1PLSA

Solution structure of a pleckstrin homology domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
113
structure length
113
Chain Sequence
MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVFKITTTKQQDHFFQAAFLEERDAWVRDINKAIKCIEGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Phosphorylation
molecule keywords PLECKSTRIN HOMOLOGY DOMAIN
publication title Solution structure of a pleckstrin-homology domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 1994-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1plsA00
4EKUA 1MIZB 2PZ1A 1DDWA 1U5EA 1XCGA 2LKOA 4GMXB 2BCJA 3SYXA 2DHKA 5C5BA 2W2WA 5FI0A 1DDVA 1UNQA 1K5DB 4IOYX 4TYZA 4HAYB 4K81A 4H8SA 2IFSA 2G35A 4EMOA 1U5DA 3HK0A 2DHJA 4KHAA 3VIAA 1W1DA 3GYPA 2LYDA 1X05A 1DYNA 3A8PA 1B55A 5LONB 3U7DA 4A6KA 2N0YA 1TJ6A 4K17A 1FAOA 4K2OA 3D8EA 5D3XA 2AL6A 3O96A 3G9WA 4EJNA 2UZRA 2K00A 2LOXA 1MK7B 4HHVA 1J19A 4TKNA 3D8FA 1K5GB 1Y5OA 1ZC4B 2D2QA 4GZUA 1U27A 2DN6A 3QWMA 1EF1A 1FB8A 4HB3B 4KAXB 2YT0A 2KCJA 5JHHA 3TFMA 2L1CA 4KHOA 1BTKA 2DTCA 1ISNA 2UZSA 4GXBA 5C5BB 5HE0A 1V88A 1WG7A 3LJUX 2DKQA 1SGHA 4CYEA 5DHAB 3F5RA 3ULBA 1LB1A 2KUPA 5DH9B 1Q67A 2QKMA 2VRWB 5D3WA 1WJ1A 4K2PA 1E5WA 1WI1A 2RVBB 3P7ZA 5CLQB 1AWEA 1FOEA 3AU4A 3PEGA 3KRXA 2D9VA 2EC1A 1TQZA 3AU5A 4DXAB 2I5CA 1PFJA 2QKLA 3HQCA 3DXCA 3DXDA 1M7EA 4D0NB 1UNPA 2EMSA 2UVMA 1X11A 1OQNA 4WVFB 3PVLA 4HB4B 2Z0PA 1BWNA 1FHXA 4GMVA 1MAIA 3TCAA 2CY5A 1ZSQA 1V61A 1GG3A 5HE2A 5CLLB 2DX1A 2GS0A 5DHFB 2HTHB 3QBVB 2YF0A 2R0DA 2DYQA 2HE7A 4DX8A 5C16A 2K2JA 4L6EA 2P0DA 5KQ1A 2P8VA 5EFXA 1AQCA 2D4QA 5KCVA 4NSWA 2CY4A 2LG1A 2DYNA 1X1FA 2Y8FA 1RJ2A 4HDQA 1ZC3B 1FGZA 2DFKA 2YSZA 3F0WA 1SHCA 1U5GA 4HB2B 5JHGA 3TW1A 3PZDA 2MDXA 1U29A 3PVWA 2I5FA 3A98B 1I2HA 4B6HA 1XD4A 2MWNB 1NTYA 4F7GA 3IVFA 4HAXB 2CAYA 2W2XC 1WVHA 2OQBA 1UPRA 4Y94A 3A8QA 1I7AA 2W2XD 3AJ4A 3KZ1A 2D11A 2COCA 2E2XA 2J59M 2OTXA 1ZVRA 1H10A 2ELBA 3GYOA 1Z87A 2VKIA 1P6SA 3CIKA 1FHOA 2YVCA 4GPTB 5GOWB 3NSUA 3M1IB 5J3TA 2ADZA 2YT1A 4P7IA 4GN1A 2Z0QA 2V76A 1UEFA 3WA0A 4DX90 1NTVA 1FHWA 1MK9B 2GJYA 1ZM0A 1NU2A 1OY2A 4PQ0A 1UNRA 1LW3A 2CODA 2RUKB 4F7HA 2DHIA 5DI9B 1Y19B 2D9ZA 1W1HA 2AEHA 5D27A 3SO6A 1V5MA 3FEHA 2RGNB 3P6AA 4Z2MB 1DROA 1WJMA 2H7DA 1XODA 2Y7BA 2H7EA 1RRPB 4HB0B 1OMWA 2VSZA 5J3YA 2DX5A 3ULCA 1X1GA 2Q13A 2D9WA 2KGXB 3ODOA 2RLOA 1J0WA 2M38A 3SNHA 2J0KA 3SV1A 5D3VA 4HDOA 2L2IA 3FSSA 4XWXA 3U8ZA 1WGQA 1EAZA 2COFA 1EGXA 4DBBA 2Y8GA 1XKEA 3BJIA 1N3HA 3KRWA 5L81A 1H4RA 1MKEA 4WJ7A 2MFQA 3DXEA 4A5KA 1KI1B 4MT7A 1X86A 4BBKA 2ROZB 2GCLA 5LOPB 1W1GA 1GC7A 3PSCA 2YRYA 2I1JA 4Z2NA 2ZPYA 2K2UA 2JP2A 3N7CA 3ODWA 1BTNA 4HAUB 4YONA 4HAVB 2NMBA 5C79A 2COAA 3X23A 3UZTA 4HAZB 4MY6A 2YS3A 4YL8A 3QIJA 3ZDTA 5HE1A 1MIXA 2DLWA 1IRSA 1P3RA 1DBHA 1P5TA 4ZRJA 4HATB 4ZRKA 4MK0A 2GCJA 2LULA 4A6FA 2P0HA 2CRFA 3TVVA 5HE3A 2J0MA 3D8DA 4WSFA 2IYBA 1XR0B 1TXDA 5JLJB 3MPXA 3ML4A 2I1KA 1PMSA 2MKRA 2D9YA 