1PLSA

Solution structure of a pleckstrin homology domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
113
structure length
113
Chain Sequence
MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVFKITTTKQQDHFFQAAFLEERDAWVRDINKAIKCIEGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a pleckstrin-homology domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Phosphorylation
molecule keywords PLECKSTRIN HOMOLOGY DOMAIN
total genus 14
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 1994-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1plsA00
4HHVA 2H7DA 1WJMA 1P6SA 1FHWA 3KRWA 1UPQA 4HAVB 2LKOA 3O96A 1KZ7A 1N3HA 5DI9B 4HDOA 1LB1A 2IFSA 2R0DA 5DH9B 4P7IA 1ZC4B 4KHOA 2N0YA 1FB8A 2K2JA 4HDQA 1H4RA 1FGYA 1NTYA 2BCJA 4F7UP 2CODA 3P7ZA 5GOWB 2I5CA 4A6HA 5L81A 4GXBA 2GS0A 1ISNA 1LW3A 2LG1A 2J0KA 2VRWB 1H10A 1TJ6A 4KHBB 1OQNA 4HATB 4NSWA 3BINA 1U5FA 5LONB 3ZVRA 3DXCA 4HB0B 3LJUX 1K5DB 1FGZA 1V5PA 2ZPYA 4IFSA 3HW2B 3PEGA 5D3YA 3A98B 2K2UA 3AU5A 1ZSQA 2J0JA 1EAZA 2RNRB 3NSUA 2CY5A 2OQBA 3PP2A 2Z0OA 3KRXA 3U8ZA 2DA0A 3F0WA 4K2PA 3TVVA 1M7RA 4A5KA 2GCJA 3ULBA 2VSZA 3WA0A 3SO6A 3AU4A 1GC6A 3D8FA 4IAPA 5D27A 4F7GA 4KHAA 5DHFB 4A6KA 1J19A 1Q67A 4C0AA 3ODXA 1XX0A 1X11A 2I1KA 1I7AA 4MY6A 3VIAA 2P0FA 5DIFB 2DKQA 1GG3A 2NMBA 1X05A 1OMWA 3QIJA 2KCJA 3KZ1A 1U27A 3QWMA 2M38A 5FI1A 2NZ8B 3ODOA 2DYQA 2P8VA 1FHOA 3SYXA 2GCLA 1W1HA 1ZC3B 1B55A 1FHXA 3A8QA 2ELAA 2AEHA 3QBVB 5JHGA 4K2OA 4WSFA 2COFA 4Y94A 1MK9B 2RGNB 1MIZB 2UZRA 2DHKA 2LOZA 3DXEA 1U5DA 3SUZA 1E5WA 3WYFB 2Y7BA 1DDWA 4GZUA 2LOXA 3SV1A 3GYOA 2Y8GA 1U2BA 3P6AA 3M1IB 4B6HA 2LULA 1U5GA 3BJIA 1EVHA 2RSGA 5J3YA 2W2XD 1GC7A 2EJ8A 1PFJA 2L1CA 2J59M 1RRPB 5KQ1A 2YF0A 1SGHA 2YT1A 1Y5OA 1XKEA 5JP4A 1MIXA 4XWXA 2G35A 3N7CA 4WVFB 4Z2NA 2GJYA 2HE7A 2CY4A 4EKUA 2P0HA 4D0NB 1WGQA 5C79A 5JLJB 4PNKA 1W1DA 4F7HA 3ODWA 1UNRA 5D3VA 4HB3B 1WGUA 2D4QA 3HQCA 3GYPA 3D8EA 4DXAB 1V5MA 2XQNM 3UZTA 1BTNA 1AWEA 2YS3A 3ZDTA 2YS1A 4A6FB 2DKPA 2MFQA 4EJNA 4GPTB 2CRFA 1DBHA 3ULCA 4GN1A 2MWNB 3DXDA 2D9WA 3D8DA 2KGXB 1P3RA 1UNPA 3A8PA 1XD4A 5C16A 1DYNA 2DTCA 2D2QA 1PMSA 5HE0A 4EMOA 1DROA 5KCVA 1W1GA 4DBBA 3AJ4A 1MK7B 5LOPB 3PVUA 4GMVA 5C5BA 2YVCA 3TW1A 4NY0A 2D9YA 1ZVRA 3FEHA 3HK0A 4MK0A 5C6RA 1WVHA 2Z0PA 2DN6A 1X1GA 1WI1A 3TCAA 5HE1A 2LYDA 5J3TA 2H7EA 1J0WA 1UEFA 1V5UA 2UZSA 1DDVA 2P0DA 4HAZB 1Z87A 1PLSA 1X1FA 2I5FA 1Y19B 2E2XA 2X18A 1NU2A 4K17A 2D10A 1XCGA 3TO1A 3KY9A 4L6EA 1M7EA 4TKNA 5CLLB 4CHJA 3MPXA 2AL6A 4ZRKA 4MT7A 2N23A 5D3WA 1BWNA 2Y8FA 4WJ7A 1KI1B 3PVWA 2YSZA 2FJLA 2CAYA 2ROVA 1MKEA 2W2WA 3G9WA 5DHAB 2EMSA 4HB4B 3PVLA 1KZGA 2QKLA 4PQ0A 3PG7A 1TXDA 1V88A 2YS5A 2M14A 2JP2A 4Z2MB 5CLQB 2EC1A 4CHMA 1U5EA 2L2IA 1FOEA 1X86A 4HAXB 1IRSA 4K81A 4CYEA 3PSCA 3OANA 1QQGA 2I1JA 5EFXA 2UVMA 4YL8A 1EF1A 1SHCA 1UNQA 2Q13A 5J3QA 1K5GB 3FM8C 5KQ4A 2J0MA 4GMXB 3CIKA 4A6FA 2QKMA 1V89A 3TFMA 2DYNA 2EMTA 2MDXA 2DHJA 4IOYX 1BTKA 