1PLSA

Solution structure of a pleckstrin homology domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
113
structure length
113
Chain Sequence
b'MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVFKITTTKQQDHFFQAAFLEERDAWVRDINKAIKCIEGLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLECKSTRIN HOMOLOGY DOMAIN
publication title Solution structure of a pleckstrin-homology domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Phosphorylation
total genus 14
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 1994-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1plsA00
4A6HA 2I5CA 4DX8A 2RUKB 1M7EA 2D9WA 3SYXA 1MK7B 1KI1B 5C16A 3OANA 2NMBA 2LG1A 2YVCA 3MDBC 2D2QA 2GS0A 4GMXB 4CHMA 3M1IB 3PZDA 2QKMA 5KQ4A 2Z0OA 3BINA 1XODA 1E5WA 1U2BA 1MKEA 3TVVA 4IAPA 5C5BA 5D3YA 2L2IA 1ZC3B 2IFSA 4NY0A 1W1HA 2UZSA 2CY5A 4MT7A 2PZ1A 2HE7A 4ZRJA 1V88A 1K5DB 1SHCA 1FGYA 5KCVA 5L81A 1V5PA 1FHWA 2V76A 2MWNB 1UNQA 1UEFA 1NU2A 1K5GB 1I2HA 5DHFB 3FSSA 1Y19B 2I1JA 5JHHA 2R0DA 4CHJA 2GCLA 1TXDA 5CLLB 1DYNA 1MPHA 3V5WA 1GC7A 1X11A 3KRWA 1Y5OA 2D11A 2QKLA 3NSUA 1ZSQA 4HAYB 3F5RA 1W1GA 4HB2B 1XKEA 2YT0A 1GC6A 2HTHB 2I5FA 5D3XA 4Y94A 1WJMA 4A5KA 2ELBA 1V61A 4C0AA 1P5TA 1OQNA 1DROA 4PQ0A 3D8EA 4TYZA 5C79A 2MKRA 4IFSA 1WG7A 1X05A 3U7DA 3RCPA 5HE2A 1NTVA 2LYDA 4KHBB 3QWMA 2Y8FA 1ISNA 2ZPYA 5JP4A 2YS3A 1EGXA 4EJNA 1RJ2A 1Z87A 1GG3A 4F7HA 2GCJA 4BBKA 1BAKA 3DXDA 1WVHA 2VRWB 4CYEA 3O96A 2P0HA 3KZ1A 1U5FA 4P7IA 1UPQA 1XCGA 1WGUA 5EFXA 3ZVRA 4ZRIA 1J19A 1NI2A 5JHGA 2AL6A 1J0WA 1X86A 2COCA 4HAWB 2EMTA 3ODXA 4ZRKA 3TFMA 2UZRA 1KZGA 2Y8GA 3IVFA 4HB0B 3T06A 3FEHA 1FOEA 4A6FA 2CODA 3HK0A 2LOXA 1LB1A 1U5DA 2CAYA 2VKIA 1QC6A 2I1KA 5C5BB 2J59M 2K00A 4HB4B 2K2UA 2CY4A 1QQGA 2P8VA 4KHAA 1U27A 4IOYX 1U5EA 2MFQA 2AEHA 2P0FA 1X1GA 3PVUA 2DKPA 1V5MA 2G35A 5DHAB 4DXAB 1FHOA 3ZDTA 4F7UP 1UNRA 2D4QA 2M14A 3VIAA 2H7EA 5DH9B 3A98B 2OTXA 2DTCA 4HAZB 2J0JA 3ODOA 1DBHA 2E2XA 4K17A 5D27A 1Q67A 2YF0A 3VOQA 2EMSA 2YS5A 1DDMA 3AJ4A 1LW3A 4DX90 1H10A 2Q13A 1BTKA 1N3HA 4KHOA 1W1DA 1ZM0A 3BJIA 5HE0A 2RNRB 2ROZB 2GJYA 1UPRA 3HQCA 2RLOA 3AU5A 5D3WA 5LOPB 3CXBB 1PFJA 2Z0PA 4HDOA 4HB3B 5FI0A 1P6SA 3DXEA 1X1FA 3U8ZA 2D10A 4HAXB 1P3RA 2W2XC 3SUZA 2LOZA 1BWNA 4H8SA 2DX5A 3SV1A 3SO6A 2K2JA 1IRSA 3A8PA 1I7AA 1AQCA 2DHIA 2DFKA 2D9XA 4MK0A 4D0NB 2DN6A 2YRYA 4HHVA 1WGQA 2D9VA 2DHJA 2UVMA 1EVHA 3QIJA 3HW2B 4MY6A 3PVWA 5HE3A 2Z0QA 2RVBB 2LULA 2N23A 3ML4A 3G9WA 4K81A 4XWXA 1EF1A 2R09A 3PVLA 2J0MA 4GZUA 4L6EA 1MK9B 2Y7BA 3CIKA 1XD4A 2VSZA 4WSFA 2J0KA 5GOWB 3GYPA 3P7ZA 5FI1A 5J3YA 3D8DA 3DXCA 4F7GA 1PMSA 3KRXA 1MAIA 3N7CA 4Z2NA 1ZVRA 2L1CA 5DI9B 3ODWA 3TO1A 2RSGA 2H7DA 3X23A 5J3QA 2COAA 3KY9A 1XX0A 4K2PA 4A6FB 4A6KA 3WYFB 3A8QA 2W2WA 2N0YA 4K2OA 3WA0A 2EJ8A 3MPXA 2XQNM 1OMWA 3LJUX 5HE1A 5J3TA 2DLWA 3PG7A 1FHXA 1PLSA 2COFA 4WJ7A 5D3VA 3TCAA 1FGZA 1DDVA 2KUPA 4DBBA 5LONB 4NSWA 3KSYA 3TW1A 2W2XD 3GYOA 2MDXA 5JLJB 