3SUZA 1WGUA 3PVUA 1V5PA 1UPQA 1V89A 2RNRB 3FM8C 3MDBC 3BINA 3HW2B 3PP2A 1FGYA 3TO1A 2ROVA 3PG7A 2YS5A 4A6HA 1KZGA 1V5UA 3ODXA 1BAKA 4IFSA 2ELAA 4F7UP 2XQNM 1DDMA 4PNKA 2R09A 1EVHA 2Z0OA 3OANA 3T06A 4KHBB 2FJLA 3KY9A 5JP4A 2N23A 2X18A 4KVGB 1XX0A 3KSYA 4CHMA 4C0AA 1NI2A 5J3QA 1U2BA 2LOZA 3WYFB 4A6FB 2RSGA 1MPHA 1KZ7A 4ZRIA 1QQGA 1U5FA 2J0JA 2EMTA 1PLSA 1QC6A 3CXBB 4IAPA 1GC6A 4NY0A 2DKPA 5FI1A 2M14A 3ZVRA 3VOQA 4CHJA 5KQ4A 2DA0A 2YS1A 2D9XA 3RCPA 2EJ8A 5D3YA 2P0FA 2NZ8B 4HAWB 1M7RA 5DIFB 2D10A 3V5WA 5C6RA
chains in the Genus database with same CATH superfamily
4EKUA 2R2YA 1MIZB 2PZ1A 1DDWA 1U5EA 1XCGA 2LKOA 4GMXB 2BCJA 3SYXA 2DHKA 2Z4DA 5C5BA 2W2WA 5FI0A 2K49A 1DDVA 1UNQA 1K5DB 4IOYX 4TYZA 4HAYB 4K81A 4H8SA 2IFSA 2G35A 4EMOA 1U5DA 3HK0A 2DHJA 4KHAA 3VIAA 1W1DA 3GYPA 2LYDA 1X05A 1DYNA 3A8PA 1B55A 5LONB 3U7DA 4A6KA 2N0YA 1TJ6A 4K17A 2ZKMX 1FAOA 4K2OA 3D8EA 5D3XA 2AL6A 3O96A 3G9WA 4EJNA 2UZRA 2K00A 2LOXA 1MK7B 4HHVA 1J19A 4TKNA 3D8FA 1K5GB 1Y5OA 1ZC4B 2D2QA 4GZUA 2Z59A 1U27A 2DN6A 5I2MA 5IRSA 3QWMA 1EF1A 1FB8A 4HB3B 4KAXB 2YT0A 2KCJA 5JHHA 3TFMA 1MI1A 2L1CA 4KHOA 1BTKA 2DTCA 1ISNA 2UZSA 4GXBA 5C5BB 5HE0A 1V88A 1WG7A 3LJUX 2DKQA 1SGHA 4CYEA 5DHAB 3F5RA 1ZYIA 3ULBA 1LB1A 2KUPA 5DH9B 1Q67A 2QKMA 2VRWB 5D3WA 2KIEA 1WJ1A 4K2PA 1E5WA 1WI1A 2RVBB 3P7ZA 5CLQB 1AWEA 1FOEA 3AU4A 3PEGA 4HSIA 2D9VA 3KRXA 2EC1A 1TQZA 3AU5A 4DXAB 2I5CA 1PFJA 2QKLA 3U12A 3HQCA 3DXCA 5I2SA 3DXDA 1M7EA 4D0NB 1UNPA 2EMSA 2UVMA 1X11A 1OQNA 4WVFB 3PVLA 4HB4B 2Z0PA 1BWNA 1FHXA 4GMVA 1MAIA 3TCAA 2CY5A 1ZSQA 1V61A 1GG3A 5HE2A 5CLLB 2DX1A 2GS0A 5DHFB 2HTHB 3QBVB 2YF0A 3FVCA 2R0DA 2DYQA 2HE7A 4DX8A 5C16A 2K2JA 4L6EA 2P0DA 5KQ1A 2P8VA 5EFXA 1AQCA 2D4QA 5KCVA 4NSWA 2CY4A 2LG1A 2DYNA 1X1FA 2Y8FA 1RJ2A 4HDQA 1ZC3B 1FGZA 2DFKA 2YSZA 3F0WA 1SHCA 1U5GA 4HB2B 5JHGA 3TW1A 3PZDA 2MDXA 1U29A 3PVWA 2I5FA 3A98B 1I2HA 4B6HA 1XD4A 2MWNB 1NTYA 4F7GA 3IVFA 4OT1A 4HAXB 2CAYA 2W2XC 1WVHA 2OQBA 1UPRA 2RRFA 4QJ4B 4Y94A 3A8QA 1I7AA 2W2XD 3AJ4A 3KZ1A 2D11A 2COCA 2E2XA 2FJUB 2KUQA 2Z13A 2J59M 2OTXA 1ZVRA 1H10A 2ELBA 3GYOA 1Z87A 2VKIA 1P6SA 3CIKA 1FHOA 2YVCA 4GPTB 5GOWB 3NSUA 3M1IB 5J3TA 2ADZA 2YT1A 4P7IA 3A58A 2GUMA 2KIGA 4CSQA 4GN1A 2Z0QA 2V76A 1UEFA 3OHMB 3WA0A 4DX90 1NTVA 1FHWA 1MK9B 2GJYA 1ZM0A 1NU2A 1T77A 1OY2A 4PQ0A 1UNRA 1LW3A 2CODA 2RUKB 4F7HA 2DHIA 2Z14A 5DI9B 1Y19B 2D9ZA 1W1HA 2AEHA 5D27A 3SO6A 4GNKB 1V5MA 3FEHA 3HIEA 2RGNB 3P6AA 4Z2MB 1DROA 1WJMA 2H7DA 4DIXA 2K8EA 1XODA 2Y7BA 2H7EA 1RRPB 4HB0B 1OMWA 2VSZA 5J3YA 4L1RA 2DX5A 3ULCA 1X1GA 2Q13A 2D9WA 2KGXB 3ODOA 4D6WA 2RLOA 1J0WA 2M38A 3SNHA 2J0KA 3SV1A 2KR0A 5D3VA 4HDOA 2L2IA 3FSSA 4XWXA 3U8ZA 1WGQA 1EAZA 2COFA 2NBVA 1EGXA 4DBBA 2Y8GA 1XKEA 3BJIA 3NWAA 1N3HA 3KRWA 5L81A 1H4RA 1MKEA 4WJ7A 2MFQA 3DXEA 3B77A 4A5KA 1KI1B 4MT7A 1X86A 2YT2A 4BBKA 2ROZB 2GCLA 5LOPB 1W1GA 1GC7A 3PSCA 2YRYA 2I1JA 4Z2NA 2ZPYA 2K2UA 2JP2A 3N7CA 3ODWA 1BTNA 4HAUB 4YONA 4HAVB 