 2I1JA 2HTHB 4CHMA 4A5KA 2G35A 2AEHA 2J0KA 2D2QA 2P0FA 3TW1A 4EJNA 3PP2A 1XD4A 3MPXA 2MKRA 4EKUA 1GC7A 3RCPA 4K17A 1DDMA 2E2XA 4Y94A 2ELBA 1WVHA 1MI1A 2DKPA 2RUKB 5CLQB 1V5MA 1X86A 3DXDA 3TO1A 4DIXA 3PVLA 3DXCA 2DTCA 2D4QA 2J0JA 4A6FA 2BCJA 4YONA 4K2PA 1W1DA 2D9WA 4K2OA 2I5CA 1X1FA 1OY2A 3MDBC 1EVHA 3DXEA 1EF1A 1OQNA 2M14A 2DHJA 3WYFB 2ELAA 2YSZA 3D8FA 3NW8A 5FI1A 5HE0A 1K5DB 4GN1A 1WGUA 4NY0A 1U2BA 2Z0PA 4P7IA 1UNRA 2Z0QA 2DHIA 1MK7B 1NTVA 3VIAA 4D6WA 2R2YA 2DX5A 2XQNM 2Y7BA 4HB0B 2YRYA 3HK0A 4GXBA 1X1GA 1TXDA 2D9YA 5CLLB 5HE1A 4DBBA 2ROZB 2DLWA 2M38A 3PG7A 3AU4A 3F0WA 3HQCA 3ULBA 5JLJB 1AQCA 2KR0A 2UZSA 2LG1A 2EMSA 1AWEA 1I7AA 1Y19B 1KI1B 3SO6A 1KZ7A 1TQZA 1UNQA 5LOPB 2D10A 4KHAA 1BWNA 4WSFA 2QKMA 1U29A 4L6EA 3ODOA 1H10A 1ZVRA 2VSZA 2AL6A 4H8SA 1SHCA 2R0DA 4QJ5B 4IFSA 1E5WA 4B6HA 1ZM0A 2Y8FA 4HSIA 1FHOA 2CY4A 3A58A 5C5BA 4IAPA 2CY5A 1EGXA 3LJUX 1V5UA 4HDQA 5M4YB 4HB4B 3OHMB 1M7EA 5JP4A 4OSNA 3A98B 2YS3A 1EAZA 4HAUB 2W2XC 4ZRKA 2MDXA 3ULCA 3SYXA 2HE7A 1BTKA 2DN6A 2UZRA 1FGYA 4YL8A 1MIZB 1Z87A 1V89A 2P0HA 4QJ3B 3M1IB 2Z0OA 4PNKA 1WGQA 4KAXB 4TYZA 5C79A 3G9WA 3WA0A 2D9XA 2LOZA 2V76A 1XX0A 3TVVA 1XKEA 4MT7A 3HW2B 4HAYB 3QIJA 1FB8A 1B55A 5L81A 2Q13A 2X18A 1FHXA
chains in the Genus database with same CATH topology
3SUZA 1P3RA 1Q67A 2KGXB 5DH9B 1ZC4B 1WJ1A 2YS5A 4HAZB 3QWMA 2YT0A 4WVFB 3AU5A 1V88A 2CRFA 4HDOA 1LW3A 1MAIA 2FJLA 1LB1A 4F7GA 1DYNA 4HHVA 2LKOA 2H7EA 4TKNA 1U27A 2Y8GA 2YS1A 4ZRJA 1FOEA 2LULA 2YVCA 2RNRB 5DHFB 1FHWA 3ODWA 1BAKA 1X05A 3TFMA 5KQ4A 1UNPA 5KQ1A 2RSGA 2K2UA 4HB3B 1U5GA 3CXBB 1PLSA 2IFSA 3PEGA 4CHJA 3PVUA 2P0DA 4F7UP 3KSYA 2EJ8A 5DI9B 2J59M 2D9ZA 3X23A 5J3TA 2N23A 2ZPYA 2P8VA 4HAXB 4NSWA 4A6HA 1SGHA 2J0MA 1K5GB 3KRWA 1BTNA 4DX90 5D27A 2YT1A 1J19A 2VRWB 3ML4A 2RVBB 1DBHA 3P6AA 1WI1A 3PVWA 2CAYA 3KY9A 1QQGA 5HE3A 2DHKA 5EFXA 2DA0A 4F7HA 5D3XA 1M7RA 2COCA 1GC6A 4GMXB 4ZRIA 4K81A 3T06A 2W2WA 1Y5OA 2DYQA 4BBKA 5J3YA 3KRXA 3ZVRA 2CODA 3GYOA 1DROA 2JP2A 2COAA 4GMVA 5KCVA 3D8DA 3TCAA 3QBVB 2PZ1A 1MKEA 4Z2NA 4PQ0A 2EMTA 5JHGA 1U5FA 4GPTB 2ADZA 5D3YA 1ZSQA 1MPHA 4D0NB 4A6KA 3D8EA 2LYDA 1XR0B 2GCJA 4CYEA 1I2HA 3P7ZA 1DDWA 4HB2B 3KZ1A 1J0WA 2ROVA 2LOXA 2GS0A 2EC1A 1TJ6A 1FGZA 1UPQA 1RJ2A 