1PLSA

Solution structure of a pleckstrin homology domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
113
structure length
113
Chain Sequence
MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVFKITTTKQQDHFFQAAFLEERDAWVRDINKAIKCIEGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLECKSTRIN HOMOLOGY DOMAIN
publication title Solution structure of a pleckstrin-homology domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Phosphorylation
total genus 14
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 1994-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1plsA00
2GCLA 2I1JA 4WVFB 1GG3A 4EJNA 3KY9A 5LONB 1IRSA 1XD4A 2NZ8B 3D8EA 2J0JA 2DKQA 1LW3A 2D10A 1NI2A 2K2UA 3UZTA 1QC6A 2DHJA 2HTHB 4HAVB 2PZ1A 2DX1A 2W2XC 4KHOA 4ZRJA 4NY0A 1ISNA 5C5BB 2LULA 4MT7A 1Y19B 1FHOA 1TXDA 3A8PA 1XCGA 2K2JA 1M7EA 2ADZA 2GCJA 3AU5A 5CLQB 4HDOA 2AL6A 3ULCA 2DN6A 2V76A 3A8QA 3GYPA 4P7IA 2COAA 2ROVA 1WJMA 2J0MA 4WSFA 2DX5A 1KZ7A 1NTYA 4WJ7A 2YT1A 1MIXA 5DH9B 2LOZA 1X1GA 4L6EA 4NSWA 2BCJA 2K00A 5JLJB 1MIZB 4K2OA 5D27A 2Z0OA 3TFMA 2D9ZA 3ODOA 2L1CA 1FGYA 3SO6A 4HB4B 3HW2B 1K5DB 1ZC3B 2DTCA 1X05A 1V5MA 3TVVA 1EF1A 2D9VA 4A6FA 1U29A 2EJ8A 4ZRKA 4YONA 1EVHA 4CHJA 2YF0A 2CODA 1P3RA 3DXDA 5FI0A 2Q13A 2IYBA 3HK0A 4D0NB 1UNRA 2RVBB 2JP2A 1FOEA 4DX8A 2D11A 3MPXA 1EGXA 2RLOA 1ZSQA 1MAIA 2H7DA 4A5KA 1UPRA 3FSSA 1TJ6A 3IVFA 4IOYX 1ZC4B 2EMTA 5C16A 1QQGA 1NTVA 1DDVA 5HE1A 1ZVRA 2N23A 4C0AA 1UNPA 4TKNA 1Z87A 3BINA 3RCPA 2YSZA 4KHAA 3V5WA 2J0KA 1AQCA 2FJLA 4GMVA 3ZVRA 4DBBA 3KSYA 1U5DA 5CLLB 1U5GA 2UZSA 1I2HA 1K5GB 2LOXA 2GS0A 1FB8A 4EMOA 2CY5A 1PMSA 4IAPA 3D8FA 4TYZA 2DKPA 4HAXB 5KQ4A 2P0FA 1B55A 2COCA 2OTXA 1V5PA 2ELBA 2Y7BA 3ODWA 3PP2A 4PQ0A 5FI1A 5JHGA 1X86A 2DHIA 1DDMA 2J59M 4XWXA 1BWNA 4HAWB 1V88A 3M1IB 4MY6A 3SUZA 2YRYA 1OQNA 3ODXA 4HAZB 2W2XD 1XODA 2MFQA 1X1FA 2H7EA 3FEHA 1FHWA 1MK7B 3PVWA 2COFA 4GPTB 3ZDTA 2RGNB 4KVGB 3KZ1A 2LYDA 1WVHA 2D9YA 1V61A 5LOPB 4F7GA 3QIJA 2YS1A 1OY2A 1J19A 5JHHA 3F0WA 1Y5OA 4ZRIA 2M14A 4B6HA 4MK0A 2NMBA 3P7ZA 4F7HA 2DFKA 2CAYA 2ELAA 2ZPYA 1BTKA 2L2IA 1WJ1A 4YL8A 1U5EA 3X23A 1KI1B 3QBVB 3SNHA 5DHAB 1RJ2A 3U8ZA 4GZUA 1U2BA 2D2QA 2I1KA 4Z2NA 2IFSA 3BJIA 1XX0A 1P6SA 3PVLA 1M7RA 2DYNA 3ML4A 3TW1A 2LKOA 1N3HA 3G9WA 1MK9B 3PZDA 2UVMA 3SYXA 4A6FB 4BBKA 1DBHA 3TO1A 1NU2A 1XR0B 2XQNM 1P5TA 3DXEA 4KHBB 2RNRB 4EKUA 2M38A 3P6AA 2EMSA 4GXBA 4HB2B 3OANA 1FAOA 4Y94A 1MPHA 2UZRA 2Z0QA 2G35A 2Y8FA 2MWNB 4HDQA 3FM8C 5DHFB 2GJYA 3PEGA 4CHMA 2E2XA 2P8VA 1E5WA 1W1DA 2RSGA 3NSUA 1WGQA 2KCJA 5DIFB 4CYEA 3KRWA 1WI1A 5JP4A 1MKEA 4HHVA 1UNQA 2QKLA 3O96A 3LJUX 1Q67A 4HB0B 2DLWA 2MKRA 1H10A 4PNKA 1ZM0A 1AWEA 5J3YA 3U7DA 5D3YA 5C6RA 5C5BA 5KQ1A 1SHCA 2D9XA 1UEFA 2D4QA 3T06A 3GYOA 2KGXB 3HQCA 4K17A 2MDXA 3AU4A 1EAZA 5KCVA 5J3TA 4DX90 1PFJA 3A98B 1GC7A 3SV1A 1BTNA 2DYQA 3VIAA 2YVCA 3QWMA 1UPQA 5HE3A 4IFSA 1DYNA 5HE0A 5HE2A 2P0HA 2VKIA 3MDBC 1U5FA 2QKMA 2Z0PA 