2NMBA 5C79A 2COAA 3X23A 3UZTA 4HAZB 5M4YB 4MY6A 2YS3A 4KHBA 4YL8A 3QIJA 3ZDTA 5HE1A 1MIXA 2DLWA 1IRSA 1P3RA 1DBHA 1P5TA 4ZRJA 4HATB 4ZRKA 4QJ5B 4MK0A 4QJ3B 4QXAB 2GCJA 2LULA 4A6FA 2P0HA 2CRFA 3TVVA 5HE3A 2J0MA 3D8DA 3NWDA 4WSFA 2IYBA 3NWFA 1XR0B 1TXDA 5JLJB 3MPXA 3ML4A 2I1KA 1PMSA 2MKRA 2D9YA 3SUZA 1WGUA 3PVUA 1V5PA 1UPQA 1V89A 2RNRB 3FM8C 3MDBC 3BINA 3HW2B 3PP2A 1FGYA 3TO1A 2ROVA 3PG7A 2YS5A 4A6HA 1KZGA 1V5UA 3ODXA 1BAKA 4OSNA 4IFSA 4GOUA 2ELAA 4F7UP 2XQNM 1DDMA 4PNKA 2R09A 1EVHA 2Z0OA 3OANA 3T06A 4KHBB 2FJLA 3KY9A 5JP4A 2N23A 2X18A 4KVGB 3DCXA 1XX0A 3KSYA 4CHMA 4C0AA 1NI2A 5J3QA 1U2BA 2LOZA 3WYFB 4A6FB 2RSGA 1MPHA 1KZ7A 4ZRIA 1QQGA 1U5FA 3HSAA 2J0JA 3NW8A 2EMTA 1PLSA 1QC6A 3CXBB 4IAPA 1GC6A 4NY0A 2DKPA 5FI1A 2M14A 5LG4B 3ZVRA 3VOQA 4CHJA 5KQ4A 2DA0A 2YS1A 2D9XA 3RCPA 2EJ8A 5D3YA 2P0FA 2NZ8B 4HAWB 1M7RA 5DIFB 2D10A 3V5WA 5C6RA
chains in the Genus database with same CATH topology
4EKUA 1MIZB 2PZ1A 1DDWA 1U5EA 1XCGA 2LKOA 4GMXB 2BCJA 3SYXA 2DHKA 5C5BA 2W2WA 5FI0A 1DDVA 1UNQA 1K5DB 4IOYX 4TYZA 4HAYB 4K81A 4H8SA 2IFSA 2G35A 4EMOA 1U5DA 3HK0A 2DHJA 4KHAA 3VIAA 1W1DA 3GYPA 2LYDA 1X05A 1DYNA 3A8PA 1B55A 5LONB 3U7DA 4A6KA 2N0YA 1TJ6A 4K17A 1FAOA 4K2OA 3D8EA 5D3XA 2AL6A 3O96A 3G9WA 4EJNA 2UZRA 2K00A 2LOXA 1MK7B 4HHVA 1J19A 4TKNA 3D8FA 1K5GB 1Y5OA 1ZC4B 2D2QA 4GZUA 1U27A 2DN6A 3QWMA 1EF1A 1FB8A 4HB3B 4KAXB 2YT0A 2KCJA 5JHHA 3TFMA 2L1CA 4KHOA 1BTKA 2DTCA 1ISNA 2UZSA 4GXBA 5C5BB 5HE0A 1V88A 1WG7A 3LJUX 2DKQA 1SGHA 4CYEA 5DHAB 3F5RA 3ULBA 1LB1A 2KUPA 5DH9B 1Q67A 2QKMA 2VRWB 5D3WA 1WJ1A 4K2PA 1E5WA 1WI1A 2RVBB 3P7ZA 5CLQB 1AWEA 1FOEA 3AU4A 3PEGA 3KRXA 2D9VA 2EC1A 1TQZA 3AU5A 4DXAB 2I5CA 1PFJA 2QKLA 3HQCA 3DXCA 3DXDA 1M7EA 4D0NB 1UNPA 2EMSA 2UVMA 1X11A 1OQNA 4WVFB 3PVLA 4HB4B 2Z0PA 1BWNA 1FHXA 4GMVA 1MAIA 3TCAA 2CY5A 1ZSQA 1V61A 1GG3A 5HE2A 5CLLB 2DX1A 2GS0A 5DHFB 2HTHB 3QBVB 2YF0A 2R0DA 2DYQA 2HE7A 4DX8A 5C16A 2K2JA 4L6EA 2P0DA 5KQ1A 2P8VA 5EFXA 1AQCA 2D4QA 5KCVA 4NSWA 2CY4A 2LG1A 2DYNA 1X1FA 2Y8FA 1RJ2A 4HDQA 1ZC3B 1FGZA 2DFKA 2YSZA 3F0WA 1SHCA 1U5GA 4HB2B 5JHGA 3TW1A 3PZDA 2MDXA 1U29A 3PVWA 2I5FA 3A98B 1I2HA 4B6HA 1XD4A 2MWNB 1NTYA 4F7GA 3IVFA 4HAXB 2CAYA 2W2XC 1WVHA 2OQBA 1UPRA 4Y94A 3A8QA 1I7AA 2W2XD 3AJ4A 3KZ1A 2D11A 2COCA 2E2XA 2J59M 2OTXA 1ZVRA 1H10A 2ELBA 3GYOA 1Z87A 2VKIA 1P6SA 3CIKA 1FHOA 2YVCA 4GPTB 5GOWB 3NSUA 3M1IB 5J3TA 2ADZA 2YT1A 4P7IA 4GN1A 2Z0QA 2V76A 1UEFA 3WA0A 4DX90 1NTVA 1FHWA 1MK9B 2GJYA 1ZM0A 1NU2A 1OY2A 4PQ0A 1UNRA 1LW3A 2CODA 2RUKB 4F7HA 2DHIA 5DI9B 1Y19B 2D9ZA 1W1HA 2AEHA 5D27A 3SO6A 1V5MA 3FEHA 2RGNB 3P6AA 4Z2MB 1DROA 1WJMA 2H7DA 1XODA 2Y7BA 2H7EA 1RRPB 4HB0B 1OMWA 2VSZA 5J3YA 2DX5A 3ULCA 1X1GA 2Q13A 2D9WA 2KGXB 3ODOA 2RLOA 1J0WA 2M38A 3SNHA 2J0KA 3SV1A 5D3VA 4HDOA 2L2IA 3FSSA 4XWXA 3U8ZA 1WGQA 1EAZA 2COFA 1EGXA 4DBBA 2Y8GA 1XKEA 3BJIA 1N3HA 3KRWA 5L81A 1H4RA 1MKEA 4WJ7A 2MFQA 3DXEA 4A5KA 1KI1B 4MT7A 1X86A 4BBKA 2ROZB 