4HAWB 2KUPA 2RUKB 3ML4A 3T06A 3VOQA 1AQCA 3F5RA 2DX5A 1NI2A 2YT0A 2D9XA 4HAUB 4KAXB 5HE2A 1MPHA 3V5WA 2D11A 1TQZA 3RCPA 1FAOA 2Z0QA 2PZ1A 2ADZA 5FI0A 1MAIA 5C5BB 1WG7A 2DX1A 4ZRJA 3CXBB 1ZM0A 3KSYA 2YRYA 4TYZA 2RVBB 3FSSA 2R09A 2DHIA 1RJ2A 4H8SA 2K00A 1XODA 1UPRA 1DDMA 2RLOA 2HTHB 1QC6A 1I2HA 2ELBA 3X23A 4HB2B 1NTVA 2VKIA 4DX90 3IVFA 1U29A 1WJ1A 4YONA 3MDBC 5D3XA 2OTXA 3U7DA 1OY2A 2D9ZA 2DFKA 4ZRIA 1EGXA 2IYBA 2MKRA 1V61A 4DX8A 2COCA 2COAA 1XR0B 2DLWA 4BBKA 4HAYB 3PZDA 2W2XC 5JHHA 1P5TA 3SNHA 5HE3A 2V76A 1BAKA 2ROZB 2D9VA 4KVGB
chains in the Genus database with same CATH superfamily
4HHVA 2H7DA 1WJMA 1P6SA 1FHWA 3KRWA 1UPQA 4HAVB 2LKOA 3O96A 1KZ7A 1N3HA 1T77A 5DI9B 4HDOA 1LB1A 2IFSA 2R0DA 5DH9B 4P7IA 1ZC4B 4KHOA 2N0YA 1FB8A 2K2JA 4HDQA 1H4RA 1FGYA 1NTYA 2BCJA 2K8EA 4F7UP 2CODA 3P7ZA 5GOWB 4QXAB 2I5CA 4A6HA 5L81A 4GXBA 4DIXA 2GS0A 2ZKMX 1ISNA 1LW3A 2LG1A 2J0KA 2VRWB 1H10A 1TJ6A 3HSAA 4KHBB 2KIEA 1OQNA 3OHMB 4HATB 4NSWA 3DCXA 3BINA 1U5FA 5LONB 3ZVRA 3DXCA 5LG4B 4HB0B 3LJUX 1K5DB 1FGZA 1V5PA 2ZPYA 4IFSA 4GNKB 3HW2B 3NW8A 5M4YB 3PEGA 5D3YA 3A98B 2K2UA 3AU5A 1ZSQA 2J0JA 2KR0A 1EAZA 2RNRB 3NSUA 2Z4DA 2CY5A 3PP2A 2OQBA 2Z0OA 2KUQA 3KRXA 3U8ZA 2DA0A 3F0WA 4K2PA 3TVVA 1M7RA 4A5KA 2NBVA 2GCJA 3ULBA 2VSZA 3WA0A 3SO6A 3NWDA 3AU4A 1GC6A 3D8FA 4IAPA 5D27A 4F7GA 4KHAA 5DHFB 4A6KA 1J19A 1Q67A 4C0AA 2Z59A 3ODXA 1XX0A 1X11A 2I1KA 1I7AA 4MY6A 3VIAA 2P0FA 5DIFB 2DKQA 1GG3A 2NMBA 1X05A 1OMWA 3QIJA 2KCJA 3KZ1A 4KHBA 1U27A 3QWMA 2M38A 5FI1A 2NZ8B 3ODOA 2DYQA 2P8VA 1FHOA 5IRSA 3SYXA 2GCLA 1W1HA 1ZC3B 1B55A 1FHXA 3A8QA 2ELAA 2AEHA 3QBVB 5JHGA 4K2OA 4WSFA 2COFA 4Y94A 1MK9B 2RGNB 1MIZB 2UZRA 2DHKA 2LOZA 3DXEA 1U5DA 3SUZA 1E5WA 3WYFB 2Y7BA 1DDWA 4GZUA 5I2SA 3A58A 2LOXA 3SV1A 3GYOA 2Y8GA 1U2BA 3P6AA 3M1IB 4B6HA 2LULA 1U5GA 3BJIA 1EVHA 2RSGA 5J3YA 2W2XD 1GC7A 2EJ8A 1PFJA 4L1RA 2L1CA 2J59M 1RRPB 5KQ1A 2Z14A 2YF0A 2GUMA 3NWAA 1SGHA 2YT1A 1Y5OA 1XKEA 5JP4A 1MIXA 4XWXA 2G35A 3N7CA 4WVFB 4HSIA 4Z2NA 4CSQA 2GJYA 2HE7A 2CY4A 4EKUA 2P0HA 4D0NB 1WGQA 5C79A 5JLJB 4PNKA 1W1DA 4F7HA 4OSNA 3HIEA 3ODWA 1UNRA 5D3VA 4HB3B 1WGUA 2K49A 2D4QA 3HQCA 1MI1A 3GYPA 3D8EA 4DXAB 1V5MA 2XQNM 3UZTA 1BTNA 1AWEA 2YS3A 3ZDTA 2YS1A 4A6FB 2DKPA 2MFQA 4EJNA 4GPTB 2CRFA 1DBHA 3ULCA 4GN1A 2MWNB 3DXDA 2D9WA 3D8DA 2KGXB 1P3RA 1UNPA 3A8PA 1XD4A 5C16A 1DYNA 2DTCA 2D2QA 1PMSA 5HE0A 4EMOA 1DROA 5KCVA 1W1GA 2R2YA 4DBBA 3AJ4A 1MK7B 5LOPB 3PVUA 4GMVA 5C5BA 2YVCA 3TW1A 4NY0A 2D9YA 4QJ4B 1ZVRA 3FEHA 3HK0A 4MK0A 5C6RA 1WVHA 2Z0PA 2DN6A 1X1GA 2KIGA 5I2MA 4QJ3B 1WI1A 3TCAA 5HE1A 2LYDA 5J3TA 2H7EA 1J0WA 1UEFA 1V5UA 2UZSA 1DDVA 2P0DA 4HAZB 4QJ5B 1Z87A 1PLSA 1X1FA 2FJUB 1Y19B 2E2XA 2I5FA 2X18A 1NU2A 4K17A 2D10A 1XCGA 3NWFA 3TO1A 3KY9A 4L6EA 1M7EA 4TKNA 5CLLB 4CHJA 3MPXA 2AL6A 4ZRKA 4MT7A 2N23A 5D3WA 1BWNA 2Z13A 2Y8FA 4WJ7A 1KI1B 4D6WA 3PVWA 2YSZA 2FJLA 2CAYA 2ROVA 1MKEA 2W2WA 3G9WA 5DHAB 2EMSA 4HB4B 3PVLA 1KZGA 2QKLA 4PQ0A 