2Z13A

Crystal structure of the n-terminal duf1126 in human ef-hand domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
122
structure length
117
Chain Sequence
SGWVAFDKQVLSFDAYLEEEVLDKSQTNYRIRYYKIYFYPEDDTIQVNEPELLQGTSIRRHRITLPPPDEDQFYTVYHFNVGTEVVFYGRTFKIYDCDAFTRNFLRKMGVKVNPPVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the N-terminal DUF1126 in human EF-hand domain
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords EF-hand domain-containing family member C2
total genus 23
structure length 117
sequence length 122
ec nomenclature
pdb deposition date 2007-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.170 Mainly Beta Roll PH-domain like PH-domain like 2z13A00
2Z13A 2Z14A
chains in the Genus database with same CATH superfamily
2DA0A 1FHXA 3ZDTA 4QXAB 2D11A 3P7ZA 1X86A 4GZUA 2K2JA 2EJ8A 4WSFA 1XCGA 2DFKA 4CYEA 4K81A 4D0NB 1UPRA 3U12A 3WA0A 4F7GA 2JP2A 4GOUA 1DDWA 3MDBC 4KHAA 1V89A 2ZKMX 2E2XA 1BWNA 3QBVB 2D4QA 5JHHA 4QJ5B 2L1CA 4CHMA 2W2WA 2OQBA 3PVWA 3QWMA 4CHJA 2LULA 4MT7A 1GC6A 1W1GA 5D3VA 3A98B 5D3YA 4K17A 1W1HA 3OHMB 4ZRIA 2Z0PA 1OMWA 4F7UP 2QKLA 1WGQA 4HAZB 4A6HA 2Z4DA 5D3XA 2P0HA 5KQ1A 2J59M 1ZSQA 4A6FB 1MI1A 1H10A 4QJ3B 4BBKA 3HK0A 3OANA 3VOQA 4A6KA 3N7CA 2IFSA 1GG3A 2UVMA 2P8VA 3NWDA 3ODWA 3PSCA 5DH9B 3QIJA 1ISNA 3UZTA 2Y8GA 5HE0A 2DX5A 3ULCA 2J0JA 2YT2A 3ZVRA 2MFQA 4CSQA 1UNPA 1B55A 2HE7A 1N3HA 3F0WA 1Y5OA 2D9YA 3G9WA 4KHBA 3KY9A 3A58A 1UPQA 4HDQA 1KZ7A 1WGUA 2EMTA 2DKQA 3PVUA 4DIXA 5J3QA 2KGXB 1BAKA 1TJ6A 3PVLA 1FOEA 3D8FA 2LG1A 5LG4B 2NZ8B 4MY6A 1WJ1A 5C5BA 4C0AA 3FSSA 2GJYA 4GMXB 5I2MA 2YS3A 3A8PA 1K5GB 5L81A 1UNQA 4WVFB 3T06A 2Y7BA 4L6EA 2BCJA 2KUPA 2MDXA 3TW1A 2R2YA 5KQ4A 4TKNA 4D6WA 1M7EA 1XR0B 3U8ZA 2Z13A 1Z87A 4HAVB 2RRFA 4GNKB 2GCLA 1EGXA 5C6RA 2I5FA 1SGHA 1NTVA 1SHCA 3NSUA 1ZVRA 1XX0A 2FJUB 1BTKA 2DYNA 2DKPA 3CXBB 1MK9B 2K8EA 3O96A 4HB2B 2D9XA 1DROA 4K2PA 5DI9B 4KHOA 2RVBB 1J0WA 2YSZA 2UZSA 4YONA 3BINA 4HAWB 1WVHA 5CLLB 4HAXB 4YL8A 3DXEA 3BJIA 2L2IA 