1I2HA

Crystal structure analysis of psd-zip45(homer1c/vesl-1l)conserved homer 1 domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
145
structure length
138
Chain Sequence
EFMGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINSTITPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSKMELTSTPSGDLQSPLTPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PSD-ZIP45(HOMER-1C/VESL-1L)
publication title Crystal Structure of the Homer 1 Family Conserved Region Reveals the Interaction Between the EVH1 Domain and Own Proline-rich Motif
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 25
structure length 138
sequence length 145
ec nomenclature
pdb deposition date 2001-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1i2hA00
1QQGA 3CIKA 1P6SA 1V61A 1TJ6A 2GJYA 1QC6A 2MDXA 2GCJA 4Y94A 1UPRA 3HW2B 3D8FA 3F5RA 2ROZB 2DHIA 3KRWA 5FI1A 4CYEA 4IFSA 4A5KA 5JLJB 4CHJA 1OY2A 1TXDA 1TQZA 3M1IB 2DA0A 3LJUX 2YRYA 1V89A 2M38A 2LG1A 2UVMA 3TFMA 2COCA 2HE7A 2RVBB 3IVFA 2DHKA 3NSUA 2DYNA 1U29A 3DXDA 3DXEA 3ODWA 3SUZA 4HAUB 1N3HA 1DDWA 2Z0PA 1XX0A 3V5WA 5KQ1A 3MDBC 3A98B 1M7RA 2V76A 4HAWB 2VSZA 1LB1A 2L2IA 4DBBA 3KRXA 4HB2B 1M7EA 4HAYB 3SO6A 4HHVA 1B55A 3FM8C 5J3TA 1AQCA 2NZ8B 5HE3A 3SV1A 1XKEA 2DHJA 2RNRB 2OQBA 1UEFA 2Y8FA 5CLQB 1K5DB 4TKNA 3A8QA 4GPTB 4KHBB 3TW1A 1GC7A 2R09A 5JHGA 2J0KA 4GXBA 2K00A 2J59M 3VIAA 1UNRA 1GG3A 2EMSA 4DX8A 1EGXA 1MIZB 5D3WA 4K17A 3D8DA 2EJ8A 5DHAB 2CRFA 5HE2A 1FHWA 4PQ0A 5D3VA 2DN6A 1Y5OA 1WGUA 2FJLA 2N0YA 2W2WA 4IOYX 5JHHA 2LOXA 1SGHA 2DFKA 1ISNA 1KZ7A 1J0WA 1J19A 1EVHA 5CLLB 2LKOA 3T06A 2RLOA 1MAIA 3KZ1A 4A6KA 3BJIA 1XCGA 2IYBA 4MK0A 3MPXA 3PVWA 3WA0A 3QWMA 1DYNA 1WI1A 3U8ZA 1NTVA 3VOQA 1BTNA 3SNHA 1RRPB 2YSZA 5HE0A 4EMOA 2G35A 1NI2A 2CY4A 2D2QA 1Y19B 3PG7A 5C16A 1EAZA 4ZRKA 1DDMA 2ELAA 3PEGA 2VKIA 1W1HA 4HAXB 2DX1A 3PP2A 2MWNB 4XWXA 1KI1B 2UZRA 3TCAA 3PVUA 3RCPA 