2BCJA 2P0DA 3F0WA 4YONA 1MIXA 1H4RA 2YT1A 1AWEA 2DKQA 2ROVA 2CRFA 3QBVB 2DHKA 2DA0A 1EAZA 4B6HA 3FM8C 1BTNA 1FAOA 1UNPA 3PSCA 2X18A 5CLQB 1TJ6A 2D9ZA 3UZTA 2M38A 1M7RA 2IYBA 2YSZA 2NZ8B 2JP2A 2ELAA 1MIZB 1SGHA 1FB8A 2DYNA 2YS1A 1WJ1A 2EC1A 2KCJA 4KVGB 5DIFB 3PP2A 1U29A 1TQZA 1RRPB 1NTYA 4WVFB 4GXBA 4HDQA 4TKNA 5KQ1A 2RGNB 3ULCA 1WI1A 2OQBA 2ADZA 2DX1A 4KAXB 3AU4A 4PNKA 1XR0B 4YL8A 3ULBA 3SNHA 1B55A 4EKUA 4GMVA 1KZ7A 4Z2MB 4HAUB 5C6RA 2FJLA 1OY2A 2LKOA 4EMOA 4HATB 1V89A 4GPTB 3P6AA 2KGXB 3D8FA 4GN1A 1DDWA 1V5UA 3PEGA 2D9YA 4HAVB 1ZC4B 2DYQA 1U5GA
chains in the Genus database with same CATH superfamily
4A6HA 2I5CA 4DX8A 4QXAB 1ZYIA 2RUKB 1M7EA 2D9WA 3SYXA 1MK7B 1KI1B 5C16A 3OANA 2NMBA 2LG1A 2YVCA 3MDBC 2D2QA 2GS0A 4GMXB 4CHMA 3M1IB 3PZDA 2QKMA 5KQ4A 2Z0OA 3BINA 2Z59A 1XODA 1E5WA 1U2BA 1MKEA 2KIGA 3TVVA 4IAPA 5C5BA 4QJ5B 5D3YA 1MI1A 5I2MA 2L2IA 1ZC3B 2IFSA 4NY0A 1W1HA 2UZSA 2CY5A 2YT2A 4MT7A 2PZ1A 2HE7A 4ZRJA 1V88A 1K5DB 1SHCA 3NWAA 3B77A 1FGYA 5KCVA 5L81A 1V5PA 1FHWA 2V76A 2MWNB 1UNQA 1UEFA 2ZKMX 1NU2A 1K5GB 1I2HA 5DHFB 5LG4B 3FSSA 1Y19B 2FJUB 2I1JA 5JHHA 2R0DA 2Z13A 4CHJA 2GCLA 1TXDA 5CLLB 1DYNA 1MPHA 3V5WA 1GC7A 1X11A 3KRWA 1Y5OA 2D11A 2QKLA 3NSUA 1ZSQA 2K49A 4HAYB 3F5RA 1W1GA 4GOUA 4HB2B 1XKEA 2YT0A 1GC6A 2HTHB 2I5FA 5D3XA 4Y94A 1WJMA 4A5KA 2ELBA 1V61A 4C0AA 1P5TA 1OQNA 1DROA 4PQ0A 3D8EA 4TYZA 5C79A 2MKRA 4IFSA 1WG7A 1X05A 3U7DA 3RCPA 5HE2A 1NTVA 2LYDA 4KHBB 3QWMA 2Y8FA 1ISNA 2ZPYA 5JP4A 2YS3A 1EGXA 4OSNA 4EJNA 1RJ2A 1Z87A 1GG3A 4F7HA 2GCJA 4BBKA 1BAKA 3DXDA 1WVHA 2KR0A 2VRWB 4CYEA 3O96A 2P0HA 3KZ1A 1U5FA 4P7IA 1UPQA 1XCGA 1WGUA 5EFXA 3ZVRA 4ZRIA 1J19A 1NI2A 5JHGA 2AL6A 1J0WA 1X86A 2COCA 4HAWB 2EMTA 3ODXA 4ZRKA 3TFMA 2UZRA 1KZGA 2Y8GA 3IVFA 4HB0B 2RRFA 3T06A 3FEHA 1FOEA 4A6FA 2CODA 3HK0A 3A58A 2LOXA 1LB1A 1U5DA 2CAYA 2VKIA 1QC6A 2I1KA 5C5BB 2J59M 2K00A 4HB4B 2K2UA 2CY4A 1QQGA 2GUMA 2P8VA 4KHAA 1U27A 4IOYX 1U5EA 2MFQA 2AEHA 2P0FA 1X1GA 3PVUA 2DKPA 3U12A 1V5MA 2G35A 5DHAB 4DXAB 1FHOA 3ZDTA 4F7UP 1UNRA 2D4QA 3DCXA 2M14A 3VIAA 2H7EA 5DH9B 3A98B 2OTXA 3OHMB 2DTCA 4HAZB 2J0JA 3ODOA 1DBHA 2E2XA 4K17A 5D27A 4HSIA 1Q67A 2YF0A 3VOQA 2EMSA 2YS5A 1DDMA 3AJ4A 1LW3A 4DX90 1H10A 4GNKB 2Q13A 1BTKA 1N3HA 4KHOA 1W1DA 1ZM0A 3BJIA 5HE0A 2RNRB 2ROZB 2GJYA 1UPRA 3HQCA 2RLOA 3AU5A 5D3WA 5LOPB 3CXBB 1PFJA 2Z0PA 4HDOA 4HB3B 5FI0A 1P6SA 3DXEA 1X1FA 4DIXA 3U8ZA 2D10A 4HAXB 1P3RA 2NBVA 2W2XC 3SUZA 2LOZA 1BWNA 4H8SA 2DX5A 3SV1A 2K8EA 2K2JA 3SO6A 1IRSA 3A8PA 4D6WA 1I7AA 1AQCA 2DHIA 2DFKA 2D9XA 4MK0A 4CSQA 4D0NB 2DN6A 2YRYA 4OT1A 4HHVA 1WGQA 2D9VA 2DHJA 2UVMA 1EVHA 3QIJA 3HW2B 2KIEA 4MY6A 3PVWA 5HE3A 2Z0QA 2RVBB 2LULA 2N23A 3ML4A 3G9WA 4K81A 1T77A 4XWXA 2Z4DA 1EF1A 2R09A 3PVLA 2J0MA 4GZUA 4L6EA 1MK9B 2Y7BA 3CIKA 1XD4A 2VSZA 4WSFA 2J0KA 5GOWB 3GYPA 3P7ZA 3NW8A 5FI1A 5J3YA 3D8DA 3DXCA 4F7GA 1PMSA 3KRXA 1MAIA 3N7CA 4Z2NA 1ZVRA 2L1CA 5DI9B 3ODWA 3TO1A 2RSGA 2H7DA 3X23A 5J3QA 