2Z13A

Crystal structure of the n-terminal duf1126 in human ef-hand domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
122
structure length
117
Chain Sequence
b'SGWVAFDKQVLSFDAYLEEEVLDKSQTNYRIRYYKIYFYPEDDTIQVNEPELLQGTSIRRHRITLPPPDEDQFYTVYHFNVGTEVVFYGRTFKIYDCDAFTRNFLRKMGVKVNPPVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EF-hand domain-containing family member C2
publication title Crystal structure of the N-terminal DUF1126 in human EF-hand domain
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 23
structure length 117
sequence length 122
ec nomenclature
pdb deposition date 2007-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.170 Mainly Beta Roll PH-domain like PH-domain like 2z13A00
2Z13A 2Z14A
chains in the Genus database with same CATH superfamily
2D9ZA 2DX1A 2RGNB 1MPHA 2FJLA 3BJIA 3DXEA 2KUQA 2HTHB 2EJ8A 1GC6A 4KHBA 4YL8A 2COCA 2J0KA 2AL6A 3OHMB 3PG7A 2M14A 1WJMA 1XODA 1X86A 2CODA 3TFMA 3NWDA 1V5UA 1LW3A 3CIKA 5C16A 2DKPA 2YRYA 4H8SA 2Z0PA 1LB1A 4QJ5B 2YT0A 4DXAB 2YSZA 4IFSA 5LG4B 1MIXA 2Q13A 5C6RA 2DHKA 2GS0A 3G9WA 3ULCA 1PFJA 2W2XC 4D6WA 2Z0QA 5JHHA 1BTNA 2YF0A 5JLJB 2G35A 3ODOA 4XWXA 2Y8FA 1BWNA 4TYZA 2K49A 2ADZA 2LYDA 3RCPA 4CSQA 4DBBA 1AQCA 2Y7BA 4WJ7A 5EFXA 4PQ0A 3FEHA 4OT1A 3D8FA 3DXCA 1X1GA 1U5DA 3CXBB 2ELAA 2N0YA 4TKNA 1MKEA 4KHAA 3VIAA 1UNPA 1K5DB 3A98B 2CY5A 2DHIA 1E5WA 5D3YA 2DYQA 5KCVA 3F5RA 2XQNM 3SUZA 3ML4A 2I5CA 2I1KA 2LULA 1EF1A 1MAIA 2MKRA 1UPQA 1TQZA 3WA0A 2UZRA 2LG1A 5CLQB 3PVWA 4HDOA 2MWNB 1V89A 3SO6A 2W2XD 4NSWA 3GYOA 2N23A 5KQ1A 1XCGA 3QWMA 2DHJA 5DHAB 1TXDA 1EVHA 4MY6A 5D3VA 1M7EA 2H7DA 4B6HA 1V88A 2ROVA 2VSZA 4KHOA 2KIGA 1RJ2A 3IVFA 2E2XA 2DLWA 4BBKA 4HAYB 4GMXB 3KY9A 3DXDA 2K2UA 2DFKA 2GJYA 2ZPYA 4CYEA 3AU5A 3X23A 2CRFA 2FJUB 1SGHA 1U29A 2D11A 2RSGA 2P0HA 2R09A 2YT1A 3UZTA 1P6SA 1ZC3B 2RUKB 1H10A 1UEFA 1NTVA 3HW2B 1Z87A 4IOYX 2COAA 2Z14A 2D9VA 4QJ4B 2D9WA 4GMVA 3PP2A 1P5TA 1FB8A 3OANA 4A6HA 1BTKA 4HAVB 3HIEA 5GOWB 4QXAB 3AU4A 3FM8C 4C0AA 3NW8A 