3PG7A 1TXDA 1V88A 2YS5A 2M14A 2JP2A 4Z2MB 5CLQB 2EC1A 4CHMA 1U5EA 2L2IA 1FOEA 1X86A 4HAXB 1IRSA 4K81A 4CYEA 3PSCA 3OANA 1QQGA 2I1JA 4OT1A 5EFXA 2UVMA 4YL8A 1EF1A 1SHCA 1UNQA 2Q13A 3B77A 5J3QA 1K5GB 3FM8C 5KQ4A 2J0MA 4GMXB 3CIKA 4A6FA 2QKMA 1V89A 3TFMA 3FVCA 2DYNA 2EMTA 2RRFA 2MDXA 2DHJA 4IOYX 1BTKA 4HAWB 2KUPA 2RUKB 3ML4A 3T06A 3VOQA 1AQCA 3F5RA 1ZYIA 2DX5A 1NI2A 2YT0A 2D9XA 4HAUB 4KAXB 5HE2A 1MPHA 3V5WA 2D11A 1TQZA 3RCPA 1FAOA 2Z0QA 2PZ1A 2ADZA 2YT2A 1MAIA 5FI0A 5C5BB 1WG7A 2DX1A 4ZRJA 3CXBB 3KSYA 1ZM0A 2YRYA 4TYZA 2RVBB 3FSSA 2R09A 2DHIA 1RJ2A 4H8SA 2K00A 1XODA 1UPRA 1DDMA 2RLOA 2HTHB 1QC6A 1I2HA 2ELBA 3X23A 4HB2B 1NTVA 2VKIA 4DX90 3IVFA 1U29A 1WJ1A 4YONA 3MDBC 5D3XA 2OTXA 3U7DA 1OY2A 2D9ZA 2DFKA 4ZRIA 1EGXA 4GOUA 2IYBA 2MKRA 1V61A 4DX8A 2COCA 2COAA 1XR0B 2DLWA 4BBKA 4HAYB 3PZDA 2W2XC 5JHHA 1P5TA 3SNHA 5HE3A 2V76A 3U12A 1BAKA 2ROZB 2D9VA 4KVGB
chains in the Genus database with same CATH topology
4HHVA 2H7DA 1WJMA 1P6SA 1FHWA 3KRWA 1UPQA 4HAVB 2LKOA 3O96A 1KZ7A 1N3HA 5DI9B 4HDOA 1LB1A 2IFSA 2R0DA 5DH9B 4P7IA 1ZC4B 4KHOA 2N0YA 1FB8A 2K2JA 4HDQA 1H4RA 1FGYA 1NTYA 2BCJA 4F7UP 2CODA 3P7ZA 5GOWB 2I5CA 4A6HA 5L81A 4GXBA 2GS0A 1ISNA 1LW3A 2LG1A 2J0KA 2VRWB 1H10A 1TJ6A 4KHBB 1OQNA 4HATB 4NSWA 3BINA 1U5FA 5LONB 3ZVRA 3DXCA 4HB0B 3LJUX 1K5DB 1FGZA 1V5PA 2ZPYA 4IFSA 3HW2B 3PEGA 5D3YA 3A98B 2K2UA 3AU5A 1ZSQA 2J0JA 1EAZA 2RNRB 3NSUA 2CY5A 2OQBA 3PP2A 2Z0OA 3KRXA 3U8ZA 2DA0A 3F0WA 4K2PA 3TVVA 1M7RA 4A5KA 2GCJA 3ULBA 2VSZA 3WA0A 3SO6A 3AU4A 1GC6A 3D8FA 4IAPA 5D27A 4F7GA 4KHAA 5DHFB 4A6KA 1J19A 1Q67A 4C0AA 3ODXA 1XX0A 1X11A 2I1KA 1I7AA 4MY6A 3VIAA 2P0FA 5DIFB 2DKQA 1GG3A 2NMBA 1X05A 1OMWA 3QIJA 2KCJA 3KZ1A 1U27A 3QWMA 2M38A 5FI1A 2NZ8B 3ODOA 2DYQA 2P8VA 1FHOA 3SYXA 2GCLA 1W1HA 1ZC3B 1B55A 1FHXA 3A8QA 2ELAA 2AEHA 3QBVB 5JHGA 4K2OA 4WSFA 2COFA 4Y94A 1MK9B 2RGNB 1MIZB 2UZRA 2DHKA 2LOZA 3DXEA 1U5DA 3SUZA 1E5WA 3WYFB 2Y7BA 1DDWA 4GZUA 2LOXA 3SV1A 3GYOA 2Y8GA 1U2BA 3P6AA 3M1IB 4B6HA 2LULA 1U5GA 3BJIA 1EVHA 2RSGA 5J3YA 2W2XD 1GC7A 2EJ8A 1PFJA 2L1CA 2J59M 1RRPB 5KQ1A 2YF0A 1SGHA 2YT1A 1Y5OA 1XKEA 5JP4A 1MIXA 4XWXA 2G35A 3N7CA 4WVFB 4Z2NA 2GJYA 2HE7A 2CY4A 4EKUA 2P0HA 4D0NB 1WGQA 5C79A 5JLJB 4PNKA 1W1DA 4F7HA 3ODWA 1UNRA 5D3VA 4HB3B 1WGUA 2D4QA 3HQCA 3GYPA 3D8EA 4DXAB 1V5MA 2XQNM 3UZTA 1BTNA 1AWEA 2YS3A 3ZDTA 2YS1A 4A6FB 2DKPA 2MFQA 4EJNA 4GPTB 2CRFA 1DBHA 3ULCA 4GN1A 2MWNB 3DXDA 2D9WA 3D8DA 2KGXB 1P3RA 1UNPA 3A8PA 1XD4A 5C16A 1DYNA 2DTCA 2D2QA 1PMSA 5HE0A 4EMOA 1DROA 5KCVA 1W1GA 4DBBA 3AJ4A 1MK7B 5LOPB 3PVUA 4GMVA 5C5BA 2YVCA 3TW1A 4NY0A 2D9YA 1ZVRA 3FEHA 3HK0A 4MK0A 5C6RA 1WVHA 2Z0PA 2DN6A 1X1GA 1WI1A 3TCAA 5HE1A 2LYDA 5J3TA 2H7EA 1J0WA 1UEFA 1V5UA 2UZSA 1DDVA 2P0DA 4HAZB 1Z87A 1PLSA 1X1FA 2I5FA 1Y19B 2E2XA 2X18A 1NU2A 4K17A 2D10A 1XCGA 3TO1A 3KY9A 4L6EA 1M7EA 4TKNA 5CLLB 4CHJA 3MPXA 2AL6A 4ZRKA 4MT7A 2N23A 5D3WA 1BWNA 2Y8FA 4WJ7A 1KI1B 3PVWA 2YSZA 2FJLA 2CAYA 