1I2HA

Crystal structure analysis of psd-zip45(homer1c/vesl-1l)conserved homer 1 domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
145
structure length
138
Chain Sequence
EFMGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINSTITPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSKMELTSTPSGDLQSPLTPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords PSD-ZIP45(HOMER-1C/VESL-1L)
publication title Crystal Structure of the Homer 1 Family Conserved Region Reveals the Interaction Between the EVH1 Domain and Own Proline-rich Motif
pubmed doi rcsb
source organism Rattus norvegicus
total genus 25
structure length 138
sequence length 145
ec nomenclature
pdb deposition date 2001-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1i2hA00
1EVHA 1Z87A 2E2XA 2DTCA 3N7CA 4HDOA 3TFMA 1TJ6A 3WYFB 1OMWA 1NTYA 4K2OA 3DXEA 2D9VA 2DFKA 1WJMA 2UZRA 2IFSA 4ZRJA 1N3HA 1U5FA 2YSZA 2ELAA 4A5KA 1FHWA 5HE1A 3UZTA 3X23A 4DX90 3KRXA 2QKLA 3D8DA 2D9XA 1PLSA 2Z0OA 3TCAA 2XQNM 2Q13A 5JLJB 3VIAA 2GS0A 2Z0QA 2EC1A 2X18A 3CIKA 2W2WA 4WSFA 4K81A 1W1GA 4GN1A 1U5GA 3BINA 2W2XC 2I1KA 3PSCA 2OQBA 4B6HA 1UPRA 3MDBC 4ZRIA 2R09A 2VRWB 4PNKA 4GPTB 2OTXA 5D3XA 2D2QA 1X86A 5FI0A 2DKQA 1GG3A 2KUPA 3F5RA 4GMXB 2L2IA 2D9ZA 3VOQA 1FAOA 1MIZB 2D9WA 1ZC4B 2M38A 2AEHA 3DXCA 3D8FA 3QBVB 2DX1A 2DHKA 3BJIA 2K2UA 5KQ1A 1NTVA 3SYXA 1X1GA 2KCJA 2YT0A 1EGXA 1BTNA 1WI1A 2YS1A 2R0DA 3ODOA 2COAA 4YONA 3DXDA 3KSYA 2LOZA 3CXBB 3SNHA 4KHOA 1AQCA 2DYQA 2GCLA 1MK7B 4IFSA 3FSSA 2H7DA 2RNRB 4A6KA 1ZC3B 1SHCA 3AU4A 3NSUA 2MKRA 2ROZB 2CODA 1U5DA 4NY0A 3GYPA 3PVWA 2LG1A 2CY4A 3ODWA 1XD4A 4HB2B 3AJ4A 1U2BA 2VSZA 3A8QA 2ROVA 3TVVA 2BCJA 2CY5A 4XWXA 1XR0B 1P6SA 4HAUB 2EMSA 1BWNA 1NU2A 1I7AA 5C79A 4MT7A 1DDMA 1TXDA 3LJUX 3TO1A 2W2XD 4BBKA 5L81A 1W1HA 2DYNA 1V89A 2H7EA 1EF1A 1P5TA 5D3WA 4MY6A 1U27A 1XODA 3T06A 1V5UA 1WJ1A 2COCA 4HDQA 4WJ7A 1DROA 2P0DA 3PZDA 2Z0PA 5JHGA 2RGNB 1K5GB 4H8SA 1UPQA 5J3QA 2YT1A 1KZ7A 2N0YA 2L1CA 2MDXA 5CLQB 5KCVA 1EAZA 2RLOA 1OY2A 1MAIA 4IOYX 1SGHA 4L6EA 4DXAB 2AL6A 5C16A 4HB0B 4GMVA 1ZM0A 1H10A 2D9YA 5CLLB 1U5EA 2YS5A 5HE2A 1V5MA 1W1DA 4PQ0A 5JP4A 4GZUA 5DH9B 4HAVB 3FEHA 2Y8GA 1LW3A 5LONB 3PEGA 5DHAB 1J0WA 3P6AA 5DHFB 1TQZA 2COFA 4HAWB 1WGUA 2P0FA 3PVUA 4MK0A 4HB4B 2VKIA 1DDWA 3SO6A 4HHVA 5FI1A 3O96A 5D27A 3KRWA 1UEFA 4HAXB 1WG7A 1XX0A 4DBBA 2V76A 3U8ZA 4KHBB 1UNQA 5HE3A 4WVFB 2FJLA 2I1JA 1DBHA 2LYDA 5J3TA 1QC6A 3D8EA 2NZ8B 3A8PA 3M1IB 2DLWA 3HW2B 4HATB 4K17A 4CHMA 2YF0A 1MK9B 2CAYA 2M14A 1XCGA 1U29A 1XKEA 3WA0A 3HQCA 1DYNA 2DA0A 3U7DA 4F7UP 1Y5OA 1FHOA 1M7EA 2RVBB 4KHAA 1AWEA 3KZ1A 2JP2A 2UVMA 4KVGB 2LULA 1PMSA 1Y19B 2MWNB 4K2PA 4GXBA 5J3YA 1FOEA 2DN6A 1RRPB 1ZSQA 4P7IA 1FHXA 1V61A 1ZVRA 2GCJA 2GJYA 5C5BA 2LKOA 1J19A 1MPHA 2MFQA 2YRYA 3OANA 4A6FA 3SV1A 4NSWA 5GOWB 1NI2A 2D4QA 4EMOA 2RUKB 4TKNA 4CYEA 1E5WA 2Y7BA 3V5WA 1B55A 1RJ2A 2Y8FA 2K2JA 2I5CA 5C5BB 5EFXA 1LB1A 5D3YA 3ULCA 2ELBA 2HTHB 