3ULBA 4EJNA 2MKRA 2I1KA 5L81A 2D9XA 2D4QA 1FHOA 3A8PA 5C6RA 2M14A 1WG7A 3PSCA 2L1CA 4F7HA 5D3XA 4K2OA 1X1GA 2E2XA 2K2UA 1GC6A 3ODXA 2CODA 2JP2A 5DI9B 3ULCA 4NY0A 2ZPYA 3OANA 2COFA 1X1FA 3O96A 2DYQA 3U7DA 3ODOA 3QBVB 1X86A 2GCLA 2YT1A 3WYFB 2KUPA 3QIJA 3TO1A 1H4RA 2PZ1A 4D0NB 1DDVA 5J3QA 5KQ4A 5HE1A 2P0DA 3D8EA 3FEHA 1PMSA 1V88A 3DXCA 1PFJA 4C0AA 3PVLA 2OTXA 5DH9B 2DTCA 3UZTA 3PZDA 1IRSA 5C5BA 2R0DA 4GMXB 5DHFB 1X11A 2VRWB 2Y7BA 1LW3A 4MY6A 4DX90 4ZRIA 2I1JA 5DIFB 2EC1A 1FAOA 1OMWA 1I7AA 2LOZA 2KCJA 4A6HA 1WVHA 3N7CA 5GOWB 4MT7A 4DXAB 2AL6A 2P0FA 1U5FA 2I5CA 4K2PA 1K5GB 4TYZA 2RGNB 2N23A 2Y8GA 3HK0A 1MIXA 2J0MA 5D3YA 1E5WA 1WJ1A 2D9VA 3KSYA 1MPHA 4A6FA 2I5FA 2W2XD 1MK7B 2CAYA 1BWNA 2BCJA 3ZDTA 4KVGB 4B6HA 1FGZA 4H8SA 1NTYA 2QKLA 2K2JA 2LYDA 4PNKA 3GYOA 1BAKA 2DLWA 2YT0A 1ZM0A 2EMTA 1DBHA 5LOPB 3HQCA 5C5BB 3ML4A 4HDOA 1FOEA 4KAXB 4CHMA 2LULA 1UNPA 3BINA 4GZUA 1MKEA 2H7DA 4HATB 2YS5A 1Z87A 5J3YA 1ZSQA 4F7GA 4K81A 2COAA 4YONA 4NSWA 2AEHA 3P6AA 1AWEA 2D11A 4HB4B 4KHOA 1BTKA 3SYXA 1UNQA 1V5PA 1W1GA 4Z2MB 2KGXB 2MFQA 4WJ7A 1H10A 2ADZA 1KZGA 1XD4A 4HB3B 2RSGA 3KY9A 4L6EA 1SHCA 4EKUA 1RJ2A 4A6FB 2DKPA 1X05A 5EFXA 1WGQA 4HDQA 4GN1A 4IAPA 1MK9B 5LONB 2YS3A 4YL8A 1P3RA 2D9YA 2UZSA 3X23A 2YS1A 2H7EA 3AU5A 4F7UP 4HAZB 4WVFB 2DX5A 1DROA 3G9WA 2D9WA 2D10A 4GMVA 1V5MA 2NMBA 3AU4A 1FGYA 3FSSA 1Q67A 2W2XC 1EF1A 1V5UA 2DKQA 4P7IA 1UPQA 4WSFA 1ZC3B 2RUKB 1U5GA 2YVCA 5C79A 3ZVRA 1WJMA 5D27A 3P7ZA 1W1DA 1XR0B 2P8VA 2QKMA 4KHAA 3F0WA 3TVVA 1U2BA 2Z0OA 3GYPA 4BBKA 2GS0A 1I2HA 1FHXA 4ZRJA 1NU2A 2CY5A 5FI0A 1XODA 4Z2NA 4HB0B 1FB8A 1PLSA 5JP4A 1U27A 2YF0A 1U5EA 2ROVA 4HAVB 2J0JA 2P0HA 1ZC4B 2D9ZA 1OQNA 1U5DA 2Q13A 2IFSA 2ELBA 3CXBB 1P5TA 2X18A 2HTHB 3AJ4A 2Z0QA 1ZVRA 5KCVA 2XQNM
chains in the Genus database with same CATH superfamily
