2Z13A

Crystal structure of the n-terminal duf1126 in human ef-hand domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
122
structure length
117
Chain Sequence
SGWVAFDKQVLSFDAYLEEEVLDKSQTNYRIRYYKIYFYPEDDTIQVNEPELLQGTSIRRHRITLPPPDEDQFYTVYHFNVGTEVVFYGRTFKIYDCDAFTRNFLRKMGVKVNPPVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EF-hand domain-containing family member C2
publication title Crystal structure of the N-terminal DUF1126 in human EF-hand domain
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 23
structure length 117
sequence length 122
ec nomenclature
pdb deposition date 2007-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.170 Mainly Beta Roll PH-domain like PH-domain like 2z13A00
2Z14A 2Z13A
chains in the Genus database with same CATH superfamily
4HAWB 3U7DA 1V5MA 1MKEA 1H4RA 2KR0A 5D3VA 2ZKMX 4GZUA 3QWMA 3KY9A 2EC1A 5DIFB 3U12A 4QJ5B 4HDQA 2DFKA 1FHXA 2YS5A 4WSFA 3O96A 2RSGA 1NU2A 2N0YA 5C5BB 1TXDA 3ZDTA 3AU5A 4BBKA 2H7DA 2P0FA 1W1HA 2Y8GA 3PVWA 5C16A 2GS0A 2YRYA 3P6AA 2N23A 1KI1B 3FSSA 2Z59A 2D4QA 1EGXA 1P3RA 1ISNA 4F7UP 3DXDA 4EMOA 2ELAA 3OANA 1WVHA 3QIJA 5EFXA 5C5BA 3F0WA 3FVCA 2VSZA 2NMBA 1I2HA 2HTHB 1V89A 2J0JA 1M7RA 2MKRA 4F7GA 2G35A 5JHGA 3RCPA 4L6EA 5C79A 1TQZA 2P0DA 1M7EA 3G9WA 1FB8A 2COAA 4KHAA 4HDOA 2R09A 5FI0A 4HSIA 1TJ6A 2LYDA 1XCGA 2D10A 2DKQA 1LB1A 3IVFA 3T06A 1UNPA 1EAZA 2IYBA 2NZ8B 3PZDA 2W2WA 1B55A 1XD4A 1MK7B 5CLQB 2P0HA 2J59M 2MDXA 4MT7A 3SNHA 1DROA 2DX1A 2MFQA 5JLJB 2ROZB 1FGYA 4K81A 2LG1A 3OHMB 4Z2NA 4A6HA 1MIZB 2J0MA 4IOYX 4CHJA 1V5UA 4GN1A 2K49A 1OMWA 2YSZA 2E2XA 3TFMA 2KUQA 1UPQA 2ZPYA 2K2JA 2RLOA 4YONA 2KIEA 5KQ4A 1BAKA 1IRSA 4GXBA 5LG4B 1WGQA 3PP2A 2NBVA 2RUKB 1NTYA 3WA0A 3MPXA 4A6FB 4HB4B 2R2YA 3ODOA 2BCJA 2UVMA 1U27A 2ADZA 3ULCA 2DYQA 1X1FA 2GCLA 2EMTA 4H8SA 2UZRA 1DDMA 4D0NB 3BJIA 2M38A 2Z0OA 1J0WA 3KRWA 4A5KA 1WJMA 4NSWA 5D27A 4GOUA 4WJ7A 4A6FA 1ZC4B 5LONB 2I1KA 1AWEA 1U5GA 1PMSA 2YF0A 2KUPA 3A8QA 5L81A 2I5FA 2DHKA 2PZ1A 4IFSA 4K2OA 4CSQA 