1NTYA 1N3HA 1WJMA 4MY6A 4XWXA 3F5RA 4HAWB 3SNHA 2DX1A 2OQBA 3N7CA 1XODA 3OANA 1ISNA 3AJ4A 5HE2A 4KHBB 3ZDTA 4GZUA 1NI2A 2DYNA 2VKIA 2COFA 4IOYX 5C5BB 1QC6A 1RRPB 1P5TA 5JHHA 5GOWB 1W1GA 2RGNB 3ODXA 1U5DA 2GJYA 2UVMA 1MK9B 4HATB 2RLOA 1P6SA 1H4RA 1U5EA 4C0AA 3SV1A 1NU2A 5LONB 4Z2MB 2MFQA 1PMSA 5C6RA 3UZTA 3NSUA 2W2XD 1X11A 1FAOA 3BINA 5J3QA 4MK0A 2I5FA 5D3VA 3A8PA 3O96A 2D9VA 3FSSA 2N0YA 3FEHA 5C16A 5DIFB 4DXAB 1DDVA 2D11A 2YF0A 2K00A 3U7DA 3U8ZA 3FM8C 3PZDA 1GG3A 2R09A 1ZC3B 4A6FB 3A8QA 2DFKA 3CIKA 1V61A 1UPRA 1PFJA 5FI0A 4DX8A 2H7DA 2I1KA 2KCJA 1XCGA 1V5PA 1W1HA 2KUPA 5DHAB 1UEFA 2DKQA 1KZGA 2L1CA 1MIXA 2IYBA 2L2IA 3VOQA 2K2JA 2MWNB 2OTXA 3IVFA 3V5WA 4HAVB 1OMWA 1IRSA 3PSCA 4EMOA 3GYPA 3BJIA 5D3WA 2GCLA 4KHOA 2NMBA 2NZ8B 4WJ7A 2QKLA 1WG7A 4KVGB 2I1JA 2HTHB 4CHMA 4A5KA 2G35A 2AEHA 2J0KA 2D2QA 2P0FA 3TW1A 4EJNA 3PP2A 1XD4A 3MPXA 2MKRA 4EKUA 1GC7A 3RCPA 4K17A 1DDMA 2E2XA 4Y94A 2ELBA 1WVHA 2DKPA 2RUKB 5CLQB 1V5MA 1X86A 3DXDA 3TO1A 3PVLA 3DXCA 2DTCA 2D4QA 2J0JA 4A6FA 2BCJA 4YONA 4K2PA 1W1DA 2D9WA 4K2OA 2I5CA 1X1FA 1OY2A 3MDBC 1EVHA 3DXEA 1EF1A 1OQNA 2M14A 2DHJA 3WYFB 2ELAA 2YSZA 3D8FA 5FI1A 5HE0A 1K5DB 4GN1A 1WGUA 4NY0A 1U2BA 2Z0PA 4P7IA 1UNRA 2Z0QA 2DHIA 1MK7B 1NTVA 3VIAA 2DX5A 2XQNM 2Y7BA 4HB0B 2YRYA 3HK0A 4GXBA 1X1GA 1TXDA 2D9YA 5CLLB 5HE1A 4DBBA 2ROZB 2DLWA 2M38A 3PG7A 3AU4A 3F0WA 3HQCA 3ULBA 5JLJB 1AQCA 2UZSA 2LG1A 2EMSA 1AWEA 1I7AA 1Y19B 1KI1B 3SO6A 1KZ7A 1TQZA 1UNQA 5LOPB 2D10A 4KHAA 1BWNA 4WSFA 2QKMA 1U29A 4L6EA 3ODOA 1H10A 1ZVRA 2VSZA 2AL6A 4H8SA 1SHCA 2R0DA 4IFSA 1E5WA 4B6HA 1ZM0A 2Y8FA 1FHOA 2CY4A 5C5BA 4IAPA 2CY5A 1EGXA 3LJUX 1V5UA 4HDQA 4HB4B 1M7EA 5JP4A 3A98B 2YS3A 1EAZA 4HAUB 2W2XC 4ZRKA 2MDXA 3ULCA 3SYXA 2HE7A 1BTKA 2DN6A 2UZRA 1FGYA 4YL8A 1MIZB 1Z87A 1V89A 2P0HA 3M1IB 2Z0OA 4PNKA 1WGQA 4KAXB 4TYZA 5C79A 3G9WA 3WA0A 2D9XA 2LOZA 2V76A 1XX0A 3TVVA 1XKEA 4MT7A 3HW2B 4HAYB 3QIJA 1FB8A 1B55A 5L81A 2Q13A 2X18A 1FHXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SUZ A;  1P3R A;  1Q67 A;  2KGX B;  5DH9 B;  1ZC4 B;  1WJ1 A;  2YS5 A;  4HAZ B;  3QWM A;  2YT0 A;  4WVF B;  3AU5 A;  1V88 A;  2CRF A;  4HDO A;  1LW3 A;  1MAI A;  2FJL A;  1LB1 A;  4F7G A;  1DYN A;  4HHV A;  2LKO A;  2H7E A;  4TKN