2GCLA 5LOPB 1W1GA 1GC7A 3PSCA 2YRYA 2I1JA 4Z2NA 2ZPYA 2K2UA 2JP2A 3N7CA 3ODWA 1BTNA 4HAUB 4YONA 4HAVB 2NMBA 5C79A 2COAA 3X23A 3UZTA 4HAZB 4MY6A 2YS3A 4YL8A 3QIJA 3ZDTA 5HE1A 1MIXA 2DLWA 1IRSA 1P3RA 1DBHA 1P5TA 4ZRJA 4HATB 4ZRKA 4MK0A 2GCJA 2LULA 4A6FA 2P0HA 2CRFA 3TVVA 5HE3A 2J0MA 3D8DA 4WSFA 2IYBA 1XR0B 1TXDA 5JLJB 3MPXA 3ML4A 2I1KA 1PMSA 2MKRA 2D9YA 3SUZA 1WGUA 3PVUA 1V5PA 1UPQA 1V89A 2RNRB 3FM8C 3MDBC 3BINA 3HW2B 3PP2A 1FGYA 3TO1A 2ROVA 3PG7A 2YS5A 4A6HA 1KZGA 1V5UA 3ODXA 1BAKA 4IFSA 2ELAA 4F7UP 2XQNM 1DDMA 4PNKA 2R09A 1EVHA 2Z0OA 3OANA 3T06A 4KHBB 2FJLA 3KY9A 5JP4A 2N23A 2X18A 4KVGB 1XX0A 3KSYA 4CHMA 4C0AA 1NI2A 5J3QA 1U2BA 2LOZA 3WYFB 4A6FB 2RSGA 1MPHA 1KZ7A 4ZRIA 1QQGA 1U5FA 2J0JA 2EMTA 1PLSA 1QC6A 3CXBB 4IAPA 1GC6A 4NY0A 2DKPA 5FI1A 2M14A 3ZVRA 3VOQA 4CHJA 5KQ4A 2DA0A 2YS1A 2D9XA 3RCPA 2EJ8A 5D3YA 2P0FA 2NZ8B 4HAWB 1M7RA 5DIFB 2D10A 3V5WA 5C6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EKU A;  1MIZ B;  2PZ1 A;  1DDW A;  1U5E A;  1XCG A;  2LKO A;  4GMX B;  2BCJ A;  3SYX A;  2DHK A;  5C5B A;  2W2W A;  5FI0 A;  1DDV A;  1UNQ A;  1K5D B;  4IOY X;  4TYZ A;  4HAY B;  4K81 A;  4H8S A;  2IFS A;  2G35 A;  4EMO A;  1U5D A;  3HK0 A;  2DHJ A;  4KHA A;  3VIA A;  1W1D A;  3GYP A;  2LYD A;  1X05 A;  1DYN A;  3A8P A;  1B55 A;  5LON B;  3U7D A;  4A6K A;  2N0Y A;  1TJ6 A;  4K17 A;  1FAO A;  4K2O A;  3D8E A;  5D3X A;  2AL6 A;  3O96 A;  3G9W A;  4EJN A;  2UZR A;  2K00 A;  2LOX A;  1MK7 B;  4HHV A;  1J19 A;  4TKN A;  3D8F A;  1K5G B;  1Y5O A;  1ZC4 B;  2D2Q A;  4GZU A;  1U27 A;  2DN6 A;  3QWM A;  1EF1 A;  1FB8 A;  4HB3 B;  4KAX B;  2YT0 A;  2KCJ A;  5JHH A;  3TFM A;  2L1C A;  4KHO A;  1BTK A;  2DTC A;  1ISN A;  2UZS A;  4GXB A;  5C5B B;  5HE0 A;  1V88 A;  1WG7 A;  3LJU X;  2DKQ A;  1SGH A;  4CYE A;  5DHA B;  3F5R A;  3ULB A;  1LB1 A;  2KUP A;  5DH9 B;  1Q67 A;  2QKM A;  2VRW B;  5D3W A;  1WJ1 A;  4K2P A;  1E5W A;  1WI1 A;  2RVB B;  3P7Z A;  5CLQ B;  1AWE A;  1FOE A;  3AU4 A;  3PEG A;  3KRX A;  2D9V A;  2EC1 A;  1TQZ A;  3AU5 A;  4DXA B;  2I5C A;  1PFJ A;  2QKL A;  3HQC A;  3DXC A;  3DXD A;  1M7E A;  4D0N B;  1UNP A;  2EMS A;  2UVM A;  1X11 A;  1OQN A;  4WVF B;  3PVL A;  4HB4 B;  2Z0P A;  1BWN A;  1FHX A;  4GMV A;  1MAI A;  3TCA A;  2CY5 A;  1ZSQ A;  1V61 A;  1GG3 A;  5HE2 A;  5CLL B;  2DX1 A;  2GS0 A;  5DHF B;  2HTH B;  3QBV B;  2YF0 A;  2R0D A;  2DYQ A;  2HE7 A;  4DX8 A;  5C16 A;  2K2J A;  4L6E A;  2P0D A;  5KQ1 A;  2P8V A;  5EFX A;  1AQC A;  2D4Q A;  5KCV A;  4NSW A;  2CY4 A;  2LG1 A;  2DYN A;  1X1F A;  2Y8F A;  1RJ2 A;  4HDQ A;  1ZC3 B;  1FGZ A;  2DFK A;  2YSZ A;  3F0W A;  1SHC A;  1U5G A;  4HB2 B;  5JHG A;  3TW1 A;  3PZD A;  2MDX A;  1U29 A;  3PVW A;  2I5F A;  3A98 B;  1I2H A;  4B6H A;  1XD4 A;  2MWN B;  1NTY A;  4F7G A;  3IVF A;  4HAX B;  2CAY A;  2W2X C;  1WVH A;  2OQB A;  1UPR A;  4Y94 A;  3A8Q A;  1I7A A;  2W2X D;  3AJ4 A;  3KZ1 A;  