1PLSA

Solution structure of a pleckstrin homology domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
113
structure length
113
Chain Sequence
MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVFKITTTKQQDHFFQAAFLEERDAWVRDINKAIKCIEGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a pleckstrin-homology domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Phosphorylation
molecule keywords PLECKSTRIN HOMOLOGY DOMAIN
total genus 14
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 1994-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1plsA00
4HAXB 4CHJA 4EMOA 1AQCA 1U2BA 3KZ1A 5C16A 2ELBA 2AL6A 1I7AA 2D9YA 2K2JA 4GMXB 3PG7A 2D9ZA 2YT1A 3F5RA 4A6KA 1BWNA 1MK7B 3QWMA 1MKEA 3A98B 1U27A 4PQ0A 2I5CA 2XQNM 3BINA 3SUZA 3PEGA 1KI1B 1H10A 3G9WA 2Y7BA 1NTVA 3TO1A 1ZVRA 3AU4A 2QKLA 2I1KA 4EKUA 1MAIA 1EAZA 2GCLA 3OANA 2DKQA 5J3YA 1WVHA 2IFSA 4DBBA 4F7GA 2L2IA 3DXDA 1WI1A 1X86A 3ZDTA 5DH9B 3MPXA 2CY5A 2R09A 5D3YA 4KHBB 1I2HA 4BBKA 3WA0A 1TXDA 2M38A 3QBVB 3AJ4A 3UZTA 1J0WA 4HATB 4Z2NA 2MWNB 1MIZB 3O96A 1DDWA 5C5BB 1OY2A 4NY0A 4KAXB 1ZC3B 2KUPA 1V89A 2K2UA 3KSYA 1K5DB 1NU2A 2EJ8A 2L1CA 5C5BA 3AU5A 2J0KA 3U7DA 2DN6A 2JP2A 3DXCA 1W1GA 1XX0A 2YSZA 1EF1A 4DXAB 1TJ6A 3X23A 1V61A 5DIFB 3FSSA 5JHHA 1RRPB 2KCJA 3BJIA 1P3RA 2YS1A 3HQCA 1MK9B 4Y94A 2W2XC 2ROVA 2LOXA 1WGUA 2G35A 2QKMA 1SHCA 2VKIA 3D8FA 2P0HA 1QQGA 3ULCA 4KVGB 2Q13A 4DX90 2E2XA 2K00A 2Z0QA 1E5WA 1KZGA 4ZRKA 2DHKA 1DDMA 1TQZA 3PSCA 5KQ1A 4MT7A 2D9WA 3PVUA 1B55A 1WGQA 2R0DA 5HE0A 4YL8A 2COFA 4HAVB 2N23A 4K2OA 1MPHA 5DI9B 1W1DA 4A6FB 1QC6A 1Q67A 2D10A 4HB4B 1XCGA 2OTXA 3IVFA 4DX8A 2UZSA 4ZRJA 2DTCA 2P0DA 1MIXA 2AEHA 2Y8FA 5C79A 2Z0OA 4HAUB 3FM8C 1U5EA 5LOPB 2COCA 1J19A 3D8DA 3V5WA 5HE2A 3MDBC 3GYOA 2DFKA 3TCAA 2DHIA 2MDXA 1FHWA 3ULBA 1M7RA 2DLWA 3ML4A 1V88A 3SV1A 1WJMA 4HB0B 3CXBB 1OQNA 2W2WA 4HB3B 4GMVA 4MK0A 1UEFA 3RCPA 3FEHA 4A6FA 2PZ1A 1U5GA 1FAOA 1H4RA 4GZUA 3PVWA 1UPRA 1BTNA 5JP4A 2P0FA 1X1GA 4NSWA 3TW1A 3U8ZA 1PLSA 1EVHA 2YVCA 3GYPA 1V5MA 1UNQA 4YONA 2OQBA 4CHMA 1BTKA 3ZVRA 4WVFB 2LOZA 2H7DA 5C6RA 1OMWA 1ISNA 1DBHA 5D3XA 1V5UA 3A8QA 3TVVA 1PMSA 2ZPYA 1U5FA 3KRXA 5GOWB 2UZRA 1ZM0A 2RGNB 1U29A 2CY4A 2DHJA 2DYNA 4HAZB 2DYQA 5FI0A 4HDOA 3VOQA 2HE7A 4KHOA 4Z2MB 5L81A 1ZC4B 2I5FA 1LW3A 3PP2A 2LG1A 2NZ8B 4GPTB 3HW2B 1SGHA 2ROZB 1GC7A 2LKOA 1AWEA 3PVLA 5CLLB 1EGXA 3HK0A 1PFJA 1U5DA 2D11A 1UNRA 3SNHA 2DX1A 1XD4A 3SO6A 5D3WA 1RJ2A 2W2XD 3KRWA 4PNKA 4WJ7A 3PZDA 5JLJB 4GXBA 2YT0A 1GG3A 2DX5A 1WG7A 2YS3A 2RVBB 1X05A 2DKPA 3KY9A 2GS0A 3SYXA 3ODWA 5HE3A 2CRFA 2P8VA 1UNPA 4HDQA 2N0YA 3P7ZA 3NSUA 1FB8A 1FOEA 2J59M 2MKRA 2YF0A 2X18A 2Z0PA 4KHAA 2EC1A 5DHFB 2LYDA 1M7EA 4P7IA 3ODXA 1Y19B 2YRYA 5KCVA 4K81A 2M14A 2Y8GA 1P5TA 1NI2A 3T06A 3A8PA 2J0JA 4WSFA 1Z87A 4IFSA 2UVMA 2VRWB 5FI1A 1XKEA 5LONB 1Y5OA 1UPQA 3ODOA 1ZSQA 2EMSA 4GN1A 1N3HA 4B6HA 2D9VA 2MFQA 4C0AA 2KGXB 4K17A 2CODA 1FGZA 5D27A 4H8SA 