A;  1U27 A;  2Y8G A;  2YS1 A;  4ZRJ A;  1FOE A;  2LUL A;  2YVC A;  2RNR B;  5DHF B;  1FHW A;  3ODW A;  1BAK A;  1X05 A;  3TFM A;  5KQ4 A;  1UNP A;  5KQ1 A;  2RSG A;  2K2U A;  4HB3 B;  1U5G A;  3CXB B;  1PLS A;  2IFS A;  3PEG A;  4CHJ A;  3PVU A;  2P0D A;  4F7U P;  3KSY A;  2EJ8 A;  5DI9 B;  2J59 M;  2D9Z A;  3X23 A;  5J3T A;  2N23 A;  2ZPY A;  2P8V A;  4HAX B;  4NSW A;  4A6H A;  1SGH A;  2J0M A;  1K5G B;  3KRW A;  1BTN A;  4DX9 0;  5D27 A;  2YT1 A;  1J19 A;  2VRW B;  3ML4 A;  2RVB B;  1DBH A;  3P6A A;  1WI1 A;  3PVW A;  2CAY A;  3KY9 A;  1QQG A;  5HE3 A;  2DHK A;  5EFX A;  2DA0 A;  4F7H A;  5D3X A;  1M7R A;  2COC A;  1GC6 A;  4GMX B;  4ZRI A;  4K81 A;  3T06 A;  2W2W A;  1Y5O A;  2DYQ A;  4BBK A;  5J3Y A;  3KRX A;  3ZVR A;  2COD A;  3GYO A;  1DRO A;  2JP2 A;  2COA A;  4GMV A;  5KCV A;  3D8D A;  3TCA A;  3QBV B;  2PZ1 A;  1MKE A;  4Z2N A;  4PQ0 A;  2EMT A;  5JHG A;  1U5F A;  4GPT B;  2ADZ A;  5D3Y A;  1ZSQ A;  1MPH A;  4D0N B;  4A6K A;  3D8E A;  2LYD A;  1XR0 B;  2GCJ A;  4CYE A;  1I2H A;  3P7Z A;  1DDW A;  4HB2 B;  3KZ1 A;  1J0W A;  2ROV A;  2LOX A;  2GS0 A;  2EC1 A;  1TJ6 A;  1FGZ A;  1UPQ A;  1RJ2 A;  1NTY A;  1N3H A;  1WJM A;  4MY6 A;  4XWX A;  3F5R A;  4HAW B;  3SNH A;  2DX1 A;  2OQB A;  3N7C A;  1XOD A;  3OAN A;  1ISN A;  3AJ4 A;  5HE2 A;  4KHB B;  3ZDT A;  4GZU A;  1NI2 A;  2DYN A;  2VKI A;  2COF A;  4IOY X;  5C5B B;  1QC6 A;  1RRP B;  1P5T A;  5JHH A;  5GOW B;  1W1G A;  2RGN B;  3ODX A;  1U5D A;  2GJY A;  2UVM A;  1MK9 B;  4HAT B;  2RLO A;  1P6S A;  1H4R A;  1U5E A;  4C0A A;  3SV1 A;  1NU2 A;  5LON B;  4Z2M B;  2MFQ A;  1PMS A;  5C6R A;  3UZT A;  3NSU A;  2W2X D;  1X11 A;  1FAO A;  3BIN A;  5J3Q A;  4MK0 A;  2I5F A;  5D3V A;  3A8P A;  3O96 A;  2D9V A;  3FSS A;  2N0Y A;  3FEH A;  5C16 A;  5DIF B;  4DXA B;  1DDV A;  2D11 A;  2YF0 A;  2K00 A;  3U7D A;  3U8Z A;  3FM8 C;  3PZD A;  1GG3 A;  2R09 A;  1ZC3 B;  4A6F B;  3A8Q A;  2DFK A;  3CIK A;  1V61 A;  1UPR A;  1PFJ A;  5FI0 A;  4DX8 A;  2H7D A;  2I1K A;  2KCJ A;  1XCG A;  1V5P A;  1W1H A;  2KUP A;  5DHA B;  1UEF A;  2DKQ A;  1KZG A;  2L1C A;  1MIX A;  2IYB A;  2L2I A;  3VOQ A;  2K2J A;  2MWN B;  2OTX A;  3IVF A;  3V5W A;  4HAV B;  1OMW A;  