1FGZA 2OQBA 2X18A 3PVUA 2VRWB 3CIKA 5D3XA 2I5FA 2Y8GA 1J0WA 2DA0A 1WG7A 1V5UA 2YT0A 2P0DA 4Z2MB 3KRXA 1BAKA 5D3VA 1I7AA 4F7UP 4GN1A 4HAUB 3AJ4A 1W1GA 2ROZB 2HE7A 2DHKA 3ULBA 1V89A 2R0DA 3D8DA 2I5CA 3PG7A 3VOQA 1FHXA 2VSZA 4HAYB 4HATB 4HB3B 1SGHA 2RUKB 3N7CA 5D3WA 4K2PA 5J3QA 1TQZA 2YS3A 2CY4A 3DXCA 1H4RA 3TCAA 5L81A 1RRPB 1WGUA 3WYFB 2LG1A 2D9WA 4A6HA 2KUPA 1DROA 1DDWA 2CRFA 5C79A 3CXBB 2N0YA 5GOWB 1W1HA 1LB1A 1KZGA 1GC6A 2W2WA 3F5RA 5EFXA 4KAXB 1X11A 5DI9B 4GMXB 4H8SA 4K81A 2YS5A 3WA0A 3PSCA 1XKEA 1PLSA 4DXAB 2AEHA 1OMWA 4A6KA 2R09A 2EC1A 1U27A
chains in the Genus database with same CATH superfamily
2GCLA 2I1JA 3DCXA 4WVFB 1GG3A 4EJNA 3KY9A 5LONB 1IRSA 1XD4A 2NZ8B 3D8EA 2J0JA 2DKQA 1LW3A 2D10A 1NI2A 2K2UA 2Z13A 3UZTA 1QC6A 2DHJA 2HTHB 4HAVB 2PZ1A 2DX1A 2W2XC 4KHOA 4ZRJA 4QJ5B 4NY0A 1ISNA 5C5BB 2LULA 4MT7A 1Y19B 1FHOA 1TXDA 3A8PA 1XCGA 2K2JA 1M7EA 2ADZA 2GCJA 3AU5A 5CLQB 4HDOA 2AL6A 1T77A 3ULCA 2RRFA 2DN6A 2V76A 3A8QA 3GYPA 4P7IA 2COAA 2ROVA 1WJMA 2J0MA 4WSFA 2DX5A 1KZ7A 1NTYA 4WJ7A 2YT1A 1MIXA 5DH9B 2LOZA 1X1GA 4L6EA 4NSWA 2BCJA 2K00A 4HSIA 5JLJB 1MIZB 4K2OA 5D27A 2Z0OA 2KIEA 4QJ4B 3TFMA 2D9ZA 3ODOA 2L1CA 1FGYA 3SO6A 4HB4B 3HW2B 1K5DB 1ZC3B 2DTCA 1X05A 1V5MA 3TVVA 1EF1A 2D9VA 4A6FA 1U29A 2EJ8A 4ZRKA 4YONA 1EVHA 4CHJA 2YF0A 4KHBA 2CODA 1P3RA 3DXDA 5FI0A 2Q13A 2IYBA 3HK0A 4D0NB 1UNRA 5IRSA 2RVBB 2JP2A 1FOEA 4DX8A 2D11A 3MPXA 1EGXA 2RLOA 1ZSQA 1MAIA 2H7DA 4A5KA 1UPRA 3FSSA 1TJ6A 3IVFA 4IOYX 1ZC4B 2EMTA 5C16A 1QQGA 3B77A 1NTVA 1DDVA 5HE1A 1ZVRA 2N23A 4C0AA 1UNPA 4TKNA 1Z87A 3BINA 3RCPA 2YSZA 4KHAA 3V5WA 2J0KA 1AQCA 2FJLA 4GMVA 3ZVRA 4DBBA 3KSYA 1U5DA 5CLLB 1U5GA 2UZSA 1I2HA 1K5GB 2LOXA 2GS0A 1FB8A 4EMOA 2KIGA 2CY5A 1PMSA 4IAPA 3D8FA 4TYZA 2DKPA 4HAXB 5KQ4A 2P0FA 1B55A 2COCA 2OTXA 4OSNA 5I2MA 1V5PA 2ELBA 2Y7BA 3ODWA 3PP2A 4PQ0A 5FI1A 5JHGA 1X86A 2DHIA 1DDMA 2J59M 4XWXA 1BWNA 4HAWB 1ZYIA 1V88A 3M1IB 4MY6A 3SUZA 2YRYA 1OQNA 3ODXA 4HAZB 2W2XD 1XODA 2MFQA 1X1FA 3A58A 2H7EA 3FEHA 1FHWA 1MK7B 3PVWA 4DIXA 3NWFA 2COFA 4GPTB 3ZDTA 2RGNB 4KVGB 3KZ1A 2LYDA 1WVHA 2D9YA 1V61A 5LOPB 4F7GA 3QIJA 2YS1A 5I2SA 1OY2A 1J19A 5JHHA 1MI1A 3F0WA 1Y5OA 4ZRIA 2M14A 4B6HA 4MK0A 2NMBA 3P7ZA 4F7HA 2DFKA 2CAYA 2ELAA 2ZPYA 5M4YB 1BTKA 2L2IA 1WJ1A 3FVCA 4YL8A 1U5EA 3X23A 1KI1B 3QBVB 3SNHA 5DHAB 1RJ2A 3U8ZA 4GZUA 1U2BA 2D2QA 2I1KA 4Z2NA 2K8EA 4D6WA 2IFSA 3BJIA 1XX0A 1P6SA 3PVLA 1M7RA 2DYNA 3ML4A 3TW1A 2LKOA 1N3HA 3G9WA 4GOUA 1MK9B 3PZDA 2UVMA 3SYXA 4A6FB 4BBKA 2Z14A 1DBHA 3TO1A 1NU2A 1XR0B 2XQNM 1P5TA 3DXEA 4KHBB 2RNRB 4EKUA 2M38A 3P6AA 2EMSA 4GXBA 4HB2B 3OANA 1FAOA 4Y94A 1MPHA 2UZRA 2YT2A 2Z0QA 2G35A 2Y8FA 2MWNB 4HDQA 3FM8C 5DHFB 2GJYA 3PEGA 4CHMA 2E2XA 2P8VA 1E5WA 1W1DA 2RSGA 3NSUA 1WGQA 2KCJA 5DIFB 4CYEA 3KRWA 1WI1A 5JP4A 3U12A 1MKEA 4HHVA 1UNQA 2QKLA 3O96A 3LJUX 1Q67A 4GNKB 4HB0B 2DLWA 2MKRA 5LG4B 1H10A 4PNKA 1ZM0A 1AWEA 5J3YA 3U7DA 5D3YA 5C6RA 5C5BA 5KQ1A 3NWAA 1SHCA 2D9XA 