4TYZA 4A6FB 5JHHA 3PG7A 3QWMA 1GC7A 2DX5A 2EMTA 2DHJA 5KQ4A 4CHJA 3FM8C 2KGXB 1KI1B 1P3RA 3AU5A 5C6RA 3HK0A 2RSGA 1X11A 3A98B 3ODXA 1OQNA 2LOXA 4HAZB 1BTKA 4EJNA 1V5PA 1M7RA 2IYBA 1UNRA 5DI9B 1KZGA 4YL8A 1V88A 3MPXA 2YVCA 4Z2MB 3G9WA 4Y94A 2D11A 1MIXA 2ADZA 1BAKA 4HB3B 3TW1A 1FGYA 1I2HA 3PVLA 2EJ8A 2UZSA 3ML4A 3KY9A 5LOPB 4F7HA 2P8VA 2J59M 1WVHA 2D10A 1PFJA 3F0WA 2HE7A 1X1FA 2CRFA 2P0HA 2QKMA 5DIFB 2DHIA 2N23A 4C0AA 1X05A 1WGQA 2J0MA 2J0KA 1UNPA 4HAYB 2J0JA 3QIJA 4F7GA 2NMBA 2PZ1A 2I5FA 4KAXB 4IAPA 1K5DB 3RCPA 2YS3A 3GYOA 4ZRKA 1ISNA 4D0NB 1GC6A 3IVFA 4A6HA 1IRSA 1QQGA 5HE0A 3ZDTA 3SUZA 1H4RA 1Q67A 2K00A 4DX8A 2DKPA 2ZPYA 1FGZA 1MKEA 4EKUA 5D3VA 3ULBA 1FB8A 3PP2A 4Z2NA 3P7ZA 1DDVA 3ZVRA 2G35A
chains in the Genus database with same CATH superfamily
1EVHA 1Z87A 2E2XA 2DTCA 3N7CA 4HDOA 3TFMA 1TJ6A 3WYFB 1OMWA 1NTYA 4K2OA 5I2SA 2K8EA 3DXEA 2D9VA 2DFKA 1WJMA 2UZRA 2IFSA 4ZRJA 1N3HA 1U5FA 2YSZA 2ELAA 4A5KA 2ZKMX 4QJ5B 1FHWA 5HE1A 3UZTA 3X23A 4DX90 3KRXA 2QKLA 3D8DA 2D9XA 1PLSA 4GNKB 2Z0OA 3TCAA 2NBVA 2XQNM 2Q13A 5JLJB 3VIAA 1T77A 2GS0A 2Z0QA 2EC1A 2X18A 3CIKA 3DCXA 2W2WA 4OSNA 4WSFA 4K81A 1W1GA 4GN1A 1U5GA 3BINA 2W2XC 2I1KA 3PSCA 2OQBA 4B6HA 1UPRA 3MDBC 4ZRIA 2R09A 2VRWB 4PNKA 4QJ3B 4GPTB 2OTXA 5D3XA 2D2QA 1X86A 5FI0A 2DKQA 1GG3A 2KUPA 3F5RA 4GMXB 2L2IA 2D9ZA 3VOQA 1FAOA 1MIZB 2D9WA 1ZC4B 2M38A 2AEHA 3DXCA 3D8FA 3QBVB 2DX1A 2DHKA 2Z13A 3BJIA 2K2UA 5KQ1A 1NTVA 3SYXA 1X1GA 2KCJA 2YT0A 1EGXA 1BTNA 1WI1A 2YS1A 2R0DA 3ODOA 2COAA 4YONA 3DXDA 3KSYA 2LOZA 3CXBB 3SNHA 4KHOA 1AQCA 2DYQA 2GCLA 1MK7B 4IFSA 2FJUB 3FSSA 2H7DA 2RNRB 4A6KA 1ZC3B 1SHCA 3AU4A 3NSUA 2MKRA 2ROZB 2CODA 1U5DA 4NY0A 3GYPA 3PVWA 2LG1A 2CY4A 3ODWA 1XD4A 4HB2B 3AJ4A 1U2BA 2VSZA 3A8QA 2ROVA 3TVVA 2BCJA 2CY5A 4XWXA 1XR0B 1P6SA 4HAUB 2EMSA 1BWNA 1NU2A 1I7AA 5C79A 4MT7A 1DDMA 1TXDA 3LJUX 3TO1A 2W2XD 4BBKA 5L81A 4DIXA 1W1HA 5LG4B 5IRSA 2DYNA 1V89A 2H7EA 1EF1A 1P5TA 5D3WA 4D6WA 4MY6A 1U27A 1XODA 3T06A 1V5UA 1WJ1A 2COCA 4HDQA 4WJ7A 1DROA 2P0DA 3PZDA 2Z0PA 5JHGA 3U12A 2RGNB 1K5GB 4H8SA 1UPQA 5J3QA 4QXAB 2YT1A 1KZ7A 2N0YA 2L1CA 2MDXA 5CLQB 5KCVA 4HSIA 1EAZA 2RLOA 1OY2A 1MAIA 4IOYX 1SGHA 4L6EA 4DXAB 2AL6A 5C16A 4HB0B 4GMVA 2Z4DA 1ZM0A 1H10A 2D9YA 5CLLB 1U5EA 2YS5A 5HE2A 1V5MA 1W1DA 4CSQA 2Z14A 4PQ0A 5JP4A 2RRFA 4GZUA 5DH9B 4HAVB 3FEHA 2Y8GA 2KIGA 1LW3A 5LONB 3PEGA 5DHAB 1J0WA 3P6AA 3HSAA 5DHFB 1TQZA 2COFA 4HAWB 1WGUA 2P0FA 3PVUA 4MK0A 4HB4B 2VKIA 1DDWA 3SO6A 4HHVA 5FI1A 3O96A 5D27A 3KRWA 1UEFA 4HAXB 1WG7A 1XX0A 4DBBA 2V76A 3U8ZA 4KHBB 1UNQA 5HE3A 4WVFB 2FJLA 2I1JA 1DBHA 2GUMA 2LYDA 5J3TA 1QC6A 3D8EA 3NWAA 2NZ8B 3A8PA 3M1IB 2DLWA 3HW2B 4HATB 4K17A 4CHMA 2YF0A 1MK9B 2CAYA 3FVCA 2M14A 3OHMB 1XCGA 3NWDA 1U29A 1XKEA 3WA0A 3HQCA 1DYNA 2DA0A 3U7DA 4F7UP 2KUQA 1Y5OA 2KR0A 1FHOA 1M7EA 3NW8A 2RVBB 4KHAA 1AWEA 3KZ1A 2JP2A 2UVMA 4KVGB 2LULA 1PMSA 1Y19B 2MWNB 4K2PA 4GXBA 5J3YA 1FOEA 2DN6A 1RRPB 1ZSQA 4P7IA 1FHXA 1V61A 1ZVRA 2GCJA 2GJYA 