1IRS A;  3PSC A;  4EMO A;  3GYP A;  3BJI A;  5D3W A;  2GCL A;  4KHO A;  2NMB A;  2NZ8 B;  4WJ7 A;  2QKL A;  1WG7 A;  4KVG B;  2I1J A;  2HTH B;  4CHM A;  4A5K A;  2G35 A;  2AEH A;  2J0K A;  2D2Q A;  2P0F A;  3TW1 A;  4EJN A;  3PP2 A;  1XD4 A;  3MPX A;  2MKR A;  4EKU A;  1GC7 A;  3RCP A;  4K17 A;  1DDM A;  2E2X A;  4Y94 A;  2ELB A;  1WVH A;  2DKP A;  2RUK B;  5CLQ B;  1V5M A;  1X86 A;  3DXD A;  3TO1 A;  3PVL A;  3DXC A;  2DTC A;  2D4Q A;  2J0J A;  4A6F A;  2BCJ A;  4YON A;  4K2P A;  1W1D A;  2D9W A;  4K2O A;  2I5C A;  1X1F A;  1OY2 A;  3MDB C;  1EVH A;  3DXE A;  1EF1 A;  1OQN A;  2M14 A;  2DHJ A;  3WYF B;  2ELA A;  2YSZ A;  3D8F A;  5FI1 A;  5HE0 A;  1K5D B;  4GN1 A;  1WGU A;  4NY0 A;  1U2B A;  2Z0P A;  4P7I A;  1UNR A;  2Z0Q A;  2DHI A;  1MK7 B;  1NTV A;  3VIA A;  2DX5 A;  2XQN M;  2Y7B A;  4HB0 B;  2YRY A;  3HK0 A;  4GXB A;  1X1G A;  1TXD A;  2D9Y A;  5CLL B;  5HE1 A;  4DBB A;  2ROZ B;  2DLW A;  2M38 A;  3PG7 A;  3AU4 A;  3F0W A;  3HQC A;  3ULB A;  5JLJ B;  1AQC A;  2UZS A;  2LG1 A;  2EMS A;  1AWE A;  1I7A A;  1Y19 B;  1KI1 B;  3SO6 A;  1KZ7 A;  1TQZ A;  1UNQ A;  5LOP B;  2D10 A;  4KHA A;  1BWN A;  4WSF A;  2QKM A;  1U29 A;  4L6E A;  3ODO A;  1H10 A;  1ZVR A;  2VSZ A;  2AL6 A;  4H8S A;  1SHC A;  2R0D A;  4IFS A;  1E5W A;  4B6H A;  1ZM0 A;  2Y8F A;  1FHO A;  2CY4 A;  5C5B A;  4IAP A;  2CY5 A;  1EGX A;  3LJU X;  1V5U A;  4HDQ A;  4HB4 B;  1M7E A;  5JP4 A;  3A98 B;  2YS3 A;  1EAZ A;  4HAU B;  2W2X C;  4ZRK A;  2MDX A;  3ULC A;  3SYX A;  2HE7 A;  1BTK A;  2DN6 A;  2UZR A;  1FGY A;  4YL8 A;  1MIZ B;  1Z87 A;  1V89 A;  2P0H A;  3M1I B;  2Z0O A;  4PNK A;  1WGQ A;  4KAX B;  4TYZ A;  5C79 A;  3G9W A;  3WA0 A;  2D9X A;  2LOZ A;  2V76 A;  1XX0 A;  3TVV A;  1XKE A;  4MT7 A;  3HW2 B;  4HAY B;  3QIJ A;  1FB8 A;  1B55 A;  5L81 A;  2Q13 A;  2X18 A;  1FHX A; 
#chains in the Genus database with same CATH topology