4QJ3B 3N7CA 4CHMA 1LW3A 1FAOA 2GCJA 4EKUA 2D2QA 2YT1A 1X86A 3D8FA 1DDVA 5KCVA 2YT2A 1I7AA 2QKMA 1W1GA 4XWXA 4EJNA 4PNKA 1UNRA 4QJ4B 3CXBB 2LOZA 3DXEA 1ZVRA 1XX0A 3UZTA 5D3XA 2DN6A 2EMSA 1DDWA 1N3HA 3TVVA 1AQCA 1MAIA 2R0DA 4IAPA 3MDBC 2ELBA 2D9VA 2KGXB 5DHAB 3U8ZA 2CY5A 2YT0A 4HB2B 4F7HA 3A8PA 5J3QA 1K5DB 1BTKA 3HK0A 1H10A 1KZ7A 3PG7A 4D6WA 4TYZA 3A98B 3SUZA 1GG3A 2CRFA 5HE3A 4DBBA 2RRFA 3VIAA 3F5RA 4HB0B 3KZ1A 4OSNA 1K5GB 2COFA 4TKNA 4L1RA 4K17A 3D8DA 3NWFA 2DLWA 4WVFB 5J3YA 3PVUA 1PLSA 4ZRJA 1V61A 3NWAA 1UNQA 4HATB 2CY4A 2D9WA 1WJ1A 2Y8FA 5D3YA 2OQBA 3HQCA 2I1JA 1EVHA 5CLLB 4QXAB 2RNRB 3TO1A 4GPTB 1FHWA 4B6HA 1U5DA 2EJ8A 2Y7BA 2LOXA 3FEHA 4MY6A 1XR0B 4C0AA 5HE1A 3SO6A 2K2UA 1MK9B 5IRSA 1Z87A 1ZC3B 1UEFA 2D11A 1UPRA 1MPHA 5DH9B 4DIXA 4DX8A 2Z0QA 2H7EA 5HE0A 1P6SA 3WYFB 3AU4A 4KHOA 3B77A 4MK0A 3TCAA 5I2MA 3ODXA 1RJ2A 3KSYA 3SYXA 1XKEA 2L2IA 5I2SA 2YS1A 4Y94A 1QC6A 1RRPB 2HE7A 3ZVRA 3DCXA 5FI1A 2XQNM 2DX5A 3GYOA 4Z2MB 3GYPA 4K2PA 3NSUA 3PVLA 1FGZA 1T77A 3M1IB 2YVCA 1ZM0A 2RVBB 2Z0PA 2Z4DA 2D9ZA 1Q67A 3A58A 3HIEA 5GOWB 3FM8C 3D8EA 4HAVB 2MWNB 5D3WA 2W2XC 2DA0A 2J0KA 3NWDA 4PQ0A 1V5PA 2DYNA 1XODA 5LOPB 1U2BA 2W2XD 2P8VA 4HAUB 1WGUA 3BINA 3HW2B 4GNKB 4HHVA 3PSCA 2DHIA 2Q13A 2LULA 3AJ4A 4OT1A 3PEGA 4DXAB 1OY2A 3ULBA 1SGHA 4KHBB 4KAXB 1E5WA 1MIXA 3QBVB 1MI1A 3ODWA 4CYEA 1BWNA 4KVGB 2DKPA 2OTXA 3VOQA 3X23A 3NW8A 1FOEA 2ROVA 1U29A 1GC7A 3V5WA 4DX90 2KIGA 2GJYA 2V76A 4GMXB 4YL8A 2LKOA 1W1DA 3ML4A 4GMVA 1EF1A 1ZYIA 4P7IA 1U5EA 4ZRIA 5HE2A 2D9YA 4KHBA 3SV1A 5DHFB 5KQ1A 1GC6A 1PFJA 2Z14A 2DHJA 2QKLA 1KZGA 1NI2A 1X05A 4HAXB 2FJUB 4HAYB 1DYNA 3P7ZA 2GUMA 3CIKA 1P5TA 1SHCA 1DBHA 2VKIA 2K00A 1U5FA 5DI9B 2AL6A 3TW1A 1X11A 2I5CA 5JHHA 2CAYA 2RGNB 3HSAA 4ZRKA 1X1GA 1BTNA 1QQGA 1J19A 2M14A 1NTVA 2Z13A 5C6RA 5JP4A 3DXCA 1WI1A 4NY0A 2DTCA 1ZSQA 2L1CA 2K8EA 2COCA 1FHOA 3KRXA 1V88A 1Y5OA 5J3TA 4A6KA 1OQNA 2D9XA 1WG7A 2JP2A 2VRWB 2X18A 4HB3B 2FJLA 3LJUX 4HAZB 1Y19B 2CODA 2IFSA 5M4YB 2KCJA 2AEHA 2YS3A 2UZSA