2COAA 3KY9A 1XX0A 4K2PA 4A6FB 5M4YB 4A6KA 3WYFB 3A8QA 2W2WA 2KUQA 2N0YA 4K2OA 3WA0A 2EJ8A 3MPXA 2XQNM 1OMWA 3LJUX 5HE1A 3HSAA 5J3TA 2DLWA 3PG7A 1FHXA 1PLSA 2COFA 4WJ7A 5D3VA 3TCAA 1FGZA 1DDVA 2KUPA 4L1RA 4DBBA 5LONB 3FVCA 3KSYA 4NSWA 3TW1A 2W2XD 3GYOA 2MDXA 3HIEA 5JLJB 2BCJA 3NWDA 2P0DA 3F0WA 4YONA 1MIXA 1H4RA 2YT1A 1AWEA 2DKQA 2ROVA 2CRFA 3QBVB 2DHKA 2DA0A 1EAZA 4B6HA 3FM8C 1BTNA 1FAOA 1UNPA 3PSCA 2X18A 5CLQB 1TJ6A 2D9ZA 3UZTA 2M38A 1M7RA 2IYBA 2YSZA 2NZ8B 2JP2A 2ELAA 1MIZB 1SGHA 1FB8A 2DYNA 2YS1A 1WJ1A 2EC1A 2KCJA 4KVGB 5DIFB 4QJ4B 3PP2A 1U29A 1TQZA 1RRPB 1NTYA 4WVFB 4GXBA 4HDQA 4TKNA 5KQ1A 2RGNB 3ULCA 1WI1A 2OQBA 2ADZA 2DX1A 4KAXB 3AU4A 3NWFA 4PNKA 2Z14A 1XR0B 4YL8A 3ULBA 5I2SA 3SNHA 1B55A 4EKUA 4GMVA 5IRSA 1KZ7A 4Z2MB 4KHBA 4HAUB 5C6RA 2FJLA 1OY2A 2LKOA 4QJ3B 4EMOA 4HATB 1V89A 4GPTB 3P6AA 2KGXB 3D8FA 4GN1A 1DDWA 1V5UA 3PEGA 2D9YA 2R2YA 4HAVB 1ZC4B 2DYQA 1U5GA
chains in the Genus database with same CATH topology
4A6HA 2I5CA 4DX8A 2RUKB 1M7EA 2D9WA 3SYXA 1MK7B 1KI1B 5C16A 3OANA 2NMBA 2LG1A 2YVCA 3MDBC 2D2QA 2GS0A 4GMXB 4CHMA 3M1IB 3PZDA 2QKMA 5KQ4A 2Z0OA 3BINA 1XODA 1E5WA 1U2BA 1MKEA 3TVVA 4IAPA 5C5BA 5D3YA 2L2IA 1ZC3B 2IFSA 4NY0A 1W1HA 2UZSA 2CY5A 4MT7A 2PZ1A 2HE7A 4ZRJA 1V88A 1K5DB 1SHCA 1FGYA 5KCVA 5L81A 1V5PA 1FHWA 2V76A 2MWNB 1UNQA 1UEFA 1NU2A 1K5GB 1I2HA 5DHFB 3FSSA 1Y19B 2I1JA 5JHHA 2R0DA 4CHJA 2GCLA 1TXDA 5CLLB 1DYNA 1MPHA 3V5WA 1GC7A 1X11A 3KRWA 1Y5OA 2D11A 2QKLA 3NSUA 1ZSQA 4HAYB 3F5RA 1W1GA 4HB2B 1XKEA 2YT0A 1GC6A 2HTHB 2I5FA 5D3XA 4Y94A 1WJMA 4A5KA 2ELBA 1V61A 4C0AA 1P5TA 1OQNA 1DROA 4PQ0A 3D8EA 4TYZA 5C79A 2MKRA 4IFSA 1WG7A 1X05A 3U7DA 3RCPA 5HE2A 1NTVA 2LYDA 4KHBB 3QWMA 2Y8FA 1ISNA 2ZPYA 5JP4A 2YS3A 1EGXA 4EJNA 1RJ2A 1Z87A 1GG3A 4F7HA 2GCJA 4BBKA 1BAKA 3DXDA 1WVHA 2VRWB 4CYEA 3O96A 2P0HA 3KZ1A 1U5FA 4P7IA 1UPQA 1XCGA 1WGUA 5EFXA 3ZVRA 4ZRIA 1J19A 1NI2A 5JHGA 2AL6A 1J0WA 1X86A 2COCA 4HAWB 2EMTA 3ODXA 4ZRKA 3TFMA 2UZRA 1KZGA 2Y8GA 3IVFA 4HB0B 3T06A 3FEHA 1FOEA 4A6FA 2CODA 3HK0A 2LOXA 1LB1A 1U5DA 2CAYA 2VKIA 1QC6A 2I1KA 5C5BB 2J59M 2K00A 4HB4B 2K2UA 2CY4A 1QQGA 2P8VA 4KHAA 1U27A 4IOYX 1U5EA 2MFQA 2AEHA 2P0FA 1X1GA 3PVUA 2DKPA 1V5MA 2G35A 5DHAB 4DXAB 1FHOA 3ZDTA 4F7UP 1UNRA 2D4QA 2M14A 3VIAA 2H7EA 5DH9B 3A98B 2OTXA 2DTCA 4HAZB 2J0JA 3ODOA 1DBHA 2E2XA 4K17A 5D27A 1Q67A 2YF0A 3VOQA 2EMSA 2YS5A 1DDMA 3AJ4A 1LW3A 4DX90 1H10A 2Q13A 1BTKA 1N3HA 4KHOA 1W1DA 1ZM0A 3BJIA 5HE0A 2RNRB 2ROZB 2GJYA 1UPRA 3HQCA 2RLOA 3AU5A 5D3WA 5LOPB 3CXBB 1PFJA 2Z0PA 4HDOA 4HB3B 5FI0A 1P6SA 3DXEA 1X1FA 3U8ZA 2D10A 4HAXB 1P3RA 2W2XC 3SUZA 2LOZA 1BWNA 4H8SA 2DX5A 3SV1A 3SO6A 2K2JA 1IRSA 3A8PA 1I7AA 1AQCA 2DHIA 2DFKA 2D9XA 4MK0A 4D0NB 2DN6A 2YRYA 4HHVA 1WGQA 2D9VA 2DHJA 2UVMA 1EVHA 3QIJA 3HW2B 4MY6A 3PVWA 5HE3A 2Z0QA 2RVBB 2LULA 2N23A 3ML4A 3G9WA 4K81A 4XWXA 1EF1A 2R09A 3PVLA 2J0MA 4GZUA 4L6EA 1MK9B 2Y7BA 3CIKA 1XD4A 2VSZA 4WSFA 2J0KA 5GOWB 3GYPA 3P7ZA 5FI1A 