2ROVA 1MKEA 2W2WA 3G9WA 5DHAB 2EMSA 4HB4B 3PVLA 1KZGA 2QKLA 4PQ0A 3PG7A 1TXDA 1V88A 2YS5A 2M14A 2JP2A 4Z2MB 5CLQB 2EC1A 4CHMA 1U5EA 2L2IA 1FOEA 1X86A 4HAXB 1IRSA 4K81A 4CYEA 3PSCA 3OANA 1QQGA 2I1JA 5EFXA 2UVMA 4YL8A 1EF1A 1SHCA 1UNQA 2Q13A 5J3QA 1K5GB 3FM8C 5KQ4A 2J0MA 4GMXB 3CIKA 4A6FA 2QKMA 1V89A 3TFMA 2DYNA 2EMTA 2MDXA 2DHJA 4IOYX 1BTKA 4HAWB 2KUPA 2RUKB 3ML4A 3T06A 3VOQA 1AQCA 3F5RA 2DX5A 1NI2A 2YT0A 2D9XA 4HAUB 4KAXB 5HE2A 1MPHA 3V5WA 2D11A 1TQZA 3RCPA 1FAOA 2Z0QA 2PZ1A 2ADZA 5FI0A 1MAIA 5C5BB 1WG7A 2DX1A 4ZRJA 3CXBB 1ZM0A 3KSYA 2YRYA 4TYZA 2RVBB 3FSSA 2R09A 2DHIA 1RJ2A 4H8SA 2K00A 1XODA 1UPRA 1DDMA 2RLOA 2HTHB 1QC6A 1I2HA 2ELBA 3X23A 4HB2B 1NTVA 2VKIA 4DX90 3IVFA 1U29A 1WJ1A 4YONA 3MDBC 5D3XA 2OTXA 3U7DA 1OY2A 2D9ZA 2DFKA 4ZRIA 1EGXA 2IYBA 2MKRA 1V61A 4DX8A 2COCA 2COAA 1XR0B 2DLWA 4BBKA 4HAYB 3PZDA 2W2XC 5JHHA 1P5TA 3SNHA 5HE3A 2V76A 1BAKA 2ROZB 2D9VA 4KVGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HHV A;  2H7D A;  1WJM A;  1P6S A;  1FHW A;  3KRW A;  1UPQ A;  4HAV B;  2LKO A;  3O96 A;  1KZ7 A;  1N3H A;  5DI9 B;  4HDO A;  1LB1 A;  2IFS A;  2R0D A;  5DH9 B;  4P7I A;  1ZC4 B;  4KHO A;  2N0Y A;  1FB8 A;  2K2J A;  4HDQ A;  1H4R A;  1FGY A;  1NTY A;  2BCJ A;  4F7U P;  2COD A;  3P7Z A;  5GOW B;  2I5C A;  4A6H A;  5L81 A;  4GXB A;  2GS0 A;  1ISN A;  1LW3 A;  2LG1 A;  2J0K A;  2VRW B;  1H10 A;  1TJ6 A;  4KHB B;  1OQN A;  4HAT B;  4NSW A;  3BIN A;  1U5F A;  5LON B;  3ZVR A;  3DXC A;  4HB0 B;  3LJU X;  1K5D B;  1FGZ A;  1V5P A;  2ZPY A;  4IFS A;  3HW2 B;  3PEG A;  5D3Y A;  3A98 B;  2K2U A;  3AU5 A;  1ZSQ A;  2J0J A;  1EAZ A;  2RNR B;  3NSU A;  2CY5 A;  2OQB A;  3PP2 A;  2Z0O A;  3KRX A;  3U8Z A;  2DA0 A;  3F0W A;  4K2P A;  3TVV A;  1M7R A;  4A5K A;  2GCJ A;  3ULB A;  2VSZ A;  3WA0 A;  3SO6 A;  3AU4 A;  1GC6 A;  3D8F A;  4IAP A;  5D27 A;  4F7G A;  4KHA A;  5DHF B;  4A6K A;  1J19 A;  1Q67 A;  4C0A A;  3ODX A;  1XX0 A;  1X11 A;  2I1K A;  1I7A A;  4MY6 A;  3VIA A;  2P0F A;  5DIF B;  2DKQ A;  1GG3 A;  2NMB A;  1X05 A;  1OMW A;  3QIJ A;  2KCJ A;  3KZ1 A;  1U27 A;  3QWM A;  2M38 A;  5FI1 A;  2NZ8 B;  3ODO A;  2DYQ A;  2P8V A;  1FHO A;  3SYX A;  2GCL A;  1W1H A;  1ZC3 B;  1B55 A;  1FHX A;  3A8Q A;  2ELA A;  2AEH A;  3QBV B;  5JHG A;  4K2O A;  4WSF A;  2COF A;  4Y94 A;  1MK9 B;  2RGN B;  1MIZ B;  2UZR A;  2DHK A;  2LOZ A;  3DXE A;  1U5D A;  3SUZ A;  1E5W A;  3WYF B;  2Y7B A;  1DDW A;  4GZU A;  2LOX A;  3SV1 A;  3GYO A;  2Y8G A;  1U2B A;  3P6A A;  3M1I B;  4B6H A;  2LUL A;  1U5G A;  3BJI A;  1EVH A;  2RSG A;  5J3Y A;  2W2X D;  1GC7 A;  2EJ8 A;  1PFJ A;  2L1C A;  2J59 M;  1RRP B;  5KQ1 A;  2YF0 A;  1SGH A;  2YT1 A;  1Y5O A;  1XKE A;  5JP4 A;  1MIX A;  4XWX A;  2G35 A;  3N7C A;  4WVF B;  4Z2N A;  2GJY A;  2HE7 A;  2CY4 A;  4EKU A;  2P0H A;  4D0N B;  1WGQ A;  5C79 A;  5JLJ B;  4PNK A;  1W1D A;  4F7H A;  3ODW A;  1UNR A;  5D3V A;  4HB3 B;  1WGU