3LJUX 5C16A 1NI2A 1DBHA 3F5RA 4OT1A 5HE2A 1U2BA 2RUKB 3ODOA 3TFMA 2PZ1A 2VKIA 4HSIA 2DYQA 2Z0OA 5EFXA 2ADZA 3RCPA 2AEHA 2EC1A 2H7DA 1OQNA 1MAIA 3GYPA 4QJ4B 3FM8C 1GC7A 1U5EA 1U27A 3DXCA 2DTCA 1UEFA 2R0DA 3KSYA 5GOWB 3HQCA 2NMBA 3M1IB 3DXDA 2N23A 5D27A 4NY0A 4EJNA 2W2XD 2YT1A 2DHKA 4XWXA 2Y8FA 2GCJA 1V88A 3SNHA 2VRWB 2D2QA 3GYOA 2OTXA 2ELAA 4ZRJA 2J0KA 2D9WA 2RSGA 5DHAB 2J0MA 1LW3A 2P0FA 2KIGA 2M14A 2LYDA 2ZPYA 1PLSA 2RNRB 1EF1A 4HB4B 3AJ4A 2CY5A 2CODA 5LOPB 5J3TA 5JLJB 1ZC3B 2CAYA 3X23A 3KZ1A 5KCVA 4HAYB 2K49A 4PNKA 1MPHA 5C5BB 3NWAA 5IRSA 2YF0A 4A6FA 3A8QA 3TVVA 1MIZB 1XKEA 3VIAA 3TO1A 1KZGA 2D9ZA 3SUZA 1IRSA 4DX90 3KRXA 1BTNA 1XD4A 1TXDA 3CIKA 1ZC4B 2COFA 4HHVA 3MPXA 3HW2B 4ZRKA 3U7DA 3PP2A 1OY2A 3FEHA 4GXBA 4GMVA 2XQNM 2EMSA 3HIEA 3TCAA 2I1KA 5FI0A 2DX1A 2W2XC 2CRFA 1W1DA 5C79A 3ODXA 2YT0A 2DHIA 1V5PA 3HSAA 4NSWA 2ELBA 2RLOA 4IOYX 4HATB 4GN1A 5D3WA 2I5CA 3B77A 1E5WA 1U29A 4HB3B 1X11A 1X1GA 1X1FA 1XODA 2D9VA 1H4RA 1V5UA 2FJLA 1FGZA 2Q13A 2DN6A 5JP4A 1U5FA 1X05A 4EMOA 3PEGA 1NU2A 5J3YA 1NTYA 2QKMA 2DHJA 1MK7B 2AL6A 1DDVA 1WG7A 1K5DB 1U5DA 4P7IA 1PFJA 1MIXA 2M38A 2Z14A 5M4YB 2RGNB 5CLQB 2IYBA 3SV1A 1FAOA 2HTHB 4L1RA 1WJMA 3SO6A 4MK0A 3KRWA 5HE3A 4A5KA 5FI1A 3D8EA 2DLWA 4Z2MB 4KVGB 2NBVA 2ROVA 1ZM0A 1FB8A 2COAA 2R09A 1AQCA 4DX8A 2X18A 2GS0A 2LOZA 3SYXA 4KHBB 2UZRA 1TQZA 3FVCA 4K2OA 4WJ7A 1V5MA 4HB0B 1QC6A 4HAUB 1I7AA 2LKOA 3D8DA 5DHFB 5LONB 2VSZA 1DDMA 2YS1A 2YRYA 3AU5A 1Q67A 1PMSA 1DYNA 2V76A 4EKUA 1FGYA 3NW8A 3AU4A 2MKRA 2Z0QA 3ML4A 4IFSA 4Y94A 2N0YA 2H7EA 1P5TA 3IVFA 2I1JA 2ROZB 1P3RA 1LB1A 2G35A 1MKEA 1ZYIA 3V5WA 5JHGA 1QQGA 1I2HA 5I2SA 1RJ2A 1WI1A 2CY4A 4H8SA 1UNRA 1RRPB 1U5GA 2LOXA 5HE1A 1T77A 2D10A 3WYFB 2MWNB 1FHWA 1KI1B 2YS5A 2KIEA 3PG7A 2K2UA 2Z59A 1V61A 4TYZA 1EVHA 1J19A 2P0DA 3DCXA 1AWEA 4DXAB 4OSNA 3ULBA 3P6AA 2COCA 1FHOA 1M7RA 2KR0A 1EAZA 1Y19B 2KUQA 4GPTB 4DBBA 3PZDA 4IAPA 1P6SA 4Z2NA 2K00A 5DIFB 4PQ0A 4B6HA 2GUMA 4KAXB 2KCJA 4HDOA 2YVCA 4F7HA 3NWFA
chains in the Genus database with same CATH topology