1QQGA 3CIKA 4HSIA 1P6SA 1V61A 1TJ6A 2GJYA 1QC6A 2MDXA 2GCJA 4Y94A 1UPRA 3HW2B 3D8FA 3F5RA 2ROZB 2DHIA 3KRWA 5FI1A 4CYEA 4IFSA 4A5KA 5JLJB 4CHJA 1OY2A 1TXDA 1TQZA 3M1IB 2DA0A 5M4YB 3LJUX 3FVCA 2YRYA 1V89A 3B77A 2M38A 2LG1A 2UVMA 3TFMA 2COCA 2HE7A 2RVBB 3IVFA 2RRFA 2DHKA 3NSUA 2ZKMX 2DYNA 1U29A 3DXDA 3DXEA 3ODWA 3SUZA 4DIXA 4HAUB 1N3HA 1DDWA 2Z0PA 1XX0A 3V5WA 5KQ1A 3MDBC 3A98B 1M7RA 2V76A 4HAWB 4L1RA 2VSZA 1LB1A 2L2IA 4DBBA 3KRXA 4HB2B 1M7EA 4HAYB 3SO6A 4HHVA 1B55A 3FM8C 5J3TA 1AQCA 2NZ8B 5HE3A 3SV1A 1XKEA 2DHJA 2RNRB 2OQBA 1UEFA 2Y8FA 1T77A 5CLQB 1K5DB 4TKNA 3A8QA 4GPTB 4KHBB 3TW1A 1GC7A 5IRSA 4QJ4B 2R09A 5JHGA 2J0KA 4GXBA 2K00A 2J59M 3VIAA 1UNRA 1GG3A 2EMSA 4DX8A 1EGXA 1MIZB 5D3WA 4K17A 3D8DA 2EJ8A 5DHAB 2CRFA 5HE2A 1FHWA 4PQ0A 5D3VA 2DN6A 1Y5OA 1WGUA 2FJLA 2N0YA 2W2WA 4IOYX 5JHHA 2FJUB 2LOXA 1SGHA 2DFKA 1ISNA 1KZ7A 1J0WA 2R2YA 1J19A 1EVHA 1ZYIA 5CLLB 2LKOA 3T06A 2RLOA 1MAIA 3KZ1A 4A6KA 3BJIA 1XCGA 2IYBA 4MK0A 3MPXA 3PVWA 3NWDA 3WA0A 2YT2A 3A58A 3QWMA 1DYNA 1WI1A 3U8ZA 1NTVA 4CSQA 3VOQA 1BTNA 3SNHA 1RRPB 2YSZA 5HE0A 4EMOA 2G35A 1NI2A 2CY4A 2D2QA 4QXAB 1Y19B 3PG7A 5C16A 1EAZA 4ZRKA 1DDMA 2ELAA 3PEGA 2VKIA 1W1HA 4HAXB 2DX1A 3PP2A 2MWNB 4XWXA 1KI1B 2UZRA 3TCAA 3PVUA 3RCPA 4QJ3B 3ULBA 4EJNA 2MKRA 2I1KA 5L81A 2D9XA 2D4QA 1FHOA 3A8PA 5C6RA 2M14A 1WG7A 3PSCA 2L1CA 4F7HA 5D3XA 4K2OA 1X1GA 2E2XA 2K2UA 1GC6A 3ODXA 2CODA 2JP2A 5DI9B 3ULCA 4NY0A 2ZPYA 3OANA 2COFA 1X1FA 3O96A 2DYQA 3U7DA 3ODOA 3QBVB 1X86A 2GCLA 2YT1A 3WYFB 2KUPA 3QIJA 3TO1A 1H4RA 2PZ1A 4D0NB 1DDVA 5J3QA 5KQ4A 5HE1A 2P0DA 3D8EA 3FEHA 1PMSA 1V88A 2KIEA 3DXCA 1PFJA 4C0AA 3PVLA 2OTXA 5DH9B 2DTCA 3UZTA 4QJ5B 3PZDA 1IRSA 2GUMA 4D6WA 5C5BA 2R0DA 4GMXB 5DHFB 1X11A 2VRWB 2Y7BA 1LW3A 4MY6A 4DX90 4ZRIA 2I1JA 5DIFB 2EC1A 1FAOA 3DCXA 1OMWA 1I7AA 2LOZA 2KCJA 4A6HA 1WVHA 3N7CA 5GOWB 4MT7A 3OHMB 4DXAB 4OSNA 2AL6A 2P0FA 1U5FA 2I5CA 4K2PA 1K5GB 4TYZA 2RGNB 2KUQA 2N23A 2Y8GA 3HK0A 1MIXA 2J0MA 5D3YA 1E5WA 1WJ1A 2D9VA 3KSYA 1MPHA 4A6FA 