A;  2D4Q A;  3HQC A;  3GYP A;  3D8E A;  4DXA B;  1V5M A;  2XQN M;  3UZT A;  1BTN A;  1AWE A;  2YS3 A;  3ZDT A;  2YS1 A;  4A6F B;  2DKP A;  2MFQ A;  4EJN A;  4GPT B;  2CRF A;  1DBH A;  3ULC A;  4GN1 A;  2MWN B;  3DXD A;  2D9W A;  3D8D A;  2KGX B;  1P3R A;  1UNP A;  3A8P A;  1XD4 A;  5C16 A;  1DYN A;  2DTC A;  2D2Q A;  1PMS A;  5HE0 A;  4EMO A;  1DRO A;  5KCV A;  1W1G A;  4DBB A;  3AJ4 A;  1MK7 B;  5LOP B;  3PVU A;  4GMV A;  5C5B A;  2YVC A;  3TW1 A;  4NY0 A;  2D9Y A;  1ZVR A;  3FEH A;  3HK0 A;  4MK0 A;  5C6R A;  1WVH A;  2Z0P A;  2DN6 A;  1X1G A;  1WI1 A;  3TCA A;  5HE1 A;  2LYD A;  5J3T A;  2H7E A;  1J0W A;  1UEF A;  1V5U A;  2UZS A;  1DDV A;  2P0D A;  4HAZ B;  1Z87 A;  1PLS A;  1X1F A;  2I5F A;  1Y19 B;  2E2X A;  2X18 A;  1NU2 A;  4K17 A;  2D10 A;  1XCG A;  3TO1 A;  3KY9 A;  4L6E A;  1M7E A;  4TKN A;  5CLL B;  4CHJ A;  3MPX A;  2AL6 A;  4ZRK A;  4MT7 A;  2N23 A;  5D3W A;  1BWN A;  2Y8F A;  4WJ7 A;  1KI1 B;  3PVW A;  2YSZ A;  2FJL A;  2CAY A;  2ROV A;  1MKE A;  2W2W A;  3G9W A;  5DHA B;  2EMS A;  4HB4 B;  3PVL A;  1KZG A;  2QKL A;  4PQ0 A;  3PG7 A;  1TXD A;  1V88 A;  2YS5 A;  2M14 A;  2JP2 A;  4Z2M B;  5CLQ B;  2EC1 A;  4CHM A;  1U5E A;  2L2I A;  1FOE A;  1X86 A;  4HAX B;  1IRS A;  4K81 A;  4CYE A;  3PSC A;  3OAN A;  1QQG A;  2I1J A;  5EFX A;  2UVM A;  4YL8 A;  1EF1 A;  1SHC A;  1UNQ A;  2Q13 A;  5J3Q A;  1K5G B;  3FM8 C;  5KQ4 A;  2J0M A;  4GMX B;  3CIK A;  4A6F A;  2QKM A;  1V89 A;  3TFM A;  2DYN A;  2EMT A;  2MDX A;  2DHJ A;  4IOY X;  1BTK A;  4HAW B;  2KUP A;  2RUK B;  3ML4 A;  3T06 A;  3VOQ A;  1AQC A;  3F5R A;  2DX5 A;  1NI2 A;  2YT0 A;  2D9X A;  4HAU B;  4KAX B;  5HE2 A;  1MPH A;  3V5W A;  2D11 A;  1TQZ A;  3RCP A;  1FAO A;  2Z0Q A;  2PZ1 A;  2ADZ A;  5FI0 A;  1MAI A;  5C5B B;  1WG7 A;  2DX1 A;  4ZRJ A;  3CXB B;  1ZM0 A;  3KSY A;  2YRY A;  4TYZ A;  2RVB B;  3FSS A;  2R09 A;  2DHI A;  1RJ2 A;  4H8S A;  2K00 A;  1XOD A;  1UPR A;  1DDM A;  2RLO A;  2HTH B;  1QC6 A;  1I2H A;  2ELB A;  3X23 A;  4HB2 B;  1NTV A;  2VKI A;  4DX9 0;  3IVF A;  1U29 A;  1WJ1 A;  4YON A;  3MDB C;  5D3X A;  2OTX A;  3U7D A;  1OY2 A;  2D9Z A;  2DFK A;  4ZRI A;  1EGX A;  2IYB A;  2MKR A;  1V61 A;  4DX8 A;  2COC A;  2COA A;  1XR0 B;  2DLW A;  4BBK A;  4HAY B;  3PZD A;  2W2X C;  5JHH A;  1P5T A;  3SNH A;  5HE3 A;  2V76 A;  1BAK A;  2ROZ B;  2D9V A;  4KVG B; 
#chains in the Genus database with same CATH topology
 4HHV A;  2H7D A;  1WJM A;  1P6S A;  1FHW A;  3KRW A;  1UPQ A;  4HAV B;  2LKO A;  3O96 A;  1KZ7 A;  1N3H A;  1T77 A;  5DI9 B;  4HDO A;  1LB1 A;  2IFS A;  2R0D A;  5DH9 B;  4P7I A;  1ZC4 B;  4KHO A;  2N0Y A;  1FB8 A;  2K2J A;  4HDQ A;  1H4R A;  1FGY A;  1NTY A;  2BCJ A;  2K8E A;  4F7U P;  2COD A;  3P7Z A;  5GOW B;  4QXA B;  2I5C A;  4A6H A;  5L81 A;  4GXB A;  4DIX A;  2GS0 A;  2ZKM X;  1ISN A;  1LW3 A;  2LG1 A;  2J0K A;  2VRW B;  1H10 A;  1TJ6 A;  3HSA A;  4KHB