2Z13A

Crystal structure of the n-terminal duf1126 in human ef-hand domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
122
structure length
117
Chain Sequence
SGWVAFDKQVLSFDAYLEEEVLDKSQTNYRIRYYKIYFYPEDDTIQVNEPELLQGTSIRRHRITLPPPDEDQFYTVYHFNVGTEVVFYGRTFKIYDCDAFTRNFLRKMGVKVNPPVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords EF-hand domain-containing family member C2
publication title Crystal structure of the N-terminal DUF1126 in human EF-hand domain
rcsb
source organism Homo sapiens
total genus 23
structure length 117
sequence length 122
ec nomenclature
pdb deposition date 2007-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.170 Mainly Beta Roll PH-domain like PH-domain like 2z13A00
2Z13A 2Z14A
chains in the Genus database with same CATH superfamily
2UVMA 2KIEA 4HSIA 4F7UP 2DKQA 2H7EA 4WVFB 2JP2A 2P0HA 5J3YA 2Z14A 3KZ1A 5DH9B 4OSNA 3MDBC 4HDQA 5FI0A 3HQCA 2XQNM 1PMSA 3F5RA 5D27A 3ML4A 3PVUA 3HW2B 4EKUA 3CXBB 3CIKA 4GMVA 2DX1A 2K00A 3NSUA 2N23A 5HE3A 5HE2A 3DXEA 2YS1A 3DXCA 2ADZA 4KVGB 2DHJA 2DTCA 4KAXB 2CY5A 2D9ZA 3OANA 5C79A 5C5BA 2NBVA 1WVHA 2YT1A 2YF0A 5C16A 2QKMA 2J0MA 2I1KA 2KCJA 2M14A 3KSYA 2UZSA 3KY9A 1SGHA 4PNKA 2COCA 2G35A 1NI2A 2VSZA 3HK0A 2CRFA 4NSWA 2Z0PA 1Z87A 4A5KA 3DCXA 2L1CA 3MPXA 2M38A 1QQGA 4YONA 1WJMA 4TYZA 4CHJA 5HE0A 2KR0A 1I2HA 2EC1A 2RGNB 5KCVA 2NZ8B 1EVHA 1MI1A 1DROA 1EF1A 2ELAA 2LULA 4KHBA 2H7DA 4MY6A 1WJ1A 3GYOA 1X1FA 2VKIA 1H4RA 2LOZA 4QJ3B 2X18A 4PQ0A 3DXDA 5HE1A 3RCPA 2LG1A 1RJ2A 4A6KA 2Z59A 1ZC3B 1X86A 4CSQA 3PVWA 4MT7A 2HTHB 5C5BB 5D3WA 2D2QA 3ZVRA 2RUKB 1XR0B 3O96A 1XX0A 2K2UA 3A98B 2I1JA 3QBVB 2AEHA 3SV1A 4TKNA 4DX90 1Q67A 1SHCA 3PSCA 1XCGA 4DBBA 4DX8A 2YT2A 1BTKA 4QJ4B 5J3QA 1ZSQA 2GS0A 5D3VA 1T77A 3G9WA 4HAVB 3D8FA 4ZRKA 3OHMB 2AL6A 2DKPA 5EFXA 3ULCA 4KHBB 3QWMA 2GJYA 3HSAA 3P6AA 4HB0B 2D10A 1PFJA 1EAZA 4HB4B 4HAWB 2PZ1A 4HAYB 2J0JA 2COAA 3TCAA 2R09A 4IOYX 5FI1A 2KGXB 1DDWA 3SYXA 4CHMA 1V5UA 1MK9B 1MIXA 5CLQB 1KZ7A 1W1DA 4DXAB 1W1GA 1GC7A 