5J3YA 3D8DA 3DXCA 4F7GA 1PMSA 3KRXA 1MAIA 3N7CA 4Z2NA 1ZVRA 2L1CA 5DI9B 3ODWA 3TO1A 2RSGA 2H7DA 3X23A 5J3QA 2COAA 3KY9A 1XX0A 4K2PA 4A6FB 4A6KA 3WYFB 3A8QA 2W2WA 2N0YA 4K2OA 3WA0A 2EJ8A 3MPXA 2XQNM 1OMWA 3LJUX 5HE1A 5J3TA 2DLWA 3PG7A 1FHXA 1PLSA 2COFA 4WJ7A 5D3VA 3TCAA 1FGZA 1DDVA 2KUPA 4DBBA 5LONB 4NSWA 3KSYA 3TW1A 2W2XD 3GYOA 2MDXA 5JLJB 2BCJA 2P0DA 3F0WA 4YONA 1MIXA 1H4RA 2YT1A 1AWEA 2DKQA 2ROVA 2CRFA 3QBVB 2DHKA 2DA0A 1EAZA 4B6HA 3FM8C 1BTNA 1FAOA 1UNPA 3PSCA 2X18A 5CLQB 1TJ6A 2D9ZA 3UZTA 2M38A 1M7RA 2IYBA 2YSZA 2NZ8B 2JP2A 2ELAA 1MIZB 1SGHA 1FB8A 2DYNA 2YS1A 1WJ1A 2EC1A 2KCJA 4KVGB 5DIFB 3PP2A 1U29A 1TQZA 1RRPB 1NTYA 4WVFB 4GXBA 4HDQA 4TKNA 5KQ1A 2RGNB 3ULCA 1WI1A 2OQBA 2ADZA 2DX1A 4KAXB 3AU4A 4PNKA 1XR0B 4YL8A 3ULBA 3SNHA 1B55A 4EKUA 4GMVA 1KZ7A 4Z2MB 4HAUB 5C6RA 2FJLA 1OY2A 2LKOA 4EMOA 4HATB 1V89A 4GPTB 3P6AA 2KGXB 3D8FA 4GN1A 1DDWA 1V5UA 3PEGA 2D9YA 4HAVB 1ZC4B 2DYQA 1U5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A6H A;  2I5C A;  4DX8 A;  2RUK B;  1M7E A;  2D9W A;  3SYX A;  1MK7 B;  1KI1 B;  5C16 A;  3OAN A;  2NMB A;  2LG1 A;  2YVC A;  3MDB C;  2D2Q A;  2GS0 A;  4GMX B;  4CHM A;  3M1I B;  3PZD A;  2QKM A;  5KQ4 A;  2Z0O A;  3BIN A;  1XOD A;  1E5W A;  1U2B A;  1MKE A;  3TVV A;  4IAP A;  5C5B A;  5D3Y A;  2L2I A;  1ZC3 B;  2IFS A;  4NY0 A;  1W1H A;  2UZS A;  2CY5 A;  4MT7 A;  2PZ1 A;  2HE7 A;  4ZRJ A;  1V88 A;  1K5D B;  1SHC A;  1FGY A;  5KCV A;  5L81 A;  1V5P A;  1FHW A;  2V76 A;  2MWN B;  1UNQ A;  1UEF A;  1NU2 A;  1K5G B;  1I2H A;  5DHF B;  3FSS A;  1Y19 B;  2I1J A;  5JHH A;  2R0D A;  4CHJ A;  2GCL A;  1TXD A;  5CLL B;  1DYN A;  1MPH A;  3V5W A;  1GC7 A;  1X11 A;  3KRW A;  1Y5O A;  2D11 A;  2QKL A;  3NSU A;  1ZSQ A;  4HAY B;  3F5R A;  1W1G A;  4HB2 B;  1XKE A;  2YT0 A;  1GC6 A;  2HTH B;  2I5F A;  5D3X A;  4Y94 A;  1WJM A;  4A5K A;  2ELB A;  1V61 A;  4C0A A;  1P5T A;  1OQN A;  1DRO A;  4PQ0 A;  3D8E A;  4TYZ A;  5C79 A;  2MKR A;  4IFS A;  1WG7 A;  1X05 A;  3U7D A;  3RCP A;  5HE2 A;  1NTV A;  2LYD A;  4KHB B;  3QWM A;  2Y8F A;  1ISN A;  2ZPY A;  5JP4 A;  2YS3 A;  1EGX A;  4EJN A;  1RJ2 A;  1Z87 A;  1GG3 A;  4F7H A;  2GCJ A;  4BBK A;  1BAK A;  3DXD A;  1WVH A;  2VRW B;  4CYE A;  3O96 A;  2P0H A;  3KZ1 A;  1U5F A;  4P7I A;  1UPQ A;  1XCG A;  1WGU A;  5EFX A;  3ZVR A;  4ZRI A;  1J19 A;  1NI2 A;  5JHG A;  2AL6 A;  1J0W A;  1X86 A;  2COC A;  4HAW B;  2EMT A;  3ODX A;  4ZRK A;  3TFM A;  2UZR A;  1KZG A;  2Y8G A;  3IVF A;  4HB0 B;  3T06 A;  3FEH A;  1FOE A;  4A6F A;  2COD A;  3HK0 A;  2LOX A;  1LB1 A;  1U5D A;  2CAY A;  2VKI A;  1QC6 A;  2I1K A;  5C5B B;  2J59 M;  2K00 A;  4HB4 B;  2K2U A;  2CY4 A;  1QQG A;  2P8V A;  4KHA A;  1U27 A;  4IOY X;  1U5E A;  2MFQ A;  2AEH A;  2P0F A;  1X1G A;  3PVU A;  2DKP A;  1V5M A;  2G35 A;  5DHA B;  4DXA B;  1FHO A;  3ZDT A;  4F7U P;  1UNR A;  2D4Q A;  2M14 A;  3VIA A;  2H7E A;  5DH9 B;  3A98 B;  