1I2HA

Crystal structure analysis of psd-zip45(homer1c/vesl-1l)conserved homer 1 domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
145
structure length
138
Chain Sequence
EFMGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINSTITPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSKMELTSTPSGDLQSPLTPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Homer 1 Family Conserved Region Reveals the Interaction Between the EVH1 Domain and Own Proline-rich Motif
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
molecule keywords PSD-ZIP45(HOMER-1C/VESL-1L)
total genus 25
structure length 138
sequence length 145
ec nomenclature
pdb deposition date 2001-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1i2hA00
2LOXA 3PP2A 2DHJA 1WGUA 2YS5A 2J59M 2QKLA 2YVCA 1MK7B 2Y8GA 1EGXA 5CLQB 5DH9B 2DA0A 3GYPA 2COFA 4EMOA 1XR0B 2Y8FA 1XODA 2Z0OA 3FM8C 3P7ZA 3PVUA 5DIFB 4MT7A 4B6HA 2LKOA 5KQ1A 3HQCA 5DHFB 4GXBA 4F7GA 5D3WA 2L2IA 1P6SA 4MK0A 1X05A 2DX1A 1XX0A 1AWEA 1EAZA 2CY5A 4DX8A 2CRFA 2AEHA 2GS0A 3PSCA 3G9WA 1BTKA 5DI9B 1H4RA 4A6FA 3FEHA 2EJ8A 4PNKA 4F7UP 1U5DA 2COCA 2X18A 4KHBB 2JP2A 2XQNM 2RSGA 1DYNA 3UZTA 2D2QA 3N7CA 1FHXA 2I5CA 2W2WA 3CIKA 5J3QA 4ZRKA 1LW3A 2AL6A 4C0AA 5GOWB 4HAXB 4BBKA 1FAOA 1MKEA 1TXDA 2D9WA 5EFXA 4NY0A 1ZC4B 2K2UA 2D10A 3TO1A 2VRWB 3SYXA 1B55A 2KCJA 2UVMA 2IYBA 2ELAA 2V76A 4GMXB 1DDMA 3D8DA 1U5FA 2MFQA 3ODXA 5HE2A 3SV1A 2ELBA 2HTHB 1BAKA 2NZ8B 2D9XA 3F0WA 1MIXA 2GCLA 2MWNB 1FOEA 3AU4A 3DXCA 3A8QA 3O96A 5HE1A 1P3RA 1SGHA 5D3XA 3WA0A 1IRSA 4WSFA 2Z0QA 2DFKA 2YSZA 3AU5A 1ZC3B 2DYNA 2P0DA 2YF0A 3ULBA 1WJMA 1ZSQA 3NSUA 5C79A 2N0YA 4GMVA 4HAVB 3OANA 4EKUA 2YS1A 1NTVA 4IFSA 2H7DA 2LYDA 5HE3A 5C5BA 1EVHA 1UPQA 1MAIA 1X11A 3KRWA 1AQCA 3QBVB 3ULCA 4MY6A 1ISNA 2HE7A 2UZSA 1V89A 2P0HA 5LONB 1V88A 5JP4A 3DXDA 4GPTB 2VSZA 5KCVA 1X86A 3TVVA 4HB4B 4HHVA 2RGNB 3ODWA 1FHOA 4HB2B 3IVFA 1UEFA 4EJNA 3A98B 2RNRB 1NTYA 3BINA 1U2BA 2M14A 1K5GB 2YS3A 4Y94A 5LOPB 4KHAA 2RLOA 4K2PA 2DHKA 1DDVA 2NMBA 4A6FB 2CAYA 2R0DA 3A8PA 1U5GA 2K2JA 2VKIA 4KHOA 4Z2NA 3CXBB 1UNQA 1Z87A 1FHWA 2RVBB 4CHJA 4TYZA 3VIAA 5HE0A 3KY9A 4TKNA 2CY4A 4K81A 5C5BB 2DHIA 2D4QA 2KUPA 2J0MA 2GJYA 2I1KA 5J3YA 5KQ4A 3MDBC 3PG7A 1FGYA 3RCPA 1WJ1A 5D3YA 4L6EA 2COAA 2D11A 4HAUB 1GC7A 1ZVRA 1U5EA 2KGXB 2LG1A 2D9VA 2EMTA 2MDXA 4YL8A 4KVGB 2YT0A 2Q13A 1OY2A 2J0JA 3BJIA 1BTNA 3ML4A 1V5PA 3KSYA 3ZDTA 4CHMA 4XWXA 4D0NB 3T06A 2DLWA 3TFMA 1TJ6A 2DN6A 1H10A 5C6RA 4DBBA 3ZVRA 3LJUX 1W1HA 1ZM0A 4ZRIA 3GYOA 4HAYB 3SUZA 3U7DA 4GN1A 2P0FA 2OTXA 1Q67A 5FI1A 3AJ4A 1GC6A 2W2XD 1RJ2A 4Z2MB 1X1GA 2DX5A 1Y5OA 1BWNA 3PZDA 4WJ7A 2Z0PA 4IOYX 3HW2B 4PQ0A 3VOQA 5D3VA 1LB1A 2ZPYA 1FB8A 1OMWA 2BCJA 1V61A 1OQNA 2PZ1A 1XKEA 3KRXA 2N23A 2E2XA 2Y7BA 2P8VA 3PVLA 3SO6A 5L81A 1V5UA 1I7AA 1J19A 3F5RA 1KZGA 1Y19B 5DHAB 4K17A 4DXAB 1K5DB 4HB0B 5D27A 1MK9B 2J0KA 2R09A 3TW1A 1M7EA 2YRYA 1EF1A 3MPXA 3KZ1A 4HAZB 2ADZA 1XD4A 1DBHA 2MKRA 