5C5BA 2LKOA 1J19A 1MPHA 2MFQA 2YRYA 3OANA 4A6FA 3SV1A 4NSWA 4L1RA 5GOWB 1NI2A 2D4QA 4EMOA 2RUKB 4TKNA 4CYEA 1E5WA 2Y7BA 3V5WA 1B55A 1RJ2A 2Y8FA 2K2JA 3A58A 2K49A 2I5CA 5C5BB 5EFXA 1LB1A 5D3YA 3ULCA 2ELBA 2HTHB 4TYZA 4A6FB 5JHHA 3PG7A 3QWMA 1GC7A 2DX5A 2EMTA 2DHJA 5KQ4A 4CHJA 3FM8C 2KGXB 1KI1B 1P3RA 3AU5A 5C6RA 3HK0A 2RSGA 1X11A 3A98B 4QJ4B 3ODXA 1OQNA 2LOXA 4HAZB 1BTKA 4EJNA 1V5PA 1M7RA 2IYBA 1UNRA 5DI9B 1KZGA 2Z59A 4YL8A 1V88A 3MPXA 2YVCA 3HIEA 3G9WA 4Z2MB 4Y94A 2D11A 1MIXA 2ADZA 1BAKA 4HB3B 1MI1A 3TW1A 1FGYA 1I2HA 4KHBA 3PVLA 2EJ8A 2UZSA 3ML4A 3KY9A 5LOPB 4F7HA 2P8VA 2J59M 1WVHA 4GOUA 5I2MA 2D10A 1PFJA 3F0WA 4OT1A 2HE7A 1X1FA 3NWFA 2CRFA 2P0HA 2QKMA 5DIFB 2DHIA 2N23A 4C0AA 1X05A 1WGQA 2J0MA 2J0KA 1UNPA 4HAYB 2YT2A 2J0JA 3QIJA 4F7GA 2NMBA 3B77A 2PZ1A 2I5FA 4KAXB 2R2YA 4IAPA 1K5DB 3RCPA 2YS3A 3GYOA 4ZRKA 1ISNA 4D0NB 1GC6A 3IVFA 4A6HA 5M4YB 1IRSA 1QQGA 5HE0A 3ZDTA 3SUZA 1H4RA 1Q67A 2K00A 4DX8A 2DKPA 2ZPYA 1FGZA 1MKEA 4EKUA 5D3VA 1ZYIA 3ULBA 1FB8A 3PP2A 4Z2NA 3P7ZA 1DDVA 3ZVRA 2KIEA 2G35A
chains in the Genus database with same CATH topology
1EVHA 1Z87A 2E2XA 2DTCA 3N7CA 4HDOA 3TFMA 1TJ6A 3WYFB 1OMWA 1NTYA 4K2OA 3DXEA 2D9VA 2DFKA 1WJMA 2UZRA 2IFSA 4ZRJA 1N3HA 1U5FA 2YSZA 2ELAA 4A5KA 1FHWA 5HE1A 3UZTA 3X23A 4DX90 3KRXA 2QKLA 3D8DA 2D9XA 1PLSA 2Z0OA 3TCAA 2XQNM 2Q13A 5JLJB 3VIAA 2GS0A 2Z0QA 2EC1A 2X18A 3CIKA 2W2WA 4WSFA 4K81A 1W1GA 4GN1A 1U5GA 3BINA 2W2XC 2I1KA 3PSCA 2OQBA 4B6HA 1UPRA 3MDBC 4ZRIA 2R09A 2VRWB 4PNKA 4GPTB 2OTXA 5D3XA 2D2QA 1X86A 5FI0A 2DKQA 1GG3A 2KUPA 3F5RA 4GMXB 2L2IA 2D9ZA 3VOQA 1FAOA 1MIZB 2D9WA 1ZC4B 2M38A 2AEHA 3DXCA 3D8FA 3QBVB 2DX1A 2DHKA 3BJIA 2K2UA 5KQ1A 1NTVA 3SYXA 1X1GA 2KCJA 2YT0A 1EGXA 1BTNA 1WI1A 2YS1A 2R0DA 3ODOA 2COAA 4YONA 3DXDA 3KSYA 2LOZA 3CXBB 3SNHA 4KHOA 1AQCA 2DYQA 2GCLA 1MK7B 4IFSA 3FSSA 2H7DA 2RNRB 4A6KA 1ZC3B 1SHCA 3AU4A 3NSUA 2MKRA 2ROZB 2CODA 1U5DA 4NY0A 3GYPA 3PVWA 2LG1A 2CY4A 3ODWA 1XD4A 4HB2B 3AJ4A 1U2BA 2VSZA 3A8QA 2ROVA 3TVVA 2BCJA 2CY5A 4XWXA 1XR0B 1P6SA 4HAUB 2EMSA 1BWNA 1NU2A 1I7AA 5C79A 4MT7A 1DDMA 1TXDA 3LJUX 3TO1A 2W2XD 4BBKA 5L81A 1W1HA 2DYNA 1V89A 2H7EA 1EF1A 1P5TA 5D3WA 4MY6A 1U27A 1XODA 3T06A 1V5UA 1WJ1A 2COCA 4HDQA 4WJ7A 1DROA 2P0DA 3PZDA 2Z0PA 5JHGA 2RGNB 1K5GB 4H8SA 1UPQA 5J3QA 2YT1A 1KZ7A 2N0YA 2L1CA 2MDXA 5CLQB 5KCVA 1EAZA 2RLOA 1OY2A 1MAIA 4IOYX 1SGHA 4L6EA 4DXAB 2AL6A 5C16A 4HB0B 4GMVA 1ZM0A 1H10A 2D9YA 5CLLB 1U5EA 2YS5A 5HE2A 1V5MA 1W1DA 4PQ0A 5JP4A 4GZUA 5DH9B 4HAVB 3FEHA 2Y8GA 1LW3A 5LONB 3PEGA 5DHAB 1J0WA 3P6AA 5DHFB 1TQZA 2COFA 4HAWB 1WGUA 2P0FA 3PVUA 4MK0A 4HB4B 2VKIA 1DDWA 3SO6A 4HHVA 5FI1A 3O96A 5D27A 3KRWA 1UEFA 4HAXB 1WG7A 1XX0A 4DBBA 2V76A 3U8ZA 4KHBB 1UNQA 5HE3A 4WVFB 2FJLA 2I1JA 1DBHA 2LYDA 5J3TA 1QC6A 3D8EA 2NZ8B 3A8PA 3M1IB 2DLWA 3HW2B 4HATB 4K17A 4CHMA 2YF0A 1MK9B 2CAYA 2M14A 1XCGA 1U29A 1XKEA 3WA0A 3HQCA 1DYNA 2DA0A 3U7DA 4F7UP 1Y5OA 1FHOA 1M7EA 2RVBB 4KHAA 1AWEA 3KZ1A 2JP2A 2UVMA 4KVGB 