1PLSA

Solution structure of a pleckstrin homology domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
113
structure length
113
Chain Sequence
MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVFKITTTKQQDHFFQAAFLEERDAWVRDINKAIKCIEGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLECKSTRIN HOMOLOGY DOMAIN
publication title Solution structure of a pleckstrin-homology domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Phosphorylation
total genus 14
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 1994-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1plsA00
4IOYX 2KCJA 3P6AA 5CLQB 2Y8FA 2LOXA 4K17A 2J0MA 2JP2A 1ZSQA 4H8SA 1SHCA 1SGHA 4HHVA 2COFA 4TYZA 4WSFA 2X18A 2LKOA 3O96A 3KRXA 2MKRA 3PZDA 4IFSA 3ODWA 2L1CA 4HAUB 4KHOA 3IVFA 2YS3A 2ZPYA 2UZSA 2OTXA 2YSZA 2YS5A 1Y5OA 1FGYA 5C6RA 4Z2NA 1FHWA 1GG3A 4IAPA 3N7CA 1ZC3B 2P0FA 4HATB 2AEHA 4A6HA 1MPHA 3PSCA 2D9ZA 3U7DA 4BBKA 3SUZA 1I7AA 1ZC4B 2I5FA 1K5DB 4PNKA 3A8QA 4MY6A 1FAOA 4A5KA 4EJNA 3NSUA 5D27A 5FI1A 5DHFB 2EJ8A 3D8FA 4DX90 5EFXA 1MIZB 1W1HA 1U2BA 2AL6A 3GYPA 1ZVRA 1X05A 1WGQA 2VRWB 5D3YA 1U5FA 1FB8A 4WJ7A 2DHJA 2R0DA 5JHGA 2VSZA 1KZ7A 3ODXA 3SYXA 2UVMA 3PEGA 3SNHA 4GXBA 1QQGA 2ELBA 5CLLB 2M38A 2FJLA 3MDBC 2CODA 5FI0A 1DDVA 3VIAA 3KY9A 3FEHA 3PVUA 3DXCA 2NZ8B 4HB4B 1LW3A 1UNQA 1PMSA 1RJ2A 4NY0A 5KQ1A 4YL8A 5HE2A 3D8DA 2PZ1A 1WGUA 5D3XA 4HB0B 1H10A 2W2XD 2HTHB 5JLJB 2CRFA 2IYBA 2Y7BA 2ADZA 4HB2B 3PG7A 1OQNA 4HAYB 5D3WA 1U5DA 2I1KA 1J0WA 2RNRB 1UPRA 2COCA 2DKPA 3RCPA 2N0YA 3QBVB 2DTCA 3TVVA 1WG7A 4HB3B 3WYFB 3MPXA 2DHIA 2DX5A 2DYQA 2D9VA 2Z0PA 1XX0A 5HE0A 2MWNB 4GMVA 2NMBA 3ODOA 1OY2A 4XWXA 1I2HA 5LOPB 1LB1A 2DHKA 2I5CA 1GC6A 5C5BB 3HW2B 1ZM0A 4ZRIA 1UEFA 3CXBB 1NU2A 2QKMA 2V76A 1U5GA 4KVGB 5C5BA 2N23A 2I1JA 5HE3A 2YRYA 4HDQA 4KAXB 3VOQA 2ROZB 1U5EA 2D10A 1BTKA 3GYOA 1XODA 1EGXA 2ROVA 1DBHA 5JHHA 5D3VA 1BWNA 4F7UP 1P3RA 1FGZA 1V5PA 1AQCA 2J59M 2D9WA 3G9WA 4GZUA 1PFJA 1M7EA 2RGNB 4CYEA 4F7HA 4TKNA 4DBBA 1UPQA 2BCJA 5JP4A 2YF0A 1FHXA 1TJ6A 1IRSA 2E2XA 2D9YA 1OMWA 2GJYA 3A8PA 1J19A 1EVHA 2DA0A 2RLOA 3X23A 3AU4A 3TW1A 2CAYA 2Z0OA 2D2QA 4KHBB 2M14A 4A6FB 3QWMA 3AJ4A 2YT1A 3AU5A 4B6HA 4CHJA 2DKQA 1ISNA 2KUPA 2LG1A 3TCAA 4L6EA 2QKLA 3KZ1A 4A6FA 2K00A 1UNRA 1XKEA 2W2WA 3KSYA 1RRPB 5J3YA 3UZTA 5KQ4A 2GS0A 2RUKB 3ZVRA 2EMSA 3T06A 5GOWB 3SO6A 3F5RA 1FOEA 4PQ0A 1MAIA 2P8VA 3ULCA 5C16A 4Z2MB 1FHOA 4DX8A 1XD4A 1EF1A 4EKUA 3D8EA 3BINA 1WI1A 4A6KA 1MIXA 1NTVA 2D9XA 4HAZB 3HQCA 4EMOA 1Y19B 1MK9B 3ZDTA 4F7GA 1KZGA 1TQZA 3BJIA 3TO1A 2W2XC 3V5WA 3QIJA 1DDWA 1BAKA 1Q67A 1DDMA 1V89A 4GPTB 1AWEA 3OANA 1NTYA 1PLSA 1DROA 2DFKA 4GN1A 4Y94A 4HAVB 1P6SA 1U27A 1TXDA 2RSGA 2EMTA 2D4QA 4MK0A 3TFMA 4CHMA 1W1GA 2COAA 2LOZA 3ML4A 2L2IA 5DI9B 4ZRKA 2Y8GA 2KGXB 2UZRA 5HE1A 5J3QA 2GCLA 3KRWA 2LULA 2H7EA 1V5MA 4K81A 3HK0A 3CIKA 2DX1A 3PP2A 2Z0QA 3DXDA 1EAZA 1U29A 2R09A 1WVHA 3SV1A 2MFQA 2CY5A 2MDXA 3M1IB 