1UEFA 2D4QA 3T06A 3GYOA 2KGXB 3HQCA 4K17A 2MDXA 3AU4A 1EAZA 5KCVA 5J3TA 4QJ3B 4DX90 1PFJA 3A98B 1GC7A 3SV1A 2R2YA 1BTNA 2DYQA 3VIAA 2YVCA 3QWMA 1UPQA 5HE3A 4IFSA 1DYNA 5HE0A 5HE2A 2P0HA 2VKIA 4CSQA 3MDBC 1U5FA 2QKMA 2Z0PA 1FGZA 4QXAB 2OQBA 2X18A 3PVUA 2VRWB 3CIKA 5D3XA 2I5FA 2Y8GA 1J0WA 2DA0A 1WG7A 1V5UA 2YT0A 2P0DA 4Z2MB 3KRXA 3NW8A 3NWDA 1BAKA 5D3VA 1I7AA 4F7UP 4GN1A 4HAUB 3AJ4A 1W1GA 2ROZB 2ZKMX 2HE7A 2DHKA 3ULBA 1V89A 3HIEA 2R0DA 3OHMB 3D8DA 2I5CA 2Z4DA 3PG7A 3VOQA 1FHXA 2VSZA 4HAYB 4HATB 4HB3B 1SGHA 2RUKB 3N7CA 5D3WA 4K2PA 5J3QA 1TQZA 2YS3A 2CY4A 3DXCA 1H4RA 3TCAA 5L81A 1RRPB 1WGUA 3WYFB 2LG1A 2D9WA 4A6HA 2KUPA 1DROA 1DDWA 2CRFA 5C79A 3CXBB 2N0YA 5GOWB 2NBVA 1W1HA 1LB1A 1KZGA 2K49A 1GC6A 2KR0A 2W2WA 3F5RA 5EFXA 4KAXB 1X11A 5DI9B 4GMXB 4H8SA 4K81A 2YS5A 3WA0A 3PSCA 1XKEA 3HSAA 1PLSA 4DXAB 4OT1A 2AEHA 1OMWA 4A6KA 2KUQA 2R09A 2GUMA 4L1RA 2Z59A 2EC1A 1U27A 2FJUB
chains in the Genus database with same CATH topology
2GCLA 2I1JA 4WVFB 1GG3A 4EJNA 3KY9A 5LONB 1IRSA 1XD4A 2NZ8B 3D8EA 2J0JA 2DKQA 1LW3A 2D10A 1NI2A 2K2UA 3UZTA 1QC6A 2DHJA 2HTHB 4HAVB 2PZ1A 2DX1A 2W2XC 4KHOA 4ZRJA 4NY0A 1ISNA 5C5BB 2LULA 4MT7A 1Y19B 1FHOA 1TXDA 3A8PA 1XCGA 2K2JA 1M7EA 2ADZA 2GCJA 3AU5A 5CLQB 4HDOA 2AL6A 3ULCA 2DN6A 2V76A 3A8QA 3GYPA 4P7IA 2COAA 2ROVA 1WJMA 2J0MA 4WSFA 2DX5A 1KZ7A 1NTYA 4WJ7A 2YT1A 1MIXA 5DH9B 2LOZA 1X1GA 4L6EA 4NSWA 2BCJA 2K00A 5JLJB 1MIZB 4K2OA 5D27A 2Z0OA 3TFMA 2D9ZA 3ODOA 2L1CA 1FGYA 3SO6A 4HB4B 3HW2B 1K5DB 1ZC3B 2DTCA 1X05A 1V5MA 3TVVA 1EF1A 2D9VA 4A6FA 1U29A 2EJ8A 4ZRKA 4YONA 1EVHA 4CHJA 2YF0A 2CODA 1P3RA 3DXDA 5FI0A 2Q13A 2IYBA 3HK0A 4D0NB 1UNRA 2RVBB 2JP2A 1FOEA 4DX8A 2D11A 3MPXA 1EGXA 2RLOA 1ZSQA 1MAIA 2H7DA 4A5KA 1UPRA 3FSSA 1TJ6A 3IVFA 4IOYX 1ZC4B 2EMTA 5C16A 1QQGA 1NTVA 1DDVA 5HE1A 1ZVRA 2N23A 4C0AA 1UNPA 4TKNA 1Z87A 3BINA 3RCPA 2YSZA 4KHAA 3V5WA 2J0KA 1AQCA 2FJLA 4GMVA 3ZVRA 4DBBA 3KSYA 1U5DA 5CLLB 1U5GA 2UZSA 1I2HA 1K5GB 2LOXA 2GS0A 1FB8A 4EMOA 2CY5A 1PMSA 4IAPA 3D8FA 4TYZA 2DKPA 4HAXB 5KQ4A 2P0FA 1B55A 2COCA 2OTXA 1V5PA 2ELBA 2Y7BA 3ODWA 3PP2A 4PQ0A 5FI1A 5JHGA 1X86A 2DHIA 1DDMA 2J59M 4XWXA 1BWNA 4HAWB 1V88A 3M1IB 4MY6A 3SUZA 2YRYA 1OQNA 3ODXA 4HAZB 2W2XD 1XODA 2MFQA 1X1FA 2H7EA 3FEHA 1FHWA 1MK7B 3PVWA 2COFA 4GPTB 3ZDTA 2RGNB 4KVGB 3KZ1A 2LYDA 1WVHA 2D9YA 1V61A 5LOPB 4F7GA 3QIJA 2YS1A 1OY2A 1J19A 5JHHA 3F0WA 1Y5OA 4ZRIA 2M14A 4B6HA 4MK0A 2NMBA 3P7ZA 4F7HA 2DFKA 2CAYA 2ELAA 2ZPYA 1BTKA 2L2IA 1WJ1A 4YL8A 1U5EA 3X23A 1KI1B 3QBVB 3SNHA 5DHAB 1RJ2A 3U8ZA 4GZUA 1U2BA 2D2QA 2I1KA 4Z2NA 2IFSA 3BJIA 1XX0A 1P6SA 3PVLA 1M7RA 2DYNA 3ML4A 3TW1A 2LKOA 1N3HA 3G9WA 1MK9B 3PZDA 2UVMA 3SYXA 4A6FB 4BBKA 1DBHA 3TO1A 1NU2A 1XR0B 2XQNM 1P5TA 3DXEA 4KHBB 2RNRB 4EKUA 2M38A 3P6AA 2EMSA 4GXBA 4HB2B 3OANA 1FAOA 4Y94A 1MPHA 2UZRA 2Z0QA 2G35A 2Y8FA 2MWNB 4HDQA 3FM8C 5DHFB 2GJYA 3PEGA 4CHMA 2E2XA 2P8VA 1E5WA 1W1DA 2RSGA 3NSUA 1WGQA 2KCJA 5DIFB 4CYEA 3KRWA 1WI1A 