2LULA 1PMSA 1Y19B 2MWNB 4K2PA 4GXBA 5J3YA 1FOEA 2DN6A 1RRPB 1ZSQA 4P7IA 1FHXA 1V61A 1ZVRA 2GCJA 2GJYA 5C5BA 2LKOA 1J19A 1MPHA 2MFQA 2YRYA 3OANA 4A6FA 3SV1A 4NSWA 5GOWB 1NI2A 2D4QA 4EMOA 2RUKB 4TKNA 4CYEA 1E5WA 2Y7BA 3V5WA 1B55A 1RJ2A 2Y8FA 2K2JA 2I5CA 5C5BB 5EFXA 1LB1A 5D3YA 3ULCA 2ELBA 2HTHB 4TYZA 4A6FB 5JHHA 3PG7A 3QWMA 1GC7A 2DX5A 2EMTA 2DHJA 5KQ4A 4CHJA 3FM8C 2KGXB 1KI1B 1P3RA 3AU5A 5C6RA 3HK0A 2RSGA 1X11A 3A98B 3ODXA 1OQNA 2LOXA 4HAZB 1BTKA 4EJNA 1V5PA 1M7RA 2IYBA 1UNRA 5DI9B 1KZGA 4YL8A 1V88A 3MPXA 2YVCA 4Z2MB 3G9WA 4Y94A 2D11A 1MIXA 2ADZA 1BAKA 4HB3B 3TW1A 1FGYA 1I2HA 3PVLA 2EJ8A 2UZSA 3ML4A 3KY9A 5LOPB 4F7HA 2P8VA 2J59M 1WVHA 2D10A 1PFJA 3F0WA 2HE7A 1X1FA 2CRFA 2P0HA 2QKMA 5DIFB 2DHIA 2N23A 4C0AA 1X05A 1WGQA 2J0MA 2J0KA 1UNPA 4HAYB 2J0JA 3QIJA 4F7GA 2NMBA 2PZ1A 2I5FA 4KAXB 4IAPA 1K5DB 3RCPA 2YS3A 3GYOA 4ZRKA 1ISNA 4D0NB 1GC6A 3IVFA 4A6HA 1IRSA 1QQGA 5HE0A 3ZDTA 3SUZA 1H4RA 1Q67A 2K00A 4DX8A 2DKPA 2ZPYA 1FGZA 1MKEA 4EKUA 5D3VA 3ULBA 1FB8A 3PP2A 4Z2NA 3P7ZA 1DDVA 3ZVRA 2G35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EVH A;  1Z87 A;  2E2X A;  2DTC A;  3N7C A;  4HDO A;  3TFM A;  1TJ6 A;  3WYF B;  1OMW A;  1NTY A;  4K2O A;  3DXE A;  2D9V A;  2DFK A;  1WJM A;  2UZR A;  2IFS A;  4ZRJ A;  1N3H A;  1U5F A;  2YSZ A;  2ELA A;  4A5K A;  1FHW A;  5HE1 A;  3UZT A;  3X23 A;  4DX9 0;  3KRX A;  2QKL A;  3D8D A;  2D9X A;  1PLS A;  2Z0O A;  3TCA A;  2XQN M;  2Q13 A;  5JLJ B;  3VIA A;  2GS0 A;  2Z0Q A;  2EC1 A;  2X18 A;  3CIK A;  2W2W A;  4WSF A;  4K81 A;  1W1G A;  4GN1 A;  1U5G A;  3BIN A;  2W2X C;  2I1K A;  3PSC A;  2OQB A;  4B6H A;  1UPR A;  3MDB C;  4ZRI A;  2R09 A;  2VRW B;  4PNK A;  4GPT B;  2OTX A;  5D3X A;  2D2Q A;  1X86 A;  5FI0 A;  2DKQ A;  1GG3 A;  2KUP A;  3F5R A;  4GMX B;  2L2I A;  2D9Z A;  3VOQ A;  1FAO A;  1MIZ B;  2D9W A;  1ZC4 B;  2M38 A;  2AEH A;  3DXC A;  3D8F A;  3QBV B;  2DX1 A;  2DHK A;  3BJI A;  2K2U A;  5KQ1 A;  1NTV A;  3SYX A;  1X1G A;  2KCJ A;  2YT0 A;  1EGX A;  1BTN A;  1WI1 A;  2YS1 A;  2R0D A;  3ODO A;  2COA A;  4YON A;  3DXD A;  3KSY A;  2LOZ A;  3CXB B;  3SNH A;  4KHO A;  1AQC A;  2DYQ A;  2GCL A;  1MK7 B;  4IFS A;  3FSS A;  2H7D A;  2RNR B;  4A6K A;  1ZC3 B;  1SHC A;  3AU4 A;  3NSU A;  2MKR A;  2ROZ B;  2COD A;  1U5D A;  4NY0 A;  3GYP A;  3PVW A;  2LG1 A;  2CY4 A;  3ODW A;  1XD4 A;  4HB2 B;  3AJ4 A;  1U2B A;  2VSZ A;  3A8Q A;  2ROV A;  3TVV A;  2BCJ A;  2CY5 A;  4XWX A;  1XR0 B;  1P6S A;  4HAU B;  2EMS A;  1BWN A;  1NU2 A;  1I7A A;  5C79 A;  4MT7 A;  1DDM A;  1TXD A;  3LJU X;  3TO1 A;  2W2X D;  4BBK A;  5L81 A;  1W1H A;  2DYN A;  1V89 A;  2H7E A;  1EF1 A;  1P5T A;  5D3W A;  4MY6 A;  1U27 A;  1XOD A;  3T06 A;  1V5U A;  1WJ1 A;  2COC A;  4HDQ A;  4WJ7 A;  1DRO A;  2P0D A;  3PZD A;  2Z0P A;  5JHG A;  2RGN B;  1K5G B;  4H8S A;  1UPQ A;  5J3Q A;  2YT1 A;  1KZ7 A;  2N0Y A;  2L1C A;  2MDX A;  5CLQ B;  5KCV A;  1EAZ A;  2RLO A;  1OY2 A;  