2M38A 2L1CA 2UZRA 1UNPA 3QWMA 4HAWB 1WG7A 4ZRJA 2EMSA 2DTCA 3TCAA 2DKQA 1I2HA 2CODA 1DROA 1NI2A 2I5FA 4WVFB 1UNRA 4YONA 3M1IB 2D9ZA 4HDOA 1WVHA 3WYFB 2EC1A 1XCGA 4HB3B 4NSWA 5JLJB 1MIZB 4HDQA 1M7RA 5C16A 1N3HA 1PLSA 4IAPA 2LOZA 4A6HA 1P5TA 1DDWA 1E5WA 2ROZB 2GCJA 3FSSA 4K2OA 1SHCA 4DX90 3D8EA 2D9YA 1X1FA 2RUKB 2K00A 3QIJA 2I1JA 3DXEA 1J0WA 1KZ7A 1PFJA 3SNHA 3P6AA 1QQGA 1PMSA 1WGQA 5J3TA 4HATB 1GG3A 2DYQA 3U8ZA 3PEGA 3PVWA 3V5WA 2QKMA 5JHGA 2YT1A 1MPHA 2OQBA 2LULA 4A5KA 4GZUA 2FJLA 1W1DA 4H8SA 4KAXB 2ROVA 3ODOA 2H7EA 1KI1B 3HK0A 1QC6A 1U29A 1FGZA 2DKPA 1NU2A 4F7HA 1U27A 1W1GA 1RRPB 4CYEA 4A6KA 1WI1A 2G35A 5CLLB 5JHHA 5FI0A 4P7IA 1UPRA 3X23A 2IFSA 1TQZA 1V5MA 2W2XC 3D8FA
chains in the Genus database with same CATH superfamily
2LOXA 3DCXA 3PP2A 2DHJA 1WGUA 3A58A 2YS5A 2J59M 2QKLA 2YVCA 5M4YB 1MK7B 2Y8GA 1EGXA 5CLQB 5DH9B 2DA0A 3GYPA 2COFA 4EMOA 1XR0B 2Y8FA 1XODA 2Z0OA 3FM8C 3P7ZA 3PVUA 5DIFB 4MT7A 4B6HA 2LKOA 5KQ1A 3HQCA 5DHFB 4GXBA 4F7GA 5D3WA 2L2IA 5IRSA 1P6SA 4MK0A 1X05A 2DX1A 1XX0A 4QJ3B 1AWEA 1EAZA 2CY5A 4DX8A 2CRFA 2AEHA 2GS0A 3PSCA 3G9WA 4HSIA 1BTKA 5DI9B 1H4RA 4A6FA 3FEHA 2EJ8A 4PNKA 4F7UP 1U5DA 2COCA 2X18A 4KHBB 2JP2A 2XQNM 2RSGA 1DYNA 3UZTA 2D2QA 3N7CA 1FHXA 2I5CA 2W2WA 3CIKA 3NWAA 5J3QA 4ZRKA 1LW3A 2AL6A 4C0AA 5GOWB 4HAXB 4BBKA 1FAOA 1MKEA 1TXDA 2D9WA 5EFXA 4NY0A 1ZC4B 2K2UA 2D10A 3TO1A 4QXAB 2Z14A 2VRWB 3SYXA 1B55A 2KCJA 2UVMA 2IYBA 3NWFA 2ELAA 2V76A 4GMXB 1DDMA 3D8DA 1U5FA 2MFQA 3ODXA 5HE2A 3SV1A 4CSQA 2ELBA 2HTHB 5I2MA 1BAKA 2NZ8B 2Z13A 2D9XA 3F0WA 1MIXA 2GCLA 2MWNB 1FOEA 3AU4A 3DXCA 3A8QA 3O96A 5HE1A 4QJ4B 1P3RA 1SGHA 5D3XA 3WA0A 1IRSA 4WSFA 2Z0QA 2RRFA 2DFKA 2YSZA 3AU5A 1ZC3B 3OHMB 2DYNA 2P0DA 2YF0A 3ULBA 1WJMA 1ZSQA 3NSUA 5C79A 5LG4B 2N0YA 4GMVA 4HAVB 3OANA 4EKUA 2YS1A 1NTVA 3FVCA 4IFSA 2H7DA 2LYDA 5HE3A 5C5BA 1EVHA 1MAIA 1UPQA 1X11A 3KRWA 1AQCA 3QBVB 3ULCA 4MY6A 1ISNA 2HE7A 2UZSA 1V89A 2P0HA 5LONB 1V88A 5JP4A 4GOUA 3DXDA 4GPTB 2VSZA 5KCVA 1X86A 4KHBA 3TVVA 4HB4B 4HHVA 2RGNB 3ODWA 1FHOA 4HB2B 3IVFA 1UEFA 4EJNA 3A98B 2RNRB 1NTYA 3BINA 1U2BA 2M14A 1K5GB 2YS3A 3NWDA 4Y94A 5LOPB 2FJUB 4KHAA 2RLOA 2KUQA 4K2PA 2Z4DA 2DHKA 1DDVA 2NMBA 4A6FB 2CAYA 2R0DA 2ZKMX 3A8PA 1U5GA 2K2JA 2VKIA 4KHOA 4Z2NA 3CXBB 1UNQA 1Z87A 1FHWA 2RVBB 4CHJA 4TYZA 3VIAA 5HE0A 3KY9A 4TKNA 2CY4A 4K81A 5C5BB 2DHIA 2D4QA 2KUPA 2J0MA 2GJYA 2I1KA 5J3YA 5KQ4A 3MDBC 3PG7A 1FGYA 3RCPA 1WJ1A 5D3YA 2GUMA 4L6EA 2COAA 2D11A 1GC7A 1ZVRA 4HAUB 1U5EA 2KGXB 2LG1A 2D9VA 2EMTA 2MDXA 4YL8A 4KVGB 2YT0A 2Q13A 1OY2A 2J0JA 3BJIA 1BTNA 3ML4A 1V5PA 3KSYA 3ZDTA 4CHMA 4XWXA 4D0NB 3T06A 2DLWA 3TFMA 1TJ6A 2DN6A 1H10A 5C6RA 4DBBA 3ZVRA 3LJUX 1W1HA 1ZM0A 4L1RA 4ZRIA 3GYOA 2NBVA 4HAYB 3SUZA 3U7DA 2K8EA 4GN1A 2P0FA 2OTXA 1Q67A 5FI1A 4D6WA 3B77A 3AJ4A 3HIEA 1GC6A 2K49A 2W2XD 1RJ2A 4Z2MB 1X1GA 2DX5A 1Y5OA 1BWNA 3PZDA 4WJ7A 2Z0PA 4IOYX 3HW2B 4PQ0A 3VOQA 5D3VA 1LB1A 2ZPYA 1FB8A 1OMWA 2BCJA 2KIGA 1V61A 1OQNA 2PZ1A 1XKEA 