5DHAB 1FHOA 4CYEA 2V76A 1W1HA 4HAYB 3CIKA 3LJUX 4TKNA 4A5KA 2D9XA 4ZRIA 2VSZA 4D0NB 2RSGA 2BCJA 2DA0A 3M1IB 2GCJA 2EMTA 4L6EA 1FGYA 1NTYA 4F7UP 2D4QA 2LULA 3VIAA 3P6AA 1KZ7A 4IOYX 1BAKA 3TFMA 4MY6A 2ELAA 2YS5A 4IAPA 5JHGA 1GC6A 2COAA 2IYBA 4HHVA 2RLOA 2RUKB 1DYNA 4EJNA 3D8EA 2H7EA 5D3VA 4XWXA 5J3QA 2CAYA 4K2PA 4F7HA 4A6HA 2FJLA 3DXEA 1IRSA 5EFXA 2RNRB 3WYFB 1FHXA 1X11A 5HE1A 1XODA 4HAWB 1K5GB 1X1FA 1V5PA 2D2QA 2I1JA 3F0WA 1WJ1A 5CLQB 1LB1A 2HTHB 4HB2B 2NMBA 2J0MA 5J3TA 5KQ4A 2ADZA 1DROA 3N7CA 1P6SA 4TYZA 2GJYA 1XR0B 3QIJA 1DDVA
chains in the Genus database with same CATH superfamily
4HAXB 4CHJA 4EMOA 1AQCA 4CSQA 1U2BA 3KZ1A 5C16A 2ELBA 2AL6A 1I7AA 2D9YA 2K2JA 4GMXB 3PG7A 2D9ZA 2YT1A 3F5RA 4A6KA 1BWNA 1MK7B 4OT1A 3QWMA 1MKEA 3A98B 3NW8A 1U27A 4PQ0A 2I5CA 2XQNM 3BINA 3SUZA 2Z13A 1KI1B 3PEGA 1H10A 4HSIA 3G9WA 2Z59A 2Y7BA 1NTVA 3TO1A 1ZVRA 3AU4A 2QKLA 2I1KA 4EKUA 1MAIA 3U12A 1EAZA 2GCLA 3OANA 2DKQA 5J3YA 1WVHA 2IFSA 4DBBA 4F7GA 2L2IA 3DXDA 1WI1A 1X86A 2KR0A 3ZDTA 5I2SA 5DH9B 3MPXA 2CY5A 2R09A 3OHMB 5D3YA 4KHBB 1I2HA 4BBKA 3WA0A 1TXDA 4D6WA 2M38A 3QBVB 3AJ4A 3UZTA 1J0WA 4HATB 4Z2NA 2MWNB 1MIZB 3O96A 1DDWA 5C5BB 1OY2A 4NY0A 2KIGA 4KAXB 3DCXA 1ZC3B 2KUPA 1V89A 2K2UA 3KSYA 1K5DB 1NU2A 2EJ8A 2L1CA 5C5BA 5LG4B 3AU5A 2J0KA 3U7DA 2DN6A 2Z4DA 2JP2A 3DXCA 1W1GA 1XX0A 4QJ5B 2YSZA 1EF1A 4DXAB 1TJ6A 3X23A 1V61A 5DIFB 3FSSA 5JHHA 1RRPB 2KCJA 3BJIA 1P3RA 2YS1A 3HQCA 1MK9B 4Y94A 2W2XC 2ROVA 2LOXA 1WGUA 2G35A 5IRSA 2QKMA 1SHCA 2VKIA 3D8FA 2P0HA 1QQGA 3ULCA 4KVGB 2Q13A 4DX90 4QJ3B 2E2XA 2K00A 2Z0QA 1E5WA 1KZGA 4ZRKA 2DHKA 1DDMA 1TQZA 3PSCA 5KQ1A 4MT7A 2D9WA 3A58A 3HIEA 3PVUA 1B55A 1WGQA 2R0DA 5HE0A 4YL8A 3NWFA 2COFA 4HAVB 4GNKB 2N23A 4K2OA 1MPHA 5DI9B 1W1DA 4A6FB 1QC6A 1Q67A 2D10A 2KIEA 4HB4B 1XCGA 2OTXA 3IVFA 4DX8A 2UZSA 4ZRJA 2DTCA 2P0DA 1MIXA 2AEHA 2Y8FA 5C79A 2Z0OA 4HAUB 3FM8C 1U5EA 5LOPB 2COCA 1J19A 3D8DA 3V5WA 5HE2A 3MDBC 3GYOA 2DFKA 3TCAA 2DHIA 2YT2A 2MDXA 1FHWA 3ULBA 1M7RA 2FJUB 2DLWA 3ML4A 1V88A 3SV1A 1WJMA 4HB0B 3CXBB 1OQNA 3FVCA 2W2WA 4HB3B 4GMVA 4MK0A 1UEFA 3RCPA 3FEHA 4A6FA 2PZ1A 1U5GA 1FAOA 1H4RA 4GZUA 3PVWA 1UPRA 1BTNA 4OSNA 5JP4A 2P0FA 1X1GA 4NSWA 3TW1A 3U8ZA 1PLSA 1EVHA 2YVCA 3GYPA 1V5MA 2NBVA 3NWDA 1UNQA 4YONA 2OQBA 4CHMA 2ZKMX 1BTKA 3ZVRA 4WVFB 2LOZA 2H7DA 5C6RA 1OMWA 1ISNA 1DBHA 5D3XA 1V5UA 3A8QA 3TVVA 1PMSA 2ZPYA 1U5FA 3KRXA 5GOWB 3HSAA 2UZRA 1ZM0A 2RGNB 1U29A 2CY4A 4QJ4B 2DHJA 2DYNA 4HAZB 2DYQA 5FI0A 4HDOA 3VOQA 2HE7A 4KHOA 4Z2MB 5L81A 1ZC4B 2I5FA 2R2YA 1LW3A 3PP2A 2LG1A 2NZ8B 4GPTB 2GUMA 3HW2B 1SGHA 2ROZB 1GC7A 2LKOA 1AWEA 4QXAB 3PVLA 5CLLB 1EGXA 3HK0A 1PFJA 1U5DA 2D11A 1UNRA 3SNHA 2DX1A 1XD4A 3SO6A 5D3WA 1RJ2A 2W2XD 3KRWA 4PNKA 4WJ7A 3PZDA 5JLJB 2YT0A 4GXBA 1GG3A 2DX5A 1WG7A 2YS3A 2RVBB 1X05A 2DKPA 3KY9A 2GS0A 3SYXA 3ODWA 5HE3A 2CRFA 2P8VA 1UNPA 4HDQA 2N0YA 3P7ZA 3NSUA 1FB8A 1FOEA 2J59M 2MKRA 2YF0A 2X18A 2Z0PA 4KHAA 2EC1A 5DHFB 2LYDA 1M7EA 