2I5FA 2W2XD 1MK7B 2CAYA 1BWNA 1MI1A 2BCJA 3ZDTA 4KVGB 4B6HA 1FGZA 3HIEA 4H8SA 1NTYA 2QKLA 2K2JA 2LYDA 4PNKA 3GYOA 1BAKA 2K8EA 2DLWA 2YT0A 1ZM0A 2EMTA 1DBHA 5LOPB 3HQCA 5C5BB 3ML4A 4HDOA 1FOEA 4KAXB 4CHMA 2LULA 1UNPA 3BINA 4GZUA 4OT1A 1MKEA 2H7DA 2Z4DA 4HATB 2YS5A 1Z87A 5J3YA 1ZSQA 4F7GA 4K81A 2COAA 4YONA 4NSWA 2AEHA 3P6AA 1AWEA 2D11A 4HB4B 4KHOA 1BTKA 3SYXA 3U12A 5LG4B 1UNQA 1V5PA 2KR0A 1W1GA 4Z2MB 2KGXB 3NWAA 2MFQA 4WJ7A 1H10A 2ADZA 2Z13A 1KZGA 1XD4A 4HB3B 2RSGA 3KY9A 2Z14A 4L6EA 1SHCA 4EKUA 1RJ2A 4A6FB 2DKPA 1X05A 5EFXA 1WGQA 4HDQA 4GN1A 3NWFA 4IAPA 1MK9B 5LONB 5I2MA 2YS3A 4YL8A 1P3RA 2D9YA 2UZSA 3X23A 2YS1A 2H7EA 3AU5A 4F7UP 4HAZB 5I2SA 4WVFB 2DX5A 2K49A 1DROA 3G9WA 3NW8A 2D9WA 2D10A 4GMVA 1V5MA 2NMBA 3AU4A 1FGYA 3FSSA 1Q67A 2W2XC 3HSAA 1EF1A 1V5UA 2DKQA 2NBVA 1UPQA 4P7IA 4WSFA 1ZC3B 2RUKB 1U5GA 2YVCA 5C79A 3ZVRA 1WJMA 5D27A 3P7ZA 1W1DA 1XR0B 2P8VA 2QKMA 2Z59A 4KHAA 3F0WA 3TVVA 1U2BA 2Z0OA 3GYPA 4BBKA 2GS0A 1I2HA 1FHXA 4GOUA 4ZRJA 1NU2A 2CY5A 5FI0A 1XODA 4Z2NA 4HB0B 1FB8A 1PLSA 5JP4A 1U27A 2YF0A 1U5EA 4GNKB 2ROVA 4HAVB 2J0JA 2P0HA 1ZC4B 2D9ZA 1OQNA 1U5DA 2Q13A 2IFSA 2ELBA 3CXBB 3AJ4A 1P5TA 2HTHB 2X18A 2Z0QA 1ZVRA 2KIGA 5KCVA 2XQNM 4KHBA
chains in the Genus database with same CATH topology
1QQGA 3CIKA 1P6SA 1V61A 1TJ6A 2GJYA 1QC6A 2MDXA 2GCJA 4Y94A 1UPRA 3HW2B 3D8FA 3F5RA 2ROZB 2DHIA 3KRWA 5FI1A 4CYEA 4IFSA 4A5KA 5JLJB 4CHJA 1OY2A 1TXDA 1TQZA 3M1IB 2DA0A 3LJUX 2YRYA 1V89A 2M38A 2LG1A 2UVMA 3TFMA 2COCA 2HE7A 2RVBB 3IVFA 2DHKA 3NSUA 2DYNA 1U29A 3DXDA 3DXEA 3ODWA 3SUZA 4HAUB 1N3HA 1DDWA 2Z0PA 1XX0A 3V5WA 5KQ1A 3MDBC 3A98B 1M7RA 2V76A 4HAWB 2VSZA 1LB1A 2L2IA 4DBBA 3KRXA 4HB2B 1M7EA 4HAYB 3SO6A 4HHVA 1B55A 3FM8C 5J3TA 1AQCA 2NZ8B 5HE3A 3SV1A 1XKEA 2DHJA 2RNRB 2OQBA 1UEFA 2Y8FA 5CLQB 1K5DB 4TKNA 3A8QA 4GPTB 4KHBB 3TW1A 1GC7A 2R09A 5JHGA 2J0KA 4GXBA 2K00A 2J59M 3VIAA 1UNRA 1GG3A 2EMSA 4DX8A 1EGXA 