3KRXA 2N23A 2E2XA 2Y7BA 2P8VA 3PVLA 3SO6A 4GNKB 5L81A 1V5UA 4DIXA 1I7AA 1J19A 3F5RA 1KZGA 1Y19B 5DHAB 4K17A 4DXAB 1K5DB 4HB0B 5D27A 1MK9B 2J0KA 2KIEA 2R09A 1MI1A 3TW1A 1M7EA 2YRYA 1EF1A 3MPXA 3KZ1A 4HAZB 2ADZA 1XD4A 1DBHA 2MKRA 2M38A 1T77A 2L1CA 2UZRA 1UNPA 3QWMA 4QJ5B 4HAWB 1WG7A 4ZRJA 2EMSA 2DTCA 3TCAA 2DKQA 1I2HA 2CODA 1DROA 1NI2A 2I5FA 4WVFB 1UNRA 4YONA 3M1IB 3NW8A 2YT2A 2D9ZA 4HDOA 1WVHA 4OSNA 3WYFB 2EC1A 2KR0A 1XCGA 4HB3B 4NSWA 5JLJB 1MIZB 4HDQA 1M7RA 5C16A 1N3HA 1PLSA 4IAPA 2LOZA 4A6HA 1P5TA 1DDWA 1E5WA 2R2YA 2ROZB 2GCJA 3FSSA 4K2OA 1SHCA 4DX90 3D8EA 2D9YA 1X1FA 2RUKB 2K00A 3QIJA 2I1JA 3DXEA 1J0WA 1KZ7A 1PFJA 3SNHA 1ZYIA 3P6AA 1QQGA 1PMSA 1WGQA 5J3TA 4HATB 1GG3A 2DYQA 3U8ZA 3PEGA 3PVWA 3V5WA 2QKMA 2Z59A 5JHGA 2YT1A 1MPHA 2OQBA 2LULA 4OT1A 4A5KA 4GZUA 2FJLA 1W1DA 4H8SA 4KAXB 2ROVA 3ODOA 2H7EA 1KI1B 3HK0A 1QC6A 1U29A 1FGZA 2DKPA 1NU2A 4F7HA 1U27A 1W1GA 1RRPB 4CYEA 4A6KA 1WI1A 2G35A 5CLLB 5JHHA 5FI0A 3U12A 3HSAA 5I2SA 4P7IA 1UPRA 3X23A 2IFSA 1TQZA 1V5MA 2W2XC 3D8FA
chains in the Genus database with same CATH topology
2LOXA 3PP2A 2DHJA 1WGUA 2YS5A 2J59M 2QKLA 2YVCA 1MK7B 2Y8GA 1EGXA 5CLQB 5DH9B 2DA0A 3GYPA 2COFA 4EMOA 1XR0B 2Y8FA 1XODA 2Z0OA 3FM8C 3P7ZA 3PVUA 5DIFB 4MT7A 4B6HA 2LKOA 5KQ1A 3HQCA 5DHFB 4GXBA 4F7GA 5D3WA 2L2IA 1P6SA 4MK0A 1X05A 2DX1A 1XX0A 1AWEA 1EAZA 2CY5A 4DX8A 2CRFA 2AEHA 2GS0A 3PSCA 3G9WA 1BTKA 5DI9B 1H4RA 4A6FA 3FEHA 2EJ8A 4PNKA 4F7UP 1U5DA 2COCA 2X18A 4KHBB 2JP2A 2XQNM 2RSGA 1DYNA 3UZTA 2D2QA 3N7CA 1FHXA 2I5CA 2W2WA 3CIKA 5J3QA 4ZRKA 1LW3A 2AL6A 4C0AA 5GOWB 4HAXB 4BBKA 1FAOA 1MKEA 1TXDA 2D9WA 5EFXA 4NY0A 1ZC4B 2K2UA 2D10A 3TO1A 2VRWB 3SYXA 1B55A 2KCJA 2UVMA 2IYBA 2ELAA 2V76A 4GMXB 1DDMA 3D8DA 1U5FA 2MFQA 3ODXA 5HE2A 3SV1A 2ELBA 2HTHB 1BAKA 2NZ8B 2D9XA 3F0WA 1MIXA 2GCLA 2MWNB 1FOEA 3AU4A 3DXCA 3A8QA 3O96A 5HE1A 1P3RA 1SGHA 5D3XA 3WA0A 1IRSA 4WSFA 2Z0QA 2DFKA 2YSZA 3AU5A 1ZC3B 2DYNA 2P0DA 2YF0A 3ULBA 1WJMA 1ZSQA 3NSUA 5C79A 2N0YA 4GMVA 4HAVB 3OANA 4EKUA 2YS1A 1NTVA 4IFSA 2H7DA 2LYDA 5HE3A 5C5BA 1EVHA 1UPQA 1MAIA 1X11A 3KRWA 1AQCA 3QBVB 3ULCA 4MY6A 1ISNA 2HE7A 2UZSA 1V89A 2P0HA 5LONB 1V88A 5JP4A 3DXDA 4GPTB 2VSZA 5KCVA 1X86A 3TVVA 4HB4B 4HHVA 2RGNB 3ODWA 1FHOA 4HB2B 3IVFA 1UEFA 4EJNA 3A98B 2RNRB 1NTYA 3BINA 1U2BA 2M14A 1K5GB 2YS3A 4Y94A 5LOPB 4KHAA 2RLOA 4K2PA 2DHKA 1DDVA 2NMBA 4A6FB 2CAYA 2R0DA 3A8PA 1U5GA 2K2JA 2VKIA 4KHOA 4Z2NA 3CXBB 1UNQA 1Z87A 1FHWA 2RVBB 4CHJA 4TYZA 3VIAA 5HE0A 3KY9A 4TKNA 2CY4A 4K81A 5C5BB 2DHIA 2D4QA 2KUPA 2J0MA 2GJYA 2I1KA 5J3YA 5KQ4A 3MDBC 3PG7A 1FGYA 3RCPA 1WJ1A 5D3YA 4L6EA 2COAA 2D11A 4HAUB 1GC7A 1ZVRA 1U5EA 2KGXB 2LG1A 2D9VA 2EMTA 2MDXA 4YL8A 4KVGB 2YT0A 2Q13A 1OY2A 2J0JA 3BJIA 1BTNA 3ML4A 1V5PA 3KSYA 3ZDTA 4CHMA 4XWXA 4D0NB 3T06A 2DLWA 3TFMA 1TJ6A 2DN6A 1H10A 5C6RA 4DBBA 3ZVRA 3LJUX 1W1HA 1ZM0A 4ZRIA 3GYOA 4HAYB 3SUZA 3U7DA 4GN1A 2P0FA 2OTXA 1Q67A 5FI1A 3AJ4A 1GC6A 2W2XD 1RJ2A 4Z2MB 1X1GA 2DX5A 1Y5OA 1BWNA 