2KIGA 3TVVA 5I2SA 2RRFA 4GNKB 2GCLA 4CSQA 3FSSA 4QJ3B 2KR0A 4Z2MB 2NBVA 3TO1A 2KUQA 4QXAB 4OT1A 5I2MA 3NWFA 2FJUB 4KHBA 3A58A 2K8EA 4Z2NA 3NWDA 2KIEA 4PQ0A 4DIXA 4HSIA 2Z14A 4KHBB 3TW1A 5M4YB 2GUMA 3OHMB 2Z59A 4KHOA 3U12A 3NW8A 3FVCA 2R2YA 4IOYX 4GOUA 4KHAA 2GCJA 4L1RA 4D6WA 2K49A 2ZKMX 4IFSA 5LG4B 3GYOA 2YT2A 3GYPA 3NWAA 2Z13A 2Z4DA 5IRSA 4OSNA 4QJ4B 4QJ5B 1ZYIA 3HIEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z13 A;  2Z14 A; 
#chains in the Genus database with same CATH topology
 2DA0 A;  1FHX A;  3ZDT A;  4QXA B;  2D11 A;  3P7Z A;  1X86 A;  4GZU A;  2K2J A;  2EJ8 A;  4WSF A;  1XCG A;  2DFK A;  4CYE A;  4K81 A;  4D0N B;  1UPR A;  3U12 A;  3WA0 A;  4F7G A;  2JP2 A;  4GOU A;  1DDW A;  3MDB C;  4KHA A;  1V89 A;  2ZKM X;  2E2X A;  1BWN A;  3QBV B;  2D4Q A;  5JHH A;  4QJ5 B;  2L1C A;  4CHM A;  2W2W A;  2OQB A;  3PVW A;  3QWM A;  4CHJ A;  2LUL A;  4MT7 A;  1GC6 A;  1W1G A;  5D3V A;  3A98 B;  5D3Y A;  4K17 A;  1W1H A;  3OHM B;  4ZRI A;  2Z0P A;  1OMW A;  4F7U P;  2QKL A;  1WGQ A;  4HAZ B;  4A6H A;  2Z4D A;  5D3X A;  2P0H A;  5KQ1 A;  2J59 M;  1ZSQ A;  4A6F B;  1MI1 A;  1H10 A;  4QJ3 B;  4BBK A;  3HK0 A;  3OAN A;  3VOQ A;  4A6K A;  3N7C A;  2IFS A;  1GG3 A;  2UVM A;  2P8V A;  3NWD A;  3ODW A;  3PSC A;  5DH9 B;  3QIJ A;  1ISN A;  3UZT A;  2Y8G A;  5HE0 A;  2DX5 A;  3ULC A;  2J0J A;  2YT2 A;  3ZVR A;  2MFQ A;  4CSQ A;  1UNP A;  1B55 A;  2HE7 A;  1N3H A;  3F0W A;  1Y5O A;  2D9Y A;  3G9W A;  4KHB A;  3KY9 A;  3A58 A;  1UPQ A;  4HDQ A;  1KZ7 A;  1WGU A;  2EMT A;  2DKQ A;  3PVU A;  4DIX A;  5J3Q A;  2KGX B;  1BAK A;  1TJ6 A;  3PVL A;  1FOE A;  3D8F A;  2LG1 A;  5LG4 B;  2NZ8 B;  4MY6 A;  1WJ1 A;  5C5B A;  4C0A A;  3FSS A;  2GJY A;  4GMX B;  5I2M A;  2YS3 A;  3A8P A;  1K5G B;  5L81 A;  1UNQ A;  4WVF B;  3T06 A;  2Y7B A;  4L6E A;  2BCJ A;  2KUP A;  2MDX A;  3TW1 A;  2R2Y A;  5KQ4 A;  4TKN A;  4D6W A;  1M7E A;  1XR0 B;  3U8Z A;  2Z13 A;  1Z87 A;  4HAV B;  2RRF A;  4GNK B;  