1MAI A;  4IOY X;  1SGH A;  4L6E A;  4DXA B;  2AL6 A;  5C16 A;  4HB0 B;  4GMV A;  1ZM0 A;  1H10 A;  2D9Y A;  5CLL B;  1U5E A;  2YS5 A;  5HE2 A;  1V5M A;  1W1D A;  4PQ0 A;  5JP4 A;  4GZU A;  5DH9 B;  4HAV B;  3FEH A;  2Y8G A;  1LW3 A;  5LON B;  3PEG A;  5DHA B;  1J0W A;  3P6A A;  5DHF B;  1TQZ A;  2COF A;  4HAW B;  1WGU A;  2P0F A;  3PVU A;  4MK0 A;  4HB4 B;  2VKI A;  1DDW A;  3SO6 A;  4HHV A;  5FI1 A;  3O96 A;  5D27 A;  3KRW A;  1UEF A;  4HAX B;  1WG7 A;  1XX0 A;  4DBB A;  2V76 A;  3U8Z A;  4KHB B;  1UNQ A;  5HE3 A;  4WVF B;  2FJL A;  2I1J A;  1DBH A;  2LYD A;  5J3T A;  1QC6 A;  3D8E A;  2NZ8 B;  3A8P A;  3M1I B;  2DLW A;  3HW2 B;  4HAT B;  4K17 A;  4CHM A;  2YF0 A;  1MK9 B;  2CAY A;  2M14 A;  1XCG A;  1U29 A;  1XKE A;  3WA0 A;  3HQC A;  1DYN A;  2DA0 A;  3U7D A;  4F7U P;  1Y5O A;  1FHO A;  1M7E A;  2RVB B;  4KHA A;  1AWE A;  3KZ1 A;  2JP2 A;  2UVM A;  4KVG B;  2LUL A;  1PMS A;  1Y19 B;  2MWN B;  4K2P A;  4GXB A;  5J3Y A;  1FOE A;  2DN6 A;  1RRP B;  1ZSQ A;  4P7I A;  1FHX A;  1V61 A;  1ZVR A;  2GCJ A;  2GJY A;  5C5B A;  2LKO A;  1J19 A;  1MPH A;  2MFQ A;  2YRY A;  3OAN A;  4A6F A;  3SV1 A;  4NSW A;  5GOW B;  1NI2 A;  2D4Q A;  4EMO A;  2RUK B;  4TKN A;  4CYE A;  1E5W A;  2Y7B A;  3V5W A;  1B55 A;  1RJ2 A;  2Y8F A;  2K2J A;  2I5C A;  5C5B B;  5EFX A;  1LB1 A;  5D3Y A;  3ULC A;  2ELB A;  2HTH B;  4TYZ A;  4A6F B;  5JHH A;  3PG7 A;  3QWM A;  1GC7 A;  2DX5 A;  2EMT A;  2DHJ A;  5KQ4 A;  4CHJ A;  3FM8 C;  2KGX B;  1KI1 B;  1P3R A;  3AU5 A;  5C6R A;  3HK0 A;  2RSG A;  1X11 A;  3A98 B;  3ODX A;  1OQN A;  2LOX A;  4HAZ B;  1BTK A;  4EJN A;  1V5P A;  1M7R A;  2IYB A;  1UNR A;  5DI9 B;  1KZG A;  4YL8 A;  1V88 A;  3MPX A;  2YVC A;  4Z2M B;  3G9W A;  4Y94 A;  2D11 A;  1MIX A;  2ADZ A;  1BAK A;  4HB3 B;  3TW1 A;  1FGY A;  1I2H A;  3PVL A;  2EJ8 A;  2UZS A;  3ML4 A;  3KY9 A;  5LOP B;  4F7H A;  2P8V A;  2J59 M;  1WVH A;  2D10 A;  1PFJ A;  3F0W A;  2HE7 A;  1X1F A;  2CRF A;  2P0H A;  2QKM A;  5DIF B;  2DHI A;  2N23 A;  4C0A A;  1X05 A;  1WGQ A;  2J0M A;  2J0K A;  1UNP A;  4HAY B;  2J0J A;  3QIJ A;  4F7G A;  2NMB A;  2PZ1 A;  2I5F A;  4KAX B;  4IAP A;  1K5D B;  3RCP A;  2YS3 A;  3GYO A;  4ZRK A;  1ISN A;  4D0N B;  1GC6 A;  3IVF A;  4A6H A;  1IRS A;  1QQG A;  5HE0 A;  3ZDT A;  3SUZ A;  1H4R A;  1Q67 A;  2K00 A;  4DX8 A;  2DKP A;  2ZPY A;  1FGZ A;  1MKE A;  4EKU A;  5D3V A;  3ULB A;  1FB8 A;  3PP2 A;  4Z2N A;  3P7Z A;  1DDV A;  3ZVR A;  2G35 A; 
#chains in the Genus database with same CATH topology