3PZDA 4WJ7A 2Z0PA 4IOYX 3HW2B 4PQ0A 3VOQA 5D3VA 1LB1A 2ZPYA 1FB8A 1OMWA 2BCJA 1V61A 1OQNA 2PZ1A 1XKEA 3KRXA 2N23A 2E2XA 2Y7BA 2P8VA 3PVLA 3SO6A 5L81A 1V5UA 1I7AA 1J19A 3F5RA 1KZGA 1Y19B 5DHAB 4K17A 4DXAB 1K5DB 4HB0B 5D27A 1MK9B 2J0KA 2R09A 3TW1A 1M7EA 2YRYA 1EF1A 3MPXA 3KZ1A 4HAZB 2ADZA 1XD4A 1DBHA 2MKRA 2M38A 2L1CA 2UZRA 1UNPA 3QWMA 4HAWB 1WG7A 4ZRJA 2EMSA 2DTCA 3TCAA 2DKQA 1I2HA 2CODA 1DROA 1NI2A 2I5FA 4WVFB 1UNRA 4YONA 3M1IB 2D9ZA 4HDOA 1WVHA 3WYFB 2EC1A 1XCGA 4HB3B 4NSWA 5JLJB 1MIZB 4HDQA 1M7RA 5C16A 1N3HA 1PLSA 4IAPA 2LOZA 4A6HA 1P5TA 1DDWA 1E5WA 2ROZB 2GCJA 3FSSA 4K2OA 1SHCA 4DX90 3D8EA 2D9YA 1X1FA 2RUKB 2K00A 3QIJA 2I1JA 3DXEA 1J0WA 1KZ7A 1PFJA 3SNHA 3P6AA 1QQGA 1PMSA 1WGQA 5J3TA 4HATB 1GG3A 2DYQA 3U8ZA 3PEGA 3PVWA 3V5WA 2QKMA 5JHGA 2YT1A 1MPHA 2OQBA 2LULA 4A5KA 4GZUA 2FJLA 1W1DA 4H8SA 4KAXB 2ROVA 3ODOA 2H7EA 1KI1B 3HK0A 1QC6A 1U29A 1FGZA 2DKPA 1NU2A 4F7HA 1U27A 1W1GA 1RRPB 4CYEA 4A6KA 1WI1A 2G35A 5CLLB 5JHHA 5FI0A 4P7IA 1UPRA 3X23A 2IFSA 1TQZA 1V5MA 2W2XC 3D8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LOX A;  3PP2 A;  2DHJ A;  1WGU A;  2YS5 A;  2J59 M;  2QKL A;  2YVC A;  1MK7 B;  2Y8G A;  1EGX A;  5CLQ B;  5DH9 B;  2DA0 A;  3GYP A;  2COF A;  4EMO A;  1XR0 B;  2Y8F A;  1XOD A;  2Z0O A;  3FM8 C;  3P7Z A;  3PVU A;  5DIF B;  4MT7 A;  4B6H A;  2LKO A;  5KQ1 A;  3HQC A;  5DHF B;  4GXB A;  4F7G A;  5D3W A;  2L2I A;  1P6S A;  4MK0 A;  1X05 A;  2DX1 A;  1XX0 A;  1AWE A;  1EAZ A;  2CY5 A;  4DX8 A;  2CRF A;  2AEH A;  2GS0 A;  3PSC A;  3G9W A;  1BTK A;  5DI9 B;  1H4R A;  4A6F A;  3FEH A;  2EJ8 A;  4PNK A;  4F7U P;  1U5D A;  2COC A;  2X18 A;  4KHB B;  2JP2 A;  2XQN M;  2RSG A;  1DYN A;  3UZT A;  2D2Q A;  3N7C A;  1FHX A;  2I5C A;  2W2W A;  3CIK A;  5J3Q A;  4ZRK A;  1LW3 A;  2AL6 A;  4C0A A;  5GOW B;  4HAX B;  4BBK A;  1FAO A;  1MKE A;  1TXD A;  2D9W A;  5EFX A;  4NY0 A;  1ZC4 B;  2K2U A;  2D10 A;  3TO1 A;  2VRW B;  3SYX A;  1B55 A;  2KCJ A;  2UVM A;  2IYB A;  2ELA A;  2V76 A;  4GMX B;  1DDM A;  3D8D A;  1U5F A;  2MFQ A;  3ODX A;  5HE2 A;  3SV1 A;  2ELB A;  2HTH B;  1BAK A;  2NZ8 B;  2D9X A;  3F0W A;  1MIX A;  2GCL A;  2MWN B;  1FOE A;  3AU4 A;  3DXC A;  3A8Q A;  3O96 A;  5HE1 A;  1P3R A;  1SGH A;  5D3X A;  3WA0 A;  1IRS A;  4WSF A;  2Z0Q A;  2DFK A;  2YSZ A;  3AU5 A;  1ZC3 B;  2DYN A;  2P0D A;  2YF0 A;  3ULB A;  1WJM A;  1ZSQ A;  3NSU A;  5C79 A;  2N0Y A;  4GMV A;  4HAV B;  3OAN A;  4EKU A;  2YS1 A;  1NTV A;  4IFS A;  2H7D A;  2LYD A;  5HE3 A;  5C5B A;  1EVH A;  1UPQ A;  1MAI A;  1X11 A;  3KRW A;  1AQC A;  3QBV B;  3ULC A;  4MY6 A;  1ISN A;  2HE7 A;  2UZS A;  1V89 A;  2P0H A;  5LON B;  1V88 A;  5JP4 A;  3DXD A;  4GPT B;  2VSZ A;  5KCV A;  1X86 A;  3TVV A;  4HB4 B;  4HHV A;  2RGN B;  3ODW A;  1FHO A;  4HB2 B;  3IVF A;  1UEF A;  4EJN A;  3A98 B;  2RNR B;  1NTY A;  3BIN A;  1U2B A;  2M14 A;  1K5G B;  2YS3 A;  4Y94 A;  5LOP B;  4KHA A;  2RLO A;  4K2P A;  2DHK