chains in the Genus database with same CATH topology
3FVCA 2K49A 4D6WA 2KUQA 2Z13A 3NWDA 4IFSA 4PQ0A 2KR0A 2Z14A 2ZKMX 4CSQA 4QJ3B 4DIXA 2KIEA 4QXAB 2K8EA 3TO1A 2FJUB 3TVVA 3GYOA 3NW8A 2RRFA 3FSSA 2GCJA 2Z59A 3GYPA 4Z2MB 4QJ5B 3U12A 5LG4B 4GNKB 2GUMA 4OSNA 2NBVA 4KHOA 4KHAA 2YT2A 4L1RA 2KIGA 4OT1A 4GOUA 2R2YA 3NWFA 5I2SA 4HSIA 5I2MA 4QJ4B 3OHMB 3TW1A 4Z2NA 1ZYIA 2Z4DA 4KHBB 2GCLA 3A58A 3HIEA 4IOYX 5M4YB 5IRSA 3NWAA 4KHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z14 A;  2Z13 A; 
#chains in the Genus database with same CATH topology
 4HAW B;  3U7D A;  1V5M A;  1MKE A;  1H4R A;  2KR0 A;  5D3V A;  2ZKM X;  4GZU A;  3QWM A;  3KY9 A;  2EC1 A;  5DIF B;  3U12 A;  4QJ5 B;  4HDQ A;  2DFK A;  1FHX A;  2YS5 A;  4WSF A;  3O96 A;  2RSG A;  1NU2 A;  2N0Y A;  5C5B B;  1TXD A;  3ZDT A;  3AU5 A;  4BBK A;  2H7D A;  2P0F A;  1W1H A;  2Y8G A;  3PVW A;  5C16 A;  2GS0 A;  2YRY A;  3P6A A;  2N23 A;  1KI1 B;  3FSS A;  2Z59 A;  2D4Q A;  1EGX A;  1P3R A;  1ISN A;  4F7U P;  3DXD A;  4EMO A;  2ELA A;  3OAN A;  1WVH A;  3QIJ A;  5EFX A;  5C5B A;  3F0W A;  3FVC A;  2VSZ A;  2NMB A;  1I2H A;  2HTH B;  1V89 A;  2J0J A;  1M7R A;  2MKR A;  4F7G A;  2G35 A;  5JHG A;  3RCP A;  4L6E A;  5C79 A;  1TQZ A;  2P0D A;  1M7E A;  3G9W A;  1FB8 A;  2COA A;  4KHA A;  4HDO A;  2R09 A;  5FI0 A;  4HSI A;  1TJ6 A;  2LYD A;  1XCG A;  2D10 A;  2DKQ A;  1LB1 A;  3IVF A;  3T06 A;  1UNP A;  1EAZ A;  2IYB A;  2NZ8 B;  3PZD A;  2W2W A;  1B55 A;  1XD4 A;  1MK7 B;  5CLQ B;  2P0H A;  2J59 M;  2MDX A;  4MT7 A;  3SNH A;  1DRO A;  2DX1 A;  2MFQ A;  5JLJ B;  2ROZ B;  1FGY A;  4K81 A;  2LG1 A;  3OHM B;  4Z2N A;  4A6H A;  1MIZ B;  2J0M A;  4IOY X;  4CHJ A;  1V5U A;  4GN1 A;  2K49 A;  1OMW A;  2YSZ A;  2E2X A;  3TFM A;  2KUQ A;  1UPQ A;  2ZPY A;  2K2J A;  2RLO A;  4YON A;  2KIE A;  5KQ4 A;  1BAK A;  1IRS A;  4GXB A;  5LG4 B;  1WGQ A;  3PP2 A;  2NBV A;  2RUK B;  1NTY A;  3WA0 A;  3MPX A;  4A6F B;  4HB4 B;  2R2Y A;  3ODO A;  2BCJ A;  2UVM A;  1U27 A;  2ADZ A;  3ULC A;  