1MIZB 5D3WA 4K17A 3D8DA 2EJ8A 5DHAB 2CRFA 5HE2A 1FHWA 4PQ0A 5D3VA 2DN6A 1Y5OA 1WGUA 2FJLA 2N0YA 2W2WA 4IOYX 5JHHA 2LOXA 1SGHA 2DFKA 1ISNA 1KZ7A 1J0WA 1J19A 1EVHA 5CLLB 2LKOA 3T06A 2RLOA 1MAIA 3KZ1A 4A6KA 3BJIA 1XCGA 2IYBA 4MK0A 3MPXA 3PVWA 3WA0A 3QWMA 1DYNA 1WI1A 3U8ZA 1NTVA 3VOQA 1BTNA 3SNHA 1RRPB 2YSZA 5HE0A 4EMOA 2G35A 1NI2A 2CY4A 2D2QA 1Y19B 3PG7A 5C16A 1EAZA 4ZRKA 1DDMA 2ELAA 3PEGA 2VKIA 1W1HA 4HAXB 2DX1A 3PP2A 2MWNB 4XWXA 1KI1B 2UZRA 3TCAA 3PVUA 3RCPA 3ULBA 4EJNA 2MKRA 2I1KA 5L81A 2D9XA 2D4QA 1FHOA 3A8PA 5C6RA 2M14A 1WG7A 3PSCA 2L1CA 4F7HA 5D3XA 4K2OA 1X1GA 2E2XA 2K2UA 1GC6A 3ODXA 2CODA 2JP2A 5DI9B 3ULCA 4NY0A 2ZPYA 3OANA 2COFA 1X1FA 3O96A 2DYQA 3U7DA 3ODOA 3QBVB 1X86A 2GCLA 2YT1A 3WYFB 2KUPA 3QIJA 3TO1A 1H4RA 2PZ1A 4D0NB 1DDVA 5J3QA 5KQ4A 5HE1A 2P0DA 3D8EA 3FEHA 1PMSA 1V88A 3DXCA 1PFJA 4C0AA 3PVLA 2OTXA 5DH9B 2DTCA 3UZTA 3PZDA 1IRSA 5C5BA 2R0DA 4GMXB 5DHFB 1X11A 2VRWB 2Y7BA 1LW3A 4MY6A 4DX90 4ZRIA 2I1JA 5DIFB 2EC1A 1FAOA 1OMWA 1I7AA 2LOZA 2KCJA 4A6HA 1WVHA 3N7CA 5GOWB 4MT7A 4DXAB 2AL6A 2P0FA 1U5FA 2I5CA 4K2PA 1K5GB 4TYZA 2RGNB 2N23A 2Y8GA 3HK0A 1MIXA 2J0MA 5D3YA 1E5WA 1WJ1A 2D9VA 3KSYA 1MPHA 4A6FA 2I5FA 2W2XD 1MK7B 2CAYA 1BWNA 2BCJA 3ZDTA 4KVGB 4B6HA 1FGZA 4H8SA 1NTYA 2QKLA 2K2JA 2LYDA 4PNKA 3GYOA 1BAKA 2DLWA 2YT0A 1ZM0A 2EMTA 1DBHA 5LOPB 3HQCA 5C5BB 3ML4A 4HDOA 1FOEA 4KAXB 4CHMA 2LULA 1UNPA 3BINA 4GZUA 1MKEA 2H7DA 4HATB 2YS5A 1Z87A 5J3YA 1ZSQA 4F7GA 4K81A 2COAA 4YONA 4NSWA 2AEHA 3P6AA 1AWEA 2D11A 4HB4B 4KHOA 1BTKA 3SYXA 1UNQA 1V5PA 1W1GA 4Z2MB 2KGXB 2MFQA 4WJ7A 1H10A 2ADZA 1KZGA 1XD4A 4HB3B 2RSGA 3KY9A 4L6EA 1SHCA 4EKUA 1RJ2A 4A6FB 2DKPA 1X05A 5EFXA 1WGQA 4HDQA 4GN1A 4IAPA 1MK9B 5LONB 2YS3A 4YL8A 1P3RA 2D9YA 2UZSA 3X23A 2YS1A 2H7EA 3AU5A 4F7UP 4HAZB 4WVFB 2DX5A 1DROA 3G9WA 2D9WA 2D10A 4GMVA 1V5MA 2NMBA 3AU4A 1FGYA 3FSSA 1Q67A 2W2XC 1EF1A 1V5UA 2DKQA 4P7IA 1UPQA 4WSFA 1ZC3B 2RUKB 