A;  1DDV A;  2NMB A;  4A6F B;  2CAY A;  2R0D A;  3A8P A;  1U5G A;  2K2J A;  2VKI A;  4KHO A;  4Z2N A;  3CXB B;  1UNQ A;  1Z87 A;  1FHW A;  2RVB B;  4CHJ A;  4TYZ A;  3VIA A;  5HE0 A;  3KY9 A;  4TKN A;  2CY4 A;  4K81 A;  5C5B B;  2DHI A;  2D4Q A;  2KUP A;  2J0M A;  2GJY A;  2I1K A;  5J3Y A;  5KQ4 A;  3MDB C;  3PG7 A;  1FGY A;  3RCP A;  1WJ1 A;  5D3Y A;  4L6E A;  2COA A;  2D11 A;  4HAU B;  1GC7 A;  1ZVR A;  1U5E A;  2KGX B;  2LG1 A;  2D9V A;  2EMT A;  2MDX A;  4YL8 A;  4KVG B;  2YT0 A;  2Q13 A;  1OY2 A;  2J0J A;  3BJI A;  1BTN A;  3ML4 A;  1V5P A;  3KSY A;  3ZDT A;  4CHM A;  4XWX A;  4D0N B;  3T06 A;  2DLW A;  3TFM A;  1TJ6 A;  2DN6 A;  1H10 A;  5C6R A;  4DBB A;  3ZVR A;  3LJU X;  1W1H A;  1ZM0 A;  4ZRI A;  3GYO A;  4HAY B;  3SUZ A;  3U7D A;  4GN1 A;  2P0F A;  2OTX A;  1Q67 A;  5FI1 A;  3AJ4 A;  1GC6 A;  2W2X D;  1RJ2 A;  4Z2M B;  1X1G A;  2DX5 A;  1Y5O A;  1BWN A;  3PZD A;  4WJ7 A;  2Z0P A;  4IOY X;  3HW2 B;  4PQ0 A;  3VOQ A;  5D3V A;  1LB1 A;  2ZPY A;  1FB8 A;  1OMW A;  2BCJ A;  1V61 A;  1OQN A;  2PZ1 A;  1XKE A;  3KRX A;  2N23 A;  2E2X A;  2Y7B A;  2P8V A;  3PVL A;  3SO6 A;  5L81 A;  1V5U A;  1I7A A;  1J19 A;  3F5R A;  1KZG A;  1Y19 B;  5DHA B;  4K17 A;  4DXA B;  1K5D B;  4HB0 B;  5D27 A;  1MK9 B;  2J0K A;  2R09 A;  3TW1 A;  1M7E A;  2YRY A;  1EF1 A;  3MPX A;  3KZ1 A;  4HAZ B;  2ADZ A;  1XD4 A;  1DBH A;  2MKR A;  2M38 A;  2L1C A;  2UZR A;  1UNP A;  3QWM A;  4HAW B;  1WG7 A;  4ZRJ A;  2EMS A;  2DTC A;  3TCA A;  2DKQ A;  1I2H A;  2COD A;  1DRO A;  1NI2 A;  2I5F A;  4WVF B;  1UNR A;  4YON A;  3M1I B;  2D9Z A;  4HDO A;  1WVH A;  3WYF B;  2EC1 A;  1XCG A;  4HB3 B;  4NSW A;  5JLJ B;  1MIZ B;  4HDQ A;  1M7R A;  5C16 A;  1N3H A;  1PLS A;  4IAP A;  2LOZ A;  4A6H A;  1P5T A;  1DDW A;  1E5W A;  2ROZ B;  2GCJ A;  3FSS A;  4K2O A;  1SHC A;  4DX9 0;  3D8E A;  2D9Y A;  1X1F A;  2RUK B;  2K00 A;  3QIJ A;  2I1J A;  3DXE A;  1J0W A;  1KZ7 A;  1PFJ A;  3SNH A;  3P6A A;  1QQG A;  1PMS A;  1WGQ A;  5J3T A;  4HAT B;  1GG3 A;  2DYQ A;  3U8Z A;  3PEG A;  3PVW A;  3V5W A;  2QKM A;  5JHG A;  2YT1 A;  1MPH A;  2OQB A;  2LUL A;  4A5K A;  4GZU A;  2FJL A;  1W1D A;  4H8S A;  4KAX B;  2ROV A;  3ODO A;  2H7E A;  1KI1 B;  3HK0 A;  1QC6 A;  1U29 A;  1FGZ A;  2DKP A;  1NU2 A;  4F7H A;  1U27 A;  1W1G A;  1RRP B;  4CYE A;  4A6K A;  1WI1 A;  2G35 A;  5CLL B;  5JHH A;  5FI0 A;  4P7I A;  1UPR A;  3X23 A;  2IFS A;  1TQZ A;  1V5M A;  2W2X C;  3D8F A; 
#chains in the Genus database with same CATH topology