4P7IA 3ODXA 1Y19B 2YRYA 5I2MA 5KCVA 3B77A 4K81A 2M14A 2Y8GA 1P5TA 1NI2A 3T06A 3A8PA 3NWAA 2J0JA 4WSFA 4DIXA 1Z87A 4IFSA 2Z14A 2UVMA 2VRWB 5FI1A 1XKEA 5LONB 1Y5OA 1UPQA 3ODOA 1ZSQA 2EMSA 4GN1A 1N3HA 4B6HA 2D9VA 2MFQA 4C0AA 5M4YB 2KGXB 4K17A 2CODA 1FGZA 5D27A 4H8SA 5DHAB 1FHOA 4CYEA 2V76A 1W1HA 4HAYB 3CIKA 3LJUX 4TKNA 4A5KA 2D9XA 4ZRIA 2VSZA 4D0NB 2RSGA 1MI1A 2BCJA 1T77A 2DA0A 3M1IB 1ZYIA 2GCJA 2EMTA 4L6EA 1FGYA 1NTYA 4F7UP 2D4QA 2LULA 4KHBA 3VIAA 3P6AA 1KZ7A 4IOYX 1BAKA 2K49A 3TFMA 4MY6A 2ELAA 4GOUA 2YS5A 4IAPA 5JHGA 1GC6A 2COAA 4L1RA 2IYBA 4HHVA 2RLOA 2RUKB 1DYNA 4EJNA 3D8EA 2H7EA 5D3VA 4XWXA 5J3QA 2CAYA 4K2PA 4F7HA 2KUQA 2K8EA 4A6HA 2RRFA 2FJLA 3DXEA 1IRSA 5EFXA 2RNRB 3WYFB 1FHXA 1X11A 5HE1A 1XODA 4HAWB 1K5GB 1X1FA 1V5PA 2D2QA 2I1JA 3F0WA 1WJ1A 5CLQB 1LB1A 2HTHB 4HB2B 2NMBA 2J0MA 5J3TA 5KQ4A 2ADZA 1DROA 3N7CA 1P6SA 4TYZA 2GJYA 1XR0B 3QIJA 1DDVA
chains in the Genus database with same CATH topology
4HAXB 4CHJA 4EMOA 1AQCA 1U2BA 3KZ1A 5C16A 2ELBA 2AL6A 1I7AA 2D9YA 2K2JA 4GMXB 3PG7A 2D9ZA 2YT1A 3F5RA 4A6KA 1BWNA 1MK7B 3QWMA 1MKEA 3A98B 1U27A 4PQ0A 2I5CA 2XQNM 3BINA 3SUZA 3PEGA 1KI1B 1H10A 3G9WA 2Y7BA 1NTVA 3TO1A 1ZVRA 3AU4A 2QKLA 2I1KA 4EKUA 1MAIA 1EAZA 2GCLA 3OANA 2DKQA 5J3YA 1WVHA 2IFSA 4DBBA 4F7GA 2L2IA 3DXDA 1WI1A 1X86A 3ZDTA 5DH9B 3MPXA 2CY5A 2R09A 5D3YA 4KHBB 1I2HA 4BBKA 3WA0A 1TXDA 2M38A 3QBVB 3AJ4A 3UZTA 1J0WA 4HATB 4Z2NA 2MWNB 1MIZB 3O96A 1DDWA 5C5BB 1OY2A 4NY0A 4KAXB 1ZC3B 2KUPA 1V89A 2K2UA 3KSYA 1K5DB 1NU2A 2EJ8A 2L1CA 5C5BA 3AU5A 2J0KA 3U7DA 2DN6A 2JP2A 3DXCA 1W1GA 1XX0A 2YSZA 1EF1A 4DXAB 1TJ6A 3X23A 1V61A 5DIFB 3FSSA 5JHHA 1RRPB 2KCJA 3BJIA 1P3RA 2YS1A 3HQCA 1MK9B 4Y94A 2W2XC 2ROVA 2LOXA 1WGUA 2G35A 2QKMA 1SHCA 2VKIA 3D8FA 2P0HA 1QQGA 3ULCA 4KVGB 2Q13A 4DX90 2E2XA 2K00A 2Z0QA 1E5WA 1KZGA 4ZRKA 2DHKA 1DDMA 1TQZA 3PSCA 5KQ1A 4MT7A 2D9WA 3PVUA 1B55A 1WGQA 2R0DA 5HE0A 4YL8A 2COFA 4HAVB 2N23A 4K2OA 1MPHA 5DI9B 1W1DA 4A6FB 1QC6A 1Q67A 2D10A 4HB4B 1XCGA 2OTXA 3IVFA 4DX8A 2UZSA 4ZRJA 2DTCA 2P0DA 1MIXA 2AEHA 2Y8FA 5C79A 2Z0OA 4HAUB 3FM8C 1U5EA 5LOPB 2COCA 1J19A 3D8DA 3V5WA 5HE2A 3MDBC 3GYOA 2DFKA 3TCAA 2DHIA 2MDXA 1FHWA 3ULBA 1M7RA 2DLWA 3ML4A 1V88A 3SV1A 1WJMA 4HB0B 3CXBB 1OQNA 2W2WA 4HB3B 4GMVA 4MK0A 1UEFA 3RCPA 3FEHA 4A6FA 2PZ1A 1U5GA 1FAOA 1H4RA 4GZUA 3PVWA 1UPRA 1BTNA 5JP4A 2P0FA 1X1GA 4NSWA 3TW1A 3U8ZA 1PLSA 1EVHA 2YVCA 3GYPA 1V5MA 1UNQA 4YONA 2OQBA 4CHMA 1BTKA 3ZVRA 4WVFB 2LOZA 2H7DA 5C6RA 1OMWA 1ISNA 1DBHA 5D3XA 1V5UA 3A8QA 3TVVA 1PMSA 2ZPYA 1U5FA 3KRXA 5GOWB 2UZRA 1ZM0A 2RGNB 1U29A 2CY4A 2DHJA 2DYNA 4HAZB 2DYQA 5FI0A 4HDOA 3VOQA 2HE7A 4KHOA 4Z2MB 5L81A 1ZC4B 2I5FA 1LW3A 3PP2A 2LG1A 2NZ8B 4GPTB 3HW2B 1SGHA 2ROZB 1GC7A 2LKOA 1AWEA 3PVLA 5CLLB 1EGXA 3HK0A 1PFJA 1U5DA 2D11A 1UNRA 3SNHA 2DX1A 1XD4A 3SO6A 5D3WA 1RJ2A 2W2XD 3KRWA 4PNKA 4WJ7A 3PZDA 5JLJB 4GXBA 2YT0A 1GG3A 2DX5A 1WG7A 2YS3A 2RVBB 1X05A 2DKPA 3KY9A 2GS0A 3SYXA 3ODWA 