1I2HA

Crystal structure analysis of psd-zip45(homer1c/vesl-1l)conserved homer 1 domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
145
structure length
138
Chain Sequence
EFMGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINSTITPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSKMELTSTPSGDLQSPLTPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PSD-ZIP45(HOMER-1C/VESL-1L)
publication title Crystal Structure of the Homer 1 Family Conserved Region Reveals the Interaction Between the EVH1 Domain and Own Proline-rich Motif
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 25
structure length 138
sequence length 145
ec nomenclature
pdb deposition date 2001-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1i2hA00
5LONB 4WVFB 2UVMA 2P8VA 4HHVA 5HE2A 4IOYX 3A98B 4HATB 3SO6A 1BWNA 3MDBC 1NI2A 4A6KA 4F7GA 4GZUA 2DYQA 2D9VA 4NSWA 5KQ4A 3ULBA 3ZDTA 4H8SA 1QC6A 3ML4A 2Z0QA 5HE0A 5C16A 2Z0PA 2DKPA 2LOXA 1ZVRA 2CY5A 2DTCA 2D9WA 2QKMA 1DDMA 1XODA 2Z0OA 2PZ1A 1Y5OA 1V89A 1W1GA 2ZPYA 4K17A 1OMWA 2ELBA 3KY9A 2R0DA 2W2XD 4HB0B 4L6EA 2I1KA 4C0AA 3ODOA 3PG7A 4IAPA 2GCLA 1I7AA 2RNRB 3LJUX 4KAXB 2LYDA 2L2IA 3HK0A 2NMBA 3FEHA 4HDOA 2VSZA 1P5TA 3TO1A 2LOZA 2EMTA 3AU4A 5D27A 5GOWB 5KCVA 1J19A 1NU2A 2J0MA 4PQ0A 5HE3A 2DHJA 3G9WA 2M38A 3BJIA 3KSYA 2DA0A 1H4RA 2D9ZA 3AU5A 3ULCA 1V88A 1K5GB 2YSZA 1IRSA 4B6HA 1EAZA 2MDXA 1Q67A 5DHAB 1FHXA 5JP4A 4GMXB 2JP2A 2UZRA 4DBBA 2V76A 3O96A 3QWMA 3D8FA 3TVVA 4A6FA 5JHHA 4HDQA 1BTKA 2D10A 4A6HA 4HAUB 3SYXA 3FM8C 5KQ1A 1B55A 2RSGA 2Y8GA 3ODWA 4KHBB 2VKIA 3SNHA 2I5CA 1E5WA 2L1CA 1RJ2A 2R09A 4HAZB 4TYZA 4HB4B 1K5DB 1KI1B 2ELAA 5DH9B 3WA0A 1X86A 3F5RA 1PMSA 4A6FB 4HAYB 1TJ6A 1V61A 2Y7BA 1EF1A 3SV1A 4YONA 1OQNA 2DX1A 3D8EA 4HAWB 3PVWA 1X11A 2D11A 5EFXA 1FGZA 1UNRA 1DDWA 1XKEA 4D0NB 4DX8A 2YT0A 2ROZB 3A8PA 1U27A 3T06A 2KGXB 1PLSA 5D3WA 1MK9B 2I5FA 4HAXB 3TFMA 1NTVA 2EJ8A 5J3TA 1EGXA 4CHMA 3RCPA 2HTHB 1PFJA 3A8QA 1U5FA 2RGNB 3X23A 4ZRIA 1FB8A 4HB3B 1X1GA 2J0KA 1V5MA 2GJYA 2DN6A 2RUKB 1MPHA 2P0FA 3CXBB 1DBHA 4GN1A 4XWXA 3OANA 1AQCA 1P6SA 2X18A 1UEFA 2P0HA 2COFA 2QKLA 2YVCA 1W1DA 4TKNA 3KZ1A 4K2PA 2OTXA 3TW1A 3V5WA 1KZ7A 1MK7B 1U5EA 2W2XC 2M14A 3BINA 2GCJA 1X1FA 2COAA 2COCA 4KHAA 4WSFA 1RRPB 1WGQA 5DI9B 4ZRJA 5C79A 3QIJA 4HAVB 2D9XA 2YS1A 5J3YA 5HE1A 2BCJA 1MIXA 5C6RA 5L81A 1FGYA 1QQGA 3PSCA 1XR0B 3ODXA 2E2XA 2LG1A 1M7RA 4K81A 3HQCA 1ISNA 2MKRA 5C5BA 1UNQA 1ZM0A 4GXBA 1I2HA 1XCGA 1WGUA 1SHCA 1J0WA 1FHOA 1GC6A 2H7EA 1N3HA 4KHOA 1LW3A 4MY6A 2CRFA 1U5GA 3PEGA 3N7CA 1UPRA 2K2UA 5D3XA 3PVLA 3ZVRA 2DFKA 5C5BB 2YF0A 4EMOA 3HW2B 2CODA 4KVGB 1P3RA 2UZSA 1U2BA 3SUZA 2EMSA 2GS0A 1WVHA 5FI1A 3F0WA 1H10A 4Y94A 2D4QA 4BBKA 1TXDA 4Z2MB 3VOQA 1V5UA 1MAIA 1U5DA 2I1JA 3U7DA 3U8ZA 5CLQB 1ZC3B 1OY2A 4K2OA 4CHJA 3DXEA 2ROVA 1WG7A 1EVHA 1FHWA 2N0YA 2AL6A 2DHIA 3P6AA 2HE7A 4PNKA 1X05A 2RVBB 2DYNA 2KUPA 3GYPA 2CY4A 4IFSA 1MIZB 4GPTB 2FJLA 2OQBA 1Y19B 2IYBA 