4EJNA 2LKOA 3P7ZA 1FHXA 2RLOA 2J59M 5GOWB 2W2XC 1MIZB 1V5PA 4L6EA 4HDOA 1NTVA 2MDXA 5LONB 5DHFB 2YRYA 2Z13A 2EMSA 3NWAA 3FM8C 2Z4DA 3ODXA 2GCJA 1UPQA 2IFSA 2D11A 4WSFA 2Z0OA 5JP4A 2RSGA 4A6HA 2CAYA 2Z0QA 5DI9B 1NU2A 1U2BA 2GUMA 3A58A 1UPRA 5CLLB 5JHGA 4IFSA 3TO1A 1OQNA 2W2XD 4A6FA 4HAUB 5D3YA 2Y7BA 1V89A 1FGZA 4OT1A 1GG3A 3B77A 3SNHA 4DIXA 1UNRA 2KIGA 4B6HA 2FJUB 2FJLA 1LW3A 1TJ6A 4D0NB 1ZM0A 2L2IA 2I5CA 3NWFA 1OMWA 4HATB 1ZYIA 1TQZA 2KUQA 2CODA 4P7IA 3TVVA 1LB1A 3VIAA 4Z2NA 2RVBB 4ZRJA 2DN6A 5L81A 2DX5A 1U27A 3V5WA 4H8SA 2E2XA 2NMBA 4HHVA 1XODA 1J0WA 1DBHA 2D9XA 4L1RA 2DLWA 1W1HA 1E5WA 3FSSA 2UZRA 4K2OA 1U5DA 2EMTA 2K2JA 1IRSA 2DA0A 1U5EA 1U5FA 2D9VA 1WG7A 3UZTA 2COFA 3A8QA 2DHKA 5JHHA 1I7AA 2R2YA 2YVCA 1UNQA 4A6FB 2ZPYA 1QC6A 4GOUA 2MFQA 1V88A 2ROVA 4KHAA 1J19A 3T06A 5I2SA 3ULBA 1ISNA 3D8DA 2VRWB 3QIJA 2RNRB 4EMOA 4ZRIA 4HB2B 4K17A 2R0DA 2GCLA 3FEHA 3SUZA 4QXAB 1ZC4B 3PG7A 2YSZA 1DDMA 4GMXB 1MPHA 3TW1A 1XKEA 2LOXA 2DYQA 5LOPB 2I5FA 2J0KA 3U12A 1Y19B 4Z2MB 4MK0A 1TXDA 3ODWA 5KQ1A 1KZGA 2W2WA 3ZDTA 4F7GA 2D9YA 1P5TA 1V5MA 1PLSA 2HE7A 2ELBA 2YT0A 4K2PA 1FB8A 4GXBA 4HAXB 2OQBA 1UNPA 3D8EA 4C0AA 4HAZB 2EJ8A 5KQ4A 5LG4B 2Y8FA 4F7HA 4QJ5B 1ZVRA 2P0DA 1GC6A 5JLJB 1WGUA 1BWNA 2RRFA 5M4YB 1K5GB 2MWNB 1BTNA 3PP2A 2K8EA 3AU5A 3HIEA 3TFMA 2D9WA 1K5DB 1U29A 1X1GA 1V61A 2V76A 2CY4A 1DDVA 5IRSA 1EGXA 1WGQA 3GYPA 1AQCA 2D4QA 1FGYA 1FHOA 3KRWA 2KUPA 5DIFB 1H10A 1M7EA 3AU4A 2N0YA 1X05A 2DFKA 4K81A 5DHAB 2ROZB 2DHIA 2IYBA 1KI1B 1P3RA 2P8VA 3PVLA 3BJIA 3M1IB 1BAKA 4IAPA 2MKRA 2P0FA 3AJ4A 1P6SA 1B55A 2BCJA 3WYFB 3SO6A 3U7DA 4YL8A 1RRPB 3U8ZA 3KRXA 2LYDA 3NW8A 1WI1A 3F0WA 1Y5OA 1U5GA 4GNKB 2ZKMX 4Y94A 1UEFA 3FVCA 5I2MA 4GPTB 3X23A 4XWXA 5D3XA 3PEGA 3WA0A 2YS5A 2Q13A 3NWDA 4NY0A 2Y8GA 4HB3B 5C6RA 1MKEA 4WJ7A 4GN1A 5J3TA 1M7RA 1DYNA 3N7CA 1XD4A 3BINA 1FOEA 1MK7B 1OY2A 3ODOA 3IVFA 2K49A 2OTXA 4CYEA 4KHOA 1MAIA 1X11A 3A8PA 4BBKA 1FHWA 1FAOA 2YS3A 1AWEA 1N3HA 2QKLA 4D6WA 2DYNA 3LJUX 3VOQA 3PZDA 1NTYA 4GZUA