2OTX A;  2DTC A;  4HAZ B;  2J0J A;  3ODO A;  1DBH A;  2E2X A;  4K17 A;  5D27 A;  1Q67 A;  2YF0 A;  3VOQ A;  2EMS A;  2YS5 A;  1DDM A;  3AJ4 A;  1LW3 A;  4DX9 0;  1H10 A;  2Q13 A;  1BTK A;  1N3H A;  4KHO A;  1W1D A;  1ZM0 A;  3BJI A;  5HE0 A;  2RNR B;  2ROZ B;  2GJY A;  1UPR A;  3HQC A;  2RLO A;  3AU5 A;  5D3W A;  5LOP B;  3CXB B;  1PFJ A;  2Z0P A;  4HDO A;  4HB3 B;  5FI0 A;  1P6S A;  3DXE A;  1X1F A;  3U8Z A;  2D10 A;  4HAX B;  1P3R A;  2W2X C;  3SUZ A;  2LOZ A;  1BWN A;  4H8S A;  2DX5 A;  3SV1 A;  3SO6 A;  2K2J A;  1IRS A;  3A8P A;  1I7A A;  1AQC A;  2DHI A;  2DFK A;  2D9X A;  4MK0 A;  4D0N B;  2DN6 A;  2YRY A;  4HHV A;  1WGQ A;  2D9V A;  2DHJ A;  2UVM A;  1EVH A;  3QIJ A;  3HW2 B;  4MY6 A;  3PVW A;  5HE3 A;  2Z0Q A;  2RVB B;  2LUL A;  2N23 A;  3ML4 A;  3G9W A;  4K81 A;  4XWX A;  1EF1 A;  2R09 A;  3PVL A;  2J0M A;  4GZU A;  4L6E A;  1MK9 B;  2Y7B A;  3CIK A;  1XD4 A;  2VSZ A;  4WSF A;  2J0K A;  5GOW B;  3GYP A;  3P7Z A;  5FI1 A;  5J3Y A;  3D8D A;  3DXC A;  4F7G A;  1PMS A;  3KRX A;  1MAI A;  3N7C A;  4Z2N A;  1ZVR A;  2L1C A;  5DI9 B;  3ODW A;  3TO1 A;  2RSG A;  2H7D A;  3X23 A;  5J3Q A;  2COA A;  3KY9 A;  1XX0 A;  4K2P A;  4A6F B;  4A6K A;  3WYF B;  3A8Q A;  2W2W A;  2N0Y A;  4K2O A;  3WA0 A;  2EJ8 A;  3MPX A;  2XQN M;  1OMW A;  3LJU X;  5HE1 A;  5J3T A;  2DLW A;  3PG7 A;  1FHX A;  1PLS A;  2COF A;  4WJ7 A;  5D3V A;  3TCA A;  1FGZ A;  1DDV A;  2KUP A;  4DBB A;  5LON B;  4NSW A;  3KSY A;  3TW1 A;  2W2X D;  3GYO A;  2MDX A;  5JLJ B;  2BCJ A;  2P0D A;  3F0W A;  4YON A;  1MIX A;  1H4R A;  2YT1 A;  1AWE A;  2DKQ A;  2ROV A;  2CRF A;  3QBV B;  2DHK A;  2DA0 A;  1EAZ A;  4B6H A;  3FM8 C;  1BTN A;  1FAO A;  1UNP A;  3PSC A;  2X18 A;  5CLQ B;  1TJ6 A;  2D9Z A;  3UZT A;  2M38 A;  1M7R A;  2IYB A;  2YSZ A;  2NZ8 B;  2JP2 A;  2ELA A;  1MIZ B;  1SGH A;  1FB8 A;  2DYN A;  2YS1 A;  1WJ1 A;  2EC1 A;  2KCJ A;  4KVG B;  5DIF B;  3PP2 A;  1U29 A;  1TQZ A;  1RRP B;  1NTY A;  4WVF B;  4GXB A;  4HDQ A;  4TKN A;  5KQ1 A;  2RGN B;  3ULC A;  1WI1 A;  2OQB A;  2ADZ A;  2DX1 A;  4KAX B;  3AU4 A;  4PNK A;  1XR0 B;  4YL8 A;  3ULB A;  3SNH A;  1B55 A;  4EKU A;  4GMV A;  1KZ7 A;  4Z2M B;  4HAU B;  5C6R A;  2FJL A;  1OY2 A;  2LKO A;  4EMO A;  4HAT B;  1V89 A;  4GPT B;  3P6A A;  2KGX B;  3D8F A;  4GN1 A;  1DDW A;  1V5U A;  3PEG A;  2D9Y A;  4HAV B;  1ZC4 B;  2DYQ A;  1U5G A; 
#chains in the Genus database with same CATH topology
 4A6H A;  2I5C A;  4DX8 A;  4QXA B;  1ZYI A;  2RUK B;  1M7E A;  2D9W A;  3SYX A;  1MK7 B;  1KI1 B;  5C16 A;  3OAN A;  2NMB A;  2LG1 A;  2YVC A;  3MDB C;  2D2Q A;  2GS0 A;  4GMX B;  4CHM A;  3M1I B;  3PZD A;  2QKM A;  5KQ4 A;  2Z0O A;  3BIN A;  2Z59 A;  1XOD A;  1E5W A;  1U2B A;  1MKE A;  2KIG A;  3TVV A;  4IAP A;  5C5B A;  4QJ5 B;  5D3Y A;  1MI1 A;  5I2M A;  2L2I A;  1ZC3 B;  2IFS A;  4NY0 A;  1W1H A;  2UZS A;  2CY5 A;  2YT2 A;  4MT7 A;  2PZ1 A;  2HE7 