2DYQ A;  1X1F A;  2GCL A;  2EMT A;  4H8S A;  2UZR A;  1DDM A;  4D0N B;  3BJI A;  2M38 A;  2Z0O A;  1J0W A;  3KRW A;  4A5K A;  1WJM A;  4NSW A;  5D27 A;  4GOU A;  4WJ7 A;  4A6F A;  1ZC4 B;  5LON B;  2I1K A;  1AWE A;  1U5G A;  1PMS A;  2YF0 A;  2KUP A;  3A8Q A;  5L81 A;  2I5F A;  2DHK A;  2PZ1 A;  4IFS A;  4K2O A;  4CSQ A;  4QJ3 B;  3N7C A;  4CHM A;  1LW3 A;  1FAO A;  2GCJ A;  4EKU A;  2D2Q A;  2YT1 A;  1X86 A;  3D8F A;  1DDV A;  5KCV A;  2YT2 A;  1I7A A;  2QKM A;  1W1G A;  4XWX A;  4EJN A;  4PNK A;  1UNR A;  4QJ4 B;  3CXB B;  2LOZ A;  3DXE A;  1ZVR A;  1XX0 A;  3UZT A;  5D3X A;  2DN6 A;  2EMS A;  1DDW A;  1N3H A;  3TVV A;  1AQC A;  1MAI A;  2R0D A;  4IAP A;  3MDB C;  2ELB A;  2D9V A;  2KGX B;  5DHA B;  3U8Z A;  2CY5 A;  2YT0 A;  4HB2 B;  4F7H A;  3A8P A;  5J3Q A;  1K5D B;  1BTK A;  3HK0 A;  1H10 A;  1KZ7 A;  3PG7 A;  4D6W A;  4TYZ A;  3A98 B;  3SUZ A;  1GG3 A;  2CRF A;  5HE3 A;  4DBB A;  2RRF A;  3VIA A;  3F5R A;  4HB0 B;  3KZ1 A;  4OSN A;  1K5G B;  2COF A;  4TKN A;  4L1R A;  4K17 A;  3D8D A;  3NWF A;  2DLW A;  4WVF B;  5J3Y A;  3PVU A;  1PLS A;  4ZRJ A;  1V61 A;  3NWA A;  1UNQ A;  4HAT B;  2CY4 A;  2D9W A;  1WJ1 A;  2Y8F A;  5D3Y A;  2OQB A;  3HQC A;  2I1J A;  1EVH A;  5CLL B;  4QXA B;  2RNR B;  3TO1 A;  4GPT B;  1FHW A;  4B6H A;  1U5D A;  2EJ8 A;  2Y7B A;  2LOX A;  3FEH A;  4MY6 A;  1XR0 B;  4C0A A;  5HE1 A;  3SO6 A;  2K2U A;  1MK9 B;  5IRS A;  1Z87 A;  1ZC3 B;  1UEF A;  2D11 A;  1UPR A;  1MPH A;  5DH9 B;  4DIX A;  4DX8 A;  2Z0Q A;  2H7E A;  5HE0 A;  1P6S A;  3WYF B;  3AU4 A;  4KHO A;  3B77 A;  4MK0 A;  3TCA A;  5I2M A;  3ODX A;  1RJ2 A;  3KSY A;  3SYX A;  1XKE A;  2L2I A;  5I2S A;  2YS1 A;  4Y94 A;  1QC6 A;  1RRP B;  2HE7 A;  3ZVR A;  3DCX A;  5FI1 A;  2XQN M;  2DX5 A;  3GYO A;  4Z2M B;  3GYP A;  4K2P A;  3NSU A;  3PVL A;  1FGZ A;  1T77 A;  3M1I B;  2YVC A;  1ZM0 A;  2RVB B;  2Z0P A;  2Z4D A;  2D9Z A;  1Q67 A;  3A58 A;  3HIE A;  5GOW B;  3FM8 C;  3D8E A;  4HAV B;  2MWN B;  5D3W A;  2W2X C;  2DA0 