 1EVH A;  1Z87 A;  2E2X A;  2DTC A;  3N7C A;  4HDO A;  3TFM A;  1TJ6 A;  3WYF B;  1OMW A;  1NTY A;  4K2O A;  5I2S A;  2K8E A;  3DXE A;  2D9V A;  2DFK A;  1WJM A;  2UZR A;  2IFS A;  4ZRJ A;  1N3H A;  1U5F A;  2YSZ A;  2ELA A;  4A5K A;  2ZKM X;  4QJ5 B;  1FHW A;  5HE1 A;  3UZT A;  3X23 A;  4DX9 0;  3KRX A;  2QKL A;  3D8D A;  2D9X A;  1PLS A;  4GNK B;  2Z0O A;  3TCA A;  2NBV A;  2XQN M;  2Q13 A;  5JLJ B;  3VIA A;  1T77 A;  2GS0 A;  2Z0Q A;  2EC1 A;  2X18 A;  3CIK A;  3DCX A;  2W2W A;  4OSN A;  4WSF A;  4K81 A;  1W1G A;  4GN1 A;  1U5G A;  3BIN A;  2W2X C;  2I1K A;  3PSC A;  2OQB A;  4B6H A;  1UPR A;  3MDB C;  4ZRI A;  2R09 A;  2VRW B;  4PNK A;  4QJ3 B;  4GPT B;  2OTX A;  5D3X A;  2D2Q A;  1X86 A;  5FI0 A;  2DKQ A;  1GG3 A;  2KUP A;  3F5R A;  4GMX B;  2L2I A;  2D9Z A;  3VOQ A;  1FAO A;  1MIZ B;  2D9W A;  1ZC4 B;  2M38 A;  2AEH A;  3DXC A;  3D8F A;  3QBV B;  2DX1 A;  2DHK A;  2Z13 A;  3BJI A;  2K2U A;  5KQ1 A;  1NTV A;  3SYX A;  1X1G A;  2KCJ A;  2YT0 A;  1EGX A;  1BTN A;  1WI1 A;  2YS1 A;  2R0D A;  3ODO A;  2COA A;  4YON A;  3DXD A;  3KSY A;  2LOZ A;  3CXB B;  3SNH A;  4KHO A;  1AQC A;  2DYQ A;  2GCL A;  1MK7 B;  4IFS A;  2FJU B;  3FSS A;  2H7D A;  2RNR B;  4A6K A;  1ZC3 B;  1SHC A;  3AU4 A;  3NSU A;  2MKR A;  2ROZ B;  2COD A;  1U5D A;  4NY0 A;  3GYP A;  3PVW A;  2LG1 A;  2CY4 A;  3ODW A;  1XD4 A;  4HB2 B;  3AJ4 A;  1U2B A;  2VSZ A;  3A8Q A;  2ROV A;  3TVV A;  2BCJ A;  2CY5 A;  4XWX A;  1XR0 B;  1P6S A;  4HAU B;  2EMS A;  1BWN A;  1NU2 A;  1I7A A;  5C79 A;  4MT7 A;  1DDM A;  1TXD A;  3LJU X;  3TO1 A;  2W2X D;  4BBK A;  5L81 A;  4DIX A;  1W1H A;  5LG4 B;  5IRS A;  2DYN A;  1V89 A;  2H7E A;  1EF1 A;  1P5T A;  5D3W A;  4D6W A;  4MY6 A;  1U27 A;  1XOD A;  3T06 A;  1V5U A;  1WJ1 A;  2COC A;  4HDQ A;  4WJ7 A;  1DRO A;  2P0D A;  3PZD A;  2Z0P A;  5JHG A;  3U12 A;  2RGN B;  1K5G B;  4H8S A;  1UPQ A;  5J3Q A;  4QXA B;  2YT1 A;  1KZ7 A;  2N0Y A;  2L1C A;  2MDX A;  5CLQ B;  5KCV A;  4HSI A;  1EAZ A;  2RLO A;  1OY2 A;  1MAI A;  4IOY X;  1SGH A;  4L6E A;  4DXA B;  2AL6 A;  5C16 A;  4HB0 B;  4GMV A;  2Z4D A;  1ZM0 A;  1H10 A;  2D9Y A;  5CLL B;  1U5E A;  2YS5 A;  5HE2 A;  1V5M A;  1W1D A;  4CSQ A;  2Z14 A;  4PQ0 A;  5JP4 A;  2RRF A;  4GZU A;  5DH9 B;  4HAV B;  3FEH A;  2Y8G A;  2KIG A;  1LW3 A;  5LON B;  3PEG A;  5DHA B;  1J0W A;  3P6A A;  3HSA A;  5DHF B;  1TQZ A;  2COF A;  4HAW B;  1WGU A;  2P0F A;  3PVU A;  4MK0 A;  4HB4 B;  2VKI A;  1DDW A;  3SO6 A;  4HHV A;  5FI1 A;  3O96 A;  5D27 A;  3KRW A;  1UEF A;  4HAX B;  1WG7 A;  1XX0 A;  4DBB A;  2V76 A;  3U8Z A;  4KHB B;  1UNQ A;  5HE3 A;  4WVF B;  2FJL A;  2I1J A;  1DBH A;  2GUM A;  2LYD A;  5J3T A;  1QC6 A;  3D8E A;  3NWA A;  2NZ8 B;  3A8P A;  3M1I B;  2DLW A;  3HW2 B;  4HAT B;  4K17 A;  4CHM A;  2YF0 A;  1MK9 B;  2CAY A;  3FVC A;  2M14 A;  3OHM B;  1XCG A;  3NWD A;  1U29 A;  1XKE A;  3WA0 A;  3HQC A;  1DYN A;  2DA0 A;  3U7D A;  4F7U P;  2KUQ A;  1Y5O A;  2KR0 A;  1FHO A;  1M7E A;  3NW8 A;  2RVB B;  4KHA A;  1AWE A;  3KZ1 A;  2JP2 A;  2UVM A;  4KVG B;  2LUL A;  1PMS A;  1Y19 B;  2MWN B;  4K2P A;  4GXB A;  5J3Y A;  1FOE A;  2DN6 A;  1RRP B;  1ZSQ A;  4P7I A;  1FHX A;  1V61 A;  1ZVR A;  2GCJ A;  2GJY A;  5C5B A;  2LKO A;  1J19 A;  1MPH A;  2MFQ A;  2YRY A;  3OAN A;  4A6F A;  3SV1 A;  4NSW A;  4L1R A;  5GOW B;  1NI2 A;  