5HE3A 2CRFA 2P8VA 1UNPA 4HDQA 2N0YA 3P7ZA 3NSUA 1FB8A 1FOEA 2J59M 2MKRA 2YF0A 2X18A 2Z0PA 4KHAA 2EC1A 5DHFB 2LYDA 1M7EA 4P7IA 3ODXA 1Y19B 2YRYA 5KCVA 4K81A 2M14A 2Y8GA 1P5TA 1NI2A 3T06A 3A8PA 2J0JA 4WSFA 1Z87A 4IFSA 2UVMA 2VRWB 5FI1A 1XKEA 5LONB 1Y5OA 1UPQA 3ODOA 1ZSQA 2EMSA 4GN1A 1N3HA 4B6HA 2D9VA 2MFQA 4C0AA 2KGXB 4K17A 2CODA 1FGZA 5D27A 4H8SA 5DHAB 1FHOA 4CYEA 2V76A 1W1HA 4HAYB 3CIKA 3LJUX 4TKNA 4A5KA 2D9XA 4ZRIA 2VSZA 4D0NB 2RSGA 2BCJA 2DA0A 3M1IB 2GCJA 2EMTA 4L6EA 1FGYA 1NTYA 4F7UP 2D4QA 2LULA 3VIAA 3P6AA 1KZ7A 4IOYX 1BAKA 3TFMA 4MY6A 2ELAA 2YS5A 4IAPA 5JHGA 1GC6A 2COAA 2IYBA 4HHVA 2RLOA 2RUKB 1DYNA 4EJNA 3D8EA 2H7EA 5D3VA 4XWXA 5J3QA 2CAYA 4K2PA 4F7HA 4A6HA 2FJLA 3DXEA 1IRSA 5EFXA 2RNRB 3WYFB 1FHXA 1X11A 5HE1A 1XODA 4HAWB 1K5GB 1X1FA 1V5PA 2D2QA 2I1JA 3F0WA 1WJ1A 5CLQB 1LB1A 2HTHB 4HB2B 2NMBA 2J0MA 5J3TA 5KQ4A 2ADZA 1DROA 3N7CA 1P6SA 4TYZA 2GJYA 1XR0B 3QIJA 1DDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HAX B;  4CHJ A;  4EMO A;  1AQC A;  1U2B A;  3KZ1 A;  5C16 A;  2ELB A;  2AL6 A;  1I7A A;  2D9Y A;  2K2J A;  4GMX B;  3PG7 A;  2D9Z A;  2YT1 A;  3F5R A;  4A6K A;  1BWN A;  1MK7 B;  3QWM A;  1MKE A;  3A98 B;  1U27 A;  4PQ0 A;  2I5C A;  2XQN M;  3BIN A;  3SUZ A;  3PEG A;  1KI1 B;  1H10 A;  3G9W A;  2Y7B A;  1NTV A;  3TO1 A;  1ZVR A;  3AU4 A;  2QKL A;  2I1K A;  4EKU A;  1MAI A;  1EAZ A;  2GCL A;  3OAN A;  2DKQ A;  5J3Y A;  1WVH A;  2IFS A;  4DBB A;  4F7G A;  2L2I A;  3DXD A;  1WI1 A;  1X86 A;  3ZDT A;  5DH9 B;  3MPX A;  2CY5 A;  2R09 A;  5D3Y A;  4KHB B;  1I2H A;  4BBK A;  3WA0 A;  1TXD A;  2M38 A;  3QBV B;  3AJ4 A;  3UZT A;  1J0W A;  4HAT B;  4Z2N A;  2MWN B;  1MIZ B;  3O96 A;  1DDW A;  5C5B B;  1OY2 A;  4NY0 A;  4KAX B;  1ZC3 B;  2KUP A;  1V89 A;  2K2U A;  3KSY A;  1K5D B;  1NU2 A;  2EJ8 A;  2L1C A;  5C5B A;  3AU5 A;  2J0K A;  3U7D A;  2DN6 A;  2JP2 A;  3DXC A;  1W1G A;  1XX0 A;  2YSZ A;  1EF1 A;  4DXA B;  1TJ6 A;  3X23 A;  1V61 A;  5DIF B;  3FSS A;  5JHH A;  1RRP B;  2KCJ A;  3BJI A;  1P3R A;  2YS1 A;  3HQC A;  1MK9 B;  4Y94 A;  2W2X C;  2ROV A;  2LOX A;  1WGU A;  2G35 A;  2QKM A;  1SHC A;  2VKI A;  3D8F A;  2P0H A;  1QQG A;  3ULC A;  4KVG B;  2Q13 A;  4DX9 0;  2E2X A;  2K00 A;  2Z0Q A;  1E5W A;  1KZG A;  4ZRK A;  2DHK A;  1DDM A;  1TQZ A;  3PSC A;  5KQ1 A;  4MT7 A;  2D9W A;  3PVU A;  1B55 A;  1WGQ A;  2R0D A;  5HE0 A;  4YL8 A;  2COF A;  4HAV B;  2N23 A;  4K2O A;  1MPH A;  5DI9 B;  1W1D A;  4A6F B;  1QC6 A;  1Q67 A;  2D10 A;  4HB4 B;  1XCG A;  2OTX A;  3IVF A;  4DX8 A;  2UZS A;  4ZRJ A;  2DTC A;  2P0D A;  1MIX A;  2AEH A;  2Y8F A;  5C79 A;  2Z0O A;  4HAU B;  3FM8 C;  1U5E A;  5LOP B;  2COC A;  1J19 A;  3D8D A;  3V5W A;  5HE2 A;  3MDB C;  3GYO A;  2DFK A;  3TCA A;  2DHI A;  2MDX A;  1FHW A;  3ULB A;  1M7R A;  2DLW A;  3ML4 A;  1V88 A;  3SV1 A;  1WJM A;  4HB0 B;  3CXB B;  1OQN A;  2W2W A;  4HB3 B;  4GMV A;  4MK0 A;  1UEF A;  3RCP