B;  2KIE A;  1OQN A;  3OHM B;  4HAT B;  4NSW A;  3DCX A;  3BIN A;  1U5F A;  5LON B;  3ZVR A;  3DXC A;  5LG4 B;  4HB0 B;  3LJU X;  1K5D B;  1FGZ A;  1V5P A;  2ZPY A;  4IFS A;  4GNK B;  3HW2 B;  3NW8 A;  5M4Y B;  3PEG A;  5D3Y A;  3A98 B;  2K2U A;  3AU5 A;  1ZSQ A;  2J0J A;  2KR0 A;  1EAZ A;  2RNR B;  3NSU A;  2Z4D A;  2CY5 A;  3PP2 A;  2OQB A;  2Z0O A;  2KUQ A;  3KRX A;  3U8Z A;  2DA0 A;  3F0W A;  4K2P A;  3TVV A;  1M7R A;  4A5K A;  2NBV A;  2GCJ A;  3ULB A;  2VSZ A;  3WA0 A;  3SO6 A;  3NWD A;  3AU4 A;  1GC6 A;  3D8F A;  4IAP A;  5D27 A;  4F7G A;  4KHA A;  5DHF B;  4A6K A;  1J19 A;  1Q67 A;  4C0A A;  2Z59 A;  3ODX A;  1XX0 A;  1X11 A;  2I1K A;  1I7A A;  4MY6 A;  3VIA A;  2P0F A;  5DIF B;  2DKQ A;  1GG3 A;  2NMB A;  1X05 A;  1OMW A;  3QIJ A;  2KCJ A;  3KZ1 A;  4KHB A;  1U27 A;  3QWM A;  2M38 A;  5FI1 A;  2NZ8 B;  3ODO A;  2DYQ A;  2P8V A;  1FHO A;  5IRS A;  3SYX A;  2GCL A;  1W1H A;  1ZC3 B;  1B55 A;  1FHX A;  3A8Q A;  2ELA A;  2AEH A;  3QBV B;  5JHG A;  4K2O A;  4WSF A;  2COF A;  4Y94 A;  1MK9 B;  2RGN B;  1MIZ B;  2UZR A;  2DHK A;  2LOZ A;  3DXE A;  1U5D A;  3SUZ A;  1E5W A;  3WYF B;  2Y7B A;  1DDW A;  4GZU A;  5I2S A;  3A58 A;  2LOX A;  3SV1 A;  3GYO A;  2Y8G A;  1U2B A;  3P6A A;  3M1I B;  4B6H A;  2LUL A;  1U5G A;  3BJI A;  1EVH A;  2RSG A;  5J3Y A;  2W2X D;  1GC7 A;  2EJ8 A;  1PFJ A;  4L1R A;  2L1C A;  2J59 M;  1RRP B;  5KQ1 A;  2Z14 A;  2YF0 A;  2GUM A;  3NWA A;  1SGH A;  2YT1 A;  1Y5O A;  1XKE A;  5JP4 A;  1MIX A;  4XWX A;  2G35 A;  3N7C A;  4WVF B;  4HSI A;  4Z2N A;  4CSQ A;  2GJY A;  2HE7 A;  2CY4 A;  4EKU A;  2P0H A;  4D0N B;  1WGQ A;  5C79 A;  5JLJ B;  4PNK A;  1W1D A;  4F7H A;  4OSN A;  3HIE A;  3ODW A;  1UNR A;  5D3V A;  4HB3 B;  1WGU A;  2K49 A;  2D4Q A;  3HQC A;  1MI1 A;  3GYP A;  3D8E A;  4DXA B;  1V5M A;  2XQN M;  3UZT A;  1BTN A;  1AWE A;  2YS3 A;  3ZDT A;  2YS1 A;  4A6F B;  2DKP A;  2MFQ A;  4EJN A;  4GPT B;  2CRF A;  1DBH A;  3ULC A;  4GN1 A;  2MWN B;  3DXD A;  2D9W A;  3D8D A;  2KGX B;  1P3R A;  1UNP A;  3A8P A;  1XD4 A;  5C16 A;  1DYN A;  2DTC A;  2D2Q A;  1PMS A;  5HE0 A;  4EMO A;  1DRO A;  5KCV A;  1W1G A;  2R2Y A;  4DBB A;  3AJ4 A;  1MK7 B;  5LOP B;  3PVU A;  4GMV A;  5C5B A;  2YVC A;  3TW1 A;  4NY0 A;  2D9Y A;  4QJ4 B;  1ZVR A;  3FEH A;  3HK0 A;  4MK0 A;  5C6R A;  1WVH A;  2Z0P A;  2DN6 A;  1X1G A;  2KIG A;  5I2M A;  4QJ3 B;  1WI1 A;  3TCA A;  5HE1 A;  2LYD A;  5J3T A;  2H7E A;  1J0W A;  1UEF A;  1V5U A;  2UZS A;  1DDV A;  2P0D A;  4HAZ B;  4QJ5 B;  1Z87 A;  1PLS A;  1X1F A;  2FJU B;  1Y19 B;  2E2X A;  2I5F A;  2X18 A;  1NU2 A;  4K17 A;  2D10 A;  1XCG A;  3NWF A;  3TO1 A;  3KY9 A;  4L6E A;  1M7E A;  4TKN A;  5CLL B;  4CHJ A;  3MPX A;  2AL6 A;  4ZRK A;  4MT7 A;  2N23 A;  5D3W A;  1BWN A;  2Z13 A;  2Y8F A;  4WJ7 A;  1KI1 B;  4D6W A;  3PVW A;  2YSZ A;  2FJL A;  2CAY A;  2ROV A;  1MKE A;  2W2W A;  3G9W A;  5DHA B;  