4K17A 1FHOA 3T06A 2P8VA 1V5MA 3KSYA 4F7UP 4ZRIA 2DA0A 2MDXA 2YVCA 3KZ1A 3F0WA 2HE7A 1QQGA 2D9XA 1NU2A 4KVGB 1ZVRA 2ROZB 2EC1A 3HK0A 2D4QA 4KAXB 1XX0A 5D27A 1EAZA 1NI2A 1WI1A 3DCXA 4GPTB 2UVMA 2DYNA 1M7RA 1P3RA 1J0WA 4NY0A 4Y94A 4L1RA 4WVFB 3V5WA 5IRSA 2EMSA 3A8PA 1NTYA 3U8ZA 5LONB 2K8EA 4KHBB 2R2YA 2ZKMX 2GUMA 2GCLA 2YS3A 3D8EA 4HAUB 3SNHA 1UNRA 1OMWA 3TVVA 2J0JA 2LOXA 4HB2B 4MT7A 1RRPB 4DIXA 2CAYA 5C5BA 5HE3A 4HB3B 4EKUA 5M4YB 1WVHA 1X11A 2M38A 1Q67A 2H7EA 2R0DA 1WGQA 2QKMA 5J3TA 2COFA 3PZDA 1IRSA 2DN6A 1X05A 2L1CA 3TCAA 5FI0A 2UZSA 2NBVA 5C79A 3GYPA 3B77A 5D3XA 2VKIA 4Z2MB 3QBVB 5DH9B 2KR0A 3FSSA 3PVUA 4A6FA 3PEGA 4GN1A 3ZVRA 1T77A 4K81A 3HSAA 1J19A 5HE2A 5J3YA 1I2HA 2KUPA 4EJNA 2I5FA 5I2SA 4ZRJA 1DYNA 2RRFA 4HAZB 2D9YA 1MI1A 4HDQA 3A8QA 3P7ZA 1KZ7A 4ZRKA 2V76A 4F7HA 4L6EA 3MDBC 1X1FA 2DKQA 4HB4B 4YONA 4D0NB 3N7CA 1BAKA 4HHVA 2NZ8B 2I1JA 4CHJA 1KZGA 3ODWA 2LKOA 1PLSA 3ODXA 2CY4A 3VOQA 3SV1A 5HE1A 3NWFA 5KQ4A 2Y8GA 1ZC4B 2X18A 5J3QA 4HAXB 2K00A 2Z4DA 1W1HA 3PVLA 1U5GA 1XD4A 3AJ4A 2RVBB 3KRXA 3M1IB 4A5KA 4A6FB 1ISNA 1U5EA 4IAPA 4GZUA 1U27A 1GG3A 3BINA 1U2BA 1DBHA 2Z13A 1H4RA 1FGZA 5LOPB 1OY2A 1UPRA 2LOZA 3LJUX 5DIFB 2DX5A 1V5PA 2KIEA 4K2PA 1W1DA 1B55A 2NMBA 1WJ1A 2PZ1A 4DX8A 4HSIA 4GOUA 1GC7A 1WGUA 2EMTA 3U7DA 1XKEA 2DTCA 2W2WA 1MK9B 4WSFA 5CLLB 2D10A 3FVCA 5FI1A 2YS5A 4CHMA 4P7IA 1ZYIA 2J0MA 2D2QA 3ULBA 2OTXA 2L2IA 3WYFB 2YS1A 3TW1A 3NSUA 1N3HA 2K2JA 1U5FA 5DHFB 1Y5OA 2VRWB 1MK7B 2P0DA 1KI1B 1W1GA 1DDWA 1K5GB 1OQNA 1AWEA 2ELBA 4HAWB 2BCJA 3SYXA 1TJ6A 4GNKB 5JHGA 2MFQA 1EGXA 1FHXA 2AEHA 3U12A 3P6AA 1XR0B 1Y19B 4K2OA 1FHWA 2IFSA 1MIZB 1DDMA 1V61A 4GXBA 1QC6A 1FOEA 1UNQA 1PMSA 1DROA 4F7GA 3MPXA 5D3WA 3KRWA 3O96A 2J59M 2RLOA 5DI9B 1I7AA 2Z0OA 4DX90 2Z59A 2RNRB 1FAOA 2OQBA 3PSCA 4EMOA 5HE0A 1ZM0A 2P0FA 5L81A 3ZDTA 4QJ3B 1DDVA 3TO1A 2JP2A 1SHCA 4HATB 1ZSQA 4OSNA 5C5BB 3D8DA 4A6KA 2KGXB 4PNKA 3QIJA 3A58A 4Z2NA 5I2MA 3NWAA 1WG7A 5JP4A 1FGYA 3HQCA 4MK0A 2IYBA 2GCJA 2KCJA 2YT2A 2QKLA 4HB0B