2D11 A;  2COC A;  2E2X A;  2J59 M;  2OTX A;  1ZVR A;  1H10 A;  2ELB A;  3GYO A;  1Z87 A;  2VKI A;  1P6S A;  3CIK A;  1FHO A;  2YVC A;  4GPT B;  5GOW B;  3NSU A;  3M1I B;  5J3T A;  2ADZ A;  2YT1 A;  4P7I A;  4GN1 A;  2Z0Q A;  2V76 A;  1UEF A;  3WA0 A;  4DX9 0;  1NTV A;  1FHW A;  1MK9 B;  2GJY A;  1ZM0 A;  1NU2 A;  1OY2 A;  4PQ0 A;  1UNR A;  1LW3 A;  2COD A;  2RUK B;  4F7H A;  2DHI A;  5DI9 B;  1Y19 B;  2D9Z A;  1W1H A;  2AEH A;  5D27 A;  3SO6 A;  1V5M A;  3FEH A;  2RGN B;  3P6A A;  4Z2M B;  1DRO A;  1WJM A;  2H7D A;  1XOD A;  2Y7B A;  2H7E A;  1RRP B;  4HB0 B;  1OMW A;  2VSZ A;  5J3Y A;  2DX5 A;  3ULC A;  1X1G A;  2Q13 A;  2D9W A;  2KGX B;  3ODO A;  2RLO A;  1J0W A;  2M38 A;  3SNH A;  2J0K A;  3SV1 A;  5D3V A;  4HDO A;  2L2I A;  3FSS A;  4XWX A;  3U8Z A;  1WGQ A;  1EAZ A;  2COF A;  1EGX A;  4DBB A;  2Y8G A;  1XKE A;  3BJI A;  1N3H A;  3KRW A;  5L81 A;  1H4R A;  1MKE A;  4WJ7 A;  2MFQ A;  3DXE A;  4A5K A;  1KI1 B;  4MT7 A;  1X86 A;  4BBK A;  2ROZ B;  2GCL A;  5LOP B;  1W1G A;  1GC7 A;  3PSC A;  2YRY A;  2I1J A;  4Z2N A;  2ZPY A;  2K2U A;  2JP2 A;  3N7C A;  3ODW A;  1BTN A;  4HAU B;  4YON A;  4HAV B;  2NMB A;  5C79 A;  2COA A;  3X23 A;  3UZT A;  4HAZ B;  4MY6 A;  2YS3 A;  4YL8 A;  3QIJ A;  3ZDT A;  5HE1 A;  1MIX A;  2DLW A;  1IRS A;  1P3R A;  1DBH A;  1P5T A;  4ZRJ A;  4HAT B;  4ZRK A;  4MK0 A;  2GCJ A;  2LUL A;  4A6F A;  2P0H A;  2CRF A;  3TVV A;  5HE3 A;  2J0M A;  3D8D A;  4WSF A;  2IYB A;  1XR0 B;  1TXD A;  5JLJ B;  3MPX A;  3ML4 A;  2I1K A;  1PMS A;  2MKR A;  2D9Y A;  3SUZ A;  1WGU A;  3PVU A;  1V5P A;  1UPQ A;  1V89 A;  2RNR B;  3FM8 C;  3MDB C;  3BIN A;  3HW2 B;  3PP2 A;  1FGY A;  3TO1 A;  2ROV A;  3PG7 A;  2YS5 A;  4A6H A;  1KZG A;  1V5U A;  3ODX A;  1BAK A;  4IFS A;  2ELA A;  4F7U P;  2XQN M;  1DDM A;  4PNK A;  2R09 A;  1EVH A;  2Z0O A;  3OAN A;  3T06 A;  4KHB B;  2FJL A;  3KY9 A;  5JP4 A;  2N23 A;  2X18 A;  4KVG B;  1XX0 A;  3KSY A;  4CHM A;  4C0A A;  1NI2 A;  5J3Q A;  1U2B A;  2LOZ A;  3WYF B;  4A6F B;  2RSG A;  1MPH A;  1KZ7 A;  4ZRI A;  1QQG A;  1U5F A;  2J0J A;  2EMT A;  1PLS A;  1QC6 A;  3CXB B;  4IAP A;  1GC6 A;  4NY0 A;  2DKP A;  5FI1 A;  2M14 A;  3ZVR A;  3VOQ A;  4CHJ A;  5KQ4 A;  2DA0 A;  2YS1 A;  2D9X A;  3RCP A;  2EJ8 A;  5D3Y A;  2P0F A;  2NZ8 B;  4HAW B;  1M7R A;  5DIF B;  2D10 A;  3V5W A;  5C6R A; 
#chains in the Genus database with same CATH topology
 4EKU A;  2R2Y A;  1MIZ B;  2PZ1 A;  1DDW A;  1U5E A;  1XCG A;  2LKO A;  4GMX B;  2BCJ A;  3SYX A;  2DHK A;  2Z4D A;  5C5B A;  2W2W A;  5FI0 A;  2K49 A;  1DDV A;  1UNQ A;  1K5D B;  4IOY X;  4TYZ A;  4HAY B;  4K81 A;  4H8S A;  2IFS A;  2G35 A;  4EMO A;  1U5D A;  3HK0 A;  2DHJ A;  4KHA A;  3VIA A;  1W1D A;  3GYP A;  2LYD A;  1X05 A;  1DYN A;  3A8P A;  1B55 A;  5LON B;  3U7D A;  4A6K A;  2N0Y A;  1TJ6 A;  4K17 A;  2ZKM X;  1FAO A;  4K2O A;  3D8E A;  5D3X A;  2AL6 A;  3O96 