5DHAB 4ZRJA 1H4RA 1UNPA 1XR0B 4GMXB 4DXAB 2RVBB 4P7IA 2P0DA 4D0NB 5KCVA 1MK7B 1P5TA 2J0JA 3PVWA 1N3HA 3U8ZA 2H7DA 2G35A 1WJ1A 1NI2A 5DH9B 1X1GA 4K2PA 2P0HA 2DN6A 2Q13A 4K2OA 2ELAA 1W1DA 1WJMA 2D11A 2YS1A 2XQNM 2HE7A 4MT7A 1V61A 1DYNA 3WA0A 1X1FA 5LONB 1KI1B 1Z87A 2K2UA 3F0WA 3P7ZA 2YVCA 2EC1A 1E5WA 2LYDA 2YT0A 2CY4A 2VKIA 3A98B 4KHAA 1X86A 3FSSA 1K5GB 1XCGA 3ULBA 1BTNA 2DLWA 5J3TA 2IFSA 2DYNA 3DXEA 1V5UA 5L81A 1M7RA 4YONA 2GCJA 1V88A 4NSWA 1MKEA 2K2JA 1B55A 4WVFB 2OQBA 4HDOA 5DIFB 1QC6A 3LJUX 5C79A 3PVLA 4HAWB 1GC7A 4HAXB 2J0KA 1X11A 3FM8C 4C0AA
chains in the Genus database with same CATH superfamily
4IOYX 2KCJA 3P6AA 5CLQB 2Y8FA 2LOXA 4K17A 2J0MA 2JP2A 1ZSQA 4H8SA 1SHCA 1SGHA 4HHVA 2COFA 4TYZA 4WSFA 2Z14A 2X18A 2LKOA 3O96A 3KRXA 2MKRA 2R2YA 3PZDA 4IFSA 3ODWA 2L1CA 4HAUB 4KHOA 3IVFA 2YS3A 2ZPYA 2UZSA 2OTXA 2YSZA 2YS5A 1Y5OA 1FGYA 5C6RA 5IRSA 3FVCA 4Z2NA 1FHWA 1GG3A 4IAPA 3B77A 2K8EA 3N7CA 1ZC3B 2P0FA 4HATB 2AEHA 4A6HA 1MPHA 3PSCA 2D9ZA 3U7DA 4BBKA 3SUZA 1I7AA 1ZC4B 2I5FA 1K5DB 1MI1A 4PNKA 3A8QA 4MY6A 1FAOA 4A5KA 4EJNA 3NSUA 5D27A 5FI1A 5DHFB 2EJ8A 3D8FA 4DX90 5EFXA 1MIZB 1W1HA 1U2BA 2AL6A 3GYPA 1ZVRA 1X05A 1WGQA 2VRWB 5D3YA 1U5FA 1FB8A 4WJ7A 2DHJA 2R0DA 5JHGA 2VSZA 1KZ7A 3ODXA 3SYXA 2UVMA 3PEGA 3SNHA 2GUMA 4GXBA 1QQGA 2ELBA 5CLLB 2M38A 2FJLA 3MDBC 2CODA 5FI0A 1DDVA 2Z59A 3VIAA 3KY9A 3FEHA 3PVUA 3DXCA 2NZ8B 4HB4B 2FJUB 1LW3A 1UNQA 1PMSA 1RJ2A 4NY0A 5KQ1A 4YL8A 5HE2A 3D8DA 2PZ1A 1WGUA 5D3XA 4HB0B 1H10A 2W2XD 2HTHB 3NWDA 5JLJB 2CRFA 2IYBA 2Y7BA 2ADZA 4HB2B 3PG7A 1OQNA 3NWAA 4CSQA 4HAYB 5D3WA 1U5DA 2I1KA 1J0WA 2RNRB 1UPRA 2COCA 2DKPA 2KR0A 3RCPA 2N0YA 3QBVB 2DTCA 3TVVA 1WG7A 4HB3B 3WYFB 3MPXA 2DHIA 2DX5A 2DYQA 2D9VA 2Z0PA 1XX0A 5HE0A 2MWNB 4GMVA 2NMBA 3ODOA 1OY2A 4XWXA 1I2HA 5LOPB 1LB1A 2DHKA 2I5CA 1GC6A 5C5BB 3HW2B 1ZM0A 4ZRIA 2Z13A 1UEFA 3OHMB 3CXBB 1NU2A 2QKMA 2V76A 1U5GA 5I2MA 4KVGB 5C5BA 2N23A 2I1JA 5HE3A 2YRYA 4HDQA 4KAXB 3VOQA 2ROZB 1ZYIA 1U5EA 2D10A 1BTKA 2K49A 3GYOA 4HSIA 1XODA 1EGXA 2ROVA 1DBHA 5JHHA 2KUQA 5D3VA 1BWNA 4F7UP 1P3RA 1FGZA 1V5PA 1AQCA 2J59M 2D9WA 3G9WA 4GZUA 5M4YB 1PFJA 1M7EA 2RGNB 4CYEA 4F7HA 4TKNA 4DBBA 1UPQA 2BCJA 5JP4A 2YF0A 1FHXA 4QJ3B 1TJ6A 1IRSA 2E2XA 2D9YA 2Z4DA 1OMWA 2GJYA 3A8PA 1J19A 1EVHA 2DA0A 2RLOA 3X23A 3AU4A 3TW1A 2CAYA 2Z0OA 2D2QA 4KHBB 2M14A 3A58A 4A6FB 3QWMA 3AJ4A 2YT1A 3NWFA 3AU5A 3NW8A 4B6HA 4CHJA 2DKQA 1ISNA 2YT2A 2KUPA 2LG1A 4OSNA 3TCAA 4L6EA 2QKLA 3KZ1A 4KHBA 4A6FA 2K00A 1UNRA 1XKEA 2W2WA 3KSYA 1RRPB 5J3YA 3UZTA 5KQ4A 2GS0A 2RUKB 3ZVRA 4QJ4B 2EMSA 3T06A 5GOWB 4L1RA 3SO6A 3F5RA 1FOEA 4PQ0A 1MAIA 2P8VA 3ULCA 5C16A 4Z2MB 1FHOA 4DX8A 4QXAB 1XD4A 1EF1A 4EKUA 3D8EA 3BINA 1WI1A 4A6KA 1MIXA 1NTVA 2D9XA 3DCXA 4HAZB 3HQCA 4EMOA 1Y19B 1MK9B 2NBVA 3ZDTA 4F7GA 1KZGA 1TQZA 3BJIA 3TO1A 2W2XC 3V5WA 3QIJA 1DDWA 1BAKA 1Q67A 1DDMA 1V89A 3U12A 4GPTB 1AWEA 3OANA 1NTYA 1PLSA 1DROA 2DFKA 4GN1A 4Y94A 4HAVB 2RRFA 1P6SA 1U27A 