2GCL A;  1EGX A;  5C6R A;  2I5F A;  1SGH A;  1NTV A;  1SHC A;  3NSU A;  1ZVR A;  1XX0 A;  2FJU B;  1BTK A;  2DYN A;  2DKP A;  3CXB B;  1MK9 B;  2K8E A;  3O96 A;  4HB2 B;  2D9X A;  1DRO A;  4K2P A;  5DI9 B;  4KHO A;  2RVB B;  1J0W A;  2YSZ A;  2UZS A;  4YON A;  3BIN A;  4HAW B;  1WVH A;  5CLL B;  4HAX B;  4YL8 A;  3DXE A;  3BJI A;  2L2I A;  3LJU X;  5C16 A;  1NI2 A;  1DBH A;  3F5R A;  4OT1 A;  5HE2 A;  1U2B A;  2RUK B;  3ODO A;  3TFM A;  2PZ1 A;  2VKI A;  4HSI A;  2DYQ A;  2Z0O A;  5EFX A;  2ADZ A;  3RCP A;  2AEH A;  2EC1 A;  2H7D A;  1OQN A;  1MAI A;  3GYP A;  4QJ4 B;  3FM8 C;  1GC7 A;  1U5E A;  1U27 A;  3DXC A;  2DTC A;  1UEF A;  2R0D A;  3KSY A;  5GOW B;  3HQC A;  2NMB A;  3M1I B;  3DXD A;  2N23 A;  5D27 A;  4NY0 A;  4EJN A;  2W2X D;  2YT1 A;  2DHK A;  4XWX A;  2Y8F A;  2GCJ A;  1V88 A;  3SNH A;  2VRW B;  2D2Q A;  3GYO A;  2OTX A;  2ELA A;  4ZRJ A;  2J0K A;  2D9W A;  2RSG A;  5DHA B;  2J0M A;  1LW3 A;  2P0F A;  2KIG A;  2M14 A;  2LYD A;  2ZPY A;  1PLS A;  2RNR B;  1EF1 A;  4HB4 B;  3AJ4 A;  2CY5 A;  2COD A;  5LOP B;  5J3T A;  5JLJ B;  1ZC3 B;  2CAY A;  3X23 A;  3KZ1 A;  5KCV A;  4HAY B;  2K49 A;  4PNK A;  1MPH A;  5C5B B;  3NWA A;  5IRS A;  2YF0 A;  4A6F A;  3A8Q A;  3TVV A;  1MIZ B;  1XKE A;  3VIA A;  3TO1 A;  1KZG A;  2D9Z A;  3SUZ A;  1IRS A;  4DX9 0;  3KRX A;  1BTN A;  1XD4 A;  1TXD A;  3CIK A;  1ZC4 B;  2COF A;  4HHV A;  3MPX A;  3HW2 B;  4ZRK A;  3U7D A;  3PP2 A;  1OY2 A;  3FEH A;  4GXB A;  4GMV A;  2XQN M;  2EMS A;  3HIE A;  3TCA A;  2I1K A;  5FI0 A;  2DX1 A;  2W2X C;  2CRF A;  1W1D A;  5C79 A;  3ODX A;  2YT0 A;  2DHI A;  1V5P A;  3HSA A;  4NSW A;  2ELB A;  2RLO A;  4IOY X;  4HAT B;  4GN1 A;  5D3W A;  2I5C A;  3B77 A;  1E5W A;  1U29 A;  4HB3 B;  1X11 A;  1X1G A;  1X1F A;  1XOD A;  2D9V A;  1H4R A;  1V5U A;  2FJL A;  1FGZ A;  2Q13 A;  2DN6 A;  5JP4 A;  1U5F A;  1X05 A;  4EMO A;  3PEG A;  1NU2 A;  5J3Y A;  1NTY A;  2QKM A;  2DHJ A;  1MK7 B;  2AL6 A;  1DDV A;  1WG7 A;  1K5D B;  1U5D A;  