A;  3G9W A;  4EJN A;  2UZR A;  2K00 A;  2LOX A;  1MK7 B;  4HHV A;  1J19 A;  4TKN A;  3D8F A;  1K5G B;  1Y5O A;  1ZC4 B;  2D2Q A;  4GZU A;  2Z59 A;  1U27 A;  2DN6 A;  5I2M A;  5IRS A;  3QWM A;  1EF1 A;  1FB8 A;  4HB3 B;  4KAX B;  2YT0 A;  2KCJ A;  5JHH A;  3TFM A;  1MI1 A;  2L1C A;  4KHO A;  1BTK A;  2DTC A;  1ISN A;  2UZS A;  4GXB A;  5C5B B;  5HE0 A;  1V88 A;  1WG7 A;  3LJU X;  2DKQ A;  1SGH A;  4CYE A;  5DHA B;  3F5R A;  1ZYI A;  3ULB A;  1LB1 A;  2KUP A;  5DH9 B;  1Q67 A;  2QKM A;  2VRW B;  5D3W A;  2KIE A;  1WJ1 A;  4K2P A;  1E5W A;  1WI1 A;  2RVB B;  3P7Z A;  5CLQ B;  1AWE A;  1FOE A;  3AU4 A;  3PEG A;  4HSI A;  2D9V A;  3KRX A;  2EC1 A;  1TQZ A;  3AU5 A;  4DXA B;  2I5C A;  1PFJ A;  2QKL A;  3U12 A;  3HQC A;  3DXC A;  5I2S A;  3DXD A;  1M7E A;  4D0N B;  1UNP A;  2EMS A;  2UVM A;  1X11 A;  1OQN A;  4WVF B;  3PVL A;  4HB4 B;  2Z0P A;  1BWN A;  1FHX A;  4GMV A;  1MAI A;  3TCA A;  2CY5 A;  1ZSQ A;  1V61 A;  1GG3 A;  5HE2 A;  5CLL B;  2DX1 A;  2GS0 A;  5DHF B;  2HTH B;  3QBV B;  2YF0 A;  3FVC A;  2R0D A;  2DYQ A;  2HE7 A;  4DX8 A;  5C16 A;  2K2J A;  4L6E A;  2P0D A;  5KQ1 A;  2P8V A;  5EFX A;  1AQC A;  2D4Q A;  5KCV A;  4NSW A;  2CY4 A;  2LG1 A;  2DYN A;  1X1F A;  2Y8F A;  1RJ2 A;  4HDQ A;  1ZC3 B;  1FGZ A;  2DFK A;  2YSZ A;  3F0W A;  1SHC A;  1U5G A;  4HB2 B;  5JHG A;  3TW1 A;  3PZD A;  2MDX A;  1U29 A;  3PVW A;  2I5F A;  3A98 B;  1I2H A;  4B6H A;  1XD4 A;  2MWN B;  1NTY A;  4F7G A;  3IVF A;  4OT1 A;  4HAX B;  2CAY A;  2W2X C;  1WVH A;  2OQB A;  1UPR A;  2RRF A;  4QJ4 B;  4Y94 A;  3A8Q A;  1I7A A;  2W2X D;  3AJ4 A;  3KZ1 A;  2D11 A;  2COC A;  2E2X A;  2FJU B;  2KUQ A;  2Z13 A;  2J59 M;  2OTX A;  1ZVR A;  1H10 A;  2ELB A;  3GYO A;  1Z87 A;  2VKI A;  1P6S A;  3CIK A;  1FHO A;  2YVC A;  4GPT B;  5GOW B;  3NSU A;  3M1I B;  5J3T A;  2ADZ A;  2YT1 A;  4P7I A;  3A58 A;  2GUM A;  2KIG A;  4CSQ A;  4GN1 A;  2Z0Q A;  2V76 A;  1UEF A;  3OHM B;  3WA0 A;  4DX9 0;  1NTV A;  1FHW A;  1MK9 B;  2GJY A;  1ZM0 A;  1NU2 A;  1T77 A;  1OY2 A;  4PQ0 A;  1UNR A;  1LW3 A;  2COD A;  2RUK B;  4F7H A;  2DHI A;  2Z14 A;  5DI9 B;  1Y19 B;  2D9Z A;  1W1H A;  2AEH A;  5D27 A;  3SO6 A;  4GNK B;  1V5M A;  3FEH A;  3HIE A;  2RGN B;  3P6A A;  4Z2M B;  1DRO A;  1WJM A;  2H7D A;  4DIX A;  2K8E A;  1XOD A;  2Y7B A;  2H7E A;  1RRP B;  4HB0 B;  1OMW A;  2VSZ A;  5J3Y A;  4L1R A;  2DX5 A;  3ULC A;  1X1G A;  2Q13 A;  2D9W A;  2KGX B;  3ODO A;  4D6W A;  2RLO A;  1J0W A;  2M38 A;  3SNH A;  2J0K A;  3SV1 A;  2KR0 A;  5D3V A;  4HDO A;  2L2I A;  3FSS A;  4XWX A;  3U8Z A;  1WGQ A;  1EAZ A;  2COF A;  2NBV A;  1EGX A;  4DBB A;  2Y8G A;  1XKE A;  3BJI A;  3NWA A;  1N3H A;  3KRW A;  5L81 A;  1H4R A;  1MKE A;  4WJ7 A;  2MFQ A;  3DXE A;  3B77 A;  4A5K A;  1KI1 B;  4MT7 A;  1X86 A;  2YT2 A;  4BBK A;  2ROZ B;  2GCL A;  5LOP B;  1W1G A;  1GC7 A;  3PSC A;  2YRY A;  2I1J A;  4Z2N A;  2ZPY A;  