5JP4A 1MKEA 4HHVA 1UNQA 2QKLA 3O96A 3LJUX 1Q67A 4HB0B 2DLWA 2MKRA 1H10A 4PNKA 1ZM0A 1AWEA 5J3YA 3U7DA 5D3YA 5C6RA 5C5BA 5KQ1A 1SHCA 2D9XA 1UEFA 2D4QA 3T06A 3GYOA 2KGXB 3HQCA 4K17A 2MDXA 3AU4A 1EAZA 5KCVA 5J3TA 4DX90 1PFJA 3A98B 1GC7A 3SV1A 1BTNA 2DYQA 3VIAA 2YVCA 3QWMA 1UPQA 5HE3A 4IFSA 1DYNA 5HE0A 5HE2A 2P0HA 2VKIA 3MDBC 1U5FA 2QKMA 2Z0PA 1FGZA 2OQBA 2X18A 3PVUA 2VRWB 3CIKA 5D3XA 2I5FA 2Y8GA 1J0WA 2DA0A 1WG7A 1V5UA 2YT0A 2P0DA 4Z2MB 3KRXA 1BAKA 5D3VA 1I7AA 4F7UP 4GN1A 4HAUB 3AJ4A 1W1GA 2ROZB 2HE7A 2DHKA 3ULBA 1V89A 2R0DA 3D8DA 2I5CA 3PG7A 3VOQA 1FHXA 2VSZA 4HAYB 4HATB 4HB3B 1SGHA 2RUKB 3N7CA 5D3WA 4K2PA 5J3QA 1TQZA 2YS3A 2CY4A 3DXCA 1H4RA 3TCAA 5L81A 1RRPB 1WGUA 3WYFB 2LG1A 2D9WA 4A6HA 2KUPA 1DROA 1DDWA 2CRFA 5C79A 3CXBB 2N0YA 5GOWB 1W1HA 1LB1A 1KZGA 1GC6A 2W2WA 3F5RA 5EFXA 4KAXB 1X11A 5DI9B 4GMXB 4H8SA 4K81A 2YS5A 3WA0A 3PSCA 1XKEA 1PLSA 4DXAB 2AEHA 1OMWA 4A6KA 2R09A 2EC1A 1U27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GCL A;  2I1J A;  4WVF B;  1GG3 A;  4EJN A;  3KY9 A;  5LON B;  1IRS A;  1XD4 A;  2NZ8 B;  3D8E A;  2J0J A;  2DKQ A;  1LW3 A;  2D10 A;  1NI2 A;  2K2U A;  3UZT A;  1QC6 A;  2DHJ A;  2HTH B;  4HAV B;  2PZ1 A;  2DX1 A;  2W2X C;  4KHO A;  4ZRJ A;  4NY0 A;  1ISN A;  5C5B B;  2LUL A;  4MT7 A;  1Y19 B;  1FHO A;  1TXD A;  3A8P A;  1XCG A;  2K2J A;  1M7E A;  2ADZ A;  2GCJ A;  3AU5 A;  5CLQ B;  4HDO A;  2AL6 A;  3ULC A;  2DN6 A;  2V76 A;  3A8Q A;  3GYP A;  4P7I A;  2COA A;  2ROV A;  1WJM A;  2J0M A;  4WSF A;  2DX5 A;  1KZ7 A;  1NTY A;  4WJ7 A;  2YT1 A;  1MIX A;  5DH9 B;  2LOZ A;  1X1G A;  4L6E A;  4NSW A;  2BCJ A;  2K00 A;  5JLJ B;  1MIZ B;  4K2O A;  5D27 A;  2Z0O A;  3TFM A;  2D9Z A;  3ODO A;  2L1C A;  1FGY A;  3SO6 A;  4HB4 B;  3HW2 B;  1K5D B;  1ZC3 B;  2DTC A;  1X05 A;  1V5M A;  3TVV A;  1EF1 A;  2D9V A;  4A6F A;  1U29 A;  2EJ8 A;  4ZRK A;  4YON A;  1EVH A;  4CHJ A;  2YF0 A;  2COD A;  1P3R A;  3DXD A;  5FI0 A;  2Q13 A;  2IYB A;  3HK0 A;  4D0N B;  1UNR A;  2RVB B;  2JP2 A;  1FOE A;  4DX8 A;  2D11 A;  3MPX A;  1EGX A;  2RLO A;  1ZSQ A;  1MAI A;  2H7D A;  4A5K A;  1UPR A;  3FSS A;  1TJ6 A;  3IVF A;  4IOY X;  1ZC4 B;  2EMT A;  5C16 A;  1QQG A;  1NTV A;  1DDV A;  5HE1 A;  1ZVR A;  2N23 A;  4C0A A;  1UNP A;  4TKN A;  1Z87 A;  3BIN A;  3RCP A;  2YSZ A;  4KHA A;  3V5W A;  2J0K A;  1AQC A;  2FJL A;  4GMV A;  3ZVR A;  4DBB A;  3KSY A;  1U5D A;  5CLL B;  1U5G A;  2UZS A;  1I2H A;  1K5G B;  2LOX A;  2GS0 A;  1FB8 A;  4EMO A;  2CY5 A;  1PMS A;  4IAP A;  3D8F A;  4TYZ A;  2DKP A;  4HAX B;  5KQ4 A;  2P0F A;  1B55 A;  2COC A;  2OTX A;  1V5P A;  2ELB A;  2Y7B A;  3ODW A;  3PP2 A;  4PQ0 A;  5FI1 A;  5JHG A;  1X86 A;  2DHI A;  1DDM A;  2J59 M;  4XWX A;  1BWN A;  4HAW B;  1V88 A;  3M1I B;  4MY6 A;  3SUZ A;  2YRY A;  1OQN A;  3ODX A;  4HAZ B;  2W2X D;  1XOD A;  2MFQ A;  1X1F A;  2H7E A;  3FEH A;  1FHW A;  1MK7 B;  3PVW A;  2COF A;  4GPT B;  3ZDT