chains in the Genus database with same CATH topology
3OHMB 3NWFA 2KIEA 3FSSA 4KHBA 4HSIA 3A58A 2GUMA 5IRSA 3GYPA 2GCLA 1ZYIA 3NW8A 5LG4B 2KUQA 3GYOA 4KHBB 4QJ5B 4GNKB 2Z14A 4IFSA 2ZKMX 4QXAB 3TO1A 4QJ3B 3TVVA 4OSNA 2R2YA 4PQ0A 2K49A 3FVCA 3TW1A 4Z2NA 4KHOA 5I2MA 2RRFA 2Z13A 4OT1A 5M4YB 3NWAA 2YT2A 3NWDA 4DIXA 2K8EA 2Z4DA 2KIGA 3HIEA 2Z59A 2GCJA 4GOUA 4IOYX 4D6WA 2FJUB 4KHAA 4CSQA 4QJ4B 3U12A 2KR0A 5I2SA 4L1RA 2NBVA 4Z2MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z13 A;  2Z14 A; 
#chains in the Genus database with same CATH topology
 2UVM A;  2KIE A;  4HSI A;  4F7U P;  2DKQ A;  2H7E A;  4WVF B;  2JP2 A;  2P0H A;  5J3Y A;  2Z14 A;  3KZ1 A;  5DH9 B;  4OSN A;  3MDB C;  4HDQ A;  5FI0 A;  3HQC A;  2XQN M;  1PMS A;  3F5R A;  5D27 A;  3ML4 A;  3PVU A;  3HW2 B;  4EKU A;  3CXB B;  3CIK A;  4GMV A;  2DX1 A;  2K00 A;  3NSU A;  2N23 A;  5HE3 A;  5HE2 A;  3DXE A;  2YS1 A;  3DXC A;  2ADZ A;  4KVG B;  2DHJ A;  2DTC A;  4KAX B;  2CY5 A;  2D9Z A;  3OAN A;  5C79 A;  5C5B A;  2NBV A;  1WVH A;  2YT1 A;  2YF0 A;  5C16 A;  2QKM A;  2J0M A;  2I1K A;  2KCJ A;  2M14 A;  3KSY A;  2UZS A;  3KY9 A;  1SGH A;  4PNK A;  2COC A;  2G35 A;  1NI2 A;  2VSZ A;  3HK0 A;  2CRF A;  4NSW A;  2Z0P A;  1Z87 A;  4A5K A;  3DCX A;  2L1C A;  3MPX A;  2M38 A;  1QQG A;  4YON A;  1WJM A;  4TYZ A;  4CHJ A;  5HE0 A;  2KR0 A;  1I2H A;  2EC1 A;  2RGN B;  5KCV A;  2NZ8 B;  1EVH A;  1MI1 A;  1DRO A;  1EF1 A;  2ELA A;  2LUL A;  4KHB A;  2H7D A;  4MY6 A;  1WJ1 A;  3GYO A;  1X1F A;  2VKI A;  1H4R A;  2LOZ A;  4QJ3 B;  2X18 A;  4PQ0 A;  3DXD A;  5HE1 A;  3RCP A;  2LG1 A;  1RJ2 A;  4A6K A;  2Z59 A;  1ZC3 B;  1X86 A;  4CSQ A;  3PVW A;  4MT7 A;  2HTH B;  5C5B B;  5D3W A;  2D2Q A;  3ZVR A;  2RUK B;  1XR0 B;  3O96 A;  1XX0 A;  2K2U A;  3A98 B;  2I1J A;  3QBV B;  2AEH A;  3SV1 A;  4TKN A;  4DX9 0;  1Q67 A;  1SHC A;  3PSC A;  1XCG A;  4DBB A;  4DX8 A;  2YT2 A;  1BTK A;  4QJ4 B;  5J3Q A;  1ZSQ A;  2GS0 A;  5D3V A;  1T77 A;  3G9W A;  4HAV B;  3D8F A;  4ZRK A;  3OHM B;  