 4OT1 A;  3SUZ A;  1P3R A;  1Q67 A;  2KGX B;  5DH9 B;  1ZC4 B;  1WJ1 A;  2K8E A;  2YS5 A;  4HAZ B;  3QWM A;  2YT0 A;  4WVF B;  3AU5 A;  1V88 A;  2CRF A;  4HDO A;  1LW3 A;  1MAI A;  2FJL A;  1LB1 A;  4F7G A;  1DYN A;  4HHV A;  2ZKM X;  2LKO A;  2H7E A;  2RRF A;  4TKN A;  1U27 A;  2Y8G A;  2YS1 A;  4ZRJ A;  1FOE A;  2LUL A;  2YVC A;  2RNR B;  5DHF B;  1FHW A;  3ODW A;  1BAK A;  1X05 A;  5IRS A;  3TFM A;  5KQ4 A;  1UNP A;  5KQ1 A;  2RSG A;  2K2U A;  4HB3 B;  1U5G A;  3CXB B;  1PLS A;  2IFS A;  3PEG A;  4CHJ A;  3PVU A;  2P0D A;  4F7U P;  3KSY A;  2EJ8 A;  5DI9 B;  2J59 M;  2D9Z A;  3X23 A;  5J3T A;  2N23 A;  2ZPY A;  2P8V A;  2GUM A;  4HAX B;  4NSW A;  4A6H A;  1SGH A;  2J0M A;  5LG4 B;  1K5G B;  3KRW A;  1BTN A;  4DX9 0;  2Z14 A;  2YT1 A;  5D27 A;  1J19 A;  2VRW B;  3ML4 A;  2RVB B;  1DBH A;  3P6A A;  1WI1 A;  3PVW A;  2CAY A;  3KY9 A;  3FVC A;  2YT2 A;  1QQG A;  5HE3 A;  2DHK A;  5EFX A;  2DA0 A;  3NWF A;  1ZYI A;  5D3X A;  4F7H A;  1M7R A;  2COC A;  1GC6 A;  4GMX B;  4ZRI A;  4K81 A;  3T06 A;  2W2W A;  1Y5O A;  2DYQ A;  4BBK A;  5J3Y A;  3KRX A;  3ZVR A;  2COD A;  3GYO A;  1DRO A;  2JP2 A;  2COA A;  3U12 A;  4GMV A;  5KCV A;  3D8D A;  3HSA A;  3TCA A;  3QBV B;  2PZ1 A;  1MKE A;  4Z2N A;  4PQ0 A;  2EMT A;  5JHG A;  1U5F A;  4GPT B;  2ADZ A;  5D3Y A;  1ZSQ A;  1MPH A;  4D0N B;  4A6K A;  3D8E A;  2LYD A;  1XR0 B;  2GCJ A;  4CYE A;  1I2H A;  3P7Z A;  1DDW A;  4HB2 B;  3KZ1 A;  1J0W A;  2ROV A;  3NWA A;  2LOX A;  2GS0 A;  2KIE A;  2EC1 A;  1TJ6 A;  1FGZ A;  1UPQ A;  1RJ2 A;  1NTY A;  1N3H A;  1WJM A;  4MY6 A;  4XWX A;  3F5R A;  4HAW B;  3SNH A;  2DX1 A;  2OQB A;  3N7C A;  2Z13 A;  1XOD A;  3OAN A;  1ISN A;  3AJ4 A;  5HE2 A;  4KHB B;  3ZDT A;  4CSQ A;  4GZU A;  1NI2 A;  2DYN A;  2VKI A;  4GNK B;  3DCX A;  2COF A;  4IOY X;  5C5B B;  1QC6 A;  1RRP B;  1P5T A;  5JHH A;  5GOW B;  1W1G A;  2RGN B;  3ODX A;  1U5D A;  2GJY A;  2UVM A;  1MK9 B;  4HAT B;  2RLO A;  4QJ4 B;  1P6S A;  1H4R A;  1U5E A;  2FJU B;  2KIG A;  4C0A A;  3SV1 A;  1NU2 A;  5LON B;  1T77 A;  4Z2M B;  2MFQ A;  1PMS A;  5C6R A;  3UZT A;  3NSU A;  2W2X D;  1X11 A;  1FAO A;  3BIN A;  5J3Q A;  2K49 A;  4MK0 A;  2I5F A;  5D3V A;  3A8P A;  3O96 A;  2D9V A;  3FSS A;  2N0Y A;  3FEH A;  5C16 A;  5DIF B;  4DXA B;  1DDV A;  2D11 A;  2YF0 A;  2K00 A;  3U7D A;  3U8Z A;  3FM8 C;  3B77 A;  3PZD A;  1GG3 A;  2R09 A;  1ZC3 B;  4A6F B;  3A8Q A;  2DFK A;  3CIK A;  1V61 A;  3HIE A;  4L1R A;  1UPR A;  1PFJ A;  5FI0 A;  4DX8 A;  5I2S A;  4KHB A;  4QXA B;  2H7D