1NTYA 1MKEA 2H7DA 1V5PA 3DXCA 2DKQA 2Q13A 1DROA 4CYEA 1WJMA 4GMVA 2DLWA 2YS5A 3NSUA 4P7IA 1XD4A 4NY0A 4MT7A 4WJ7A 1W1HA 3FSSA 3DXDA 1DYNA 1BAKA 1BTNA 4Z2NA 2W2WA 5DIFB 2VRWB 4YL8A 2DX5A 2KCJA 4DX90 5JLJB 3UZTA 4A5KA 5D3YA 4MK0A 1TQZA 1Z87A 1U29A 2YT1A 2RLOA 3PP2A 4F7HA 3VIAA 3TCAA 2ADZA 5J3QA 2MFQA 1UNPA 2YRYA 3D8DA 4F7UP 1GC7A 2D9YA 3KRXA 1WI1A 1SGHA 2NZ8B 2MWNB 2Y8FA 5D3VA 2LKOA 4EKUA 2XQNM 2EC1A 5CLLB 1ZSQA 3KRWA 2J0JA 1M7EA 1UPQA 3IVFA 1XX0A 3PVUA 2N23A 3P7ZA 1DDVA 4ZRKA 1FAOA 3AJ4A 1WJ1A 3WYFB 2LULA 3CIKA 5FI0A 4DXAB 5JHGA 2AEHA 1FOEA 2K2JA 2P0DA 2D2QA 2IFSA 3PZDA 1LB1A 2G35A 1KZGA 4HB2B 2YS3A 2CAYA 3GYOA 3MPXA 1AWEA 1GG3A 5DHFB 2K00A 4EJNA 3QBVB 5LOPB 1ZC4B 2DHKA 2J59M 3M1IB
chains in the Genus database with same CATH superfamily
5LONB 4WVFB 3HSAA 2UVMA 2P8VA 4HHVA 5HE2A 4IOYX 3A98B 4HATB 3SO6A 1BWNA 3MDBC 1NI2A 4A6KA 4F7GA 4GZUA 2DYQA 2D9VA 4NSWA 5KQ4A 3ULBA 3ZDTA 4H8SA 1QC6A 3ML4A 2Z0QA 5HE0A 5C16A 2Z0PA 2DKPA 2LOXA 1ZVRA 2CY5A 4OSNA 2DTCA 2D9WA 2QKMA 1DDMA 1XODA 4CSQA 2Z0OA 2PZ1A 1Y5OA 1V89A 1W1GA 2ZPYA 5LG4B 4K17A 1OMWA 2ELBA 4QJ4B 3KY9A 2R0DA 2W2XD 4HB0B 1T77A 4L6EA 2I1KA 4C0AA 5I2SA 3ODOA 3PG7A 4IAPA 2GCLA 1I7AA 2RNRB 3LJUX 4KAXB 2LYDA 2L2IA 3HK0A 2NMBA 3FEHA 4HDOA 2VSZA 1P5TA 3TO1A 2LOZA 2EMTA 3AU4A 5D27A 5GOWB 5KCVA 1J19A 1NU2A 2J0MA 4PQ0A 5HE3A 2DHJA 3G9WA 2M38A 3BJIA 3KSYA 2DA0A 1H4RA 2D9ZA 3FVCA 3AU5A 3ULCA 1V88A 1K5GB 2KR0A 2YSZA 4KHBA 1IRSA 3NWAA 4B6HA 1EAZA 2MDXA 1Q67A 5DHAB 1FHXA 5JP4A 4GMXB 2JP2A 2UZRA 4DBBA 2V76A 3O96A 3QWMA 3D8FA 3TVVA 4A6FA 5JHHA 4HDQA 1BTKA 2D10A 4A6HA 4HAUB 3SYXA 3FM8C 5KQ1A 1B55A 2RSGA 2Y8GA 3ODWA 4KHBB 2VKIA 3SNHA 2I5CA 1E5WA 2L1CA 1RJ2A 2R09A 4HAZB 2KIGA 4TYZA 4HB4B 4L1RA 1K5DB 1KI1B 2ELAA 5DH9B 3WA0A 1X86A 4DIXA 3F5RA 1PMSA 4A6FB 4HAYB 1TJ6A 3HIEA 1V61A 2Y7BA 1EF1A 3SV1A 4YONA 2K49A 1OQNA 2DX1A 3D8EA 4HAWB 3PVWA 1X11A 2D11A 5EFXA 1FGZA 1UNRA 1DDWA 2K8EA 1XKEA 4HSIA 4D0NB 4DX8A 2YT0A 3NWDA 2ROZB 3A8PA 1U27A 3T06A 2KGXB 1PLSA 5D3WA 1MK9B 2I5FA 4HAXB 3TFMA 1NTVA 2EJ8A 5J3TA 1EGXA 4CHMA 3RCPA 2HTHB 1PFJA 2RRFA 3A8QA 1U5FA 2RGNB 3X23A 4ZRIA 1FB8A 4HB3B 1X1GA 2J0KA 1V5MA 2GJYA 2DN6A 2RUKB 1MPHA 2P0FA 3CXBB 1DBHA 4GN1A 4XWXA 1AQCA 3OANA 1P6SA 2X18A 3OHMB 1UEFA 2P0HA 2COFA 2QKLA 2YVCA 1W1DA 4TKNA 3KZ1A 4K2PA 2OTXA 3TW1A 3V5WA 1KZ7A 1MK7B 1U5EA 2W2XC 2M14A 3BINA 2GCJA 1X1FA 2COAA 2COCA 4KHAA 4WSFA 1RRPB 1WGQA 5DI9B 4ZRJA 5C79A 3QIJA 4HAVB 2D9XA 2YS1A 5J3YA 5HE1A 2BCJA 1MIXA 5C6RA 5L81A 1FGYA 1QQGA 3PSCA 1XR0B 3ODXA 2E2XA 3DCXA 2LG1A 1M7RA 4K81A 3HQCA 1ISNA 2MKRA 5C5BA 1UNQA 1ZM0A 4GXBA 1I2HA 1XCGA 1WGUA 1SHCA 1J0WA 1FHOA 1GC6A 2H7EA 1N3HA 4KHOA 1LW3A 2FJUB 2CRFA 4MY6A 1U5GA 3PEGA 3N7CA 2Z14A 2NBVA 1UPRA 5IRSA 2K2UA 4QJ3B 5D3XA 3PVLA 3ZVRA 2DFKA 5C5BB 2YF0A 4EMOA 3HW2B 2CODA 4KVGB 1P3RA 2KUQA 4QJ5B 2UZSA 1U2BA 3SUZA 2EMSA 2GS0A 1WVHA 5FI1A 3F0WA 1H10A 4Y94A 2D4QA 4BBKA 1TXDA 4Z2MB 3VOQA 1V5UA 1MAIA 1U5DA 2I1JA 3U7DA 3U8ZA 