A;  3FEH A;  4A6F A;  2PZ1 A;  1U5G A;  1FAO A;  1H4R A;  4GZU A;  3PVW A;  1UPR A;  1BTN A;  5JP4 A;  2P0F A;  1X1G A;  4NSW A;  3TW1 A;  3U8Z A;  1PLS A;  1EVH A;  2YVC A;  3GYP A;  1V5M A;  1UNQ A;  4YON A;  2OQB A;  4CHM A;  1BTK A;  3ZVR A;  4WVF B;  2LOZ A;  2H7D A;  5C6R A;  1OMW A;  1ISN A;  1DBH A;  5D3X A;  1V5U A;  3A8Q A;  3TVV A;  1PMS A;  2ZPY A;  1U5F A;  3KRX A;  5GOW B;  2UZR A;  1ZM0 A;  2RGN B;  1U29 A;  2CY4 A;  2DHJ A;  2DYN A;  4HAZ B;  2DYQ A;  5FI0 A;  4HDO A;  3VOQ A;  2HE7 A;  4KHO A;  4Z2M B;  5L81 A;  1ZC4 B;  2I5F A;  1LW3 A;  3PP2 A;  2LG1 A;  2NZ8 B;  4GPT B;  3HW2 B;  1SGH A;  2ROZ B;  1GC7 A;  2LKO A;  1AWE A;  3PVL A;  5CLL B;  1EGX A;  3HK0 A;  1PFJ A;  1U5D A;  2D11 A;  1UNR A;  3SNH A;  2DX1 A;  1XD4 A;  3SO6 A;  5D3W A;  1RJ2 A;  2W2X D;  3KRW A;  4PNK A;  4WJ7 A;  3PZD A;  5JLJ B;  4GXB A;  2YT0 A;  1GG3 A;  2DX5 A;  1WG7 A;  2YS3 A;  2RVB B;  1X05 A;  2DKP A;  3KY9 A;  2GS0 A;  3SYX A;  3ODW A;  5HE3 A;  2CRF A;  2P8V A;  1UNP A;  4HDQ A;  2N0Y A;  3P7Z A;  3NSU A;  1FB8 A;  1FOE A;  2J59 M;  2MKR A;  2YF0 A;  2X18 A;  2Z0P A;  4KHA A;  2EC1 A;  5DHF B;  2LYD A;  1M7E A;  4P7I A;  3ODX A;  1Y19 B;  2YRY A;  5KCV A;  4K81 A;  2M14 A;  2Y8G A;  1P5T A;  1NI2 A;  3T06 A;  3A8P A;  2J0J A;  4WSF A;  1Z87 A;  4IFS A;  2UVM A;  2VRW B;  5FI1 A;  1XKE A;  5LON B;  1Y5O A;  1UPQ A;  3ODO A;  1ZSQ A;  2EMS A;  4GN1 A;  1N3H A;  4B6H A;  2D9V A;  2MFQ A;  4C0A A;  2KGX B;  4K17 A;  2COD A;  1FGZ A;  5D27 A;  4H8S A;  5DHA B;  1FHO A;  4CYE A;  2V76 A;  1W1H A;  4HAY B;  3CIK A;  3LJU X;  4TKN A;  4A5K A;  2D9X A;  4ZRI A;  2VSZ A;  4D0N B;  2RSG A;  2BCJ A;  2DA0 A;  3M1I B;  2GCJ A;  2EMT A;  4L6E A;  1FGY A;  1NTY A;  4F7U P;  2D4Q A;  2LUL A;  3VIA A;  3P6A A;  1KZ7 A;  4IOY X;  1BAK A;  3TFM A;  4MY6 A;  2ELA A;  2YS5 A;  4IAP A;  5JHG A;  1GC6 A;  2COA A;  2IYB A;  4HHV A;  2RLO A;  2RUK B;  1DYN A;  4EJN A;  3D8E A;  2H7E A;  5D3V A;  4XWX A;  5J3Q A;  2CAY A;  4K2P A;  4F7H A;  4A6H A;  2FJL A;  3DXE A;  1IRS A;  5EFX A;  2RNR B;  3WYF B;  1FHX A;  1X11 A;  5HE1 A;  1XOD A;  4HAW B;  1K5G B;  1X1F A;  1V5P A;  2D2Q A;  2I1J A;  3F0W A;  1WJ1 A;  5CLQ B;  1LB1 A;  2HTH B;  4HB2 B;  2NMB A;  2J0M A;  5J3T A;  5KQ4 A;  2ADZ A;  1DRO A;  3N7C A;  1P6S A;  4TYZ A;  2GJY A;  1XR0 B;  3QIJ A;  1DDV A; 
#chains in the Genus database with same CATH topology
 4HAX B;  4CHJ A;  4EMO A;  1AQC A;  4CSQ A;  1U2B A;  3KZ1 A;  5C16 A;  2ELB A;  2AL6 A;  1I7A A;  2D9Y A;  2K2J A;  4GMX B;  3PG7 A;  2D9Z A;  2YT1 A;  3F5R A;  4A6K A;  1BWN A;  1MK7 B;  4OT1 A;  3QWM A;  1MKE A;  3A98 B;  3NW8 A;  1U27 A;  4PQ0 A;  2I5C A;  2XQN M;  3BIN A;  3SUZ A;  2Z13 A;  1KI1 B;  3PEG A;  1H10 A;  4HSI A;  3G9W A;  2Z59 A;  2Y7B A;  1NTV A;  3TO1 A;  1ZVR A;  3AU4 A;  2QKL A;  2I1K A;  4EKU A;  1MAI A;  3U12 A;  1EAZ A;  2GCL A;  3OAN