A;  2RGN B;  4KVG B;  3KZ1 A;  2LYD A;  1WVH A;  2D9Y A;  1V61 A;  5LOP B;  4F7G A;  3QIJ A;  2YS1 A;  1OY2 A;  1J19 A;  5JHH A;  3F0W A;  1Y5O A;  4ZRI A;  2M14 A;  4B6H A;  4MK0 A;  2NMB A;  3P7Z A;  4F7H A;  2DFK A;  2CAY A;  2ELA A;  2ZPY A;  1BTK A;  2L2I A;  1WJ1 A;  4YL8 A;  1U5E A;  3X23 A;  1KI1 B;  3QBV B;  3SNH A;  5DHA B;  1RJ2 A;  3U8Z A;  4GZU A;  1U2B A;  2D2Q A;  2I1K A;  4Z2N A;  2IFS A;  3BJI A;  1XX0 A;  1P6S A;  3PVL A;  1M7R A;  2DYN A;  3ML4 A;  3TW1 A;  2LKO A;  1N3H A;  3G9W A;  1MK9 B;  3PZD A;  2UVM A;  3SYX A;  4A6F B;  4BBK A;  1DBH A;  3TO1 A;  1NU2 A;  1XR0 B;  2XQN M;  1P5T A;  3DXE A;  4KHB B;  2RNR B;  4EKU A;  2M38 A;  3P6A A;  2EMS A;  4GXB A;  4HB2 B;  3OAN A;  1FAO A;  4Y94 A;  1MPH A;  2UZR A;  2Z0Q A;  2G35 A;  2Y8F A;  2MWN B;  4HDQ A;  3FM8 C;  5DHF B;  2GJY A;  3PEG A;  4CHM A;  2E2X A;  2P8V A;  1E5W A;  1W1D A;  2RSG A;  3NSU A;  1WGQ A;  2KCJ A;  5DIF B;  4CYE A;  3KRW A;  1WI1 A;  5JP4 A;  1MKE A;  4HHV A;  1UNQ A;  2QKL A;  3O96 A;  3LJU X;  1Q67 A;  4HB0 B;  2DLW A;  2MKR A;  1H10 A;  4PNK A;  1ZM0 A;  1AWE A;  5J3Y A;  3U7D A;  5D3Y A;  5C6R A;  5C5B A;  5KQ1 A;  1SHC A;  2D9X A;  1UEF A;  2D4Q A;  3T06 A;  3GYO A;  2KGX B;  3HQC A;  4K17 A;  2MDX A;  3AU4 A;  1EAZ A;  5KCV A;  5J3T A;  4DX9 0;  1PFJ A;  3A98 B;  1GC7 A;  3SV1 A;  1BTN A;  2DYQ A;  3VIA A;  2YVC A;  3QWM A;  1UPQ A;  5HE3 A;  4IFS A;  1DYN A;  5HE0 A;  5HE2 A;  2P0H A;  2VKI A;  3MDB C;  1U5F A;  2QKM A;  2Z0P A;  1FGZ A;  2OQB A;  2X18 A;  3PVU A;  2VRW B;  3CIK A;  5D3X A;  2I5F A;  2Y8G A;  1J0W A;  2DA0 A;  1WG7 A;  1V5U A;  2YT0 A;  2P0D A;  4Z2M B;  3KRX A;  1BAK A;  5D3V A;  1I7A A;  4F7U P;  4GN1 A;  4HAU B;  3AJ4 A;  1W1G A;  2ROZ B;  2HE7 A;  2DHK A;  3ULB A;  1V89 A;  2R0D A;  3D8D A;  2I5C A;  3PG7 A;  3VOQ A;  1FHX A;  2VSZ A;  4HAY B;  4HAT B;  4HB3 B;  1SGH A;  2RUK B;  3N7C A;  5D3W A;  4K2P A;  5J3Q A;  1TQZ A;  2YS3 A;  2CY4 A;  3DXC A;  1H4R A;  3TCA A;  5L81 A;  1RRP B;  1WGU A;  3WYF B;  2LG1 A;  2D9W A;  4A6H A;  2KUP A;  1DRO A;  1DDW A;  2CRF A;  5C79 A;  3CXB B;  2N0Y A;  5GOW B;  1W1H A;  1LB1 A;  1KZG A;  1GC6 A;  2W2W A;  3F5R A;  5EFX A;  4KAX B;  1X11 A;  5DI9 B;  4GMX B;  4H8S A;  4K81 A;  2YS5 A;  3WA0 A;  3PSC A;  1XKE A;  1PLS A;  4DXA B;  2AEH A;  1OMW A;  4A6K A;  2R09 A;  2EC1 A;  1U27 A; 
#chains in the Genus database with same CATH topology
 2GCL A;  2I1J A;  3DCX A;  4WVF B;  1GG3 A;  4EJN A;  3KY9 A;  5LON B;  1IRS A;  1XD4 A;  2NZ8 B;  3D8E A;  2J0J A;  2DKQ A;  1LW3 A;  2D10 A;  1NI2 A;  2K2U A;  2Z13 A;  3UZT A;  1QC6 A;  2DHJ A;  2HTH B;  4HAV B;  2PZ1 A;  2DX1 A;  2W2X C;  4KHO A;  4ZRJ A;  4QJ5 B;  4NY0 A;  1ISN A;  5C5B B;  2LUL A;  4MT7 A;  1Y19 B;  1FHO A;  1TXD A;  3A8P A;  1XCG A;  2K2J A;  1M7E A;  2ADZ A;  2GCJ A;  3AU5 A;  5CLQ B;  4HDO A;  2AL6 A;  1T77 A;  3ULC A;  2RRF