2D4Q A;  4EMO A;  2RUK B;  4TKN A;  4CYE A;  1E5W A;  2Y7B A;  3V5W A;  1B55 A;  1RJ2 A;  2Y8F A;  2K2J A;  3A58 A;  2K49 A;  2I5C A;  5C5B B;  5EFX A;  1LB1 A;  5D3Y A;  3ULC A;  2ELB A;  2HTH B;  4TYZ A;  4A6F B;  5JHH A;  3PG7 A;  3QWM A;  1GC7 A;  2DX5 A;  2EMT A;  2DHJ A;  5KQ4 A;  4CHJ A;  3FM8 C;  2KGX B;  1KI1 B;  1P3R A;  3AU5 A;  5C6R A;  3HK0 A;  2RSG A;  1X11 A;  3A98 B;  4QJ4 B;  3ODX A;  1OQN A;  2LOX A;  4HAZ B;  1BTK A;  4EJN A;  1V5P A;  1M7R A;  2IYB A;  1UNR A;  5DI9 B;  1KZG A;  2Z59 A;  4YL8 A;  1V88 A;  3MPX A;  2YVC A;  3HIE A;  3G9W A;  4Z2M B;  4Y94 A;  2D11 A;  1MIX A;  2ADZ A;  1BAK A;  4HB3 B;  1MI1 A;  3TW1 A;  1FGY A;  1I2H A;  4KHB A;  3PVL A;  2EJ8 A;  2UZS A;  3ML4 A;  3KY9 A;  5LOP B;  4F7H A;  2P8V A;  2J59 M;  1WVH A;  4GOU A;  5I2M A;  2D10 A;  1PFJ A;  3F0W A;  4OT1 A;  2HE7 A;  1X1F A;  3NWF A;  2CRF A;  2P0H A;  2QKM A;  5DIF B;  2DHI A;  2N23 A;  4C0A A;  1X05 A;  1WGQ A;  2J0M A;  2J0K A;  1UNP A;  4HAY B;  2YT2 A;  2J0J A;  3QIJ A;  4F7G A;  2NMB A;  3B77 A;  2PZ1 A;  2I5F A;  4KAX B;  2R2Y A;  4IAP A;  1K5D B;  3RCP A;  2YS3 A;  3GYO A;  4ZRK A;  1ISN A;  4D0N B;  1GC6 A;  3IVF A;  4A6H A;  5M4Y B;  1IRS A;  1QQG A;  5HE0 A;  3ZDT A;  3SUZ A;  1H4R A;  1Q67 A;  2K00 A;  4DX8 A;  2DKP A;  2ZPY A;  1FGZ A;  1MKE A;  4EKU A;  5D3V A;  1ZYI A;  3ULB A;  1FB8 A;  3PP2 A;  4Z2N A;  3P7Z A;  1DDV A;  3ZVR A;  2KIE A;  2G35 A; 
#chains in the Genus database with same CATH homology
 1EVH A;  1Z87 A;  2E2X A;  2DTC A;  3N7C A;  4HDO A;  3TFM A;  1TJ6 A;  3WYF B;  1OMW A;  1NTY A;  4K2O A;  3DXE A;  2D9V A;  2DFK A;  1WJM A;  2UZR A;  2IFS A;  4ZRJ A;  1N3H A;  1U5F A;  2YSZ A;  2ELA A;  4A5K A;  1FHW A;  5HE1 A;  3UZT A;  3X23 A;  4DX9 0;  3KRX A;  2QKL A;  3D8D A;  2D9X A;  1PLS A;  2Z0O A;  3TCA A;  2XQN M;  2Q13 A;  5JLJ B;  3VIA A;  2GS0 A;  2Z0Q A;  2EC1 A;  2X18 A;  3CIK A;  2W2W A;  4WSF A;  4K81 A;  1W1G A;  4GN1 A;  1U5G A;  3BIN A;  2W2X C;  2I1K A;  3PSC A;  2OQB A;  4B6H A;  1UPR A;  3MDB C;  4ZRI A;  2R09 A;  2VRW B;  4PNK A;  4GPT B;  2OTX A;  5D3X A;  2D2Q A;  1X86 A;  5FI0 A;  2DKQ A;  1GG3 A;  2KUP A;  3F5R A;  4GMX B;  2L2I A;  2D9Z A;  3VOQ A;  1FAO A;  1MIZ B;  2D9W A;  1ZC4 B;  2M38 A;  2AEH A;  3DXC A;  3D8F A;  3QBV B;  2DX1 A;  2DHK A;  3BJI A;  2K2U A;  5KQ1 A;  1NTV A;  3SYX A;  1X1G A;  2KCJ A;  2YT0 A;  1EGX A;  1BTN A;  1WI1 A;  2YS1 A;  2R0D A;  3ODO A;  2COA A;  4YON A;  3DXD A;  3KSY A;  2LOZ A;  3CXB B;  3SNH A;  4KHO A;  1AQC A;  2DYQ A;  2GCL A;  1MK7 B;  4IFS A;  3FSS A;  2H7D A;  2RNR B;  4A6K A;  1ZC3 B;  1SHC A;  3AU4 A;  3NSU A;  2MKR A;  2ROZ B;  2COD A;  1U5D A;  4NY0 A;  3GYP A;  3PVW A;  2LG1 A;  2CY4 A;  3ODW A;  1XD4 A;  4HB2 B;  3AJ4 A;  1U2B A;  2VSZ A;  3A8Q A;  2ROV A;  3TVV A;  2BCJ A;  2CY5 A;  4XWX A;  1XR0 B;  1P6S A;  4HAU B;  2EMS A;  1BWN A;  1NU2 A;  1I7A A;  5C79 A;  