5CLQB 5I2MA 5M4YB 1ZC3B 1OY2A 4K2OA 4CHJA 3DXEA 2ROVA 1WG7A 3NW8A 1EVHA 1FHWA 2N0YA 2AL6A 2DHIA 3P6AA 3B77A 2HE7A 4PNKA 1X05A 2RVBB 2DYNA 2KUPA 3GYPA 2CY4A 4IFSA 1MIZB 4GPTB 2FJLA 2OQBA 4OT1A 1Y19B 2IYBA 1NTYA 1MKEA 2H7DA 1V5PA 3DXCA 2DKQA 2Q13A 1DROA 4CYEA 1WJMA 4GMVA 2DLWA 2YS5A 3NSUA 4P7IA 1XD4A 4NY0A 4MT7A 4WJ7A 1W1HA 3FSSA 3DXDA 4D6WA 1DYNA 1BAKA 1BTNA 4Z2NA 2W2WA 5DIFB 2VRWB 4YL8A 2DX5A 2KCJA 4DX90 5JLJB 3UZTA 4A5KA 5D3YA 4MK0A 2GUMA 1TQZA 1Z87A 3U12A 2R2YA 1U29A 2YT1A 2RLOA 3PP2A 4F7HA 3VIAA 3TCAA 2ADZA 5J3QA 2MFQA 1UNPA 2YRYA 3D8DA 4F7UP 1GC7A 2D9YA 3KRXA 1WI1A 1SGHA 2NZ8B 2MWNB 2Y8FA 5D3VA 2LKOA 4EKUA 2XQNM 2EC1A 5CLLB 1ZSQA 2J0JA 1M7EA 2ZKMX 3KRWA 1UPQA 3IVFA 1XX0A 3PVUA 2N23A 3P7ZA 4GOUA 3NWFA 1DDVA 4ZRKA 1FAOA 3AJ4A 1WJ1A 3WYFB 2LULA 3CIKA 5FI0A 4DXAB 5JHGA 2AEHA 2Z4DA 1MI1A 1FOEA 2K2JA 3A58A 2P0DA 2D2QA 2IFSA 2Z13A 3PZDA 1LB1A 2G35A 1KZGA 4HB2B 2YS3A 2CAYA 3GYOA 1ZYIA 3MPXA 1AWEA 1GG3A 5DHFB 2K00A 4EJNA 4GNKB 2KIEA 3QBVB 5LOPB 1ZC4B 2YT2A 4QXAB 2DHKA 2J59M 2Z59A 3M1IB
chains in the Genus database with same CATH topology
5LONB 4WVFB 2UVMA 2P8VA 4HHVA 5HE2A 4IOYX 3A98B 4HATB 3SO6A 1BWNA 3MDBC 1NI2A 4A6KA 4F7GA 4GZUA 2DYQA 2D9VA 4NSWA 5KQ4A 3ULBA 3ZDTA 4H8SA 1QC6A 3ML4A 2Z0QA 5HE0A 5C16A 2Z0PA 2DKPA 2LOXA 1ZVRA 2CY5A 2DTCA 2D9WA 2QKMA 1DDMA 1XODA 2Z0OA 2PZ1A 1Y5OA 1V89A 1W1GA 2ZPYA 4K17A 1OMWA 2ELBA 3KY9A 2R0DA 2W2XD 4HB0B 4L6EA 2I1KA 4C0AA 3ODOA 3PG7A 4IAPA 2GCLA 1I7AA 2RNRB 3LJUX 4KAXB 2LYDA 2L2IA 3HK0A 2NMBA 3FEHA 4HDOA 2VSZA 1P5TA 3TO1A 2LOZA 2EMTA 3AU4A 5D27A 5GOWB 5KCVA 1J19A 1NU2A 2J0MA 4PQ0A 5HE3A 2DHJA 3G9WA 2M38A 3BJIA 3KSYA 2DA0A 1H4RA 2D9ZA 3AU5A 3ULCA 1V88A 1K5GB 2YSZA 1IRSA 4B6HA 1EAZA 2MDXA 1Q67A 5DHAB 1FHXA 5JP4A 4GMXB 2JP2A 2UZRA 4DBBA 2V76A 3O96A 3QWMA 3D8FA 3TVVA 4A6FA 5JHHA 4HDQA 1BTKA 2D10A 4A6HA 4HAUB 3SYXA 3FM8C 5KQ1A 1B55A 2RSGA 2Y8GA 3ODWA 4KHBB 2VKIA 3SNHA 2I5CA 1E5WA 2L1CA 1RJ2A 2R09A 4HAZB 4TYZA 4HB4B 1K5DB 1KI1B 2ELAA 5DH9B 3WA0A 1X86A 3F5RA 1PMSA 4A6FB 4HAYB 1TJ6A 1V61A 2Y7BA 1EF1A 3SV1A 4YONA 1OQNA 2DX1A 3D8EA 4HAWB 3PVWA 1X11A 2D11A 5EFXA 1FGZA 1UNRA 1DDWA 1XKEA 4D0NB 4DX8A 2YT0A 2ROZB 3A8PA 1U27A 3T06A 2KGXB 1PLSA 5D3WA 1MK9B 2I5FA 4HAXB 3TFMA 1NTVA 2EJ8A 5J3TA 1EGXA 4CHMA 3RCPA 2HTHB 1PFJA 3A8QA 1U5FA 2RGNB 3X23A 4ZRIA 1FB8A 4HB3B 1X1GA 2J0KA 1V5MA 2GJYA 2DN6A 2RUKB 1MPHA 2P0FA 3CXBB 1DBHA 4GN1A 4XWXA 3OANA 1AQCA 1P6SA 2X18A 1UEFA 2P0HA 2COFA 2QKLA 2YVCA 1W1DA 4TKNA 3KZ1A 4K2PA 2OTXA 3TW1A 3V5WA 1KZ7A 1MK7B 1U5EA 2W2XC 2M14A 3BINA 2GCJA 1X1FA 2COAA 2COCA 4KHAA 4WSFA 1RRPB 1WGQA 5DI9B 4ZRJA 5C79A 3QIJA 4HAVB 2D9XA 2YS1A 5J3YA 5HE1A 2BCJA 1MIXA 5C6RA 5L81A 1FGYA 1QQGA 3PSCA 1XR0B 3ODXA 2E2XA 2LG1A 1M7RA 4K81A 3HQCA 1ISNA 2MKRA 5C5BA 1UNQA 1ZM0A 4GXBA 1I2HA 1XCGA 1WGUA 1SHCA 1J0WA 1FHOA 1GC6A 2H7EA 1N3HA 4KHOA 1LW3A 4MY6A 2CRFA 1U5GA 3PEGA 3N7CA 1UPRA 2K2UA 5D3XA 3PVLA 3ZVRA 2DFKA 5C5BB 2YF0A 4EMOA 3HW2B 2CODA 4KVGB 1P3RA 