1TXDA 2RSGA 2EMTA 2D4QA 4MK0A 3TFMA 4CHMA 1W1GA 2COAA 2LOZA 3ML4A 2L2IA 5DI9B 4ZRKA 2Y8GA 2KGXB 2UZRA 3HSAA 5HE1A 4GOUA 5J3QA 2GCLA 3KRWA 2LULA 2H7EA 1V5MA 4K81A 3HK0A 3CIKA 2DX1A 3PP2A 2Z0QA 3DXDA 1EAZA 1U29A 2R09A 1WVHA 3SV1A 4QJ5B 2MFQA 2CY5A 2MDXA 3M1IB 5DHAB 4ZRJA 1H4RA 1UNPA 1XR0B 1T77A 2KIGA 4GMXB 4DXAB 2RVBB 4P7IA 2P0DA 4D0NB 5KCVA 1MK7B 1P5TA 2J0JA 3PVWA 1N3HA 3U8ZA 2H7DA 2G35A 2KIEA 1WJ1A 1NI2A 5DH9B 1X1GA 4K2PA 2P0HA 2DN6A 2Q13A 4K2OA 2ELAA 1W1DA 1WJMA 2D11A 2YS1A 2XQNM 2HE7A 4MT7A 1V61A 1DYNA 3WA0A 1X1FA 5LONB 1KI1B 1Z87A 2ZKMX 2K2UA 3F0WA 3P7ZA 2YVCA 2EC1A 1E5WA 2LYDA 5I2SA 4OT1A 2YT0A 2CY4A 5LG4B 2VKIA 3A98B 4KHAA 1X86A 3FSSA 1K5GB 1XCGA 3ULBA 1BTNA 2DLWA 5J3TA 2IFSA 2DYNA 3DXEA 1V5UA 5L81A 1M7RA 4YONA 4D6WA 3HIEA 2GCJA 1V88A 4NSWA 1MKEA 2K2JA 1B55A 4WVFB 2OQBA 4HDOA 5DIFB 1QC6A 3LJUX 5C79A 3PVLA 4HAWB 4GNKB 1GC7A 4HAXB 2J0KA 1X11A 4DIXA 3FM8C 4C0AA
chains in the Genus database with same CATH topology
4IOYX 2KCJA 3P6AA 5CLQB 2Y8FA 2LOXA 4K17A 2J0MA 2JP2A 1ZSQA 4H8SA 1SHCA 1SGHA 4HHVA 2COFA 4TYZA 4WSFA 2X18A 2LKOA 3O96A 3KRXA 2MKRA 3PZDA 4IFSA 3ODWA 2L1CA 4HAUB 4KHOA 3IVFA 2YS3A 2ZPYA 2UZSA 2OTXA 2YSZA 2YS5A 1Y5OA 1FGYA 5C6RA 4Z2NA 1FHWA 1GG3A 4IAPA 3N7CA 1ZC3B 2P0FA 4HATB 2AEHA 4A6HA 1MPHA 3PSCA 2D9ZA 3U7DA 4BBKA 3SUZA 1I7AA 1ZC4B 2I5FA 1K5DB 4PNKA 3A8QA 4MY6A 1FAOA 4A5KA 4EJNA 3NSUA 5D27A 5FI1A 5DHFB 2EJ8A 3D8FA 4DX90 5EFXA 1MIZB 1W1HA 1U2BA 2AL6A 3GYPA 1ZVRA 1X05A 1WGQA 2VRWB 5D3YA 1U5FA 1FB8A 4WJ7A 2DHJA 2R0DA 5JHGA 2VSZA 1KZ7A 3ODXA 3SYXA 2UVMA 3PEGA 3SNHA 4GXBA 1QQGA 2ELBA 5CLLB 2M38A 2FJLA 3MDBC 2CODA 5FI0A 1DDVA 3VIAA 3KY9A 3FEHA 3PVUA 3DXCA 2NZ8B 4HB4B 1LW3A 1UNQA 1PMSA 1RJ2A 4NY0A 5KQ1A 4YL8A 5HE2A 3D8DA 2PZ1A 1WGUA 5D3XA 4HB0B 1H10A 2W2XD 2HTHB 5JLJB 2CRFA 2IYBA 2Y7BA 2ADZA 4HB2B 3PG7A 1OQNA 4HAYB 5D3WA 1U5DA 2I1KA 1J0WA 2RNRB 1UPRA 2COCA 2DKPA 3RCPA 2N0YA 3QBVB 2DTCA 3TVVA 1WG7A 4HB3B 3WYFB 3MPXA 2DHIA 2DX5A 2DYQA 2D9VA 2Z0PA 1XX0A 5HE0A 2MWNB 4GMVA 2NMBA 3ODOA 1OY2A 4XWXA 1I2HA 5LOPB 1LB1A 2DHKA 2I5CA 1GC6A 5C5BB 3HW2B 1ZM0A 4ZRIA 1UEFA 3CXBB 1NU2A 2QKMA 2V76A 1U5GA 4KVGB 5C5BA 2N23A 2I1JA 5HE3A 2YRYA 4HDQA 4KAXB 3VOQA 2ROZB 1U5EA 2D10A 1BTKA 3GYOA 1XODA 1EGXA 2ROVA 1DBHA 5JHHA 5D3VA 1BWNA 4F7UP 1P3RA 1FGZA 1V5PA 1AQCA 2J59M 2D9WA 3G9WA 4GZUA 1PFJA 1M7EA 2RGNB 4CYEA 4F7HA 4TKNA 4DBBA 1UPQA 2BCJA 5JP4A 2YF0A 1FHXA 1TJ6A 1IRSA 2E2XA 2D9YA 1OMWA 2GJYA 3A8PA 1J19A 1EVHA 2DA0A 2RLOA 3X23A 3AU4A 3TW1A 2CAYA 2Z0OA 2D2QA 4KHBB 2M14A 4A6FB 3QWMA 3AJ4A 2YT1A 3AU5A 4B6HA 4CHJA 2DKQA 1ISNA 2KUPA 2LG1A 3TCAA 4L6EA 2QKLA 3KZ1A 4A6FA 2K00A 1UNRA 1XKEA 2W2WA 3KSYA 1RRPB 5J3YA 3UZTA 5KQ4A 2GS0A 2RUKB 3ZVRA 2EMSA 3T06A 5GOWB 3SO6A 3F5RA 1FOEA 4PQ0A 1MAIA 2P8VA 3ULCA 5C16A 4Z2MB 1FHOA 4DX8A 1XD4A 1EF1A 4EKUA 3D8EA 3BINA 1WI1A 4A6KA 1MIXA 1NTVA 2D9XA 4HAZB 3HQCA 4EMOA 1Y19B 1MK9B 3ZDTA 4F7GA 1KZGA 1TQZA 3BJIA 3TO1A 2W2XC 3V5WA 3QIJA 