1U5GA 2YVCA 5C79A 3ZVRA 1WJMA 5D27A 3P7ZA 1W1DA 1XR0B 2P8VA 2QKMA 4KHAA 3F0WA 3TVVA 1U2BA 2Z0OA 3GYPA 4BBKA 2GS0A 1I2HA 1FHXA 4ZRJA 1NU2A 2CY5A 5FI0A 1XODA 4Z2NA 4HB0B 1FB8A 1PLSA 5JP4A 1U27A 2YF0A 1U5EA 2ROVA 4HAVB 2J0JA 2P0HA 1ZC4B 2D9ZA 1OQNA 1U5DA 2Q13A 2IFSA 2ELBA 3CXBB 1P5TA 2X18A 2HTHB 3AJ4A 2Z0QA 1ZVRA 5KCVA 2XQNM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QQG A;  3CIK A;  1P6S A;  1V61 A;  1TJ6 A;  2GJY A;  1QC6 A;  2MDX A;  2GCJ A;  4Y94 A;  1UPR A;  3HW2 B;  3D8F A;  3F5R A;  2ROZ B;  2DHI A;  3KRW A;  5FI1 A;  4CYE A;  4IFS A;  4A5K A;  5JLJ B;  4CHJ A;  1OY2 A;  1TXD A;  1TQZ A;  3M1I B;  2DA0 A;  3LJU X;  2YRY A;  1V89 A;  2M38 A;  2LG1 A;  2UVM A;  3TFM A;  2COC A;  2HE7 A;  2RVB B;  3IVF A;  2DHK A;  3NSU A;  2DYN A;  1U29 A;  3DXD A;  3DXE A;  3ODW A;  3SUZ A;  4HAU B;  1N3H A;  1DDW A;  2Z0P A;  1XX0 A;  3V5W A;  5KQ1 A;  3MDB C;  3A98 B;  1M7R A;  2V76 A;  4HAW B;  2VSZ A;  1LB1 A;  2L2I A;  4DBB A;  3KRX A;  4HB2 B;  1M7E A;  4HAY B;  3SO6 A;  4HHV A;  1B55 A;  3FM8 C;  5J3T A;  1AQC A;  2NZ8 B;  5HE3 A;  3SV1 A;  1XKE A;  2DHJ A;  2RNR B;  2OQB A;  1UEF A;  2Y8F A;  5CLQ B;  1K5D B;  4TKN A;  3A8Q A;  4GPT B;  4KHB B;  3TW1 A;  1GC7 A;  2R09 A;  5JHG A;  2J0K A;  4GXB A;  2K00 A;  2J59 M;  3VIA A;  1UNR A;  1GG3 A;  2EMS A;  4DX8 A;  1EGX A;  1MIZ B;  5D3W A;  4K17 A;  3D8D A;  2EJ8 A;  5DHA B;  2CRF A;  5HE2 A;  1FHW A;  4PQ0 A;  5D3V A;  2DN6 A;  1Y5O A;  1WGU A;  2FJL A;  2N0Y A;  2W2W A;  4IOY X;  5JHH A;  2LOX A;  1SGH A;  2DFK A;  1ISN A;  1KZ7 A;  1J0W A;  1J19 A;  1EVH A;  5CLL B;  2LKO A;  3T06 A;  2RLO A;  1MAI A;  3KZ1 A;  4A6K A;  3BJI A;  1XCG A;  2IYB A;  4MK0 A;  3MPX A;  3PVW A;  3WA0 A;  3QWM A;  1DYN A;  1WI1 A;  3U8Z A;  1NTV A;  3VOQ A;  1BTN A;  3SNH A;  1RRP B;  2YSZ A;  5HE0 A;  4EMO A;  2G35 A;  1NI2 A;  2CY4 A;  2D2Q A;  1Y19 B;  3PG7 