 2LOX A;  3DCX A;  3PP2 A;  2DHJ A;  1WGU A;  3A58 A;  2YS5 A;  2J59 M;  2QKL A;  2YVC A;  5M4Y B;  1MK7 B;  2Y8G A;  1EGX A;  5CLQ B;  5DH9 B;  2DA0 A;  3GYP A;  2COF A;  4EMO A;  1XR0 B;  2Y8F A;  1XOD A;  2Z0O A;  3FM8 C;  3P7Z A;  3PVU A;  5DIF B;  4MT7 A;  4B6H A;  2LKO A;  5KQ1 A;  3HQC A;  5DHF B;  4GXB A;  4F7G A;  5D3W A;  2L2I A;  5IRS A;  1P6S A;  4MK0 A;  1X05 A;  2DX1 A;  1XX0 A;  4QJ3 B;  1AWE A;  1EAZ A;  2CY5 A;  4DX8 A;  2CRF A;  2AEH A;  2GS0 A;  3PSC A;  3G9W A;  4HSI A;  1BTK A;  5DI9 B;  1H4R A;  4A6F A;  3FEH A;  2EJ8 A;  4PNK A;  4F7U P;  1U5D A;  2COC A;  2X18 A;  4KHB B;  2JP2 A;  2XQN M;  2RSG A;  1DYN A;  3UZT A;  2D2Q A;  3N7C A;  1FHX A;  2I5C A;  2W2W A;  3CIK A;  3NWA A;  5J3Q A;  4ZRK A;  1LW3 A;  2AL6 A;  4C0A A;  5GOW B;  4HAX B;  4BBK A;  1FAO A;  1MKE A;  1TXD A;  2D9W A;  5EFX A;  4NY0 A;  1ZC4 B;  2K2U A;  2D10 A;  3TO1 A;  4QXA B;  2Z14 A;  2VRW B;  3SYX A;  1B55 A;  2KCJ A;  2UVM A;  2IYB A;  3NWF A;  2ELA A;  2V76 A;  4GMX B;  1DDM A;  3D8D A;  1U5F A;  2MFQ A;  3ODX A;  5HE2 A;  3SV1 A;  4CSQ A;  2ELB A;  2HTH B;  5I2M A;  1BAK A;  2NZ8 B;  2Z13 A;  2D9X A;  3F0W A;  1MIX A;  2GCL A;  2MWN B;  1FOE A;  3AU4 A;  3DXC A;  3A8Q A;  3O96 A;  5HE1 A;  4QJ4 B;  1P3R A;  1SGH A;  5D3X A;  3WA0 A;  1IRS A;  4WSF A;  2Z0Q A;  2RRF A;  2DFK A;  2YSZ A;  3AU5 A;  1ZC3 B;  3OHM B;  2DYN A;  2P0D A;  2YF0 A;  3ULB A;  1WJM A;  1ZSQ A;  3NSU A;  5C79 A;  5LG4 B;  2N0Y A;  4GMV A;  4HAV B;  3OAN A;  4EKU A;  2YS1 A;  1NTV A;  3FVC A;  4IFS A;  2H7D A;  2LYD A;  5HE3 A;  5C5B A;  1EVH A;  1MAI A;  1UPQ A;  1X11 A;  3KRW A;  1AQC A;  3QBV B;  3ULC A;  4MY6 A;  1ISN A;  2HE7 A;  2UZS A;  1V89 A;  2P0H A;  5LON B;  1V88 A;  5JP4 A;  4GOU A;  3DXD A;  4GPT B;  2VSZ A;  5KCV A;  1X86 A;  4KHB A;  3TVV A;  4HB4 B;  4HHV A;  2RGN B;  3ODW A;  1FHO A;  4HB2 B;  3IVF A;  1UEF A;  4EJN A;  3A98 B;  2RNR B;  1NTY A;  3BIN A;  1U2B A;  2M14 A;  1K5G B;  2YS3 A;  3NWD A;  4Y94 A;  5LOP B;  2FJU B;  4KHA A;  2RLO A;  2KUQ A;  4K2P A;  2Z4D A;  2DHK A;  1DDV A;  2NMB A;  4A6F B;  2CAY A;  2R0D A;  2ZKM X;  3A8P A;  1U5G A;  2K2J A;  2VKI A;  4KHO A;  4Z2N A;  3CXB B;  1UNQ A;  1Z87 A;  1FHW A;  2RVB B;  4CHJ A;  4TYZ A;  3VIA A;  5HE0 A;  3KY9 A;  4TKN A;  2CY4 A;  4K81 A;  5C5B B;  2DHI A;  2D4Q A;  2KUP A;  2J0M A;  2GJY A;  2I1K A;  5J3Y A;  5KQ4 A;  3MDB C;  3PG7 A;  1FGY A;  3RCP A;  1WJ1 A;  5D3Y A;  2GUM A;  4L6E A;  2COA A;  2D11 A;  1GC7 A;  1ZVR A;  4HAU B;  1U5E A;  2KGX B;  2LG1 A;  2D9V A;  2EMT A;  2MDX A;  4YL8 A;  4KVG B;  2YT0 A;  2Q13 A;  1OY2 A;  2J0J A;  3BJI A;  1BTN A;  3ML4 A;  1V5P A;  3KSY A;  3ZDT A;  4CHM A;  4XWX A;  4D0N B;  3T06 A;  2DLW A;  3TFM A;  1TJ6 A;  2DN6 A;  1H10 A;  5C6R A;  4DBB A;  3ZVR A;  3LJU X;  1W1H A;  1ZM0 A;  4L1R A;  4ZRI A;  3GYO A;  2NBV A;  4HAY B;  3SUZ A;  3U7D A;  2K8E A;  4GN1 A;  2P0F A;  2OTX A;  1Q67 A;  5FI1 A;  4D6W A;  3B77 A;  3AJ4 A;  3HIE A;  1GC6 A;  2K49 A;  2W2X D;  1RJ2 A;  4Z2M B;  1X1G A;  2DX5 A;  1Y5O A;  1BWN A;  3PZD A;  4WJ7 A;  2Z0P A;  4IOY X;  3HW2 B;  4PQ0 A;  3VOQ A;  5D3V A;  1LB1 A;  2ZPY A;  1FB8 A;  1OMW A;  2BCJ A;  2KIG A;  1V61 A;  1OQN A;  2PZ1 A;  1XKE A;  3KRX A;  2N23 A;  2E2X A;  2Y7B A;  2P8V A;  3PVL A;  3SO6 A;  4GNK B;  5L81 A;  1V5U A;  4DIX