4MT7 A;  1DDM A;  1TXD A;  3LJU X;  3TO1 A;  2W2X D;  4BBK A;  5L81 A;  1W1H A;  2DYN A;  1V89 A;  2H7E A;  1EF1 A;  1P5T A;  5D3W A;  4MY6 A;  1U27 A;  1XOD A;  3T06 A;  1V5U A;  1WJ1 A;  2COC A;  4HDQ A;  4WJ7 A;  1DRO A;  2P0D A;  3PZD A;  2Z0P A;  5JHG A;  2RGN B;  1K5G B;  4H8S A;  1UPQ A;  5J3Q A;  2YT1 A;  1KZ7 A;  2N0Y A;  2L1C A;  2MDX A;  5CLQ B;  5KCV A;  1EAZ A;  2RLO A;  1OY2 A;  1MAI A;  4IOY X;  1SGH A;  4L6E A;  4DXA B;  2AL6 A;  5C16 A;  4HB0 B;  4GMV A;  1ZM0 A;  1H10 A;  2D9Y A;  5CLL B;  1U5E A;  2YS5 A;  5HE2 A;  1V5M A;  1W1D A;  4PQ0 A;  5JP4 A;  4GZU A;  5DH9 B;  4HAV B;  3FEH A;  2Y8G A;  1LW3 A;  5LON B;  3PEG A;  5DHA B;  1J0W A;  3P6A A;  5DHF B;  1TQZ A;  2COF A;  4HAW B;  1WGU A;  2P0F A;  3PVU A;  4MK0 A;  4HB4 B;  2VKI A;  1DDW A;  3SO6 A;  4HHV A;  5FI1 A;  3O96 A;  5D27 A;  3KRW A;  1UEF A;  4HAX B;  1WG7 A;  1XX0 A;  4DBB A;  2V76 A;  3U8Z A;  4KHB B;  1UNQ A;  5HE3 A;  4WVF B;  2FJL A;  2I1J A;  1DBH A;  2LYD A;  5J3T A;  1QC6 A;  3D8E A;  2NZ8 B;  3A8P A;  3M1I B;  2DLW A;  3HW2 B;  4HAT B;  4K17 A;  4CHM A;  2YF0 A;  1MK9 B;  2CAY A;  2M14 A;  1XCG A;  1U29 A;  1XKE A;  3WA0 A;  3HQC A;  1DYN A;  2DA0 A;  3U7D A;  4F7U P;  1Y5O A;  1FHO A;  1M7E A;  2RVB B;  4KHA A;  1AWE A;  3KZ1 A;  2JP2 A;  2UVM A;  4KVG B;  2LUL A;  1PMS A;  1Y19 B;  2MWN B;  4K2P A;  4GXB A;  5J3Y A;  1FOE A;  2DN6 A;  1RRP B;  1ZSQ A;  4P7I A;  1FHX A;  1V61 A;  1ZVR A;  2GCJ A;  2GJY A;  5C5B A;  2LKO A;  1J19 A;  1MPH A;  2MFQ A;  2YRY A;  3OAN A;  4A6F A;  3SV1 A;  4NSW A;  5GOW B;  1NI2 A;  2D4Q A;  4EMO A;  2RUK B;  4TKN A;  4CYE A;  1E5W A;  2Y7B A;  3V5W A;  1B55 A;  1RJ2 A;  2Y8F A;  2K2J A;  2I5C A;  5C5B B;  5EFX A;  1LB1 A;  5D3Y A;  3ULC A;  2ELB A;  2HTH B;  4TYZ A;  4A6F B;  5JHH A;  3PG7 A;  3QWM A;  1GC7 A;  2DX5 A;  2EMT A;  2DHJ A;  5KQ4 A;  4CHJ A;  3FM8 C;  2KGX B;  1KI1 B;  1P3R A;  3AU5 A;  5C6R A;  3HK0 A;  2RSG A;  1X11 A;  3A98 B;  3ODX A;  1OQN A;  2LOX A;  4HAZ B;  1BTK A;  4EJN A;  1V5P A;  1M7R A;  2IYB A;  1UNR A;  5DI9 B;  1KZG A;  4YL8 A;  1V88 A;  3MPX A;  2YVC A;  4Z2M B;  3G9W A;  4Y94 A;  2D11 A;  1MIX A;  2ADZ A;  1BAK A;  4HB3 B;  3TW1 A;  1FGY A;  1I2H A;  3PVL A;  2EJ8 A;  2UZS A;  3ML4 A;  3KY9 A;  5LOP B;  4F7H A;  2P8V A;  2J59 M;  1WVH A;  2D10 A;  1PFJ A;  3F0W A;  2HE7 A;  1X1F A;  2CRF A;  2P0H A;  2QKM A;  5DIF B;  2DHI A;  2N23 A;  4C0A A;  1X05 A;  1WGQ A;  2J0M A;  2J0K A;  1UNP A;  4HAY B;  2J0J A;  3QIJ A;  4F7G A;  2NMB A;  2PZ1 A;  2I5F A;  4KAX B;  4IAP A;  1K5D B;  3RCP A;  2YS3 A;  3GYO A;  4ZRK A;  1ISN A;  4D0N B;  1GC6 A;  3IVF A;  4A6H A;  1IRS A;  1QQG A;  5HE0 A;  3ZDT A;  3SUZ A;  1H4R A;  1Q67 A;  2K00 A;  4DX8 A;  2DKP A;  2ZPY A;  1FGZ A;  1MKE A;  4EKU A;  5D3V A;  3ULB A;  1FB8 A;  3PP2 A;  4Z2N A;  3P7Z A;  1DDV A;  3ZVR A;  2G35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...