2UZSA 1U2BA 3SUZA 2EMSA 2GS0A 1WVHA 5FI1A 3F0WA 1H10A 4Y94A 2D4QA 4BBKA 1TXDA 4Z2MB 3VOQA 1V5UA 1MAIA 1U5DA 2I1JA 3U7DA 3U8ZA 5CLQB 1ZC3B 1OY2A 4K2OA 4CHJA 3DXEA 2ROVA 1WG7A 1EVHA 1FHWA 2N0YA 2AL6A 2DHIA 3P6AA 2HE7A 4PNKA 1X05A 2RVBB 2DYNA 2KUPA 3GYPA 2CY4A 4IFSA 1MIZB 4GPTB 2FJLA 2OQBA 1Y19B 2IYBA 1NTYA 1MKEA 2H7DA 1V5PA 3DXCA 2DKQA 2Q13A 1DROA 4CYEA 1WJMA 4GMVA 2DLWA 2YS5A 3NSUA 4P7IA 1XD4A 4NY0A 4MT7A 4WJ7A 1W1HA 3FSSA 3DXDA 1DYNA 1BAKA 1BTNA 4Z2NA 2W2WA 5DIFB 2VRWB 4YL8A 2DX5A 2KCJA 4DX90 5JLJB 3UZTA 4A5KA 5D3YA 4MK0A 1TQZA 1Z87A 1U29A 2YT1A 2RLOA 3PP2A 4F7HA 3VIAA 3TCAA 2ADZA 5J3QA 2MFQA 1UNPA 2YRYA 3D8DA 4F7UP 1GC7A 2D9YA 3KRXA 1WI1A 1SGHA 2NZ8B 2MWNB 2Y8FA 5D3VA 2LKOA 4EKUA 2XQNM 2EC1A 5CLLB 1ZSQA 3KRWA 2J0JA 1M7EA 1UPQA 3IVFA 1XX0A 3PVUA 2N23A 3P7ZA 1DDVA 4ZRKA 1FAOA 3AJ4A 1WJ1A 3WYFB 2LULA 3CIKA 5FI0A 4DXAB 5JHGA 2AEHA 1FOEA 2K2JA 2P0DA 2D2QA 2IFSA 3PZDA 1LB1A 2G35A 1KZGA 4HB2B 2YS3A 2CAYA 3GYOA 3MPXA 1AWEA 1GG3A 5DHFB 2K00A 4EJNA 3QBVB 5LOPB 1ZC4B 2DHKA 2J59M 3M1IB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LON B;  4WVF B;  2UVM A;  2P8V A;  4HHV A;  5HE2 A;  4IOY X;  3A98 B;  4HAT B;  3SO6 A;  1BWN A;  3MDB C;  1NI2 A;  4A6K A;  4F7G A;  4GZU A;  2DYQ A;  2D9V A;  4NSW A;  5KQ4 A;  3ULB A;  3ZDT A;  4H8S A;  1QC6 A;  3ML4 A;  2Z0Q A;  5HE0 A;  5C16 A;  2Z0P A;  2DKP A;  2LOX A;  1ZVR A;  2CY5 A;  2DTC A;  2D9W A;  2QKM A;  1DDM A;  1XOD A;  2Z0O A;  2PZ1 A;  1Y5O A;  1V89 A;  1W1G A;  2ZPY A;  4K17 A;  1OMW A;  2ELB A;  3KY9 A;  2R0D A;  2W2X D;  4HB0 B;  4L6E A;  2I1K A;  4C0A A;  3ODO A;  3PG7 A;  4IAP A;  2GCL A;  1I7A A;  2RNR B;  3LJU X;  4KAX B;  2LYD A;  2L2I A;  3HK0 A;  2NMB A;  3FEH A;  4HDO A;  2VSZ A;  1P5T A;  3TO1 A;  2LOZ A;  2EMT A;  3AU4 A;  5D27 A;  5GOW B;  5KCV A;  1J19 A;  1NU2 A;  2J0M A;  4PQ0 A;  5HE3 A;  2DHJ A;  3G9W A;  2M38 A;  3BJI A;  3KSY A;  2DA0 A;  1H4R A;  2D9Z A;  3AU5 A;  3ULC A;  1V88 A;  1K5G B;  2YSZ A;  1IRS A;  4B6H A;  1EAZ A;  2MDX A;  1Q67 A;  5DHA B;  1FHX A;  5JP4 A;  4GMX B;  2JP2 A;  2UZR A;  4DBB A;  2V76 A;  3O96 A;  3QWM A;  3D8F A;  3TVV A;  4A6F A;  5JHH A;  4HDQ A;  1BTK A;  2D10 A;  4A6H A;  4HAU B;  3SYX A;  3FM8 C;  5KQ1 A;  1B55 A;  2RSG A;  2Y8G A;  3ODW A;  4KHB B;  2VKI A;  3SNH A;  2I5C A;  1E5W A;  2L1C A;  1RJ2 A;  2R09 A;  4HAZ B;  4TYZ A;  4HB4 B;  1K5D B;  1KI1 B;  2ELA A;  5DH9 B;  3WA0 A;  1X86 A;  3F5R A;  1PMS A;  4A6F B;  4HAY B;  1TJ6 A;  1V61 A;  2Y7B A;  1EF1 A;  3SV1 A;  4YON A;  1OQN A;  2DX1 A;  3D8E A;  4HAW B;  3PVW A;  1X11 A;  2D11 A;  5EFX A;  1FGZ A;  1UNR A;  1DDW A;  1XKE A;  4D0N B;  4DX8 A;  2YT0 A;  2ROZ B;  3A8P A;  1U27 A;  3T06 A;  2KGX B;  1PLS A;  5D3W A;  1MK9 B;  2I5F A;  4HAX B;  3TFM A;  1NTV A;  2EJ8 A;  5J3T A;  1EGX A;  4CHM A;  3RCP A;  2HTH B;  1PFJ A;  3A8Q A;  1U5F A;  2RGN B;  3X23 A;  4ZRI A;  1FB8 A;  4HB3 B;  1X1G A;  2J0K A;  1V5M