A;  1I7A A;  1J19 A;  3F5R A;  1KZG A;  1Y19 B;  5DHA B;  4K17 A;  4DXA B;  1K5D B;  4HB0 B;  5D27 A;  1MK9 B;  2J0K A;  2KIE A;  2R09 A;  1MI1 A;  3TW1 A;  1M7E A;  2YRY A;  1EF1 A;  3MPX A;  3KZ1 A;  4HAZ B;  2ADZ A;  1XD4 A;  1DBH A;  2MKR A;  2M38 A;  1T77 A;  2L1C A;  2UZR A;  1UNP A;  3QWM A;  4QJ5 B;  4HAW B;  1WG7 A;  4ZRJ A;  2EMS A;  2DTC A;  3TCA A;  2DKQ A;  1I2H A;  2COD A;  1DRO A;  1NI2 A;  2I5F A;  4WVF B;  1UNR A;  4YON A;  3M1I B;  3NW8 A;  2YT2 A;  2D9Z A;  4HDO A;  1WVH A;  4OSN A;  3WYF B;  2EC1 A;  2KR0 A;  1XCG A;  4HB3 B;  4NSW A;  5JLJ B;  1MIZ B;  4HDQ A;  1M7R A;  5C16 A;  1N3H A;  1PLS A;  4IAP A;  2LOZ A;  4A6H A;  1P5T A;  1DDW A;  1E5W A;  2R2Y A;  2ROZ B;  2GCJ A;  3FSS A;  4K2O A;  1SHC A;  4DX9 0;  3D8E A;  2D9Y A;  1X1F A;  2RUK B;  2K00 A;  3QIJ A;  2I1J A;  3DXE A;  1J0W A;  1KZ7 A;  1PFJ A;  3SNH A;  1ZYI A;  3P6A A;  1QQG A;  1PMS A;  1WGQ A;  5J3T A;  4HAT B;  1GG3 A;  2DYQ A;  3U8Z A;  3PEG A;  3PVW A;  3V5W A;  2QKM A;  2Z59 A;  5JHG A;  2YT1 A;  1MPH A;  2OQB A;  2LUL A;  4OT1 A;  4A5K A;  4GZU A;  2FJL A;  1W1D A;  4H8S A;  4KAX B;  2ROV A;  3ODO A;  2H7E A;  1KI1 B;  3HK0 A;  1QC6 A;  1U29 A;  1FGZ A;  2DKP A;  1NU2 A;  4F7H A;  1U27 A;  1W1G A;  1RRP B;  4CYE A;  4A6K A;  1WI1 A;  2G35 A;  5CLL B;  5JHH A;  5FI0 A;  3U12 A;  3HSA A;  5I2S A;  4P7I A;  1UPR A;  3X23 A;  2IFS A;  1TQZ A;  1V5M A;  2W2X C;  3D8F A; 
#chains in the Genus database with same CATH homology
 2LOX A;  3PP2 A;  2DHJ A;  1WGU A;  2YS5 A;  2J59 M;  2QKL A;  2YVC A;  1MK7 B;  2Y8G A;  1EGX A;  5CLQ B;  5DH9 B;  2DA0 A;  3GYP A;  2COF A;  4EMO A;  1XR0 B;  2Y8F A;  1XOD A;  2Z0O A;  3FM8 C;  3P7Z A;  3PVU A;  5DIF B;  4MT7 A;  4B6H A;  2LKO A;  5KQ1 A;  3HQC A;  5DHF B;  4GXB A;  4F7G A;  5D3W A;  2L2I A;  1P6S A;  4MK0 A;  1X05 A;  2DX1 A;  1XX0 A;  1AWE A;  1EAZ A;  2CY5 A;  4DX8 A;  2CRF A;  2AEH A;  2GS0 A;  3PSC A;  3G9W A;  1BTK A;  5DI9 B;  1H4R A;  4A6F A;  3FEH A;  2EJ8 A;  4PNK A;  4F7U P;  1U5D A;  2COC A;  2X18 A;  4KHB B;  2JP2 A;  2XQN M;  2RSG A;  1DYN A;  3UZT A;  2D2Q A;  3N7C A;  1FHX A;  2I5C A;  2W2W A;  3CIK A;  5J3Q A;  4ZRK A;  1LW3 A;  2AL6 A;  4C0A A;  5GOW B;  4HAX B;  4BBK A;  1FAO A;  1MKE A;  1TXD A;  2D9W A;  5EFX A;  4NY0 A;  1ZC4 B;  2K2U A;  2D10 A;  3TO1 A;  2VRW B;  3SYX A;  1B55 A;  2KCJ A;  2UVM A;  2IYB A;  2ELA A;  2V76 A;  4GMX B;  1DDM A;  3D8D A;  1U5F A;  2MFQ A;  3ODX A;  5HE2 A;  3SV1 A;  2ELB A;  2HTH B;  1BAK A;  2NZ8 B;  2D9X A;  3F0W A;  1MIX A;  2GCL A;  2MWN B;  1FOE A;  3AU4 A;  3DXC A;  3A8Q A;  3O96 A;  5HE1 A;  1P3R A;  1SGH A;  5D3X A;  3WA0 A;  1IRS A;  4WSF A;  2Z0Q A;  2DFK A;  2YSZ A;  3AU5 A;  1ZC3 B;  2DYN A;  2P0D A;  2YF0 A;  3ULB A;  1WJM A;  1ZSQ A;  3NSU A;  5C79 A;  2N0Y A;  4GMV A;  4HAV B;  3OAN A;  4EKU A;  2YS1 A;  1NTV A;  4IFS A;  2H7D A;  2LYD A;  5HE3 A;  5C5B A;  1EVH