2K2U A;  2JP2 A;  3N7C A;  3ODW A;  1BTN A;  4HAU B;  4YON A;  4HAV B;  2NMB A;  5C79 A;  2COA A;  3X23 A;  3UZT A;  4HAZ B;  5M4Y B;  4MY6 A;  2YS3 A;  4KHB A;  4YL8 A;  3QIJ A;  3ZDT A;  5HE1 A;  1MIX A;  2DLW A;  1IRS A;  1P3R A;  1DBH A;  1P5T A;  4ZRJ A;  4HAT B;  4ZRK A;  4QJ5 B;  4MK0 A;  4QJ3 B;  4QXA B;  2GCJ A;  2LUL A;  4A6F A;  2P0H A;  2CRF A;  3TVV A;  5HE3 A;  2J0M A;  3D8D A;  3NWD A;  4WSF A;  2IYB A;  3NWF A;  1XR0 B;  1TXD A;  5JLJ B;  3MPX A;  3ML4 A;  2I1K A;  1PMS A;  2MKR A;  2D9Y A;  3SUZ A;  1WGU A;  3PVU A;  1V5P A;  1UPQ A;  1V89 A;  2RNR B;  3FM8 C;  3MDB C;  3BIN A;  3HW2 B;  3PP2 A;  1FGY A;  3TO1 A;  2ROV A;  3PG7 A;  2YS5 A;  4A6H A;  1KZG A;  1V5U A;  3ODX A;  1BAK A;  4OSN A;  4IFS A;  4GOU A;  2ELA A;  4F7U P;  2XQN M;  1DDM A;  4PNK A;  2R09 A;  1EVH A;  2Z0O A;  3OAN A;  3T06 A;  4KHB B;  2FJL A;  3KY9 A;  5JP4 A;  2N23 A;  2X18 A;  4KVG B;  3DCX A;  1XX0 A;  3KSY A;  4CHM A;  4C0A A;  1NI2 A;  5J3Q A;  1U2B A;  2LOZ A;  3WYF B;  4A6F B;  2RSG A;  1MPH A;  1KZ7 A;  4ZRI A;  1QQG A;  1U5F A;  3HSA A;  2J0J A;  3NW8 A;  2EMT A;  1PLS A;  1QC6 A;  3CXB B;  4IAP A;  1GC6 A;  4NY0 A;  2DKP A;  5FI1 A;  2M14 A;  5LG4 B;  3ZVR A;  3VOQ A;  4CHJ A;  5KQ4 A;  2DA0 A;  2YS1 A;  2D9X A;  3RCP A;  2EJ8 A;  5D3Y A;  2P0F A;  2NZ8 B;  4HAW B;  1M7R A;  5DIF B;  2D10 A;  3V5W A;  5C6R A; 
#chains in the Genus database with same CATH homology
 4EKU A;  1MIZ B;  2PZ1 A;  1DDW A;  1U5E A;  1XCG A;  2LKO A;  4GMX B;  2BCJ A;  3SYX A;  2DHK A;  5C5B A;  2W2W A;  5FI0 A;  1DDV A;  1UNQ A;  1K5D B;  4IOY X;  4TYZ A;  4HAY B;  4K81 A;  4H8S A;  2IFS A;  2G35 A;  4EMO A;  1U5D A;  3HK0 A;  2DHJ A;  4KHA A;  3VIA A;  1W1D A;  3GYP A;  2LYD A;  1X05 A;  1DYN A;  3A8P A;  1B55 A;  5LON B;  3U7D A;  4A6K A;  2N0Y A;  1TJ6 A;  4K17 A;  1FAO A;  4K2O A;  3D8E A;  5D3X A;  2AL6 A;  3O96 A;  3G9W A;  4EJN A;  2UZR A;  2K00 A;  2LOX A;  1MK7 B;  4HHV A;  1J19 A;  4TKN A;  3D8F A;  1K5G B;  1Y5O A;  1ZC4 B;  2D2Q A;  4GZU A;  1U27 A;  2DN6 A;  3QWM A;  1EF1 A;  1FB8 A;  4HB3 B;  4KAX B;  2YT0 A;  2KCJ A;  5JHH A;  3TFM A;  2L1C A;  4KHO A;  1BTK A;  2DTC A;  1ISN A;  2UZS A;  4GXB A;  5C5B B;  5HE0 A;  1V88 A;  1WG7 A;  3LJU X;  2DKQ A;  1SGH A;  4CYE A;  5DHA B;  3F5R A;  3ULB A;  1LB1 A;  2KUP A;  5DH9 B;  1Q67 A;  2QKM A;  2VRW B;  5D3W A;  1WJ1 A;  4K2P A;  1E5W A;  1WI1 A;  2RVB B;  3P7Z A;  5CLQ B;  1AWE A;  1FOE A;  3AU4 A;  3PEG A;  3KRX A;  2D9V A;  2EC1 A;  1TQZ A;  3AU5 A;  4DXA B;  2I5C A;  1PFJ A;  2QKL A;  3HQC A;  3DXC A;  3DXD A;  1M7E A;  4D0N B;  1UNP A;  2EMS A;  2UVM A;  1X11 A;  1OQN A;  4WVF B;  3PVL A;  4HB4 B;  2Z0P A;  1BWN A;  1FHX A;  4GMV A;  1MAI A;  3TCA A;  2CY5 A;  1ZSQ A;  1V61 A;  1GG3 A;  5HE2 A;  5CLL B;  2DX1 A;  2GS0 A;  5DHF B;  2HTH B;  3QBV B;  2YF0 A;  2R0D A;  2DYQ A;  2HE7 A;  4DX8 A;  