chains in the Genus database with same CATH topology
4Z2MB 3TVVA 4QJ5B 4CSQA 2KR0A 3FSSA 4GOUA 4IOYX 4QJ3B 4IFSA 5LG4B 2Z14A 3TO1A 2KUQA 4DIXA 4QJ4B 4PQ0A 5M4YB 4L1RA 4KHBA 4OT1A 5IRSA 3FVCA 4OSNA 1ZYIA 3OHMB 4D6WA 5I2SA 2K8EA 4KHBB 2R2YA 2ZKMX 3GYOA 2GUMA 2RRFA 3NWFA 2Z13A 3HIEA 4KHAA 2GCLA 2FJUB 2Z59A 3A58A 4QXAB 5I2MA 3NWAA 4Z2NA 4GNKB 2GCJA 2NBVA 3NW8A 3GYPA 2KIEA 2K49A 2Z4DA 3NWDA 3TW1A 2YT2A 4KHOA 2KIGA 4HSIA 3U12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z13 A;  2Z14 A; 
#chains in the Genus database with same CATH topology
 2D9Z A;  2DX1 A;  2RGN B;  1MPH A;  2FJL A;  3BJI A;  3DXE A;  2KUQ A;  2HTH B;  2EJ8 A;  1GC6 A;  4KHB A;  4YL8 A;  2COC A;  2J0K A;  2AL6 A;  3OHM B;  3PG7 A;  2M14 A;  1WJM A;  1XOD A;  1X86 A;  2COD A;  3TFM A;  3NWD A;  1V5U A;  1LW3 A;  3CIK A;  5C16 A;  2DKP A;  2YRY A;  4H8S A;  2Z0P A;  1LB1 A;  4QJ5 B;  2YT0 A;  4DXA B;  2YSZ A;  4IFS A;  5LG4 B;  1MIX A;  2Q13 A;  5C6R A;  2DHK A;  2GS0 A;  3G9W A;  3ULC A;  1PFJ A;  2W2X C;  4D6W A;  2Z0Q A;  5JHH A;  1BTN A;  2YF0 A;  5JLJ B;  2G35 A;  3ODO A;  4XWX A;  2Y8F A;  1BWN A;  4TYZ A;  2K49 A;  2ADZ A;  2LYD A;  3RCP A;  4CSQ A;  4DBB A;  1AQC A;  2Y7B A;  4WJ7 A;  5EFX A;  4PQ0 A;  3FEH A;  4OT1 A;  3D8F A;  3DXC A;  1X1G A;  1U5D A;  3CXB B;  2ELA A;  2N0Y A;  4TKN A;  1MKE A;  4KHA A;  3VIA A;  1UNP A;  1K5D B;  3A98 B;  2CY5 A;  2DHI A;  1E5W A;  5D3Y A;  2DYQ A;  5KCV A;  3F5R A;  2XQN M;  3SUZ A;  3ML4 A;  2I5C A;  2I1K A;  2LUL A;  1EF1 A;  1MAI A;  2MKR A;  1UPQ A;  1TQZ A;  3WA0 A;  2UZR A;  2LG1 A;  5CLQ B;  3PVW A;  4HDO A;  2MWN B;  1V89 A;  3SO6 A;  2W2X D;  4NSW A;  3GYO A;  2N23 A;  5KQ1 A;  1XCG A;  3QWM A;  2DHJ A;  5DHA B;  1TXD A;  1EVH A;  4MY6 A;  5D3V A;  1M7E A;  2H7D A;  4B6H A;  1V88 A;  2ROV A;  2VSZ A;  4KHO A;  2KIG A;  1RJ2 A;  3IVF A;  2E2X A;  2DLW A;  4BBK A;  4HAY B;  4GMX B;  3KY9 A;  3DXD A;  2K2U A;  2DFK A;  2GJY A;  2ZPY A;  4CYE A;  3AU5 A;  3X23 A;  2CRF A;  2FJU B;  1SGH A;  