A;  1UPQ A;  1MAI A;  1X11 A;  3KRW A;  1AQC A;  3QBV B;  3ULC A;  4MY6 A;  1ISN A;  2HE7 A;  2UZS A;  1V89 A;  2P0H A;  5LON B;  1V88 A;  5JP4 A;  3DXD A;  4GPT B;  2VSZ A;  5KCV A;  1X86 A;  3TVV A;  4HB4 B;  4HHV A;  2RGN B;  3ODW A;  1FHO A;  4HB2 B;  3IVF A;  1UEF A;  4EJN A;  3A98 B;  2RNR B;  1NTY A;  3BIN A;  1U2B A;  2M14 A;  1K5G B;  2YS3 A;  4Y94 A;  5LOP B;  4KHA A;  2RLO A;  4K2P A;  2DHK A;  1DDV A;  2NMB A;  4A6F B;  2CAY A;  2R0D A;  3A8P A;  1U5G A;  2K2J A;  2VKI A;  4KHO A;  4Z2N A;  3CXB B;  1UNQ A;  1Z87 A;  1FHW A;  2RVB B;  4CHJ A;  4TYZ A;  3VIA A;  5HE0 A;  3KY9 A;  4TKN A;  2CY4 A;  4K81 A;  5C5B B;  2DHI A;  2D4Q A;  2KUP A;  2J0M A;  2GJY A;  2I1K A;  5J3Y A;  5KQ4 A;  3MDB C;  3PG7 A;  1FGY A;  3RCP A;  1WJ1 A;  5D3Y A;  4L6E A;  2COA A;  2D11 A;  4HAU B;  1GC7 A;  1ZVR A;  1U5E A;  2KGX B;  2LG1 A;  2D9V A;  2EMT A;  2MDX A;  4YL8 A;  4KVG B;  2YT0 A;  2Q13 A;  1OY2 A;  2J0J A;  3BJI A;  1BTN A;  3ML4 A;  1V5P A;  3KSY A;  3ZDT A;  4CHM A;  4XWX A;  4D0N B;  3T06 A;  2DLW A;  3TFM A;  1TJ6 A;  2DN6 A;  1H10 A;  5C6R A;  4DBB A;  3ZVR A;  3LJU X;  1W1H A;  1ZM0 A;  4ZRI A;  3GYO A;  4HAY B;  3SUZ A;  3U7D A;  4GN1 A;  2P0F A;  2OTX A;  1Q67 A;  5FI1 A;  3AJ4 A;  1GC6 A;  2W2X D;  1RJ2 A;  4Z2M B;  1X1G A;  2DX5 A;  1Y5O A;  1BWN A;  3PZD A;  4WJ7 A;  2Z0P A;  4IOY X;  3HW2 B;  4PQ0 A;  3VOQ A;  5D3V A;  1LB1 A;  2ZPY A;  1FB8 A;  1OMW A;  2BCJ A;  1V61 A;  1OQN A;  2PZ1 A;  1XKE A;  3KRX A;  2N23 A;  2E2X A;  2Y7B A;  2P8V A;  3PVL A;  3SO6 A;  5L81 A;  1V5U A;  1I7A A;  1J19 A;  3F5R A;  1KZG A;  1Y19 B;  5DHA B;  4K17 A;  4DXA B;  1K5D B;  4HB0 B;  5D27 A;  1MK9 B;  2J0K A;  2R09 A;  3TW1 A;  1M7E A;  2YRY A;  1EF1 A;  3MPX A;  3KZ1 A;  4HAZ B;  2ADZ A;  1XD4 A;  1DBH A;  2MKR A;  2M38 A;  2L1C A;  2UZR A;  1UNP A;  3QWM A;  4HAW B;  1WG7 A;  4ZRJ A;  2EMS A;  2DTC A;  3TCA A;  2DKQ A;  1I2H A;  2COD A;  1DRO A;  1NI2 A;  2I5F A;  4WVF B;  1UNR A;  4YON A;  3M1I B;  2D9Z A;  4HDO A;  1WVH A;  3WYF B;  2EC1 A;  1XCG A;  4HB3 B;  4NSW A;  5JLJ B;  1MIZ B;  4HDQ A;  1M7R A;  5C16 A;  1N3H A;  1PLS A;  4IAP A;  2LOZ A;  4A6H A;  1P5T A;  1DDW A;  1E5W A;  2ROZ B;  2GCJ A;  3FSS A;  4K2O A;  1SHC A;  4DX9 0;  3D8E A;  2D9Y A;  1X1F A;  2RUK B;  2K00 A;  3QIJ A;  2I1J A;  3DXE A;  1J0W A;  1KZ7 A;  1PFJ A;  3SNH A;  3P6A A;  1QQG A;  1PMS A;  1WGQ A;  5J3T A;  4HAT B;  1GG3 A;  2DYQ A;  3U8Z A;  3PEG A;  3PVW A;  3V5W A;  2QKM A;  5JHG A;  2YT1 A;  1MPH A;  2OQB A;  2LUL A;  4A5K A;  4GZU A;  2FJL A;  1W1D A;  4H8S A;  4KAX B;  2ROV A;  3ODO A;  2H7E A;  1KI1 B;  3HK0 A;  1QC6 A;  1U29 A;  1FGZ A;  2DKP A;  1NU2 A;  4F7H A;  1U27 A;  1W1G A;  1RRP B;  4CYE A;  4A6K A;  1WI1 A;  2G35 A;  5CLL B;  5JHH A;  5FI0 A;  4P7I A;  1UPR A;  3X23 A;  2IFS A;  1TQZ A;  1V5M A;  2W2X C;  3D8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...