A;  2DKQ A;  5J3Y A;  1WVH A;  2IFS A;  4DBB A;  4F7G A;  2L2I A;  3DXD A;  1WI1 A;  1X86 A;  2KR0 A;  3ZDT A;  5I2S A;  5DH9 B;  3MPX A;  2CY5 A;  2R09 A;  3OHM B;  5D3Y A;  4KHB B;  1I2H A;  4BBK A;  3WA0 A;  1TXD A;  4D6W A;  2M38 A;  3QBV B;  3AJ4 A;  3UZT A;  1J0W A;  4HAT B;  4Z2N A;  2MWN B;  1MIZ B;  3O96 A;  1DDW A;  5C5B B;  1OY2 A;  4NY0 A;  2KIG A;  4KAX B;  3DCX A;  1ZC3 B;  2KUP A;  1V89 A;  2K2U A;  3KSY A;  1K5D B;  1NU2 A;  2EJ8 A;  2L1C A;  5C5B A;  5LG4 B;  3AU5 A;  2J0K A;  3U7D A;  2DN6 A;  2Z4D A;  2JP2 A;  3DXC A;  1W1G A;  1XX0 A;  4QJ5 B;  2YSZ A;  1EF1 A;  4DXA B;  1TJ6 A;  3X23 A;  1V61 A;  5DIF B;  3FSS A;  5JHH A;  1RRP B;  2KCJ A;  3BJI A;  1P3R A;  2YS1 A;  3HQC A;  1MK9 B;  4Y94 A;  2W2X C;  2ROV A;  2LOX A;  1WGU A;  2G35 A;  5IRS A;  2QKM A;  1SHC A;  2VKI A;  3D8F A;  2P0H A;  1QQG A;  3ULC A;  4KVG B;  2Q13 A;  4DX9 0;  4QJ3 B;  2E2X A;  2K00 A;  2Z0Q A;  1E5W A;  1KZG A;  4ZRK A;  2DHK A;  1DDM A;  1TQZ A;  3PSC A;  5KQ1 A;  4MT7 A;  2D9W A;  3A58 A;  3HIE A;  3PVU A;  1B55 A;  1WGQ A;  2R0D A;  5HE0 A;  4YL8 A;  3NWF A;  2COF A;  4HAV B;  4GNK B;  2N23 A;  4K2O A;  1MPH A;  5DI9 B;  1W1D A;  4A6F B;  1QC6 A;  1Q67 A;  2D10 A;  2KIE A;  4HB4 B;  1XCG A;  2OTX A;  3IVF A;  4DX8 A;  2UZS A;  4ZRJ A;  2DTC A;  2P0D A;  1MIX A;  2AEH A;  2Y8F A;  5C79 A;  2Z0O A;  4HAU B;  3FM8 C;  1U5E A;  5LOP B;  2COC A;  1J19 A;  3D8D A;  3V5W A;  5HE2 A;  3MDB C;  3GYO A;  2DFK A;  3TCA A;  2DHI A;  2YT2 A;  2MDX A;  1FHW A;  3ULB A;  1M7R A;  2FJU B;  2DLW A;  3ML4 A;  1V88 A;  3SV1 A;  1WJM A;  4HB0 B;  3CXB B;  1OQN A;  3FVC A;  2W2W A;  4HB3 B;  4GMV A;  4MK0 A;  1UEF A;  3RCP A;  3FEH A;  4A6F A;  2PZ1 A;  1U5G A;  1FAO A;  1H4R A;  4GZU A;  3PVW A;  1UPR A;  1BTN A;  4OSN A;  5JP4 A;  2P0F A;  1X1G A;  4NSW A;  3TW1 A;  3U8Z A;  1PLS A;  1EVH A;  2YVC A;  3GYP A;  1V5M A;  2NBV A;  3NWD A;  1UNQ A;  4YON A;  2OQB A;  4CHM A;  2ZKM X;  1BTK A;  3ZVR A;  4WVF B;  2LOZ A;  2H7D A;  5C6R A;  1OMW A;  1ISN A;  1DBH A;  5D3X A;  1V5U A;  3A8Q A;  3TVV A;  1PMS A;  2ZPY A;  1U5F A;  3KRX A;  5GOW B;  3HSA A;  2UZR A;  1ZM0 A;  2RGN B;  1U29 A;  2CY4 A;  4QJ4 B;  2DHJ A;  2DYN A;  4HAZ B;  2DYQ A;  5FI0 A;  4HDO A;  3VOQ A;  2HE7 A;  4KHO A;  4Z2M B;  5L81 A;  1ZC4 B;  2I5F A;  2R2Y A;  1LW3 A;  3PP2 A;  2LG1 A;  2NZ8 B;  4GPT B;  2GUM A;  3HW2 B;  1SGH A;  2ROZ B;  1GC7 A;  2LKO A;  1AWE A;  4QXA B;  3PVL A;  5CLL B;  1EGX A;  3HK0 A;  1PFJ A;  1U5D A;  2D11 A;  1UNR A;  3SNH A;  2DX1 A;  1XD4 A;  3SO6 A;  5D3W A;  1RJ2 A;  2W2X D;  3KRW A;  4PNK A;  4WJ7 A;  3PZD A;  5JLJ B;  2YT0 A;  4GXB A;  1GG3 A;  2DX5 A;  1WG7 A;  2YS3 A;  2RVB B;  1X05 A;  2DKP A;  3KY9 A;  2GS0 A;  3SYX A;  3ODW A;  5HE3 A;  2CRF A;  2P8V A;  1UNP A;  4HDQ A;  2N0Y A;  3P7Z A;  3NSU A;  1FB8 A;  1FOE A;  2J59 M;  2MKR A;  2YF0 A;  2X18 A;  