4P7I A;  1PFJ A;  1MIX A;  2M38 A;  2Z14 A;  5M4Y B;  2RGN B;  5CLQ B;  2IYB A;  3SV1 A;  1FAO A;  2HTH B;  4L1R A;  1WJM A;  3SO6 A;  4MK0 A;  3KRW A;  5HE3 A;  4A5K A;  5FI1 A;  3D8E A;  2DLW A;  4Z2M B;  4KVG B;  2NBV A;  2ROV A;  1ZM0 A;  1FB8 A;  2COA A;  2R09 A;  1AQC A;  4DX8 A;  2X18 A;  2GS0 A;  2LOZ A;  3SYX A;  4KHB B;  2UZR A;  1TQZ A;  3FVC A;  4K2O A;  4WJ7 A;  1V5M A;  4HB0 B;  1QC6 A;  4HAU B;  1I7A A;  2LKO A;  3D8D A;  5DHF B;  5LON B;  2VSZ A;  1DDM A;  2YS1 A;  2YRY A;  3AU5 A;  1Q67 A;  1PMS A;  1DYN A;  2V76 A;  4EKU A;  1FGY A;  3NW8 A;  3AU4 A;  2MKR A;  2Z0Q A;  3ML4 A;  4IFS A;  4Y94 A;  2N0Y A;  2H7E A;  1P5T A;  3IVF A;  2I1J A;  2ROZ B;  1P3R A;  1LB1 A;  2G35 A;  1MKE A;  1ZYI A;  3V5W A;  5JHG A;  1QQG A;  1I2H A;  5I2S A;  1RJ2 A;  1WI1 A;  2CY4 A;  4H8S A;  1UNR A;  1RRP B;  1U5G A;  2LOX A;  5HE1 A;  1T77 A;  2D10 A;  3WYF B;  2MWN B;  1FHW A;  1KI1 B;  2YS5 A;  2KIE A;  3PG7 A;  2K2U A;  2Z59 A;  1V61 A;  4TYZ A;  1EVH A;  1J19 A;  2P0D A;  3DCX A;  1AWE A;  4DXA B;  4OSN A;  3ULB A;  3P6A A;  2COC A;  1FHO A;  1M7R A;  2KR0 A;  1EAZ A;  1Y19 B;  2KUQ A;  4GPT B;  4DBB A;  3PZD A;  4IAP A;  1P6S A;  4Z2N A;  2K00 A;  5DIF B;  4PQ0 A;  4B6H A;  2GUM A;  4KAX B;  2KCJ A;  4HDO A;  2YVC A;  4F7H A;  3NWF A; 
#chains in the Genus database with same CATH homology
 2KIG A;  3TVV A;  5I2S A;  2RRF A;  4GNK B;  2GCL A;  4CSQ A;  3FSS A;  4QJ3 B;  2KR0 A;  4Z2M B;  2NBV A;  3TO1 A;  2KUQ A;  4QXA B;  4OT1 A;  5I2M A;  3NWF A;  2FJU B;  4KHB A;  3A58 A;  2K8E A;  4Z2N A;  3NWD A;  2KIE A;  4PQ0 A;  4DIX A;  4HSI A;  2Z14 A;  4KHB B;  3TW1 A;  5M4Y B;  2GUM A;  3OHM B;  2Z59 A;  4KHO A;  3U12 A;  3NW8 A;  3FVC A;  2R2Y A;  4IOY X;  4GOU A;  4KHA A;  2GCJ A;  4L1R A;  4D6W A;  2K49 A;  2ZKM X;  4IFS A;  5LG4 B;  3GYO A;  2YT2 A;  3GYP A;  3NWA A;  2Z13 A;  2Z4D A;  5IRS A;  4OSN A;  4QJ4 B;  4QJ5 B;  1ZYI A;  3HIE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...