1U29 A;  2D11 A;  2RSG A;  2P0H A;  2R09 A;  2YT1 A;  3UZT A;  1P6S A;  1ZC3 B;  2RUK B;  1H10 A;  1UEF A;  1NTV A;  3HW2 B;  1Z87 A;  4IOY X;  2COA A;  2Z14 A;  2D9V A;  4QJ4 B;  2D9W A;  4GMV A;  3PP2 A;  1P5T A;  1FB8 A;  3OAN A;  4A6H A;  1BTK A;  4HAV B;  3HIE A;  5GOW B;  4QXA B;  3AU4 A;  3FM8 C;  4C0A A;  3NW8 A;  4K17 A;  1FHO A;  3T06 A;  2P8V A;  1V5M A;  3KSY A;  4F7U P;  4ZRI A;  2DA0 A;  2MDX A;  2YVC A;  3KZ1 A;  3F0W A;  2HE7 A;  1QQG A;  2D9X A;  1NU2 A;  4KVG B;  1ZVR A;  2ROZ B;  2EC1 A;  3HK0 A;  2D4Q A;  4KAX B;  1XX0 A;  5D27 A;  1EAZ A;  1NI2 A;  1WI1 A;  3DCX A;  4GPT B;  2UVM A;  2DYN A;  1M7R A;  1P3R A;  1J0W A;  4NY0 A;  4Y94 A;  4L1R A;  4WVF B;  3V5W A;  5IRS A;  2EMS A;  3A8P A;  1NTY A;  3U8Z A;  5LON B;  2K8E A;  4KHB B;  2R2Y A;  2ZKM X;  2GUM A;  2GCL A;  2YS3 A;  3D8E A;  4HAU B;  3SNH A;  1UNR A;  1OMW A;  3TVV A;  2J0J A;  2LOX A;  4HB2 B;  4MT7 A;  1RRP B;  4DIX A;  2CAY A;  5C5B A;  5HE3 A;  4HB3 B;  4EKU A;  5M4Y B;  1WVH A;  1X11 A;  2M38 A;  1Q67 A;  2H7E A;  2R0D A;  1WGQ A;  2QKM A;  5J3T A;  2COF A;  3PZD A;  1IRS A;  2DN6 A;  1X05 A;  2L1C A;  3TCA A;  5FI0 A;  2UZS A;  2NBV A;  5C79 A;  3GYP A;  3B77 A;  5D3X A;  2VKI A;  4Z2M B;  3QBV B;  5DH9 B;  2KR0 A;  3FSS A;  3PVU A;  4A6F A;  3PEG A;  4GN1 A;  3ZVR A;  1T77 A;  4K81 A;  3HSA A;  1J19 A;  5HE2 A;  5J3Y A;  1I2H A;  2KUP A;  4EJN A;  2I5F A;  5I2S A;  4ZRJ A;  1DYN A;  2RRF A;  4HAZ B;  2D9Y A;  1MI1 A;  4HDQ A;  3A8Q A;  3P7Z A;  1KZ7 A;  4ZRK A;  2V76 A;  4F7H A;  4L6E A;  3MDB C;  1X1F A;  2DKQ A;  4HB4 B;  4YON A;  4D0N B;  3N7C A;  1BAK A;  4HHV A;  2NZ8 B;  2I1J A;  4CHJ A;  1KZG A;  3ODW A;  2LKO A;  1PLS A;  3ODX A;  2CY4 A;  3VOQ A;  3SV1 A;  5HE1 A;  3NWF A;  5KQ4 A;  2Y8G A;  1ZC4 B;  2X18 A;  5J3Q A;  4HAX B;  2K00 A;  2Z4D A;  1W1H A;  3PVL A;  1U5G A;  1XD4 A;  3AJ4 A;  2RVB B;  3KRX A;  3M1I B;  4A5K A;  4A6F B;  1ISN A;  1U5E A;  4IAP A;  4GZU A;  1U27 A;  1GG3 A;  3BIN A;  1U2B