2Z0P A;  4KHA A;  2EC1 A;  5DHF B;  2LYD A;  1M7E A;  4P7I A;  3ODX A;  1Y19 B;  2YRY A;  5I2M A;  5KCV A;  3B77 A;  4K81 A;  2M14 A;  2Y8G A;  1P5T A;  1NI2 A;  3T06 A;  3A8P A;  3NWA A;  2J0J A;  4WSF A;  4DIX A;  1Z87 A;  4IFS A;  2Z14 A;  2UVM A;  2VRW B;  5FI1 A;  1XKE A;  5LON B;  1Y5O A;  1UPQ A;  3ODO A;  1ZSQ A;  2EMS A;  4GN1 A;  1N3H A;  4B6H A;  2D9V A;  2MFQ A;  4C0A A;  5M4Y B;  2KGX B;  4K17 A;  2COD A;  1FGZ A;  5D27 A;  4H8S A;  5DHA B;  1FHO A;  4CYE A;  2V76 A;  1W1H A;  4HAY B;  3CIK A;  3LJU X;  4TKN A;  4A5K A;  2D9X A;  4ZRI A;  2VSZ A;  4D0N B;  2RSG A;  1MI1 A;  2BCJ A;  1T77 A;  2DA0 A;  3M1I B;  1ZYI A;  2GCJ A;  2EMT A;  4L6E A;  1FGY A;  1NTY A;  4F7U P;  2D4Q A;  2LUL A;  4KHB A;  3VIA A;  3P6A A;  1KZ7 A;  4IOY X;  1BAK A;  2K49 A;  3TFM A;  4MY6 A;  2ELA A;  4GOU A;  2YS5 A;  4IAP A;  5JHG A;  1GC6 A;  2COA A;  4L1R A;  2IYB A;  4HHV A;  2RLO A;  2RUK B;  1DYN A;  4EJN A;  3D8E A;  2H7E A;  5D3V A;  4XWX A;  5J3Q A;  2CAY A;  4K2P A;  4F7H A;  2KUQ A;  2K8E A;  4A6H A;  2RRF A;  2FJL A;  3DXE A;  1IRS A;  5EFX A;  2RNR B;  3WYF B;  1FHX A;  1X11 A;  5HE1 A;  1XOD A;  4HAW B;  1K5G B;  1X1F A;  1V5P A;  2D2Q A;  2I1J A;  3F0W A;  1WJ1 A;  5CLQ B;  1LB1 A;  2HTH B;  4HB2 B;  2NMB A;  2J0M A;  5J3T A;  5KQ4 A;  2ADZ A;  1DRO A;  3N7C A;  1P6S A;  4TYZ A;  2GJY A;  1XR0 B;  3QIJ A;  1DDV A; 
#chains in the Genus database with same CATH homology
 4HAX B;  4CHJ A;  4EMO A;  1AQC A;  1U2B A;  3KZ1 A;  5C16 A;  2ELB A;  2AL6 A;  1I7A A;  2D9Y A;  2K2J A;  4GMX B;  3PG7 A;  2D9Z A;  2YT1 A;  3F5R A;  4A6K A;  1BWN A;  1MK7 B;  3QWM A;  1MKE A;  3A98 B;  1U27 A;  4PQ0 A;  2I5C A;  2XQN M;  3BIN A;  3SUZ A;  3PEG A;  1KI1 B;  1H10 A;  3G9W A;  2Y7B A;  1NTV A;  3TO1 A;  1ZVR A;  3AU4 A;  2QKL A;  2I1K A;  4EKU A;  1MAI A;  1EAZ A;  2GCL A;  3OAN A;  2DKQ A;  5J3Y A;  1WVH A;  2IFS A;  4DBB A;  4F7G A;  2L2I A;  3DXD A;  1WI1 A;  1X86 A;  3ZDT A;  5DH9 B;  3MPX A;  2CY5 A;  2R09 A;  5D3Y A;  4KHB B;  1I2H A;  4BBK A;  3WA0 A;  1TXD A;  2M38 A;  3QBV B;  3AJ4 A;  3UZT A;  1J0W A;  4HAT B;  4Z2N A;  2MWN B;  1MIZ B;  3O96 A;  1DDW A;  5C5B B;  1OY2 A;  4NY0 A;  4KAX B;  1ZC3 B;  2KUP A;  1V89 A;  2K2U A;  3KSY A;  1K5D B;  1NU2 A;  2EJ8 A;  2L1C A;  5C5B A;  3AU5 A;  2J0K A;  3U7D A;  2DN6 A;  2JP2 A;  3DXC A;  1W1G A;  1XX0 A;  2YSZ A;  1EF1 A;  4DXA B;  1TJ6 A;  3X23 A;  1V61 A;  5DIF B;  3FSS A;  5JHH A;  1RRP B;  2KCJ A;  3BJI A;  1P3R A;  2YS1 A;  3HQC A;  1MK9 B;  4Y94 A;  2W2X C;  2ROV A;  2LOX A;  1WGU A;  2G35 A;  2QKM A;  1SHC A;  2VKI A;  3D8F A;  2P0H A;  1QQG A;  3ULC A;  4KVG B;  2Q13 A;  4DX9 0;  2E2X A;  2K00 A;  2Z0Q A;  1E5W A;  1KZG A;  4ZRK A;  2DHK A;  1DDM A;  1TQZ A;  3PSC A;  5KQ1 A;  4MT7 A;  2D9W A;  3PVU A;  1B55 A;  1WGQ A;  2R0D A;  5HE0 A;  4YL8 A;  2COF A;  4HAV B;  2N23 A;  4K2O A;  1MPH