A;  2I1K A;  2KCJ A;  1XCG A;  1V5P A;  1W1H A;  2KUP A;  5DHA B;  1UEF A;  2DKQ A;  1KZG A;  2L1C A;  2Z4D A;  1MIX A;  2IYB A;  2L2I A;  3VOQ A;  5I2M A;  2K2J A;  2MWN B;  2OTX A;  3IVF A;  3V5W A;  4HAV B;  2NBV A;  1OMW A;  1IRS A;  2KUQ A;  3PSC A;  4EMO A;  3GYP A;  3BJI A;  5D3W A;  2Z59 A;  2GCL A;  4KHO A;  2NMB A;  2NZ8 B;  4WJ7 A;  2QKL A;  1WG7 A;  4GOU A;  3NWD A;  4KVG B;  2I1J A;  2HTH B;  4CHM A;  4A5K A;  2G35 A;  2AEH A;  2J0K A;  2D2Q A;  2P0F A;  3TW1 A;  4EJN A;  3PP2 A;  1XD4 A;  3MPX A;  2MKR A;  4EKU A;  1GC7 A;  3RCP A;  4K17 A;  1DDM A;  2E2X A;  4Y94 A;  2ELB A;  1WVH A;  1MI1 A;  2DKP A;  2RUK B;  5CLQ B;  1V5M A;  1X86 A;  3DXD A;  3TO1 A;  4DIX A;  3PVL A;  3DXC A;  2DTC A;  2D4Q A;  2J0J A;  4A6F A;  2BCJ A;  4YON A;  4K2P A;  1W1D A;  2D9W A;  4K2O A;  2I5C A;  1X1F A;  1OY2 A;  3MDB C;  1EVH A;  3DXE A;  1EF1 A;  1OQN A;  2M14 A;  2DHJ A;  3WYF B;  2ELA A;  2YSZ A;  3D8F A;  3NW8 A;  5FI1 A;  5HE0 A;  1K5D B;  4GN1 A;  1WGU A;  4NY0 A;  1U2B A;  2Z0P A;  4P7I A;  1UNR A;  2Z0Q A;  2DHI A;  1MK7 B;  1NTV A;  3VIA A;  4D6W A;  2R2Y A;  2DX5 A;  2XQN M;  2Y7B A;  4HB0 B;  2YRY A;  3HK0 A;  4GXB A;  1X1G A;  1TXD A;  2D9Y A;  5CLL B;  5HE1 A;  4DBB A;  2ROZ B;  2DLW A;  2M38 A;  3PG7 A;  3AU4 A;  3F0W A;  3HQC A;  3ULB A;  5JLJ B;  1AQC A;  2KR0 A;  2UZS A;  2LG1 A;  2EMS A;  1AWE A;  1I7A A;  1Y19 B;  1KI1 B;  3SO6 A;  1KZ7 A;  1TQZ A;  1UNQ A;  5LOP B;  2D10 A;  4KHA A;  1BWN A;  4WSF A;  2QKM A;  1U29 A;  4L6E A;  3ODO A;  1H10 A;  1ZVR A;  2VSZ A;  2AL6 A;  4H8S A;  1SHC A;  2R0D A;  4QJ5 B;  4IFS A;  1E5W A;  4B6H A;  1ZM0 A;  2Y8F A;  4HSI A;  1FHO A;  2CY4 A;  3A58 A;  5C5B A;  4IAP A;  2CY5 A;  1EGX A;  3LJU X;  1V5U A;  4HDQ A;  5M4Y B;  4HB4 B;  3OHM B;  1M7E A;  5JP4 A;  4OSN A;  3A98 B;  2YS3 A;  1EAZ A;  4HAU B;  2W2X C;  4ZRK A;  2MDX A;  3ULC A;  3SYX A;  2HE7 A;  1BTK A;  2DN6 A;  2UZR A;  1FGY A;  4YL8 A;  1MIZ B;  1Z87 A;  1V89 A;  2P0H A;  4QJ3 B;  3M1I B;  2Z0O A;  4PNK A;  1WGQ A;  4KAX B;  4TYZ A;  5C79 A;  3G9W A;  3WA0 A;  2D9X A;  2LOZ A;  2V76 A;  1XX0 A;  3TVV A;  1XKE A;  4MT7 A;  3HW2 B;  4HAY B;  3QIJ A;  1FB8 A;  1B55 A;  5L81 A;  2Q13 A;  2X18 A;  1FHX A; 