A;  1DBH A;  2Z13 A;  1H4R A;  1FGZ A;  5LOP B;  1OY2 A;  1UPR A;  2LOZ A;  3LJU X;  5DIF B;  2DX5 A;  1V5P A;  2KIE A;  4K2P A;  1W1D A;  1B55 A;  2NMB A;  1WJ1 A;  2PZ1 A;  4DX8 A;  4HSI A;  4GOU A;  1GC7 A;  1WGU A;  2EMT A;  3U7D A;  1XKE A;  2DTC A;  2W2W A;  1MK9 B;  4WSF A;  5CLL B;  2D10 A;  3FVC A;  5FI1 A;  2YS5 A;  4CHM A;  4P7I A;  1ZYI A;  2J0M A;  2D2Q A;  3ULB A;  2OTX A;  2L2I A;  3WYF B;  2YS1 A;  3TW1 A;  3NSU A;  1N3H A;  2K2J A;  1U5F A;  5DHF B;  1Y5O A;  2VRW B;  1MK7 B;  2P0D A;  1KI1 B;  1W1G A;  1DDW A;  1K5G B;  1OQN A;  1AWE A;  2ELB A;  4HAW B;  2BCJ A;  3SYX A;  1TJ6 A;  4GNK B;  5JHG A;  2MFQ A;  1EGX A;  1FHX A;  2AEH A;  3U12 A;  3P6A A;  1XR0 B;  1Y19 B;  4K2O A;  1FHW A;  2IFS A;  1MIZ B;  1DDM A;  1V61 A;  4GXB A;  1QC6 A;  1FOE A;  1UNQ A;  1PMS A;  1DRO A;  4F7G A;  3MPX A;  5D3W A;  3KRW A;  3O96 A;  2J59 M;  2RLO A;  5DI9 B;  1I7A A;  2Z0O A;  4DX9 0;  2Z59 A;  2RNR B;  1FAO A;  2OQB A;  3PSC A;  4EMO A;  5HE0 A;  1ZM0 A;  2P0F A;  5L81 A;  3ZDT A;  4QJ3 B;  1DDV A;  3TO1 A;  2JP2 A;  1SHC A;  4HAT B;  1ZSQ A;  4OSN A;  5C5B B;  3D8D A;  4A6K A;  2KGX B;  4PNK A;  3QIJ A;  3A58 A;  4Z2N A;  5I2M A;  3NWA A;  1WG7 A;  5JP4 A;  1FGY A;  3HQC A;  4MK0 A;  2IYB A;  2GCJ A;  2KCJ A;  2YT2 A;  2QKL A;  4HB0 B; 
#chains in the Genus database with same CATH homology
 4Z2M B;  3TVV A;  4QJ5 B;  4CSQ A;  2KR0 A;  3FSS A;  4GOU A;  4IOY X;  4QJ3 B;  4IFS A;  5LG4 B;  2Z14 A;  3TO1 A;  2KUQ A;  4DIX A;  4QJ4 B;  4PQ0 A;  5M4Y B;  4L1R A;  4KHB A;  4OT1 A;  5IRS A;  3FVC A;  4OSN A;  1ZYI A;  3OHM B;  4D6W A;  5I2S A;  2K8E A;  4KHB B;  2R2Y A;  2ZKM X;  3GYO A;  2GUM A;  2RRF A;  3NWF A;  2Z13 A;  3HIE A;  4KHA A;  2GCL A;  2FJU B;  2Z59 A;  3A58 A;  4QXA B;  5I2M A;  3NWA A;  4Z2N A;  4GNK B;  2GCJ A;  2NBV A;  3NW8 A;  3GYP A;  2KIE A;  2K49 A;  2Z4D A;  3NWD A;  3TW1 A;  2YT2 A;  4KHO A;  2KIG A;  4HSI A;  3U12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...