A;  2DN6 A;  2V76 A;  3A8Q A;  3GYP A;  4P7I A;  2COA A;  2ROV A;  1WJM A;  2J0M A;  4WSF A;  2DX5 A;  1KZ7 A;  1NTY A;  4WJ7 A;  2YT1 A;  1MIX A;  5DH9 B;  2LOZ A;  1X1G A;  4L6E A;  4NSW A;  2BCJ A;  2K00 A;  4HSI A;  5JLJ B;  1MIZ B;  4K2O A;  5D27 A;  2Z0O A;  2KIE A;  4QJ4 B;  3TFM A;  2D9Z A;  3ODO A;  2L1C A;  1FGY A;  3SO6 A;  4HB4 B;  3HW2 B;  1K5D B;  1ZC3 B;  2DTC A;  1X05 A;  1V5M A;  3TVV A;  1EF1 A;  2D9V A;  4A6F A;  1U29 A;  2EJ8 A;  4ZRK A;  4YON A;  1EVH A;  4CHJ A;  2YF0 A;  4KHB A;  2COD A;  1P3R A;  3DXD A;  5FI0 A;  2Q13 A;  2IYB A;  3HK0 A;  4D0N B;  1UNR A;  5IRS A;  2RVB B;  2JP2 A;  1FOE A;  4DX8 A;  2D11 A;  3MPX A;  1EGX A;  2RLO A;  1ZSQ A;  1MAI A;  2H7D A;  4A5K A;  1UPR A;  3FSS A;  1TJ6 A;  3IVF A;  4IOY X;  1ZC4 B;  2EMT A;  5C16 A;  1QQG A;  3B77 A;  1NTV A;  1DDV A;  5HE1 A;  1ZVR A;  2N23 A;  4C0A A;  1UNP A;  4TKN A;  1Z87 A;  3BIN A;  3RCP A;  2YSZ A;  4KHA A;  3V5W A;  2J0K A;  1AQC A;  2FJL A;  4GMV A;  3ZVR A;  4DBB A;  3KSY A;  1U5D A;  5CLL B;  1U5G A;  2UZS A;  1I2H A;  1K5G B;  2LOX A;  2GS0 A;  1FB8 A;  4EMO A;  2KIG A;  2CY5 A;  1PMS A;  4IAP A;  3D8F A;  4TYZ A;  2DKP A;  4HAX B;  5KQ4 A;  2P0F A;  1B55 A;  2COC A;  2OTX A;  4OSN A;  5I2M A;  1V5P A;  2ELB A;  2Y7B A;  3ODW A;  3PP2 A;  4PQ0 A;  5FI1 A;  5JHG A;  1X86 A;  2DHI A;  1DDM A;  2J59 M;  4XWX A;  1BWN A;  4HAW B;  1ZYI A;  1V88 A;  3M1I B;  4MY6 A;  3SUZ A;  2YRY A;  1OQN A;  3ODX A;  4HAZ B;  2W2X D;  1XOD A;  2MFQ A;  1X1F A;  3A58 A;  2H7E A;  3FEH A;  1FHW A;  1MK7 B;  3PVW A;  4DIX A;  3NWF A;  2COF A;  4GPT B;  3ZDT A;  2RGN B;  4KVG B;  3KZ1 A;  2LYD A;  1WVH A;  2D9Y A;  1V61 A;  5LOP B;  4F7G A;  3QIJ A;  2YS1 A;  5I2S A;  1OY2 A;  1J19 A;  5JHH A;  1MI1 A;  3F0W A;  1Y5O A;  4ZRI A;  2M14 A;  4B6H A;  4MK0 A;  2NMB A;  3P7Z A;  4F7H A;  2DFK A;  2CAY A;  2ELA A;  2ZPY A;  5M4Y B;  1BTK A;  2L2I A;  1WJ1 A;  3FVC A;  4YL8 A;  1U5E A;  3X23 A;  1KI1 B;  3QBV B;  3SNH A;  5DHA B;  1RJ2 A;  3U8Z A;  4GZU A;  1U2B A;  2D2Q A;  2I1K A;  4Z2N A;  2K8E A;  4D6W A;  2IFS A;  3BJI A;  1XX0 A;  1P6S A;  3PVL A;  1M7R A;  2DYN A;  3ML4 A;  3TW1 A;  2LKO A;  1N3H A;  3G9W A;  4GOU A;  1MK9 B;  3PZD A;  2UVM A;  3SYX A;  4A6F B;  4BBK A;  2Z14 A;  1DBH A;  3TO1 A;  1NU2 A;  1XR0 B;  2XQN M;  1P5T A;  3DXE A;  4KHB B;  2RNR B;  4EKU A;  2M38 A;  3P6A A;  2EMS A;  4GXB A;  4HB2 B;  3OAN A;  1FAO A;  4Y94 A;  1MPH A;  2UZR A;  2YT2 A;  2Z0Q A;  2G35 A;  2Y8F A;  2MWN B;  4HDQ A;  3FM8 C;  5DHF B;  2GJY A;  3PEG A;  4CHM A;  2E2X A;  2P8V A;  1E5W A;  1W1D A;  2RSG A;  3NSU A;  1WGQ A;  2KCJ A;  5DIF B;  4CYE A;  3KRW A;  1WI1 A;  5JP4 A;  3U12 A;  1MKE A;  4HHV A;  1UNQ A;  2QKL A;  3O96 A;  3LJU X;  1Q67 A;  4GNK B;  4HB0 B;  2DLW A;  2MKR A;  5LG4 B;  1H10 A;  4PNK A;  1ZM0 A;  1AWE A;  5J3Y A;  3U7D A;  5D3Y A;  5C6R A;  5C5B A;  5KQ1 