A;  2GJY A;  2DN6 A;  2RUK B;  1MPH A;  2P0F A;  3CXB B;  1DBH A;  4GN1 A;  4XWX A;  3OAN A;  1AQC A;  1P6S A;  2X18 A;  1UEF A;  2P0H A;  2COF A;  2QKL A;  2YVC A;  1W1D A;  4TKN A;  3KZ1 A;  4K2P A;  2OTX A;  3TW1 A;  3V5W A;  1KZ7 A;  1MK7 B;  1U5E A;  2W2X C;  2M14 A;  3BIN A;  2GCJ A;  1X1F A;  2COA A;  2COC A;  4KHA A;  4WSF A;  1RRP B;  1WGQ A;  5DI9 B;  4ZRJ A;  5C79 A;  3QIJ A;  4HAV B;  2D9X A;  2YS1 A;  5J3Y A;  5HE1 A;  2BCJ A;  1MIX A;  5C6R A;  5L81 A;  1FGY A;  1QQG A;  3PSC A;  1XR0 B;  3ODX A;  2E2X A;  2LG1 A;  1M7R A;  4K81 A;  3HQC A;  1ISN A;  2MKR A;  5C5B A;  1UNQ A;  1ZM0 A;  4GXB A;  1I2H A;  1XCG A;  1WGU A;  1SHC A;  1J0W A;  1FHO A;  1GC6 A;  2H7E A;  1N3H A;  4KHO A;  1LW3 A;  4MY6 A;  2CRF A;  1U5G A;  3PEG A;  3N7C A;  1UPR A;  2K2U A;  5D3X A;  3PVL A;  3ZVR A;  2DFK A;  5C5B B;  2YF0 A;  4EMO A;  3HW2 B;  2COD A;  4KVG B;  1P3R A;  2UZS A;  1U2B A;  3SUZ A;  2EMS A;  2GS0 A;  1WVH A;  5FI1 A;  3F0W A;  1H10 A;  4Y94 A;  2D4Q A;  4BBK A;  1TXD A;  4Z2M B;  3VOQ A;  1V5U A;  1MAI A;  1U5D A;  2I1J A;  3U7D A;  3U8Z A;  5CLQ B;  1ZC3 B;  1OY2 A;  4K2O A;  4CHJ A;  3DXE A;  2ROV A;  1WG7 A;  1EVH A;  1FHW A;  2N0Y A;  2AL6 A;  2DHI A;  3P6A A;  2HE7 A;  4PNK A;  1X05 A;  2RVB B;  2DYN A;  2KUP A;  3GYP A;  2CY4 A;  4IFS A;  1MIZ B;  4GPT B;  2FJL A;  2OQB A;  1Y19 B;  2IYB A;  1NTY A;  1MKE A;  2H7D A;  1V5P A;  3DXC A;  2DKQ A;  2Q13 A;  1DRO A;  4CYE A;  1WJM A;  4GMV A;  2DLW A;  2YS5 A;  3NSU A;  4P7I A;  1XD4 A;  4NY0 A;  4MT7 A;  4WJ7 A;  1W1H A;  3FSS A;  3DXD A;  1DYN A;  1BAK A;  1BTN A;  4Z2N A;  2W2W A;  5DIF B;  2VRW B;  4YL8 A;  2DX5 A;  2KCJ A;  4DX9 0;  5JLJ B;  3UZT A;  4A5K A;  5D3Y A;  4MK0 A;  1TQZ A;  1Z87 A;  1U29 A;  2YT1 A;  2RLO A;  3PP2 A;  4F7H A;  3VIA A;  3TCA A;  2ADZ A;  5J3Q A;  2MFQ A;  1UNP A;  2YRY A;  3D8D A;  4F7U P;  1GC7 A;  2D9Y A;  3KRX A;  1WI1 A;  1SGH A;  2NZ8 B;  2MWN B;  2Y8F A;  5D3V A;  2LKO A;  4EKU A;  2XQN M;  2EC1 A;  5CLL B;  1ZSQ A;  3KRW A;  2J0J A;  1M7E A;  1UPQ A;  3IVF A;  1XX0 A;  3PVU A;  2N23 A;  3P7Z A;  1DDV A;  4ZRK A;  1FAO A;  3AJ4 A;  1WJ1 A;  3WYF B;  2LUL A;  3CIK A;  5FI0 A;  4DXA B;  5JHG A;  2AEH A;  1FOE A;  2K2J A;  2P0D A;  2D2Q A;  2IFS A;  3PZD A;  1LB1 A;  2G35 A;  1KZG A;  4HB2 B;  2YS3 A;  2CAY A;  3GYO A;  3MPX A;  1AWE A;  1GG3 A;  5DHF B;  2K00 A;  4EJN A;  3QBV B;  5LOP B;  1ZC4 B;  2DHK A;  2J59 M;  3M1I B; 
#chains in the Genus database with same CATH topology