#chains in the Genus database with same CATH homology
 3SUZ A;  1P3R A;  1Q67 A;  2KGX B;  5DH9 B;  1ZC4 B;  1WJ1 A;  2YS5 A;  4HAZ B;  3QWM A;  2YT0 A;  4WVF B;  3AU5 A;  1V88 A;  2CRF A;  4HDO A;  1LW3 A;  1MAI A;  2FJL A;  1LB1 A;  4F7G A;  1DYN A;  4HHV A;  2LKO A;  2H7E A;  4TKN A;  1U27 A;  2Y8G A;  2YS1 A;  4ZRJ A;  1FOE A;  2LUL A;  2YVC A;  2RNR B;  5DHF B;  1FHW A;  3ODW A;  1BAK A;  1X05 A;  3TFM A;  5KQ4 A;  1UNP A;  5KQ1 A;  2RSG A;  2K2U A;  4HB3 B;  1U5G A;  3CXB B;  1PLS A;  2IFS A;  3PEG A;  4CHJ A;  3PVU A;  2P0D A;  4F7U P;  3KSY A;  2EJ8 A;  5DI9 B;  2J59 M;  2D9Z A;  3X23 A;  5J3T A;  2N23 A;  2ZPY A;  2P8V A;  4HAX B;  4NSW A;  4A6H A;  1SGH A;  2J0M A;  1K5G B;  3KRW A;  1BTN A;  4DX9 0;  5D27 A;  2YT1 A;  1J19 A;  2VRW B;  3ML4 A;  2RVB B;  1DBH A;  3P6A A;  1WI1 A;  3PVW A;  2CAY A;  3KY9 A;  1QQG A;  5HE3 A;  2DHK A;  5EFX A;  2DA0 A;  4F7H A;  5D3X A;  1M7R A;  2COC A;  1GC6 A;  4GMX B;  4ZRI A;  4K81 A;  3T06 A;  2W2W A;  1Y5O A;  2DYQ A;  4BBK A;  5J3Y A;  3KRX A;  3ZVR A;  2COD A;  3GYO A;  1DRO A;  2JP2 A;  2COA A;  4GMV A;  5KCV A;  3D8D A;  3TCA A;  3QBV B;  2PZ1 A;  1MKE A;  4Z2N A;  4PQ0 A;  2EMT A;  5JHG A;  1U5F A;  4GPT B;  2ADZ A;  5D3Y A;  1ZSQ A;  1MPH A;  4D0N B;  4A6K A;  3D8E A;  2LYD A;  1XR0 B;  2GCJ A;  4CYE A;  1I2H A;  3P7Z A;  1DDW A;  4HB2 B;  3KZ1 A;  1J0W A;  2ROV A;  2LOX A;  2GS0 A;  2EC1 A;  1TJ6 A;  1FGZ A;  1UPQ A;  1RJ2 A;  1NTY A;  1N3H A;  1WJM A;  4MY6 A;  4XWX A;  3F5R A;  4HAW B;  3SNH A;  2DX1 A;  2OQB A;  3N7C A;  1XOD A;  3OAN A;  1ISN A;  3AJ4 A;  5HE2 A;  4KHB B;  3ZDT A;  4GZU A;  1NI2 A;  2DYN A;  2VKI A;  2COF A;  4IOY X;  5C5B B;  1QC6 A;  1RRP B;  1P5T A;  5JHH A;  5GOW B;  1W1G A;  2RGN B;  3ODX A;  1U5D A;  2GJY A;  2UVM A;  1MK9 B;  4HAT B;  2RLO A;  1P6S A;  1H4R A;  1U5E A;  4C0A A;  3SV1 A;  1NU2 A;  5LON B;  4Z2M B;  2MFQ A;  1PMS A;  5C6R A;  3UZT A;  3NSU A;  2W2X D;  1X11 A;  1FAO A;  3BIN A;  5J3Q A;  4MK0 A;  2I5F A;  5D3V A;  3A8P A;  3O96 A;  2D9V A;  3FSS A;  2N0Y A;  3FEH A;  5C16 A;  5DIF B;  4DXA B;  1DDV A;  2D11 A;  2YF0 A;  2K00 A;  3U7D A;  3U8Z A;  3FM8 C;  3PZD A;  1GG3 A;  