1DDWA 1BAKA 1Q67A 1DDMA 1V89A 4GPTB 1AWEA 3OANA 1NTYA 1PLSA 1DROA 2DFKA 4GN1A 4Y94A 4HAVB 1P6SA 1U27A 1TXDA 2RSGA 2EMTA 2D4QA 4MK0A 3TFMA 4CHMA 1W1GA 2COAA 2LOZA 3ML4A 2L2IA 5DI9B 4ZRKA 2Y8GA 2KGXB 2UZRA 5HE1A 5J3QA 2GCLA 3KRWA 2LULA 2H7EA 1V5MA 4K81A 3HK0A 3CIKA 2DX1A 3PP2A 2Z0QA 3DXDA 1EAZA 1U29A 2R09A 1WVHA 3SV1A 2MFQA 2CY5A 2MDXA 3M1IB 5DHAB 4ZRJA 1H4RA 1UNPA 1XR0B 4GMXB 4DXAB 2RVBB 4P7IA 2P0DA 4D0NB 5KCVA 1MK7B 1P5TA 2J0JA 3PVWA 1N3HA 3U8ZA 2H7DA 2G35A 1WJ1A 1NI2A 5DH9B 1X1GA 4K2PA 2P0HA 2DN6A 2Q13A 4K2OA 2ELAA 1W1DA 1WJMA 2D11A 2YS1A 2XQNM 2HE7A 4MT7A 1V61A 1DYNA 3WA0A 1X1FA 5LONB 1KI1B 1Z87A 2K2UA 3F0WA 3P7ZA 2YVCA 2EC1A 1E5WA 2LYDA 2YT0A 2CY4A 2VKIA 3A98B 4KHAA 1X86A 3FSSA 1K5GB 1XCGA 3ULBA 1BTNA 2DLWA 5J3TA 2IFSA 2DYNA 3DXEA 1V5UA 5L81A 1M7RA 4YONA 2GCJA 1V88A 4NSWA 1MKEA 2K2JA 1B55A 4WVFB 2OQBA 4HDOA 5DIFB 1QC6A 3LJUX 5C79A 3PVLA 4HAWB 1GC7A 4HAXB 2J0KA 1X11A 3FM8C 4C0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IOY X;  2KCJ A;  3P6A A;  5CLQ B;  2Y8F A;  2LOX A;  4K17 A;  2J0M A;  2JP2 A;  1ZSQ A;  4H8S A;  1SHC A;  1SGH A;  4HHV A;  2COF A;  4TYZ A;  4WSF A;  2X18 A;  2LKO A;  3O96 A;  3KRX A;  2MKR A;  3PZD A;  4IFS A;  3ODW A;  2L1C A;  4HAU B;  4KHO A;  3IVF A;  2YS3 A;  2ZPY A;  2UZS A;  2OTX A;  2YSZ A;  2YS5 A;  1Y5O A;  1FGY A;  5C6R A;  4Z2N A;  1FHW A;  1GG3 A;  4IAP A;  3N7C A;  1ZC3 B;  2P0F A;  4HAT B;  2AEH A;  4A6H A;  1MPH A;  3PSC A;  2D9Z A;  3U7D A;  4BBK A;  3SUZ A;  1I7A A;  1ZC4 B;  2I5F A;  1K5D B;  4PNK A;  3A8Q A;  4MY6 A;  1FAO A;  4A5K A;  4EJN A;  3NSU A;  5D27 A;  5FI1 A;  5DHF B;  2EJ8 A;  3D8F A;  4DX9 0;  5EFX A;  1MIZ B;  1W1H A;  1U2B A;  2AL6 A;  3GYP A;  1ZVR A;  1X05 A;  1WGQ A;  2VRW B;  5D3Y A;  1U5F A;  1FB8 A;  4WJ7 A;  2DHJ A;  2R0D A;  5JHG A;  2VSZ A;  1KZ7 A;  3ODX A;  3SYX A;  2UVM A;  3PEG A;  3SNH A;  4GXB A;  1QQG A;  2ELB A;  5CLL B;  2M38 A;  2FJL A;  3MDB C;  2COD A;  5FI0 A;  1DDV A;  3VIA A;  3KY9 A;  3FEH A;  3PVU A;  3DXC A;  2NZ8 B;  4HB4 B;  1LW3 A;  1UNQ A;  1PMS A;  1RJ2 A;  4NY0 A;  5KQ1 A;  4YL8 A;  5HE2 A;  3D8D A;  2PZ1 A;  1WGU A;  5D3X A;  4HB0 B;  1H10 A;  2W2X D;  2HTH B;  5JLJ B;  2CRF A;  2IYB A;  2Y7B A;  2ADZ A;  4HB2 B;  3PG7 A;  1OQN A;  4HAY B;  5D3W A;  1U5D A;  2I1K A;  1J0W A;  2RNR B;  1UPR A;  2COC A;  2DKP A;  3RCP A;  2N0Y A;  3QBV B;  2DTC A;  3TVV A;  1WG7 A;  4HB3 B;  3WYF B;  3MPX A;  2DHI A;  2DX5 A;  2DYQ A;  2D9V A;  2Z0P A;  1XX0 A;  5HE0 A;  2MWN B;  4GMV A;  2NMB A;  3ODO A;  1OY2 A;  4XWX A;  1I2H A;  5LOP B;  1LB1 A;  2DHK A;  2I5C A;  1GC6 A;  5C5B B;  3HW2 B;  1ZM0 A;  4ZRI A;  1UEF A;  3CXB B;  1NU2 A;  2QKM A;  2V76 A;  1U5G A;  4KVG B;  5C5B A;  2N23 A;  2I1J A;  5HE3 A;  2YRY A;  4HDQ A;  4KAX B;  3VOQ A;  2ROZ B;  1U5E A;  2D10 A;  1BTK A;  3GYO A;  1XOD A;  1EGX A;  2ROV A;  1DBH A;  5JHH A;  5D3V A;  1BWN A;  4F7U P;  1P3R