 5LON B;  4WVF B;  3HSA A;  2UVM A;  2P8V A;  4HHV A;  5HE2 A;  4IOY X;  3A98 B;  4HAT B;  3SO6 A;  1BWN A;  3MDB C;  1NI2 A;  4A6K A;  4F7G A;  4GZU A;  2DYQ A;  2D9V A;  4NSW A;  5KQ4 A;  3ULB A;  3ZDT A;  4H8S A;  1QC6 A;  3ML4 A;  2Z0Q A;  5HE0 A;  5C16 A;  2Z0P A;  2DKP A;  2LOX A;  1ZVR A;  2CY5 A;  4OSN A;  2DTC A;  2D9W A;  2QKM A;  1DDM A;  1XOD A;  4CSQ A;  2Z0O A;  2PZ1 A;  1Y5O A;  1V89 A;  1W1G A;  2ZPY A;  5LG4 B;  4K17 A;  1OMW A;  2ELB A;  4QJ4 B;  3KY9 A;  2R0D A;  2W2X D;  4HB0 B;  1T77 A;  4L6E A;  2I1K A;  4C0A A;  5I2S A;  3ODO A;  3PG7 A;  4IAP A;  2GCL A;  1I7A A;  2RNR B;  3LJU X;  4KAX B;  2LYD A;  2L2I A;  3HK0 A;  2NMB A;  3FEH A;  4HDO A;  2VSZ A;  1P5T A;  3TO1 A;  2LOZ A;  2EMT A;  3AU4 A;  5D27 A;  5GOW B;  5KCV A;  1J19 A;  1NU2 A;  2J0M A;  4PQ0 A;  5HE3 A;  2DHJ A;  3G9W A;  2M38 A;  3BJI A;  3KSY A;  2DA0 A;  1H4R A;  2D9Z A;  3FVC A;  3AU5 A;  3ULC A;  1V88 A;  1K5G B;  2KR0 A;  2YSZ A;  4KHB A;  1IRS A;  3NWA A;  4B6H A;  1EAZ A;  2MDX A;  1Q67 A;  5DHA B;  1FHX A;  5JP4 A;  4GMX B;  2JP2 A;  2UZR A;  4DBB A;  2V76 A;  3O96 A;  3QWM A;  3D8F A;  3TVV A;  4A6F A;  5JHH A;  4HDQ A;  1BTK A;  2D10 A;  4A6H A;  4HAU B;  3SYX A;  3FM8 C;  5KQ1 A;  1B55 A;  2RSG A;  2Y8G A;  3ODW A;  4KHB B;  2VKI A;  3SNH A;  2I5C A;  1E5W A;  2L1C A;  1RJ2 A;  2R09 A;  4HAZ B;  2KIG A;  4TYZ A;  4HB4 B;  4L1R A;  1K5D B;  1KI1 B;  2ELA A;  5DH9 B;  3WA0 A;  1X86 A;  4DIX A;  3F5R A;  1PMS A;  4A6F B;  4HAY B;  1TJ6 A;  3HIE A;  1V61 A;  2Y7B A;  1EF1 A;  3SV1 A;  4YON A;  2K49 A;  1OQN A;  2DX1 A;  3D8E A;  4HAW B;  3PVW A;  1X11 A;  2D11 A;  5EFX A;  1FGZ A;  1UNR A;  1DDW A;  2K8E A;  1XKE A;  4HSI A;  4D0N B;  4DX8 A;  2YT0 A;  3NWD A;  2ROZ B;  3A8P A;  1U27 A;  3T06 A;  2KGX B;  1PLS A;  5D3W A;  1MK9 B;  2I5F A;  4HAX B;  3TFM A;  1NTV A;  2EJ8 A;  5J3T A;  1EGX A;  4CHM A;  3RCP A;  2HTH B;  1PFJ A;  2RRF A;  3A8Q A;  1U5F A;  2RGN B;  3X23 A;  4ZRI A;  1FB8 A;  4HB3 B;  1X1G A;  2J0K A;  1V5M A;  2GJY A;  2DN6 A;  2RUK B;  1MPH A;  2P0F A;  3CXB B;  1DBH A;  4GN1 A;  4XWX A;  1AQC A;  3OAN A;  1P6S A;  2X18 A;  3OHM B;  1UEF A;  2P0H A;  2COF A;  2QKL A;  2YVC A;  1W1D A;  4TKN A;  3KZ1 A;  4K2P A;  2OTX A;  3TW1 A;  3V5W A;  1KZ7 A;  1MK7 B;  1U5E A;  2W2X C;  2M14 A;  3BIN A;  2GCJ A;  1X1F A;  2COA A;  2COC A;  4KHA A;  4WSF A;  1RRP B;  1WGQ A;  5DI9 B;  4ZRJ A;  5C79 A;  3QIJ A;  4HAV B;  2D9X A;  2YS1 A;  5J3Y A;  5HE1 A;  2BCJ A;  1MIX A;  5C6R A;  5L81 A;  1FGY A;  1QQG A;  3PSC A;  1XR0 B;  3ODX A;  2E2X A;  3DCX A;  2LG1 A;  1M7R A;  4K81 A;  3HQC A;  1ISN A;  2MKR A;  5C5B A;  1UNQ A;  1ZM0 A;  4GXB A;  1I2H A;  1XCG A;  1WGU A;  1SHC A;  1J0W A;  1FHO A;  1GC6 A;  2H7E A;  1N3H A;  4KHO A;  1LW3 A;  2FJU B;  2CRF A;  4MY6 A;  1U5G A;  3PEG A;  3N7C A;  2Z14 A;  2NBV A;  1UPR A;  5IRS A;  2K2U A;  4QJ3 B;  5D3X A;  3PVL A;  3ZVR A;  2DFK A;  5C5B B;  2YF0 A;  4EMO A;  3HW2 B;  2COD A;  4KVG B;  1P3R A;  2KUQ A;  4QJ5 B;  2UZS A;  1U2B A;  3SUZ A;  2EMS A;  2GS0 A;  1WVH A;  5FI1 A;  3F0W A;  1H10 A;  4Y94 A;  2D4Q A;  4BBK A;  1TXD A;  4Z2M B;  3VOQ A;  1V5U A;  1MAI A;  1U5D A;  2I1J A;  3U7D A;  3U8Z A;  5CLQ B;  5I2M A;  5M4Y B;  1ZC3 B;  1OY2 A;  4K2O A;  4CHJ A;  3DXE A;  2ROV A;  1WG7 A;  3NW8 A;  1EVH A;  1FHW