A;  5DI9 B;  1W1D A;  4A6F B;  1QC6 A;  1Q67 A;  2D10 A;  4HB4 B;  1XCG A;  2OTX A;  3IVF A;  4DX8 A;  2UZS A;  4ZRJ A;  2DTC A;  2P0D A;  1MIX A;  2AEH A;  2Y8F A;  5C79 A;  2Z0O A;  4HAU B;  3FM8 C;  1U5E A;  5LOP B;  2COC A;  1J19 A;  3D8D A;  3V5W A;  5HE2 A;  3MDB C;  3GYO A;  2DFK A;  3TCA A;  2DHI A;  2MDX A;  1FHW A;  3ULB A;  1M7R A;  2DLW A;  3ML4 A;  1V88 A;  3SV1 A;  1WJM A;  4HB0 B;  3CXB B;  1OQN A;  2W2W A;  4HB3 B;  4GMV A;  4MK0 A;  1UEF A;  3RCP A;  3FEH A;  4A6F A;  2PZ1 A;  1U5G A;  1FAO A;  1H4R A;  4GZU A;  3PVW A;  1UPR A;  1BTN A;  5JP4 A;  2P0F A;  1X1G A;  4NSW A;  3TW1 A;  3U8Z A;  1PLS A;  1EVH A;  2YVC A;  3GYP A;  1V5M A;  1UNQ A;  4YON A;  2OQB A;  4CHM A;  1BTK A;  3ZVR A;  4WVF B;  2LOZ A;  2H7D A;  5C6R A;  1OMW A;  1ISN A;  1DBH A;  5D3X A;  1V5U A;  3A8Q A;  3TVV A;  1PMS A;  2ZPY A;  1U5F A;  3KRX A;  5GOW B;  2UZR A;  1ZM0 A;  2RGN B;  1U29 A;  2CY4 A;  2DHJ A;  2DYN A;  4HAZ B;  2DYQ A;  5FI0 A;  4HDO A;  3VOQ A;  2HE7 A;  4KHO A;  4Z2M B;  5L81 A;  1ZC4 B;  2I5F A;  1LW3 A;  3PP2 A;  2LG1 A;  2NZ8 B;  4GPT B;  3HW2 B;  1SGH A;  2ROZ B;  1GC7 A;  2LKO A;  1AWE A;  3PVL A;  5CLL B;  1EGX A;  3HK0 A;  1PFJ A;  1U5D A;  2D11 A;  1UNR A;  3SNH A;  2DX1 A;  1XD4 A;  3SO6 A;  5D3W A;  1RJ2 A;  2W2X D;  3KRW A;  4PNK A;  4WJ7 A;  3PZD A;  5JLJ B;  4GXB A;  2YT0 A;  1GG3 A;  2DX5 A;  1WG7 A;  2YS3 A;  2RVB B;  1X05 A;  2DKP A;  3KY9 A;  2GS0 A;  3SYX A;  3ODW A;  5HE3 A;  2CRF A;  2P8V A;  1UNP A;  4HDQ A;  2N0Y A;  3P7Z A;  3NSU A;  1FB8 A;  1FOE A;  2J59 M;  2MKR A;  2YF0 A;  2X18 A;  2Z0P A;  4KHA A;  2EC1 A;  5DHF B;  2LYD A;  1M7E A;  4P7I A;  3ODX A;  1Y19 B;  2YRY A;  5KCV A;  4K81 A;  2M14 A;  2Y8G A;  1P5T A;  1NI2 A;  3T06 A;  3A8P A;  2J0J A;  4WSF A;  1Z87 A;  4IFS A;  2UVM A;  2VRW B;  5FI1 A;  1XKE A;  5LON B;  1Y5O A;  1UPQ A;  3ODO A;  1ZSQ A;  2EMS A;  4GN1 A;  1N3H A;  4B6H A;  2D9V A;  2MFQ A;  4C0A A;  2KGX B;  4K17 A;  2COD A;  1FGZ A;  5D27 A;  4H8S A;  5DHA B;  1FHO A;  4CYE A;  2V76 A;  1W1H A;  4HAY B;  3CIK A;  3LJU X;  4TKN A;  4A5K A;  2D9X A;  4ZRI A;  2VSZ A;  4D0N B;  2RSG A;  2BCJ A;  2DA0 A;  3M1I B;  2GCJ A;  2EMT A;  4L6E A;  1FGY A;  1NTY A;  4F7U P;  2D4Q A;  2LUL A;  3VIA A;  3P6A A;  1KZ7 A;  4IOY X;  1BAK A;  3TFM A;  4MY6 A;  2ELA A;  2YS5 A;  4IAP A;  5JHG A;  1GC6 A;  2COA A;  2IYB A;  4HHV A;  2RLO A;  2RUK B;  1DYN A;  4EJN A;  3D8E A;  2H7E A;  5D3V A;  4XWX A;  5J3Q A;  2CAY A;  4K2P A;  4F7H A;  4A6H A;  2FJL A;  3DXE A;  1IRS A;  5EFX A;  2RNR B;  3WYF B;  1FHX A;  1X11 A;  5HE1 A;  1XOD A;  4HAW B;  1K5G B;  1X1F A;  1V5P A;  2D2Q A;  2I1J A;  3F0W A;  1WJ1 A;  5CLQ B;  1LB1 A;  2HTH B;  4HB2 B;  2NMB A;  2J0M A;  5J3T A;  5KQ4 A;  2ADZ A;  1DRO A;  3N7C A;  1P6S A;  4TYZ A;  2GJY A;  1XR0 B;  3QIJ A;  1DDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...