A;  4ZRJ A;  1V88 A;  1K5D B;  1SHC A;  3NWA A;  3B77 A;  1FGY A;  5KCV A;  5L81 A;  1V5P A;  1FHW A;  2V76 A;  2MWN B;  1UNQ A;  1UEF A;  2ZKM X;  1NU2 A;  1K5G B;  1I2H A;  5DHF B;  5LG4 B;  3FSS A;  1Y19 B;  2FJU B;  2I1J A;  5JHH A;  2R0D A;  2Z13 A;  4CHJ A;  2GCL A;  1TXD A;  5CLL B;  1DYN A;  1MPH A;  3V5W A;  1GC7 A;  1X11 A;  3KRW A;  1Y5O A;  2D11 A;  2QKL A;  3NSU A;  1ZSQ A;  2K49 A;  4HAY B;  3F5R A;  1W1G A;  4GOU A;  4HB2 B;  1XKE A;  2YT0 A;  1GC6 A;  2HTH B;  2I5F A;  5D3X A;  4Y94 A;  1WJM A;  4A5K A;  2ELB A;  1V61 A;  4C0A A;  1P5T A;  1OQN A;  1DRO A;  4PQ0 A;  3D8E A;  4TYZ A;  5C79 A;  2MKR A;  4IFS A;  1WG7 A;  1X05 A;  3U7D A;  3RCP A;  5HE2 A;  1NTV A;  2LYD A;  4KHB B;  3QWM A;  2Y8F A;  1ISN A;  2ZPY A;  5JP4 A;  2YS3 A;  1EGX A;  4OSN A;  4EJN A;  1RJ2 A;  1Z87 A;  1GG3 A;  4F7H A;  2GCJ A;  4BBK A;  1BAK A;  3DXD A;  1WVH A;  2KR0 A;  2VRW B;  4CYE A;  3O96 A;  2P0H A;  3KZ1 A;  1U5F A;  4P7I A;  1UPQ A;  1XCG A;  1WGU A;  5EFX A;  3ZVR A;  4ZRI A;  1J19 A;  1NI2 A;  5JHG A;  2AL6 A;  1J0W A;  1X86 A;  2COC A;  4HAW B;  2EMT A;  3ODX A;  4ZRK A;  3TFM A;  2UZR A;  1KZG A;  2Y8G A;  3IVF A;  4HB0 B;  2RRF A;  3T06 A;  3FEH A;  1FOE A;  4A6F A;  2COD A;  3HK0 A;  3A58 A;  2LOX A;  1LB1 A;  1U5D A;  2CAY A;  2VKI A;  1QC6 A;  2I1K A;  5C5B B;  2J59 M;  2K00 A;  4HB4 B;  2K2U A;  2CY4 A;  1QQG A;  2GUM A;  2P8V A;  4KHA A;  1U27 A;  4IOY X;  1U5E A;  2MFQ A;  2AEH A;  2P0F A;  1X1G A;  3PVU A;  2DKP A;  3U12 A;  1V5M A;  2G35 A;  5DHA B;  4DXA B;  1FHO A;  3ZDT A;  4F7U P;  1UNR A;  2D4Q A;  3DCX A;  2M14 A;  3VIA A;  2H7E A;  5DH9 B;  3A98 B;  2OTX A;  3OHM B;  2DTC A;  4HAZ B;  2J0J A;  3ODO A;  1DBH A;  2E2X A;  4K17 A;  5D27 A;  4HSI A;  1Q67 A;  2YF0 A;  3VOQ A;  2EMS A;  2YS5 A;  1DDM A;  3AJ4 A;  1LW3 A;  4DX9 0;  1H10 A;  4GNK B;  2Q13 A;  1BTK A;  1N3H A;  4KHO A;  1W1D A;  1ZM0 A;  3BJI A;  5HE0 A;  2RNR B;  2ROZ B;  2GJY A;  1UPR A;  3HQC A;  2RLO A;  3AU5 A;  5D3W A;  5LOP B;  3CXB B;  1PFJ A;  2Z0P A;  4HDO A;  4HB3 B;  5FI0 A;  1P6S A;  3DXE A;  1X1F A;  4DIX A;  3U8Z A;  2D10 A;  4HAX B;  1P3R A;  2NBV A;  2W2X C;  3SUZ A;  2LOZ A;  1BWN A;  4H8S A;  2DX5 A;  3SV1 A;  2K8E A;  2K2J A;  3SO6 A;  1IRS A;  3A8P A;  4D6W A;  1I7A A;  1AQC A;  2DHI A;  2DFK A;  2D9X A;  4MK0 A;  4CSQ A;  4D0N B;  2DN6 A;  2YRY A;  4OT1 A;  4HHV A;  1WGQ A;  2D9V A;  2DHJ A;  2UVM A;  1EVH A;  3QIJ A;  3HW2 B;  2KIE A;  4MY6 A;  3PVW A;  5HE3 A;  2Z0Q A;  2RVB B;  2LUL A;  2N23 A;  3ML4 A;  3G9W A;  4K81 A;  1T77 A;  4XWX A;  2Z4D A;  1EF1 A;  2R09 A;  3PVL A;  2J0M A;  4GZU A;  4L6E A;  1MK9 B;  2Y7B A;  3CIK A;  1XD4 A;  2VSZ A;  4WSF A;  2J0K A;  5GOW B;  3GYP A;  3P7Z A;  3NW8 A;  5FI1 A;  5J3Y A;  3D8D A;  3DXC A;  4F7G A;  1PMS A;  3KRX A;  1MAI A;  3N7C A;  4Z2N A;  1ZVR A;  2L1C A;  5DI9 B;  3ODW A;  3TO1 A;  2RSG