2EMS A;  4HB4 B;  3PVL A;  1KZG A;  2QKL A;  4PQ0 A;  3PG7 A;  1TXD A;  1V88 A;  2YS5 A;  2M14 A;  2JP2 A;  4Z2M B;  5CLQ B;  2EC1 A;  4CHM A;  1U5E A;  2L2I A;  1FOE A;  1X86 A;  4HAX B;  1IRS A;  4K81 A;  4CYE A;  3PSC A;  3OAN A;  1QQG A;  2I1J A;  4OT1 A;  5EFX A;  2UVM A;  4YL8 A;  1EF1 A;  1SHC A;  1UNQ A;  2Q13 A;  3B77 A;  5J3Q A;  1K5G B;  3FM8 C;  5KQ4 A;  2J0M A;  4GMX B;  3CIK A;  4A6F A;  2QKM A;  1V89 A;  3TFM A;  3FVC A;  2DYN A;  2EMT A;  2RRF A;  2MDX A;  2DHJ A;  4IOY X;  1BTK A;  4HAW B;  2KUP A;  2RUK B;  3ML4 A;  3T06 A;  3VOQ A;  1AQC A;  3F5R A;  1ZYI A;  2DX5 A;  1NI2 A;  2YT0 A;  2D9X A;  4HAU B;  4KAX B;  5HE2 A;  1MPH A;  3V5W A;  2D11 A;  1TQZ A;  3RCP A;  1FAO A;  2Z0Q A;  2PZ1 A;  2ADZ A;  2YT2 A;  1MAI A;  5FI0 A;  5C5B B;  1WG7 A;  2DX1 A;  4ZRJ A;  3CXB B;  3KSY A;  1ZM0 A;  2YRY A;  4TYZ A;  2RVB B;  3FSS A;  2R09 A;  2DHI A;  1RJ2 A;  4H8S A;  2K00 A;  1XOD A;  1UPR A;  1DDM A;  2RLO A;  2HTH B;  1QC6 A;  1I2H A;  2ELB A;  3X23 A;  4HB2 B;  1NTV A;  2VKI A;  4DX9 0;  3IVF A;  1U29 A;  1WJ1 A;  4YON A;  3MDB C;  5D3X A;  2OTX A;  3U7D A;  1OY2 A;  2D9Z A;  2DFK A;  4ZRI A;  1EGX A;  4GOU A;  2IYB A;  2MKR A;  1V61 A;  4DX8 A;  2COC A;  2COA A;  1XR0 B;  2DLW A;  4BBK A;  4HAY B;  3PZD A;  2W2X C;  5JHH A;  1P5T A;  3SNH A;  5HE3 A;  2V76 A;  3U12 A;  1BAK A;  2ROZ B;  2D9V A;  4KVG B; 
#chains in the Genus database with same CATH homology
 4HHV A;  2H7D A;  1WJM A;  1P6S A;  1FHW A;  3KRW A;  1UPQ A;  4HAV B;  2LKO A;  3O96 A;  1KZ7 A;  1N3H A;  5DI9 B;  4HDO A;  1LB1 A;  2IFS A;  2R0D A;  5DH9 B;  4P7I A;  1ZC4 B;  4KHO A;  2N0Y A;  1FB8 A;  2K2J A;  4HDQ A;  1H4R A;  1FGY A;  1NTY A;  2BCJ A;  4F7U P;  2COD A;  3P7Z A;  5GOW B;  2I5C A;  4A6H A;  5L81 A;  4GXB A;  2GS0 A;  1ISN A;  1LW3 A;  2LG1 A;  2J0K A;  2VRW B;  1H10 A;  1TJ6 A;  4KHB B;  1OQN A;  4HAT B;  4NSW A;  3BIN A;  1U5F A;  5LON B;  3ZVR A;  3DXC A;  4HB0 B;  3LJU X;  1K5D B;  1FGZ A;  1V5P A;  2ZPY A;  4IFS A;  3HW2 B;  3PEG A;  5D3Y A;  3A98 B;  2K2U A;  3AU5 A;  1ZSQ A;  2J0J A;  1EAZ A;  2RNR B;  3NSU A;  2CY5 A;  2OQB A;  3PP2 A;  2Z0O A;  3KRX A;  3U8Z A;  2DA0 A;  3F0W A;  4K2P A;  3TVV A;  1M7R A;  4A5K A;  2GCJ A;  3ULB A;  2VSZ A;  3WA0 A;  3SO6 A;  3AU4 A;  1GC6 A;  3D8F A;  4IAP A;  5D27 A;  4F7G A;  4KHA A;  5DHF B;  4A6K A;  1J19 A;  1Q67 A;  4C0A A;  3ODX A;  1XX0 A;  1X11 A;  2I1K A;  1I7A A;  4MY6 A;  3VIA A;  2P0F A;  5DIF B;  2DKQ A;  1GG3 A;  2NMB A;  1X05 A;  1OMW A;  3QIJ A;  2KCJ A;  3KZ1 A;  1U27 A;  3QWM A;  2M38 A;  5FI1 A;  2NZ8 B;  3ODO A;  2DYQ A;  2P8V A;  1FHO A;  3SYX A;  2GCL A;  1W1H A;  1ZC3 B;  1B55 A;  1FHX A;  3A8Q A;  2ELA A;  2AEH A;  3QBV B;  5JHG A;  4K2O A;  4WSF A;  2COF A;  4Y94 A;  1MK9 B;  2RGN B;  1MIZ B;  2UZR A;  2DHK A;  2LOZ A;  3DXE A;  1U5D A;  3SUZ A;  1E5W A;  3WYF B;  2Y7B A;  1DDW A;  