A;  1FGZ A;  1V5P A;  1AQC A;  2J59 M;  2D9W A;  3G9W A;  4GZU A;  1PFJ A;  1M7E A;  2RGN B;  4CYE A;  4F7H A;  4TKN A;  4DBB A;  1UPQ A;  2BCJ A;  5JP4 A;  2YF0 A;  1FHX A;  1TJ6 A;  1IRS A;  2E2X A;  2D9Y A;  1OMW A;  2GJY A;  3A8P A;  1J19 A;  1EVH A;  2DA0 A;  2RLO A;  3X23 A;  3AU4 A;  3TW1 A;  2CAY A;  2Z0O A;  2D2Q A;  4KHB B;  2M14 A;  4A6F B;  3QWM A;  3AJ4 A;  2YT1 A;  3AU5 A;  4B6H A;  4CHJ A;  2DKQ A;  1ISN A;  2KUP A;  2LG1 A;  3TCA A;  4L6E A;  2QKL A;  3KZ1 A;  4A6F A;  2K00 A;  1UNR A;  1XKE A;  2W2W A;  3KSY A;  1RRP B;  5J3Y A;  3UZT A;  5KQ4 A;  2GS0 A;  2RUK B;  3ZVR A;  2EMS A;  3T06 A;  5GOW B;  3SO6 A;  3F5R A;  1FOE A;  4PQ0 A;  1MAI A;  2P8V A;  3ULC A;  5C16 A;  4Z2M B;  1FHO A;  4DX8 A;  1XD4 A;  1EF1 A;  4EKU A;  3D8E A;  3BIN A;  1WI1 A;  4A6K A;  1MIX A;  1NTV A;  2D9X A;  4HAZ B;  3HQC A;  4EMO A;  1Y19 B;  1MK9 B;  3ZDT A;  4F7G A;  1KZG A;  1TQZ A;  3BJI A;  3TO1 A;  2W2X C;  3V5W A;  3QIJ A;  1DDW A;  1BAK A;  1Q67 A;  1DDM A;  1V89 A;  4GPT B;  1AWE A;  3OAN A;  1NTY A;  1PLS A;  1DRO A;  2DFK A;  4GN1 A;  4Y94 A;  4HAV B;  1P6S A;  1U27 A;  1TXD A;  2RSG A;  2EMT A;  2D4Q A;  4MK0 A;  3TFM A;  4CHM A;  1W1G A;  2COA A;  2LOZ A;  3ML4 A;  2L2I A;  5DI9 B;  4ZRK A;  2Y8G A;  2KGX B;  2UZR A;  5HE1 A;  5J3Q A;  2GCL A;  3KRW A;  2LUL A;  2H7E A;  1V5M A;  4K81 A;  3HK0 A;  3CIK A;  2DX1 A;  3PP2 A;  2Z0Q A;  3DXD A;  1EAZ A;  1U29 A;  2R09 A;  1WVH A;  3SV1 A;  2MFQ A;  2CY5 A;  2MDX A;  3M1I B;  5DHA B;  4ZRJ A;  1H4R A;  1UNP A;  1XR0 B;  4GMX B;  4DXA B;  2RVB B;  4P7I A;  2P0D A;  4D0N B;  5KCV A;  1MK7 B;  1P5T A;  2J0J A;  3PVW A;  1N3H A;  3U8Z A;  2H7D A;  2G35 A;  1WJ1 A;  1NI2 A;  5DH9 B;  1X1G A;  4K2P A;  2P0H A;  2DN6 A;  2Q13 A;  4K2O A;  2ELA A;  1W1D A;  1WJM A;  2D11 A;  2YS1 A;  2XQN M;  2HE7 A;  4MT7 A;  1V61 A;  1DYN A;  3WA0 A;  1X1F A;  5LON B;  1KI1 B;  1Z87 A;  2K2U A;  3F0W A;  3P7Z A;  2YVC A;  2EC1 A;  1E5W A;  2LYD A;  2YT0 A;  2CY4 A;  2VKI A;  3A98 B;  4KHA A;  1X86 A;  3FSS A;  1K5G B;  1XCG A;  3ULB A;  1BTN A;  2DLW A;  5J3T A;  2IFS A;  2DYN A;  3DXE A;  1V5U A;  5L81 A;  1M7R A;  4YON A;  2GCJ A;  1V88 A;  4NSW A;  1MKE A;  2K2J A;  1B55 A;  4WVF B;  2OQB A;  4HDO A;  5DIF B;  1QC6 A;  3LJU X;  5C79 A;  3PVL A;  4HAW B;  1GC7 A;  4HAX B;  2J0K A;  1X11 A;  3FM8 C;  4C0A A; 
#chains in the Genus database with same CATH topology
 4IOY X;  2KCJ A;  3P6A A;  5CLQ B;  2Y8F A;  2LOX A;  4K17 A;  2J0M A;  2JP2 A;  1ZSQ A;  4H8S A;  1SHC A;  1SGH A;  4HHV A;  2COF A;  4TYZ A;  4WSF A;  2Z14 A;  2X18 A;  2LKO A;  3O96 A;  3KRX A;  2MKR A;  2R2Y A;  3PZD A;  4IFS A;  3ODW A;  2L1C A;  4HAU B;  4KHO A;  3IVF A;  2YS3 A;  2ZPY A;  2UZS A;  2OTX A;  2YSZ A;  2YS5 A;  1Y5O A;  1FGY A;  5C6R A;  5IRS A;  3FVC A;  4Z2N A;  1FHW A;  1GG3 A;  4IAP A;  3B77 A;  2K8E A;  3N7C A;  1ZC3 B;  2P0F