A;  2H7D A;  3X23 A;  5J3Q A;  2COA A;  3KY9 A;  1XX0 A;  4K2P A;  4A6F B;  5M4Y B;  4A6K A;  3WYF B;  3A8Q A;  2W2W A;  2KUQ A;  2N0Y A;  4K2O A;  3WA0 A;  2EJ8 A;  3MPX A;  2XQN M;  1OMW A;  3LJU X;  5HE1 A;  3HSA A;  5J3T A;  2DLW A;  3PG7 A;  1FHX A;  1PLS A;  2COF A;  4WJ7 A;  5D3V A;  3TCA A;  1FGZ A;  1DDV A;  2KUP A;  4L1R A;  4DBB A;  5LON B;  3FVC A;  3KSY A;  4NSW A;  3TW1 A;  2W2X D;  3GYO A;  2MDX A;  3HIE A;  5JLJ B;  2BCJ A;  3NWD A;  2P0D A;  3F0W A;  4YON A;  1MIX A;  1H4R A;  2YT1 A;  1AWE A;  2DKQ A;  2ROV A;  2CRF A;  3QBV B;  2DHK A;  2DA0 A;  1EAZ A;  4B6H A;  3FM8 C;  1BTN A;  1FAO A;  1UNP A;  3PSC A;  2X18 A;  5CLQ B;  1TJ6 A;  2D9Z A;  3UZT A;  2M38 A;  1M7R A;  2IYB A;  2YSZ A;  2NZ8 B;  2JP2 A;  2ELA A;  1MIZ B;  1SGH A;  1FB8 A;  2DYN A;  2YS1 A;  1WJ1 A;  2EC1 A;  2KCJ A;  4KVG B;  5DIF B;  4QJ4 B;  3PP2 A;  1U29 A;  1TQZ A;  1RRP B;  1NTY A;  4WVF B;  4GXB A;  4HDQ A;  4TKN A;  5KQ1 A;  2RGN B;  3ULC A;  1WI1 A;  2OQB A;  2ADZ A;  2DX1 A;  4KAX B;  3AU4 A;  3NWF A;  4PNK A;  2Z14 A;  1XR0 B;  4YL8 A;  3ULB A;  5I2S A;  3SNH A;  1B55 A;  4EKU A;  4GMV A;  5IRS A;  1KZ7 A;  4Z2M B;  4KHB A;  4HAU B;  5C6R A;  2FJL A;  1OY2 A;  2LKO A;  4QJ3 B;  4EMO A;  4HAT B;  1V89 A;  4GPT B;  3P6A A;  2KGX B;  3D8F A;  4GN1 A;  1DDW A;  1V5U A;  3PEG A;  2D9Y A;  2R2Y A;  4HAV B;  1ZC4 B;  2DYQ A;  1U5G A; 
#chains in the Genus database with same CATH homology
 4A6H A;  2I5C A;  4DX8 A;  2RUK B;  1M7E A;  2D9W A;  3SYX A;  1MK7 B;  1KI1 B;  5C16 A;  3OAN A;  2NMB A;  2LG1 A;  2YVC A;  3MDB C;  2D2Q A;  2GS0 A;  4GMX B;  4CHM A;  3M1I B;  3PZD A;  2QKM A;  5KQ4 A;  2Z0O A;  3BIN A;  1XOD A;  1E5W A;  1U2B A;  1MKE A;  3TVV A;  4IAP A;  5C5B A;  5D3Y A;  2L2I A;  1ZC3 B;  2IFS A;  4NY0 A;  1W1H A;  2UZS A;  2CY5 A;  4MT7 A;  2PZ1 A;  2HE7 A;  4ZRJ A;  1V88 A;  1K5D B;  1SHC A;  1FGY A;  5KCV A;  5L81 A;  1V5P A;  1FHW A;  2V76 A;  2MWN B;  1UNQ A;  1UEF A;  1NU2 A;  1K5G B;  1I2H A;  5DHF B;  3FSS A;  1Y19 B;  2I1J A;  5JHH A;  2R0D A;  4CHJ A;  2GCL A;  1TXD A;  5CLL B;  1DYN A;  1MPH A;  3V5W A;  1GC7 A;  1X11 A;  3KRW A;  1Y5O A;  2D11 A;  2QKL A;  3NSU A;  1ZSQ A;  4HAY B;  3F5R A;  1W1G A;  4HB2 B;  1XKE A;  2YT0 A;  1GC6 A;  2HTH B;  2I5F A;  5D3X A;  4Y94 A;  1WJM A;  4A5K A;  2ELB A;  1V61 A;  4C0A A;  1P5T A;  1OQN A;  1DRO A;  4PQ0 A;  3D8E A;  4TYZ A;  5C79 A;  2MKR A;  4IFS A;  1WG7 A;  1X05 A;  3U7D A;  3RCP A;  5HE2 A;  1NTV A;  2LYD A;  4KHB B;  3QWM A;  2Y8F A;  1ISN A;  2ZPY A;  5JP4 A;  2YS3 A;  1EGX A;  4EJN A;  1RJ2 A;  1Z87 A;  1GG3 A;  4F7H A;  2GCJ A;  4BBK A;  1BAK A;  3DXD A;  1WVH A;  2VRW B;  4CYE A;  3O96 A;  2P0H A;  3KZ1 A;  1U5F A;  4P7I A;  1UPQ A;  1XCG A;  1WGU A;  5EFX A;  3ZVR A;  4ZRI A;  1J19 A;  1NI2 A;  5JHG A;  2AL6 A;  1J0W A;  1X86 A;  2COC A;  4HAW B;  2EMT A;  3ODX A;  4ZRK A;  3TFM