A;  3NWA A;  1SHC A;  2D9X A;  1UEF A;  2D4Q A;  3T06 A;  3GYO A;  2KGX B;  3HQC A;  4K17 A;  2MDX A;  3AU4 A;  1EAZ A;  5KCV A;  5J3T A;  4QJ3 B;  4DX9 0;  1PFJ A;  3A98 B;  1GC7 A;  3SV1 A;  2R2Y A;  1BTN A;  2DYQ A;  3VIA A;  2YVC A;  3QWM A;  1UPQ A;  5HE3 A;  4IFS A;  1DYN A;  5HE0 A;  5HE2 A;  2P0H A;  2VKI A;  4CSQ A;  3MDB C;  1U5F A;  2QKM A;  2Z0P A;  1FGZ A;  4QXA B;  2OQB A;  2X18 A;  3PVU A;  2VRW B;  3CIK A;  5D3X A;  2I5F A;  2Y8G A;  1J0W A;  2DA0 A;  1WG7 A;  1V5U A;  2YT0 A;  2P0D A;  4Z2M B;  3KRX A;  3NW8 A;  3NWD A;  1BAK A;  5D3V A;  1I7A A;  4F7U P;  4GN1 A;  4HAU B;  3AJ4 A;  1W1G A;  2ROZ B;  2ZKM X;  2HE7 A;  2DHK A;  3ULB A;  1V89 A;  3HIE A;  2R0D A;  3OHM B;  3D8D A;  2I5C A;  2Z4D A;  3PG7 A;  3VOQ A;  1FHX A;  2VSZ A;  4HAY B;  4HAT B;  4HB3 B;  1SGH A;  2RUK B;  3N7C A;  5D3W A;  4K2P A;  5J3Q A;  1TQZ A;  2YS3 A;  2CY4 A;  3DXC A;  1H4R A;  3TCA A;  5L81 A;  1RRP B;  1WGU A;  3WYF B;  2LG1 A;  2D9W A;  4A6H A;  2KUP A;  1DRO A;  1DDW A;  2CRF A;  5C79 A;  3CXB B;  2N0Y A;  5GOW B;  2NBV A;  1W1H A;  1LB1 A;  1KZG A;  2K49 A;  1GC6 A;  2KR0 A;  2W2W A;  3F5R A;  5EFX A;  4KAX B;  1X11 A;  5DI9 B;  4GMX B;  4H8S A;  4K81 A;  2YS5 A;  3WA0 A;  3PSC A;  1XKE A;  3HSA A;  1PLS A;  4DXA B;  4OT1 A;  2AEH A;  1OMW A;  4A6K A;  2KUQ A;  2R09 A;  2GUM A;  4L1R A;  2Z59 A;  2EC1 A;  1U27 A;  2FJU B; 
#chains in the Genus database with same CATH homology
 2GCL A;  2I1J A;  4WVF B;  1GG3 A;  4EJN A;  3KY9 A;  5LON B;  1IRS A;  1XD4 A;  2NZ8 B;  3D8E A;  2J0J A;  2DKQ A;  1LW3 A;  2D10 A;  1NI2 A;  2K2U A;  3UZT A;  1QC6 A;  2DHJ A;  2HTH B;  4HAV B;  2PZ1 A;  2DX1 A;  2W2X C;  4KHO A;  4ZRJ A;  4NY0 A;  1ISN A;  5C5B B;  2LUL A;  4MT7 A;  1Y19 B;  1FHO A;  1TXD A;  3A8P A;  1XCG A;  2K2J A;  1M7E A;  2ADZ A;  2GCJ A;  3AU5 A;  5CLQ B;  4HDO A;  2AL6 A;  3ULC A;  2DN6 A;  2V76 A;  3A8Q A;  3GYP A;  4P7I A;  2COA A;  2ROV A;  1WJM A;  2J0M A;  4WSF A;  2DX5 A;  1KZ7 A;  1NTY A;  4WJ7 A;  2YT1 A;  1MIX A;  5DH9 B;  2LOZ A;  1X1G A;  4L6E A;  4NSW A;  2BCJ A;  2K00 A;  5JLJ B;  1MIZ B;  4K2O A;  5D27 A;  2Z0O A;  3TFM A;  2D9Z A;  3ODO A;  2L1C A;  1FGY A;  3SO6 A;  4HB4 B;  3HW2 B;  1K5D B;  1ZC3 B;  2DTC A;  1X05 A;  1V5M A;  3TVV A;  1EF1 A;  2D9V A;  4A6F A;  1U29 A;  2EJ8 A;  4ZRK A;  4YON A;  1EVH A;  4CHJ A;  2YF0 A;  2COD A;  1P3R A;  3DXD A;  5FI0 A;  2Q13 A;  2IYB A;  3HK0 A;  4D0N B;  1UNR A;  2RVB B;  2JP2 A;  1FOE A;  4DX8 A;  2D11 A;  3MPX A;  1EGX A;  2RLO A;  1ZSQ A;  1MAI A;  2H7D A;  4A5K A;  1UPR A;  3FSS A;  1TJ6 A;  3IVF A;  4IOY X;  1ZC4 B;  2EMT A;  5C16 A;  1QQG A;  1NTV A;  1DDV A;  5HE1 A;  1ZVR A;  2N23 A;  4C0A A;  1UNP A;  4TKN A;  1Z87 A;  3BIN A;  3RCP A;  2YSZ A;  4KHA A;  3V5W A;  2J0K A;  1AQC A;  2FJL A;  4GMV A;  3ZVR A;  4DBB A;  3KSY A;  1U5D A;  5CLL B;  1U5G A;  2UZS A;  1I2H A;  1K5G