A;  2N0Y A;  2AL6 A;  2DHI A;  3P6A A;  3B77 A;  2HE7 A;  4PNK A;  1X05 A;  2RVB B;  2DYN A;  2KUP A;  3GYP A;  2CY4 A;  4IFS A;  1MIZ B;  4GPT B;  2FJL A;  2OQB A;  4OT1 A;  1Y19 B;  2IYB A;  1NTY A;  1MKE A;  2H7D A;  1V5P A;  3DXC A;  2DKQ A;  2Q13 A;  1DRO A;  4CYE A;  1WJM A;  4GMV A;  2DLW A;  2YS5 A;  3NSU A;  4P7I A;  1XD4 A;  4NY0 A;  4MT7 A;  4WJ7 A;  1W1H A;  3FSS A;  3DXD A;  4D6W A;  1DYN A;  1BAK A;  1BTN A;  4Z2N A;  2W2W A;  5DIF B;  2VRW B;  4YL8 A;  2DX5 A;  2KCJ A;  4DX9 0;  5JLJ B;  3UZT A;  4A5K A;  5D3Y A;  4MK0 A;  2GUM A;  1TQZ A;  1Z87 A;  3U12 A;  2R2Y A;  1U29 A;  2YT1 A;  2RLO A;  3PP2 A;  4F7H A;  3VIA A;  3TCA A;  2ADZ A;  5J3Q A;  2MFQ A;  1UNP A;  2YRY A;  3D8D A;  4F7U P;  1GC7 A;  2D9Y A;  3KRX A;  1WI1 A;  1SGH A;  2NZ8 B;  2MWN B;  2Y8F A;  5D3V A;  2LKO A;  4EKU A;  2XQN M;  2EC1 A;  5CLL B;  1ZSQ A;  2J0J A;  1M7E A;  2ZKM X;  3KRW A;  1UPQ A;  3IVF A;  1XX0 A;  3PVU A;  2N23 A;  3P7Z A;  4GOU A;  3NWF A;  1DDV A;  4ZRK A;  1FAO A;  3AJ4 A;  1WJ1 A;  3WYF B;  2LUL A;  3CIK A;  5FI0 A;  4DXA B;  5JHG A;  2AEH A;  2Z4D A;  1MI1 A;  1FOE A;  2K2J A;  3A58 A;  2P0D A;  2D2Q A;  2IFS A;  2Z13 A;  3PZD A;  1LB1 A;  2G35 A;  1KZG A;  4HB2 B;  2YS3 A;  2CAY A;  3GYO A;  1ZYI A;  3MPX A;  1AWE A;  1GG3 A;  5DHF B;  2K00 A;  4EJN A;  4GNK B;  2KIE A;  3QBV B;  5LOP B;  1ZC4 B;  2YT2 A;  4QXA B;  2DHK A;  2J59 M;  2Z59 A;  3M1I B; 
#chains in the Genus database with same CATH homology
 5LON B;  4WVF B;  2UVM A;  2P8V A;  4HHV A;  5HE2 A;  4IOY X;  3A98 B;  4HAT B;  3SO6 A;  1BWN A;  3MDB C;  1NI2 A;  4A6K A;  4F7G A;  4GZU A;  2DYQ A;  2D9V A;  4NSW A;  5KQ4 A;  3ULB A;  3ZDT A;  4H8S A;  1QC6 A;  3ML4 A;  2Z0Q A;  5HE0 A;  5C16 A;  2Z0P A;  2DKP A;  2LOX A;  1ZVR A;  2CY5 A;  2DTC A;  2D9W A;  2QKM A;  1DDM A;  1XOD A;  2Z0O A;  2PZ1 A;  1Y5O A;  1V89 A;  1W1G A;  2ZPY A;  4K17 A;  1OMW A;  2ELB A;  3KY9 A;  2R0D A;  2W2X D;  4HB0 B;  4L6E A;  2I1K A;  4C0A A;  3ODO A;  3PG7 A;  4IAP A;  2GCL A;  1I7A A;  2RNR B;  3LJU X;  4KAX B;  2LYD A;  2L2I A;  3HK0 A;  2NMB A;  3FEH A;  4HDO A;  2VSZ A;  1P5T A;  3TO1 A;  2LOZ A;  2EMT A;  3AU4 A;  5D27 A;  5GOW B;  5KCV A;  1J19 A;  1NU2 A;  2J0M A;  4PQ0 A;  5HE3 A;  2DHJ A;  3G9W A;  2M38 A;  3BJI A;  3KSY A;  2DA0 A;  1H4R A;  2D9Z A;  3AU5 A;  3ULC A;  1V88 A;  1K5G B;  2YSZ A;  1IRS A;  4B6H A;  1EAZ A;  2MDX A;  1Q67 A;  5DHA B;  1FHX A;  5JP4 A;  4GMX B;  2JP2 A;  2UZR A;  4DBB A;  2V76 A;  3O96 A;  3QWM A;  3D8F A;  3TVV A;  4A6F A;  5JHH A;  4HDQ A;  1BTK A;  2D10 A;  4A6H A;  4HAU B;  3SYX A;  3FM8 C;  5KQ1 A;  1B55 A;  2RSG A;  2Y8G A;  3ODW A;  4KHB B;  2VKI A;  3SNH A;  2I5C A;  1E5W A;  2L1C A;  1RJ2 A;  2R09 A;  4HAZ B;  4TYZ A;  4HB4 B;  1K5D B;  1KI1 B;  2ELA A;  5DH9 B;  3WA0 A;  1X86 A;  3F5R A;  1PMS A;  4A6F B;  4HAY B;  1TJ6 A;  1V61 A;  2Y7B A;  1EF1 A;  3SV1 A;  4YON