A;  5C16 A;  1EAZ A;  4ZRK A;  1DDM A;  2ELA A;  3PEG A;  2VKI A;  1W1H A;  4HAX B;  2DX1 A;  3PP2 A;  2MWN B;  4XWX A;  1KI1 B;  2UZR A;  3TCA A;  3PVU A;  3RCP A;  3ULB A;  4EJN A;  2MKR A;  2I1K A;  5L81 A;  2D9X A;  2D4Q A;  1FHO A;  3A8P A;  5C6R A;  2M14 A;  1WG7 A;  3PSC A;  2L1C A;  4F7H A;  5D3X A;  4K2O A;  1X1G A;  2E2X A;  2K2U A;  1GC6 A;  3ODX A;  2COD A;  2JP2 A;  5DI9 B;  3ULC A;  4NY0 A;  2ZPY A;  3OAN A;  2COF A;  1X1F A;  3O96 A;  2DYQ A;  3U7D A;  3ODO A;  3QBV B;  1X86 A;  2GCL A;  2YT1 A;  3WYF B;  2KUP A;  3QIJ A;  3TO1 A;  1H4R A;  2PZ1 A;  4D0N B;  1DDV A;  5J3Q A;  5KQ4 A;  5HE1 A;  2P0D A;  3D8E A;  3FEH A;  1PMS A;  1V88 A;  3DXC A;  1PFJ A;  4C0A A;  3PVL A;  2OTX A;  5DH9 B;  2DTC A;  3UZT A;  3PZD A;  1IRS A;  5C5B A;  2R0D A;  4GMX B;  5DHF B;  1X11 A;  2VRW B;  2Y7B A;  1LW3 A;  4MY6 A;  4DX9 0;  4ZRI A;  2I1J A;  5DIF B;  2EC1 A;  1FAO A;  1OMW A;  1I7A A;  2LOZ A;  2KCJ A;  4A6H A;  1WVH A;  3N7C A;  5GOW B;  4MT7 A;  4DXA B;  2AL6 A;  2P0F A;  1U5F A;  2I5C A;  4K2P A;  1K5G B;  4TYZ A;  2RGN B;  2N23 A;  2Y8G A;  3HK0 A;  1MIX A;  2J0M A;  5D3Y A;  1E5W A;  1WJ1 A;  2D9V A;  3KSY A;  1MPH A;  4A6F A;  2I5F A;  2W2X D;  1MK7 B;  2CAY A;  1BWN A;  2BCJ A;  3ZDT A;  4KVG B;  4B6H A;  1FGZ A;  4H8S A;  1NTY A;  2QKL A;  2K2J A;  2LYD A;  4PNK A;  3GYO A;  1BAK A;  2DLW A;  2YT0 A;  1ZM0 A;  2EMT A;  1DBH A;  5LOP B;  3HQC A;  5C5B B;  3ML4 A;  4HDO A;  1FOE A;  4KAX B;  4CHM A;  2LUL A;  1UNP A;  3BIN A;  4GZU A;  1MKE A;  2H7D A;  4HAT B;  2YS5 A;  1Z87 A;  5J3Y A;  1ZSQ A;  4F7G A;  4K81 A;  2COA A;  4YON A;  4NSW A;  2AEH A;  3P6A A;  1AWE A;  2D11 A;  4HB4 B;  4KHO A;  1BTK A;  3SYX A;  1UNQ A;  1V5P A;  1W1G A;  4Z2M B;  2KGX B;  2MFQ A;  4WJ7 A;  1H10 A;  2ADZ A;  1KZG A;  1XD4 A;  4HB3 B;  2RSG A;  3KY9 A;  4L6E A;  1SHC A;  4EKU A;  1RJ2 A;  4A6F