B;  2LOX A;  2GS0 A;  1FB8 A;  4EMO A;  2CY5 A;  1PMS A;  4IAP A;  3D8F A;  4TYZ A;  2DKP A;  4HAX B;  5KQ4 A;  2P0F A;  1B55 A;  2COC A;  2OTX A;  1V5P A;  2ELB A;  2Y7B A;  3ODW A;  3PP2 A;  4PQ0 A;  5FI1 A;  5JHG A;  1X86 A;  2DHI A;  1DDM A;  2J59 M;  4XWX A;  1BWN A;  4HAW B;  1V88 A;  3M1I B;  4MY6 A;  3SUZ A;  2YRY A;  1OQN A;  3ODX A;  4HAZ B;  2W2X D;  1XOD A;  2MFQ A;  1X1F A;  2H7E A;  3FEH A;  1FHW A;  1MK7 B;  3PVW A;  2COF A;  4GPT B;  3ZDT A;  2RGN B;  4KVG B;  3KZ1 A;  2LYD A;  1WVH A;  2D9Y A;  1V61 A;  5LOP B;  4F7G A;  3QIJ A;  2YS1 A;  1OY2 A;  1J19 A;  5JHH A;  3F0W A;  1Y5O A;  4ZRI A;  2M14 A;  4B6H A;  4MK0 A;  2NMB A;  3P7Z A;  4F7H A;  2DFK A;  2CAY A;  2ELA A;  2ZPY A;  1BTK A;  2L2I A;  1WJ1 A;  4YL8 A;  1U5E A;  3X23 A;  1KI1 B;  3QBV B;  3SNH A;  5DHA B;  1RJ2 A;  3U8Z A;  4GZU A;  1U2B A;  2D2Q A;  2I1K A;  4Z2N A;  2IFS A;  3BJI A;  1XX0 A;  1P6S A;  3PVL A;  1M7R A;  2DYN A;  3ML4 A;  3TW1 A;  2LKO A;  1N3H A;  3G9W A;  1MK9 B;  3PZD A;  2UVM A;  3SYX A;  4A6F B;  4BBK A;  1DBH A;  3TO1 A;  1NU2 A;  1XR0 B;  2XQN M;  1P5T A;  3DXE A;  4KHB B;  2RNR B;  4EKU A;  2M38 A;  3P6A A;  2EMS A;  4GXB A;  4HB2 B;  3OAN A;  1FAO A;  4Y94 A;  1MPH A;  2UZR A;  2Z0Q A;  2G35 A;  2Y8F A;  2MWN B;  4HDQ A;  3FM8 C;  5DHF B;  2GJY A;  3PEG A;  4CHM A;  2E2X A;  2P8V A;  1E5W A;  1W1D A;  2RSG A;  3NSU A;  1WGQ A;  2KCJ A;  5DIF B;  4CYE A;  3KRW A;  1WI1 A;  5JP4 A;  1MKE A;  4HHV A;  1UNQ A;  2QKL A;  3O96 A;  3LJU X;  1Q67 A;  4HB0 B;  2DLW A;  2MKR A;  1H10 A;  4PNK A;  1ZM0 A;  1AWE A;  5J3Y A;  3U7D A;  5D3Y A;  5C6R A;  5C5B A;  5KQ1 A;  1SHC A;  2D9X A;  1UEF A;  2D4Q A;  3T06 A;  3GYO A;  2KGX B;  3HQC A;  4K17 A;  2MDX A;  3AU4 A;  1EAZ A;  5KCV A;  5J3T A;  4DX9 0;  1PFJ A;  3A98 B;  1GC7 A;  3SV1 A;  1BTN A;  2DYQ A;  3VIA A;  2YVC A;  3QWM A;  1UPQ A;  5HE3 A;  4IFS A;  1DYN A;  5HE0 A;  5HE2 A;  2P0H A;  2VKI A;  3MDB C;  1U5F A;  2QKM A;  2Z0P A;  1FGZ A;  2OQB A;  2X18 A;  3PVU A;  2VRW B;  3CIK A;  5D3X A;  2I5F A;  2Y8G A;  1J0W A;  2DA0 A;  1WG7 A;  1V5U A;  2YT0 A;  2P0D A;  4Z2M B;  3KRX A;  1BAK A;  5D3V A;  1I7A A;  4F7U P;  4GN1 A;  4HAU B;  3AJ4 A;  1W1G A;  2ROZ B;  2HE7 A;  2DHK A;  3ULB A;  1V89 A;  2R0D A;  3D8D A;  2I5C A;  3PG7 A;  3VOQ A;  1FHX A;  2VSZ A;  4HAY B;  4HAT B;  4HB3 B;  1SGH A;  2RUK B;  3N7C A;  5D3W A;  4K2P A;  5J3Q A;  1TQZ A;  2YS3 A;  2CY4 A;  3DXC A;  1H4R A;  3TCA A;  5L81 A;  1RRP B;  1WGU A;  3WYF B;  2LG1 A;  2D9W A;  4A6H A;  2KUP A;  1DRO A;  1DDW A;  2CRF A;  5C79 A;  3CXB B;  2N0Y A;  5GOW B;  1W1H A;  1LB1 A;  1KZG A;  1GC6 A;  2W2W A;  3F5R A;  5EFX A;  4KAX B;  1X11 A;  5DI9 B;  4GMX B;  4H8S A;  4K81 A;  2YS5 A;  3WA0 A;  3PSC A;  1XKE A;  1PLS A;  4DXA B;  2AEH A;  1OMW A;  4A6K A;  2R09 A;  2EC1 A;  1U27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...