2R09 A;  1ZC3 B;  4A6F B;  3A8Q A;  2DFK A;  3CIK A;  1V61 A;  1UPR A;  1PFJ A;  5FI0 A;  4DX8 A;  2H7D A;  2I1K A;  2KCJ A;  1XCG A;  1V5P A;  1W1H A;  2KUP A;  5DHA B;  1UEF A;  2DKQ A;  1KZG A;  2L1C A;  1MIX A;  2IYB A;  2L2I A;  3VOQ A;  2K2J A;  2MWN B;  2OTX A;  3IVF A;  3V5W A;  4HAV B;  1OMW A;  1IRS A;  3PSC A;  4EMO A;  3GYP A;  3BJI A;  5D3W A;  2GCL A;  4KHO A;  2NMB A;  2NZ8 B;  4WJ7 A;  2QKL A;  1WG7 A;  4KVG B;  2I1J A;  2HTH B;  4CHM A;  4A5K A;  2G35 A;  2AEH A;  2J0K A;  2D2Q A;  2P0F A;  3TW1 A;  4EJN A;  3PP2 A;  1XD4 A;  3MPX A;  2MKR A;  4EKU A;  1GC7 A;  3RCP A;  4K17 A;  1DDM A;  2E2X A;  4Y94 A;  2ELB A;  1WVH A;  2DKP A;  2RUK B;  5CLQ B;  1V5M A;  1X86 A;  3DXD A;  3TO1 A;  3PVL A;  3DXC A;  2DTC A;  2D4Q A;  2J0J A;  4A6F A;  2BCJ A;  4YON A;  4K2P A;  1W1D A;  2D9W A;  4K2O A;  2I5C A;  1X1F A;  1OY2 A;  3MDB C;  1EVH A;  3DXE A;  1EF1 A;  1OQN A;  2M14 A;  2DHJ A;  3WYF B;  2ELA A;  2YSZ A;  3D8F A;  5FI1 A;  5HE0 A;  1K5D B;  4GN1 A;  1WGU A;  4NY0 A;  1U2B A;  2Z0P A;  4P7I A;  1UNR A;  2Z0Q A;  2DHI A;  1MK7 B;  1NTV A;  3VIA A;  2DX5 A;  2XQN M;  2Y7B A;  4HB0 B;  2YRY A;  3HK0 A;  4GXB A;  1X1G A;  1TXD A;  2D9Y A;  5CLL B;  5HE1 A;  4DBB A;  2ROZ B;  2DLW A;  2M38 A;  3PG7 A;  3AU4 A;  3F0W A;  3HQC A;  3ULB A;  5JLJ B;  1AQC A;  2UZS A;  2LG1 A;  2EMS A;  1AWE A;  1I7A A;  1Y19 B;  1KI1 B;  3SO6 A;  1KZ7 A;  1TQZ A;  1UNQ A;  5LOP B;  2D10 A;  4KHA A;  1BWN A;  4WSF A;  2QKM A;  1U29 A;  4L6E A;  3ODO A;  1H10 A;  1ZVR A;  2VSZ A;  2AL6 A;  4H8S A;  1SHC A;  2R0D A;  4IFS A;  1E5W A;  4B6H A;  1ZM0 A;  2Y8F A;  1FHO A;  2CY4 A;  5C5B A;  4IAP A;  2CY5 A;  1EGX A;  3LJU X;  1V5U A;  4HDQ A;  4HB4 B;  1M7E A;  5JP4 A;  3A98 B;  2YS3 A;  1EAZ A;  4HAU B;  2W2X C;  4ZRK A;  2MDX A;  3ULC A;  3SYX A;  2HE7 A;  1BTK A;  2DN6 A;  2UZR A;  1FGY A;  4YL8 A;  1MIZ B;  1Z87 A;  1V89 A;  2P0H A;  3M1I B;  2Z0O A;  4PNK A;  1WGQ A;  4KAX B;  4TYZ A;  5C79 A;  3G9W A;  3WA0 A;  2D9X A;  2LOZ A;  2V76 A;  1XX0 A;  3TVV A;  1XKE A;  4MT7 A;  3HW2 B;  4HAY B;  3QIJ A;  1FB8 A;  1B55 A;  5L81 A;  2Q13 A;  2X18 A;  1FHX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...