A;  1OQN A;  2DX1 A;  3D8E A;  4HAW B;  3PVW A;  1X11 A;  2D11 A;  5EFX A;  1FGZ A;  1UNR A;  1DDW A;  1XKE A;  4D0N B;  4DX8 A;  2YT0 A;  2ROZ B;  3A8P A;  1U27 A;  3T06 A;  2KGX B;  1PLS A;  5D3W A;  1MK9 B;  2I5F A;  4HAX B;  3TFM A;  1NTV A;  2EJ8 A;  5J3T A;  1EGX A;  4CHM A;  3RCP A;  2HTH B;  1PFJ A;  3A8Q A;  1U5F A;  2RGN B;  3X23 A;  4ZRI A;  1FB8 A;  4HB3 B;  1X1G A;  2J0K A;  1V5M A;  2GJY A;  2DN6 A;  2RUK B;  1MPH A;  2P0F A;  3CXB B;  1DBH A;  4GN1 A;  4XWX A;  3OAN A;  1AQC A;  1P6S A;  2X18 A;  1UEF A;  2P0H A;  2COF A;  2QKL A;  2YVC A;  1W1D A;  4TKN A;  3KZ1 A;  4K2P A;  2OTX A;  3TW1 A;  3V5W A;  1KZ7 A;  1MK7 B;  1U5E A;  2W2X C;  2M14 A;  3BIN A;  2GCJ A;  1X1F A;  2COA A;  2COC A;  4KHA A;  4WSF A;  1RRP B;  1WGQ A;  5DI9 B;  4ZRJ A;  5C79 A;  3QIJ A;  4HAV B;  2D9X A;  2YS1 A;  5J3Y A;  5HE1 A;  2BCJ A;  1MIX A;  5C6R A;  5L81 A;  1FGY A;  1QQG A;  3PSC A;  1XR0 B;  3ODX A;  2E2X A;  2LG1 A;  1M7R A;  4K81 A;  3HQC A;  1ISN A;  2MKR A;  5C5B A;  1UNQ A;  1ZM0 A;  4GXB A;  1I2H A;  1XCG A;  1WGU A;  1SHC A;  1J0W A;  1FHO A;  1GC6 A;  2H7E A;  1N3H A;  4KHO A;  1LW3 A;  4MY6 A;  2CRF A;  1U5G A;  3PEG A;  3N7C A;  1UPR A;  2K2U A;  5D3X A;  3PVL A;  3ZVR A;  2DFK A;  5C5B B;  2YF0 A;  4EMO A;  3HW2 B;  2COD A;  4KVG B;  1P3R A;  2UZS A;  1U2B A;  3SUZ A;  2EMS A;  2GS0 A;  1WVH A;  5FI1 A;  3F0W A;  1H10 A;  4Y94 A;  2D4Q A;  4BBK A;  1TXD A;  4Z2M B;  3VOQ A;  1V5U A;  1MAI A;  1U5D A;  2I1J A;  3U7D A;  3U8Z A;  5CLQ B;  1ZC3 B;  1OY2 A;  4K2O A;  4CHJ A;  3DXE A;  2ROV A;  1WG7 A;  1EVH A;  1FHW A;  2N0Y A;  2AL6 A;  2DHI A;  3P6A A;  2HE7 A;  4PNK A;  1X05 A;  2RVB B;  2DYN A;  2KUP A;  3GYP A;  2CY4 A;  4IFS A;  1MIZ B;  4GPT B;  2FJL A;  2OQB A;  1Y19 B;  2IYB A;  1NTY A;  1MKE A;  2H7D A;  1V5P A;  3DXC A;  2DKQ A;  2Q13 A;  1DRO A;  4CYE A;  1WJM A;  4GMV A;  2DLW A;  2YS5 A;  3NSU A;  4P7I A;  1XD4 A;  4NY0 A;  4MT7 A;  4WJ7 A;  1W1H A;  3FSS A;  3DXD A;  1DYN A;  1BAK A;  1BTN A;  4Z2N A;  2W2W A;  5DIF B;  2VRW B;  4YL8 A;  2DX5 A;  2KCJ A;  4DX9 0;  5JLJ B;  3UZT A;  4A5K A;  5D3Y A;  4MK0 A;  1TQZ A;  1Z87 A;  1U29 A;  2YT1 A;  2RLO A;  3PP2 A;  4F7H A;  3VIA A;  3TCA A;  2ADZ A;  5J3Q A;  2MFQ A;  1UNP A;  2YRY A;  3D8D A;  4F7U P;  1GC7 A;  2D9Y A;  3KRX A;  1WI1 A;  1SGH A;  2NZ8 B;  2MWN B;  2Y8F A;  5D3V A;  2LKO A;  4EKU A;  2XQN M;  2EC1 A;  5CLL B;  1ZSQ A;  3KRW A;  2J0J A;  1M7E A;  1UPQ A;  3IVF A;  1XX0 A;  3PVU A;  2N23 A;  3P7Z A;  1DDV A;  4ZRK A;  1FAO A;  3AJ4 A;  1WJ1 A;  3WYF B;  2LUL A;  3CIK A;  5FI0 A;  4DXA B;  5JHG A;  2AEH A;  1FOE A;  2K2J A;  2P0D A;  2D2Q A;  2IFS A;  3PZD A;  1LB1 A;  2G35 A;  1KZG A;  4HB2 B;  2YS3 A;  2CAY A;  3GYO A;  3MPX A;  1AWE A;  1GG3 A;  5DHF B;  2K00 A;  4EJN A;  3QBV B;  5LOP B;  1ZC4 B;  2DHK A;  2J59 M;  3M1I B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...