A;  4HAT B;  2AEH A;  4A6H A;  1MPH A;  3PSC A;  2D9Z A;  3U7D A;  4BBK A;  3SUZ A;  1I7A A;  1ZC4 B;  2I5F A;  1K5D B;  1MI1 A;  4PNK A;  3A8Q A;  4MY6 A;  1FAO A;  4A5K A;  4EJN A;  3NSU A;  5D27 A;  5FI1 A;  5DHF B;  2EJ8 A;  3D8F A;  4DX9 0;  5EFX A;  1MIZ B;  1W1H A;  1U2B A;  2AL6 A;  3GYP A;  1ZVR A;  1X05 A;  1WGQ A;  2VRW B;  5D3Y A;  1U5F A;  1FB8 A;  4WJ7 A;  2DHJ A;  2R0D A;  5JHG A;  2VSZ A;  1KZ7 A;  3ODX A;  3SYX A;  2UVM A;  3PEG A;  3SNH A;  2GUM A;  4GXB A;  1QQG A;  2ELB A;  5CLL B;  2M38 A;  2FJL A;  3MDB C;  2COD A;  5FI0 A;  1DDV A;  2Z59 A;  3VIA A;  3KY9 A;  3FEH A;  3PVU A;  3DXC A;  2NZ8 B;  4HB4 B;  2FJU B;  1LW3 A;  1UNQ A;  1PMS A;  1RJ2 A;  4NY0 A;  5KQ1 A;  4YL8 A;  5HE2 A;  3D8D A;  2PZ1 A;  1WGU A;  5D3X A;  4HB0 B;  1H10 A;  2W2X D;  2HTH B;  3NWD A;  5JLJ B;  2CRF A;  2IYB A;  2Y7B A;  2ADZ A;  4HB2 B;  3PG7 A;  1OQN A;  3NWA A;  4CSQ A;  4HAY B;  5D3W A;  1U5D A;  2I1K A;  1J0W A;  2RNR B;  1UPR A;  2COC A;  2DKP A;  2KR0 A;  3RCP A;  2N0Y A;  3QBV B;  2DTC A;  3TVV A;  1WG7 A;  4HB3 B;  3WYF B;  3MPX A;  2DHI A;  2DX5 A;  2DYQ A;  2D9V A;  2Z0P A;  1XX0 A;  5HE0 A;  2MWN B;  4GMV A;  2NMB A;  3ODO A;  1OY2 A;  4XWX A;  1I2H A;  5LOP B;  1LB1 A;  2DHK A;  2I5C A;  1GC6 A;  5C5B B;  3HW2 B;  1ZM0 A;  4ZRI A;  2Z13 A;  1UEF A;  3OHM B;  3CXB B;  1NU2 A;  2QKM A;  2V76 A;  1U5G A;  5I2M A;  4KVG B;  5C5B A;  2N23 A;  2I1J A;  5HE3 A;  2YRY A;  4HDQ A;  4KAX B;  3VOQ A;  2ROZ B;  1ZYI A;  1U5E A;  2D10 A;  1BTK A;  2K49 A;  3GYO A;  4HSI A;  1XOD A;  1EGX A;  2ROV A;  1DBH A;  5JHH A;  2KUQ A;  5D3V A;  1BWN A;  4F7U P;  1P3R A;  1FGZ A;  1V5P A;  1AQC A;  2J59 M;  2D9W A;  3G9W A;  4GZU A;  5M4Y B;  1PFJ A;  1M7E A;  2RGN B;  4CYE A;  4F7H A;  4TKN A;  4DBB A;  1UPQ A;  2BCJ A;  5JP4 A;  2YF0 A;  1FHX A;  4QJ3 B;  1TJ6 A;  1IRS A;  2E2X A;  2D9Y A;  2Z4D A;  1OMW A;  2GJY A;  3A8P A;  1J19 A;  1EVH A;  2DA0 A;  2RLO A;  3X23 A;  3AU4 A;  3TW1 A;  2CAY A;  2Z0O A;  2D2Q A;  4KHB B;  2M14 A;  3A58 A;  4A6F B;  3QWM A;  3AJ4 A;  2YT1 A;  3NWF A;  3AU5 A;  3NW8 A;  4B6H A;  4CHJ A;  2DKQ A;  1ISN A;  2YT2 A;  2KUP A;  2LG1 A;  4OSN A;  3TCA A;  4L6E A;  2QKL A;  3KZ1 A;  4KHB A;  4A6F A;  2K00 A;  1UNR A;  1XKE A;  2W2W A;  3KSY A;  1RRP B;  5J3Y A;  3UZT A;  5KQ4 A;  2GS0 A;  2RUK B;  3ZVR A;  4QJ4 B;  2EMS A;  3T06 A;  5GOW B;  4L1R A;  3SO6 A;  3F5R A;  1FOE A;  4PQ0 A;  1MAI A;  2P8V A;  3ULC A;  5C16 A;  4Z2M B;  1FHO A;  4DX8 A;  4QXA B;  1XD4 A;  1EF1 A;  4EKU A;  3D8E A;  3BIN A;  1WI1 A;  4A6K A;  1MIX A;  1NTV A;  2D9X A;  3DCX A;  4HAZ B;  3HQC A;  4EMO A;  1Y19 B;  1MK9 B;  2NBV A;  3ZDT A;  4F7G A;  1KZG A;  1TQZ A;  3BJI A;  3TO1 A;  2W2X C;  3V5W A;  3QIJ A;  1DDW A;  1BAK A;  1Q67 A;  1DDM A;  1V89 A;  3U12 A;  4GPT B;  1AWE A;  3OAN A;  1NTY A;  1PLS A;  1DRO A;  2DFK A;  4GN1 A;  4Y94 A;  4HAV