2AL6 A;  2DKP A;  5EFX A;  3ULC A;  4KHB B;  3QWM A;  2GJY A;  3HSA A;  3P6A A;  4HB0 B;  2D10 A;  1PFJ A;  1EAZ A;  4HB4 B;  4HAW B;  2PZ1 A;  4HAY B;  2J0J A;  2COA A;  3TCA A;  2R09 A;  4IOY X;  5FI1 A;  2KGX B;  1DDW A;  3SYX A;  4CHM A;  1V5U A;  1MK9 B;  1MIX A;  5CLQ B;  1KZ7 A;  1W1D A;  4DXA B;  1W1G A;  1GC7 A;  4EJN A;  2LKO A;  3P7Z A;  1FHX A;  2RLO A;  2J59 M;  5GOW B;  2W2X C;  1MIZ B;  1V5P A;  4L6E A;  4HDO A;  1NTV A;  2MDX A;  5LON B;  5DHF B;  2YRY A;  2Z13 A;  2EMS A;  3NWA A;  3FM8 C;  2Z4D A;  3ODX A;  2GCJ A;  1UPQ A;  2IFS A;  2D11 A;  4WSF A;  2Z0O A;  5JP4 A;  2RSG A;  4A6H A;  2CAY A;  2Z0Q A;  5DI9 B;  1NU2 A;  1U2B A;  2GUM A;  3A58 A;  1UPR A;  5CLL B;  5JHG A;  4IFS A;  3TO1 A;  1OQN A;  2W2X D;  4A6F A;  4HAU B;  5D3Y A;  2Y7B A;  1V89 A;  1FGZ A;  4OT1 A;  1GG3 A;  3B77 A;  3SNH A;  4DIX A;  1UNR A;  2KIG A;  4B6H A;  2FJU B;  2FJL A;  1LW3 A;  1TJ6 A;  4D0N B;  1ZM0 A;  2L2I A;  2I5C A;  3NWF A;  1OMW A;  4HAT B;  1ZYI A;  1TQZ A;  2KUQ A;  2COD A;  4P7I A;  3TVV A;  1LB1 A;  3VIA A;  4Z2N A;  2RVB B;  4ZRJ A;  2DN6 A;  5L81 A;  2DX5 A;  1U27 A;  3V5W A;  4H8S A;  2E2X A;  2NMB A;  4HHV A;  1XOD A;  1J0W A;  1DBH A;  2D9X A;  4L1R A;  2DLW A;  1W1H A;  1E5W A;  3FSS A;  2UZR A;  4K2O A;  1U5D A;  2EMT A;  2K2J A;  1IRS A;  2DA0 A;  1U5E A;  1U5F A;  2D9V A;  1WG7 A;  3UZT A;  2COF A;  3A8Q A;  2DHK A;  5JHH A;  1I7A A;  2R2Y A;  2YVC A;  1UNQ A;  4A6F B;  2ZPY A;  1QC6 A;  4GOU A;  2MFQ A;  1V88 A;  2ROV A;  4KHA A;  1J19 A;  3T06 A;  5I2S A;  3ULB A;  1ISN A;  3D8D A;  2VRW B;  3QIJ A;  2RNR B;  4EMO A;  4ZRI A;  4HB2 B;  4K17 A;  2R0D A;  2GCL A;  3FEH A;  3SUZ A;  4QXA B;  1ZC4 B;  3PG7 A;  2YSZ A;  1DDM A;  4GMX B;  1MPH A;  3TW1 A;  1XKE A;  2LOX A;  2DYQ A;  5LOP B;  2I5F A;  2J0K A;  3U12 A;  1Y19 B;  4Z2M B;  4MK0 A;  1TXD A;  3ODW A;  5KQ1 A;  1KZG A;  2W2W A;  3ZDT A;  4F7G A;  2D9Y A;  1P5T A;  1V5M A;  1PLS A;  2HE7 A;  2ELB A;  2YT0 A;  4K2P A;  1FB8 