A;  2J0K A;  3NWD A;  4PQ0 A;  1V5P A;  2DYN A;  1XOD A;  5LOP B;  1U2B A;  2W2X D;  2P8V A;  4HAU B;  1WGU A;  3BIN A;  3HW2 B;  4GNK B;  4HHV A;  3PSC A;  2DHI A;  2Q13 A;  2LUL A;  3AJ4 A;  4OT1 A;  3PEG A;  4DXA B;  1OY2 A;  3ULB A;  1SGH A;  4KHB B;  4KAX B;  1E5W A;  1MIX A;  3QBV B;  1MI1 A;  3ODW A;  4CYE A;  1BWN A;  4KVG B;  2DKP A;  2OTX A;  3VOQ A;  3X23 A;  3NW8 A;  1FOE A;  2ROV A;  1U29 A;  1GC7 A;  3V5W A;  4DX9 0;  2KIG A;  2GJY A;  2V76 A;  4GMX B;  4YL8 A;  2LKO A;  1W1D A;  3ML4 A;  4GMV A;  1EF1 A;  1ZYI A;  4P7I A;  1U5E A;  4ZRI A;  5HE2 A;  2D9Y A;  4KHB A;  3SV1 A;  5DHF B;  5KQ1 A;  1GC6 A;  1PFJ A;  2Z14 A;  2DHJ A;  2QKL A;  1KZG A;  1NI2 A;  1X05 A;  4HAX B;  2FJU B;  4HAY B;  1DYN A;  3P7Z A;  2GUM A;  3CIK A;  1P5T A;  1SHC A;  1DBH A;  2VKI A;  2K00 A;  1U5F A;  5DI9 B;  2AL6 A;  3TW1 A;  1X11 A;  2I5C A;  5JHH A;  2CAY A;  2RGN B;  3HSA A;  4ZRK A;  1X1G A;  1BTN A;  1QQG A;  1J19 A;  2M14 A;  1NTV A;  2Z13 A;  5C6R A;  5JP4 A;  3DXC A;  1WI1 A;  4NY0 A;  2DTC A;  1ZSQ A;  2L1C A;  2K8E A;  2COC A;  1FHO A;  3KRX A;  1V88 A;  1Y5O A;  5J3T A;  4A6K A;  1OQN A;  2D9X A;  1WG7 A;  2JP2 A;  2VRW B;  2X18 A;  4HB3 B;  2FJL A;  3LJU X;  4HAZ B;  1Y19 B;  2COD A;  2IFS A;  5M4Y B;  2KCJ A;  2AEH A;  2YS3 A;  2UZS A; 
#chains in the Genus database with same CATH homology
 3FVC A;  2K49 A;  4D6W A;  2KUQ A;  2Z13 A;  3NWD A;  4IFS A;  4PQ0 A;  2KR0 A;  2Z14 A;  2ZKM X;  4CSQ A;  4QJ3 B;  4DIX A;  2KIE A;  4QXA B;  2K8E A;  3TO1 A;  2FJU B;  3TVV A;  3GYO A;  3NW8 A;  2RRF A;  3FSS A;  2GCJ A;  2Z59 A;  3GYP A;  4Z2M B;  4QJ5 B;  3U12 A;  5LG4 B;  4GNK B;  2GUM A;  4OSN A;  2NBV A;  4KHO A;  4KHA A;  2YT2 A;  4L1R A;  2KIG A;  4OT1 A;  4GOU A;  2R2Y A;  3NWF A;  5I2S A;  4HSI A;  5I2M A;  4QJ4 B;  3OHM B;  3TW1 A;  4Z2N A;  1ZYI A;  2Z4D A;  4KHB B;  2GCL A;  3A58 A;  3HIE A;  4IOY X;  5M4Y B;  5IRS A;  3NWA A;  4KHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...