B;  2RRF A;  1P6S A;  1U27 A;  1TXD A;  2RSG A;  2EMT A;  2D4Q A;  4MK0 A;  3TFM A;  4CHM A;  1W1G A;  2COA A;  2LOZ A;  3ML4 A;  2L2I A;  5DI9 B;  4ZRK A;  2Y8G A;  2KGX B;  2UZR A;  3HSA A;  5HE1 A;  4GOU A;  5J3Q A;  2GCL A;  3KRW A;  2LUL A;  2H7E A;  1V5M A;  4K81 A;  3HK0 A;  3CIK A;  2DX1 A;  3PP2 A;  2Z0Q A;  3DXD A;  1EAZ A;  1U29 A;  2R09 A;  1WVH A;  3SV1 A;  4QJ5 B;  2MFQ A;  2CY5 A;  2MDX A;  3M1I B;  5DHA B;  4ZRJ A;  1H4R A;  1UNP A;  1XR0 B;  1T77 A;  2KIG A;  4GMX B;  4DXA B;  2RVB B;  4P7I A;  2P0D A;  4D0N B;  5KCV A;  1MK7 B;  1P5T A;  2J0J A;  3PVW A;  1N3H A;  3U8Z A;  2H7D A;  2G35 A;  2KIE A;  1WJ1 A;  1NI2 A;  5DH9 B;  1X1G A;  4K2P A;  2P0H A;  2DN6 A;  2Q13 A;  4K2O A;  2ELA A;  1W1D A;  1WJM A;  2D11 A;  2YS1 A;  2XQN M;  2HE7 A;  4MT7 A;  1V61 A;  1DYN A;  3WA0 A;  1X1F A;  5LON B;  1KI1 B;  1Z87 A;  2ZKM X;  2K2U A;  3F0W A;  3P7Z A;  2YVC A;  2EC1 A;  1E5W A;  2LYD A;  5I2S A;  4OT1 A;  2YT0 A;  2CY4 A;  5LG4 B;  2VKI A;  3A98 B;  4KHA A;  1X86 A;  3FSS A;  1K5G B;  1XCG A;  3ULB A;  1BTN A;  2DLW A;  5J3T A;  2IFS A;  2DYN A;  3DXE A;  1V5U A;  5L81 A;  1M7R A;  4YON A;  4D6W A;  3HIE A;  2GCJ A;  1V88 A;  4NSW A;  1MKE A;  2K2J A;  1B55 A;  4WVF B;  2OQB A;  4HDO A;  5DIF B;  1QC6 A;  3LJU X;  5C79 A;  3PVL A;  4HAW B;  4GNK B;  1GC7 A;  4HAX B;  2J0K A;  1X11 A;  4DIX A;  3FM8 C;  4C0A A; 
#chains in the Genus database with same CATH homology
 4IOY X;  2KCJ A;  3P6A A;  5CLQ B;  2Y8F A;  2LOX A;  4K17 A;  2J0M A;  2JP2 A;  1ZSQ A;  4H8S A;  1SHC A;  1SGH A;  4HHV A;  2COF A;  4TYZ A;  4WSF A;  2X18 A;  2LKO A;  3O96 A;  3KRX A;  2MKR A;  3PZD A;  4IFS A;  3ODW A;  2L1C A;  4HAU B;  4KHO A;  3IVF A;  2YS3 A;  2ZPY A;  2UZS A;  2OTX A;  2YSZ A;  2YS5 A;  1Y5O A;  1FGY A;  5C6R A;  4Z2N A;  1FHW A;  1GG3 A;  4IAP A;  3N7C A;  1ZC3 B;  2P0F A;  4HAT B;  2AEH A;  4A6H A;  1MPH A;  3PSC A;  2D9Z A;  3U7D A;  4BBK A;  3SUZ A;  1I7A A;  1ZC4 B;  2I5F A;  1K5D B;  4PNK A;  3A8Q A;  4MY6 A;  1FAO A;  4A5K A;  4EJN A;  3NSU A;  5D27 A;  5FI1 A;  5DHF B;  2EJ8 A;  3D8F A;  4DX9 0;  5EFX A;  1MIZ B;  1W1H A;  1U2B A;  2AL6 A;  3GYP A;  1ZVR A;  1X05 A;  1WGQ A;  2VRW B;  5D3Y A;  1U5F A;  1FB8 A;  4WJ7 A;  2DHJ A;  2R0D A;  5JHG A;  2VSZ A;  1KZ7 A;  3ODX A;  3SYX A;  2UVM A;  3PEG A;  3SNH A;  4GXB A;  1QQG A;  2ELB A;  5CLL B;  2M38 A;  2FJL A;  3MDB C;  2COD A;  5FI0 A;  1DDV A;  3VIA A;  3KY9 A;  3FEH A;  3PVU A;  3DXC A;  2NZ8 B;  4HB4 B;  1LW3 A;  1UNQ A;  1PMS A;  1RJ2 A;  4NY0 A;  5KQ1 A;  4YL8 A;  5HE2 A;  3D8D A;  2PZ1 A;  1WGU A;  5D3X A;  4HB0 B;  1H10 A;  2W2X D;  2HTH B;  5JLJ B;  2CRF A;  2IYB A;  2Y7B A;  2ADZ A;  4HB2 B;  3PG7 A;  1OQN A;  4HAY B;  5D3W A;  1U5D A;  2I1K A;  1J0W A;  2RNR B;  1UPR A;  2COC A;  2DKP A;  3RCP A;  2N0Y A;  3QBV B;  2DTC A;  3TVV A;  1WG7 A;  4HB3 B;  3WYF B;  3MPX A;  2DHI