A;  2UZR A;  1KZG A;  2Y8G A;  3IVF A;  4HB0 B;  3T06 A;  3FEH A;  1FOE A;  4A6F A;  2COD A;  3HK0 A;  2LOX A;  1LB1 A;  1U5D A;  2CAY A;  2VKI A;  1QC6 A;  2I1K A;  5C5B B;  2J59 M;  2K00 A;  4HB4 B;  2K2U A;  2CY4 A;  1QQG A;  2P8V A;  4KHA A;  1U27 A;  4IOY X;  1U5E A;  2MFQ A;  2AEH A;  2P0F A;  1X1G A;  3PVU A;  2DKP A;  1V5M A;  2G35 A;  5DHA B;  4DXA B;  1FHO A;  3ZDT A;  4F7U P;  1UNR A;  2D4Q A;  2M14 A;  3VIA A;  2H7E A;  5DH9 B;  3A98 B;  2OTX A;  2DTC A;  4HAZ B;  2J0J A;  3ODO A;  1DBH A;  2E2X A;  4K17 A;  5D27 A;  1Q67 A;  2YF0 A;  3VOQ A;  2EMS A;  2YS5 A;  1DDM A;  3AJ4 A;  1LW3 A;  4DX9 0;  1H10 A;  2Q13 A;  1BTK A;  1N3H A;  4KHO A;  1W1D A;  1ZM0 A;  3BJI A;  5HE0 A;  2RNR B;  2ROZ B;  2GJY A;  1UPR A;  3HQC A;  2RLO A;  3AU5 A;  5D3W A;  5LOP B;  3CXB B;  1PFJ A;  2Z0P A;  4HDO A;  4HB3 B;  5FI0 A;  1P6S A;  3DXE A;  1X1F A;  3U8Z A;  2D10 A;  4HAX B;  1P3R A;  2W2X C;  3SUZ A;  2LOZ A;  1BWN A;  4H8S A;  2DX5 A;  3SV1 A;  3SO6 A;  2K2J A;  1IRS A;  3A8P A;  1I7A A;  1AQC A;  2DHI A;  2DFK A;  2D9X A;  4MK0 A;  4D0N B;  2DN6 A;  2YRY A;  4HHV A;  1WGQ A;  2D9V A;  2DHJ A;  2UVM A;  1EVH A;  3QIJ A;  3HW2 B;  4MY6 A;  3PVW A;  5HE3 A;  2Z0Q A;  2RVB B;  2LUL A;  2N23 A;  3ML4 A;  3G9W A;  4K81 A;  4XWX A;  1EF1 A;  2R09 A;  3PVL A;  2J0M A;  4GZU A;  4L6E A;  1MK9 B;  2Y7B A;  3CIK A;  1XD4 A;  2VSZ A;  4WSF A;  2J0K A;  5GOW B;  3GYP A;  3P7Z A;  5FI1 A;  5J3Y A;  3D8D A;  3DXC A;  4F7G A;  1PMS A;  3KRX A;  1MAI A;  3N7C A;  4Z2N A;  1ZVR A;  2L1C A;  5DI9 B;  3ODW A;  3TO1 A;  2RSG A;  2H7D A;  3X23 A;  5J3Q A;  2COA A;  3KY9 A;  1XX0 A;  4K2P A;  4A6F B;  4A6K A;  3WYF B;  3A8Q A;  2W2W A;  2N0Y A;  4K2O A;  3WA0 A;  2EJ8 A;  3MPX A;  2XQN M;  1OMW A;  3LJU X;  5HE1 A;  5J3T A;  2DLW A;  3PG7 A;  1FHX A;  1PLS A;  2COF A;  4WJ7 A;  5D3V A;  3TCA A;  1FGZ A;  1DDV A;  2KUP A;  4DBB A;  5LON B;  4NSW A;  3KSY A;  3TW1 A;  2W2X D;  3GYO A;  2MDX A;  5JLJ B;  2BCJ A;  2P0D A;  3F0W A;  4YON A;  1MIX A;  1H4R A;  2YT1 A;  1AWE A;  2DKQ A;  2ROV A;  2CRF A;  3QBV B;  2DHK A;  2DA0 A;  1EAZ A;  4B6H A;  3FM8 C;  1BTN A;  1FAO A;  1UNP A;  3PSC A;  2X18 A;  5CLQ B;  1TJ6 A;  2D9Z A;  3UZT A;  2M38 A;  1M7R A;  2IYB A;  2YSZ A;  2NZ8 B;  2JP2 A;  2ELA A;  1MIZ B;  1SGH A;  1FB8 A;  2DYN A;  2YS1 A;  1WJ1 A;  2EC1 A;  2KCJ A;  4KVG B;  5DIF B;  3PP2 A;  1U29 A;  1TQZ A;  1RRP B;  1NTY A;  4WVF B;  4GXB A;  4HDQ A;  4TKN A;  5KQ1 A;  2RGN B;  3ULC A;  1WI1 A;  2OQB A;  2ADZ A;  2DX1 A;  4KAX B;  3AU4 A;  4PNK A;  1XR0 B;  4YL8 A;  3ULB A;  3SNH A;  1B55 A;  4EKU A;  4GMV A;  1KZ7 A;  4Z2M B;  4HAU B;  5C6R A;  2FJL A;  1OY2 A;  2LKO A;  4EMO A;  4HAT B;  1V89 A;  4GPT B;  3P6A A;  2KGX B;  3D8F A;  4GN1 A;  1DDW A;  1V5U A;  3PEG A;  2D9Y A;  4HAV B;  1ZC4 B;  2DYQ A;  1U5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...