A;  4GXB A;  4HAX B;  2OQB A;  1UNP A;  3D8E A;  4C0A A;  4HAZ B;  2EJ8 A;  5KQ4 A;  5LG4 B;  2Y8F A;  4F7H A;  4QJ5 B;  1ZVR A;  2P0D A;  1GC6 A;  5JLJ B;  1WGU A;  1BWN A;  2RRF A;  5M4Y B;  1K5G B;  2MWN B;  1BTN A;  3PP2 A;  2K8E A;  3AU5 A;  3HIE A;  3TFM A;  2D9W A;  1K5D B;  1U29 A;  1X1G A;  1V61 A;  2V76 A;  2CY4 A;  1DDV A;  5IRS A;  1EGX A;  1WGQ A;  3GYP A;  1AQC A;  2D4Q A;  1FGY A;  1FHO A;  3KRW A;  2KUP A;  5DIF B;  1H10 A;  1M7E A;  3AU4 A;  2N0Y A;  1X05 A;  2DFK A;  4K81 A;  5DHA B;  2ROZ B;  2DHI A;  2IYB A;  1KI1 B;  1P3R A;  2P8V A;  3PVL A;  3BJI A;  3M1I B;  1BAK A;  4IAP A;  2MKR A;  2P0F A;  3AJ4 A;  1P6S A;  1B55 A;  2BCJ A;  3WYF B;  3SO6 A;  3U7D A;  4YL8 A;  1RRP B;  3U8Z A;  3KRX A;  2LYD A;  3NW8 A;  1WI1 A;  3F0W A;  1Y5O A;  1U5G A;  4GNK B;  2ZKM X;  4Y94 A;  1UEF A;  3FVC A;  5I2M A;  4GPT B;  3X23 A;  4XWX A;  5D3X A;  3PEG A;  3WA0 A;  2YS5 A;  2Q13 A;  3NWD A;  4NY0 A;  2Y8G A;  4HB3 B;  5C6R A;  1MKE A;  4WJ7 A;  4GN1 A;  5J3T A;  1M7R A;  1DYN A;  3N7C A;  1XD4 A;  3BIN A;  1FOE A;  1MK7 B;  1OY2 A;  3ODO A;  3IVF A;  2K49 A;  2OTX A;  4CYE A;  4KHO A;  1MAI A;  1X11 A;  3A8P A;  4BBK A;  1FHW A;  1FAO A;  2YS3 A;  1AWE A;  1N3H A;  2QKL A;  4D6W A;  2DYN A;  3LJU X;  3VOQ A;  3PZD A;  1NTY A;  4GZU A; 
#chains in the Genus database with same CATH homology
 3OHM B;  3NWF A;  2KIE A;  3FSS A;  4KHB A;  4HSI A;  3A58 A;  2GUM A;  5IRS A;  3GYP A;  2GCL A;  1ZYI A;  3NW8 A;  5LG4 B;  2KUQ A;  3GYO A;  4KHB B;  4QJ5 B;  4GNK B;  2Z14 A;  4IFS A;  2ZKM X;  4QXA B;  3TO1 A;  4QJ3 B;  3TVV A;  4OSN A;  2R2Y A;  4PQ0 A;  2K49 A;  3FVC A;  3TW1 A;  4Z2N A;  4KHO A;  5I2M A;  2RRF A;  2Z13 A;  4OT1 A;  5M4Y B;  3NWA A;  2YT2 A;  3NWD A;  4DIX A;  2K8E A;  2Z4D A;  2KIG A;  3HIE A;  2Z59 A;  2GCJ A;  4GOU A;  4IOY X;  4D6W A;  2FJU B;  4KHA A;  4CSQ A;  4QJ4 B;  3U12 A;  2KR0 A;  5I2S A;  4L1R A;  2NBV A;  4Z2M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...