A;  2DX5 A;  2DYQ A;  2D9V A;  2Z0P A;  1XX0 A;  5HE0 A;  2MWN B;  4GMV A;  2NMB A;  3ODO A;  1OY2 A;  4XWX A;  1I2H A;  5LOP B;  1LB1 A;  2DHK A;  2I5C A;  1GC6 A;  5C5B B;  3HW2 B;  1ZM0 A;  4ZRI A;  1UEF A;  3CXB B;  1NU2 A;  2QKM A;  2V76 A;  1U5G A;  4KVG B;  5C5B A;  2N23 A;  2I1J A;  5HE3 A;  2YRY A;  4HDQ A;  4KAX B;  3VOQ A;  2ROZ B;  1U5E A;  2D10 A;  1BTK A;  3GYO A;  1XOD A;  1EGX A;  2ROV A;  1DBH A;  5JHH A;  5D3V A;  1BWN A;  4F7U P;  1P3R A;  1FGZ A;  1V5P A;  1AQC A;  2J59 M;  2D9W A;  3G9W A;  4GZU A;  1PFJ A;  1M7E A;  2RGN B;  4CYE A;  4F7H A;  4TKN A;  4DBB A;  1UPQ A;  2BCJ A;  5JP4 A;  2YF0 A;  1FHX A;  1TJ6 A;  1IRS A;  2E2X A;  2D9Y A;  1OMW A;  2GJY A;  3A8P A;  1J19 A;  1EVH A;  2DA0 A;  2RLO A;  3X23 A;  3AU4 A;  3TW1 A;  2CAY A;  2Z0O A;  2D2Q A;  4KHB B;  2M14 A;  4A6F B;  3QWM A;  3AJ4 A;  2YT1 A;  3AU5 A;  4B6H A;  4CHJ A;  2DKQ A;  1ISN A;  2KUP A;  2LG1 A;  3TCA A;  4L6E A;  2QKL A;  3KZ1 A;  4A6F A;  2K00 A;  1UNR A;  1XKE A;  2W2W A;  3KSY A;  1RRP B;  5J3Y A;  3UZT A;  5KQ4 A;  2GS0 A;  2RUK B;  3ZVR A;  2EMS A;  3T06 A;  5GOW B;  3SO6 A;  3F5R A;  1FOE A;  4PQ0 A;  1MAI A;  2P8V A;  3ULC A;  5C16 A;  4Z2M B;  1FHO A;  4DX8 A;  1XD4 A;  1EF1 A;  4EKU A;  3D8E A;  3BIN A;  1WI1 A;  4A6K A;  1MIX A;  1NTV A;  2D9X A;  4HAZ B;  3HQC A;  4EMO A;  1Y19 B;  1MK9 B;  3ZDT A;  4F7G A;  1KZG A;  1TQZ A;  3BJI A;  3TO1 A;  2W2X C;  3V5W A;  3QIJ A;  1DDW A;  1BAK A;  1Q67 A;  1DDM A;  1V89 A;  4GPT B;  1AWE A;  3OAN A;  1NTY A;  1PLS A;  1DRO A;  2DFK A;  4GN1 A;  4Y94 A;  4HAV B;  1P6S A;  1U27 A;  1TXD A;  2RSG A;  2EMT A;  2D4Q A;  4MK0 A;  3TFM A;  4CHM A;  1W1G A;  2COA A;  2LOZ A;  3ML4 A;  2L2I A;  5DI9 B;  4ZRK A;  2Y8G A;  2KGX B;  2UZR A;  5HE1 A;  5J3Q A;  2GCL A;  3KRW A;  2LUL A;  2H7E A;  1V5M A;  4K81 A;  3HK0 A;  3CIK A;  2DX1 A;  3PP2 A;  2Z0Q A;  3DXD A;  1EAZ A;  1U29 A;  2R09 A;  1WVH A;  3SV1 A;  2MFQ A;  2CY5 A;  2MDX A;  3M1I B;  5DHA B;  4ZRJ A;  1H4R A;  1UNP A;  1XR0 B;  4GMX B;  4DXA B;  2RVB B;  4P7I A;  2P0D A;  4D0N B;  5KCV A;  1MK7 B;  1P5T A;  2J0J A;  3PVW A;  1N3H A;  3U8Z A;  2H7D A;  2G35 A;  1WJ1 A;  1NI2 A;  5DH9 B;  1X1G A;  4K2P A;  2P0H A;  2DN6 A;  2Q13 A;  4K2O A;  2ELA A;  1W1D A;  1WJM A;  2D11 A;  2YS1 A;  2XQN M;  2HE7 A;  4MT7 A;  1V61 A;  1DYN A;  3WA0 A;  1X1F A;  5LON B;  1KI1 B;  1Z87 A;  2K2U A;  3F0W A;  3P7Z A;  2YVC A;  2EC1 A;  1E5W A;  2LYD A;  2YT0 A;  2CY4 A;  2VKI A;  3A98 B;  4KHA A;  1X86 A;  3FSS A;  1K5G B;  1XCG A;  3ULB A;  1BTN A;  2DLW A;  5J3T A;  2IFS A;  2DYN A;  3DXE A;  1V5U A;  5L81 A;  1M7R A;  4YON A;  2GCJ A;  1V88 A;  4NSW A;  1MKE A;  2K2J A;  1B55 A;  4WVF B;  2OQB A;  4HDO A;  5DIF B;  1QC6 A;  3LJU X;  5C79 A;  3PVL A;  4HAW B;  1GC7 A;  4HAX B;  2J0K A;  1X11 A;  3FM8 C;  4C0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...