4GZU A;  2LOX A;  3SV1 A;  3GYO A;  2Y8G A;  1U2B A;  3P6A A;  3M1I B;  4B6H A;  2LUL A;  1U5G A;  3BJI A;  1EVH A;  2RSG A;  5J3Y A;  2W2X D;  1GC7 A;  2EJ8 A;  1PFJ A;  2L1C A;  2J59 M;  1RRP B;  5KQ1 A;  2YF0 A;  1SGH A;  2YT1 A;  1Y5O A;  1XKE A;  5JP4 A;  1MIX A;  4XWX A;  2G35 A;  3N7C A;  4WVF B;  4Z2N A;  2GJY A;  2HE7 A;  2CY4 A;  4EKU A;  2P0H A;  4D0N B;  1WGQ A;  5C79 A;  5JLJ B;  4PNK A;  1W1D A;  4F7H A;  3ODW A;  1UNR A;  5D3V A;  4HB3 B;  1WGU A;  2D4Q A;  3HQC A;  3GYP A;  3D8E A;  4DXA B;  1V5M A;  2XQN M;  3UZT A;  1BTN A;  1AWE A;  2YS3 A;  3ZDT A;  2YS1 A;  4A6F B;  2DKP A;  2MFQ A;  4EJN A;  4GPT B;  2CRF A;  1DBH A;  3ULC A;  4GN1 A;  2MWN B;  3DXD A;  2D9W A;  3D8D A;  2KGX B;  1P3R A;  1UNP A;  3A8P A;  1XD4 A;  5C16 A;  1DYN A;  2DTC A;  2D2Q A;  1PMS A;  5HE0 A;  4EMO A;  1DRO A;  5KCV A;  1W1G A;  4DBB A;  3AJ4 A;  1MK7 B;  5LOP B;  3PVU A;  4GMV A;  5C5B A;  2YVC A;  3TW1 A;  4NY0 A;  2D9Y A;  1ZVR A;  3FEH A;  3HK0 A;  4MK0 A;  5C6R A;  1WVH A;  2Z0P A;  2DN6 A;  1X1G A;  1WI1 A;  3TCA A;  5HE1 A;  2LYD A;  5J3T A;  2H7E A;  1J0W A;  1UEF A;  1V5U A;  2UZS A;  1DDV A;  2P0D A;  4HAZ B;  1Z87 A;  1PLS A;  1X1F A;  2I5F A;  1Y19 B;  2E2X A;  2X18 A;  1NU2 A;  4K17 A;  2D10 A;  1XCG A;  3TO1 A;  3KY9 A;  4L6E A;  1M7E A;  4TKN A;  5CLL B;  4CHJ A;  3MPX A;  2AL6 A;  4ZRK A;  4MT7 A;  2N23 A;  5D3W A;  1BWN A;  2Y8F A;  4WJ7 A;  1KI1 B;  3PVW A;  2YSZ A;  2FJL A;  2CAY A;  2ROV A;  1MKE A;  2W2W A;  3G9W A;  5DHA B;  2EMS A;  4HB4 B;  3PVL A;  1KZG A;  2QKL A;  4PQ0 A;  3PG7 A;  1TXD A;  1V88 A;  2YS5 A;  2M14 A;  2JP2 A;  4Z2M B;  5CLQ B;  2EC1 A;  4CHM A;  1U5E A;  2L2I A;  1FOE A;  1X86 A;  4HAX B;  1IRS A;  4K81 A;  4CYE A;  3PSC A;  3OAN A;  1QQG A;  2I1J A;  5EFX A;  2UVM A;  4YL8 A;  1EF1 A;  1SHC A;  1UNQ A;  2Q13 A;  5J3Q A;  1K5G B;  3FM8 C;  5KQ4 A;  2J0M A;  4GMX B;  3CIK A;  4A6F A;  2QKM A;  1V89 A;  3TFM A;  2DYN A;  2EMT A;  2MDX A;  2DHJ A;  4IOY X;  1BTK A;  4HAW B;  2KUP A;  2RUK B;  3ML4 A;  3T06 A;  3VOQ A;  1AQC A;  3F5R A;  2DX5 A;  1NI2 A;  2YT0 A;  2D9X A;  4HAU B;  4KAX B;  5HE2 A;  1MPH A;  3V5W A;  2D11 A;  1TQZ A;  3RCP A;  1FAO A;  2Z0Q A;  2PZ1 A;  2ADZ A;  5FI0 A;  1MAI A;  5C5B B;  1WG7 A;  2DX1 A;  4ZRJ A;  3CXB B;  1ZM0 A;  3KSY A;  2YRY A;  4TYZ A;  2RVB B;  3FSS A;  2R09 A;  2DHI A;  1RJ2 A;  4H8S A;  2K00 A;  1XOD A;  1UPR A;  1DDM A;  2RLO A;  2HTH B;  1QC6 A;  1I2H A;  2ELB A;  3X23 A;  4HB2 B;  1NTV A;  2VKI A;  4DX9 0;  3IVF A;  1U29 A;  1WJ1 A;  4YON A;  3MDB C;  5D3X A;  2OTX A;  3U7D A;  1OY2 A;  2D9Z A;  2DFK A;  4ZRI A;  1EGX A;  2IYB A;  2MKR A;  1V61 A;  4DX8 A;  2COC A;  2COA A;  1XR0 B;  2DLW A;  4BBK A;  4HAY B;  3PZD A;  2W2X C;  5JHH A;  1P5T A;  3SNH A;  5HE3 A;  2V76 A;  1BAK A;  2ROZ B;  2D9V A;  4KVG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...