5C16 A;  2K2J A;  4L6E A;  2P0D A;  5KQ1 A;  2P8V A;  5EFX A;  1AQC A;  2D4Q A;  5KCV A;  4NSW A;  2CY4 A;  2LG1 A;  2DYN A;  1X1F A;  2Y8F A;  1RJ2 A;  4HDQ A;  1ZC3 B;  1FGZ A;  2DFK A;  2YSZ A;  3F0W A;  1SHC A;  1U5G A;  4HB2 B;  5JHG A;  3TW1 A;  3PZD A;  2MDX A;  1U29 A;  3PVW A;  2I5F A;  3A98 B;  1I2H A;  4B6H A;  1XD4 A;  2MWN B;  1NTY A;  4F7G A;  3IVF A;  4HAX B;  2CAY A;  2W2X C;  1WVH A;  2OQB A;  1UPR A;  4Y94 A;  3A8Q A;  1I7A A;  2W2X D;  3AJ4 A;  3KZ1 A;  2D11 A;  2COC A;  2E2X A;  2J59 M;  2OTX A;  1ZVR A;  1H10 A;  2ELB A;  3GYO A;  1Z87 A;  2VKI A;  1P6S A;  3CIK A;  1FHO A;  2YVC A;  4GPT B;  5GOW B;  3NSU A;  3M1I B;  5J3T A;  2ADZ A;  2YT1 A;  4P7I A;  4GN1 A;  2Z0Q A;  2V76 A;  1UEF A;  3WA0 A;  4DX9 0;  1NTV A;  1FHW A;  1MK9 B;  2GJY A;  1ZM0 A;  1NU2 A;  1OY2 A;  4PQ0 A;  1UNR A;  1LW3 A;  2COD A;  2RUK B;  4F7H A;  2DHI A;  5DI9 B;  1Y19 B;  2D9Z A;  1W1H A;  2AEH A;  5D27 A;  3SO6 A;  1V5M A;  3FEH A;  2RGN B;  3P6A A;  4Z2M B;  1DRO A;  1WJM A;  2H7D A;  1XOD A;  2Y7B A;  2H7E A;  1RRP B;  4HB0 B;  1OMW A;  2VSZ A;  5J3Y A;  2DX5 A;  3ULC A;  1X1G A;  2Q13 A;  2D9W A;  2KGX B;  3ODO A;  2RLO A;  1J0W A;  2M38 A;  3SNH A;  2J0K A;  3SV1 A;  5D3V A;  4HDO A;  2L2I A;  3FSS A;  4XWX A;  3U8Z A;  1WGQ A;  1EAZ A;  2COF A;  1EGX A;  4DBB A;  2Y8G A;  1XKE A;  3BJI A;  1N3H A;  3KRW A;  5L81 A;  1H4R A;  1MKE A;  4WJ7 A;  2MFQ A;  3DXE A;  4A5K A;  1KI1 B;  4MT7 A;  1X86 A;  4BBK A;  2ROZ B;  2GCL A;  5LOP B;  1W1G A;  1GC7 A;  3PSC A;  2YRY A;  2I1J A;  4Z2N A;  2ZPY A;  2K2U A;  2JP2 A;  3N7C A;  3ODW A;  1BTN A;  4HAU B;  4YON A;  4HAV B;  2NMB A;  5C79 A;  2COA A;  3X23 A;  3UZT A;  4HAZ B;  4MY6 A;  2YS3 A;  4YL8 A;  3QIJ A;  3ZDT A;  5HE1 A;  1MIX A;  2DLW A;  1IRS A;  1P3R A;  1DBH A;  1P5T A;  4ZRJ A;  4HAT B;  4ZRK A;  4MK0 A;  2GCJ A;  2LUL A;  4A6F A;  2P0H A;  2CRF A;  3TVV A;  5HE3 A;  2J0M A;  3D8D A;  4WSF A;  2IYB A;  1XR0 B;  1TXD A;  5JLJ B;  3MPX A;  3ML4 A;  2I1K A;  1PMS A;  2MKR A;  2D9Y A;  3SUZ A;  1WGU A;  3PVU A;  1V5P A;  1UPQ A;  1V89 A;  2RNR B;  3FM8 C;  3MDB C;  3BIN A;  3HW2 B;  3PP2 A;  1FGY A;  3TO1 A;  2ROV A;  3PG7 A;  2YS5 A;  4A6H A;  1KZG A;  1V5U A;  3ODX A;  1BAK A;  4IFS A;  2ELA A;  4F7U P;  2XQN M;  1DDM A;  4PNK A;  2R09 A;  1EVH A;  2Z0O A;  3OAN A;  3T06 A;  4KHB B;  2FJL A;  3KY9 A;  5JP4 A;  2N23 A;  2X18 A;  4KVG B;  1XX0 A;  3KSY A;  4CHM A;  4C0A A;  1NI2 A;  5J3Q A;  1U2B A;  2LOZ A;  3WYF B;  4A6F B;  2RSG A;  1MPH A;  1KZ7 A;  4ZRI A;  1QQG A;  1U5F A;  2J0J A;  2EMT A;  1PLS A;  1QC6 A;  3CXB B;  4IAP A;  1GC6 A;  4NY0 A;  2DKP A;  5FI1 A;  2M14 A;  3ZVR A;  3VOQ A;  4CHJ A;  5KQ4 A;  2DA0 A;  2YS1 A;  2D9X A;  3RCP A;  2EJ8 A;  5D3Y A;  2P0F A;  2NZ8 B;  4HAW B;  1M7R A;  5DIF B;  2D10 A;  3V5W A;  5C6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...