B;  2DKP A;  1X05 A;  5EFX A;  1WGQ A;  4HDQ A;  4GN1 A;  4IAP A;  1MK9 B;  5LON B;  2YS3 A;  4YL8 A;  1P3R A;  2D9Y A;  2UZS A;  3X23 A;  2YS1 A;  2H7E A;  3AU5 A;  4F7U P;  4HAZ B;  4WVF B;  2DX5 A;  1DRO A;  3G9W A;  2D9W A;  2D10 A;  4GMV A;  1V5M A;  2NMB A;  3AU4 A;  1FGY A;  3FSS A;  1Q67 A;  2W2X C;  1EF1 A;  1V5U A;  2DKQ A;  4P7I A;  1UPQ A;  4WSF A;  1ZC3 B;  2RUK B;  1U5G A;  2YVC A;  5C79 A;  3ZVR A;  1WJM A;  5D27 A;  3P7Z A;  1W1D A;  1XR0 B;  2P8V A;  2QKM A;  4KHA A;  3F0W A;  3TVV A;  1U2B A;  2Z0O A;  3GYP A;  4BBK A;  2GS0 A;  1I2H A;  1FHX A;  4ZRJ A;  1NU2 A;  2CY5 A;  5FI0 A;  1XOD A;  4Z2N A;  4HB0 B;  1FB8 A;  1PLS A;  5JP4 A;  1U27 A;  2YF0 A;  1U5E A;  2ROV A;  4HAV B;  2J0J A;  2P0H A;  1ZC4 B;  2D9Z A;  1OQN A;  1U5D A;  2Q13 A;  2IFS A;  2ELB A;  3CXB B;  1P5T A;  2X18 A;  2HTH B;  3AJ4 A;  2Z0Q A;  1ZVR A;  5KCV A;  2XQN M; 
#chains in the Genus database with same CATH topology
 1QQG A;  3CIK A;  4HSI A;  1P6S A;  1V61 A;  1TJ6 A;  2GJY A;  1QC6 A;  2MDX A;  2GCJ A;  4Y94 A;  1UPR A;  3HW2 B;  3D8F A;  3F5R A;  2ROZ B;  2DHI A;  3KRW A;  5FI1 A;  4CYE A;  4IFS A;  4A5K A;  5JLJ B;  4CHJ A;  1OY2 A;  1TXD A;  1TQZ A;  3M1I B;  2DA0 A;  5M4Y B;  3LJU X;  3FVC A;  2YRY A;  1V89 A;  3B77 A;  2M38 A;  2LG1 A;  2UVM A;  3TFM A;  2COC A;  2HE7 A;  2RVB B;  3IVF A;  2RRF A;  2DHK A;  3NSU A;  2ZKM X;  2DYN A;  1U29 A;  3DXD A;  3DXE A;  3ODW A;  3SUZ A;  4DIX A;  4HAU B;  1N3H A;  1DDW A;  2Z0P A;  1XX0 A;  3V5W A;  5KQ1 A;  3MDB C;  3A98 B;  1M7R A;  2V76 A;  4HAW B;  4L1R A;  2VSZ A;  1LB1 A;  2L2I A;  4DBB A;  3KRX A;  4HB2 B;  1M7E A;  4HAY B;  3SO6 A;  4HHV A;  1B55 A;  3FM8 C;  5J3T A;  1AQC A;  2NZ8 B;  5HE3 A;  3SV1 A;  1XKE A;  2DHJ A;  2RNR B;  2OQB A;  1UEF A;  2Y8F A;  1T77 A;  5CLQ B;  1K5D B;  4TKN A;  3A8Q A;  4GPT B;  4KHB B;  3TW1 A;  1GC7 A;  5IRS A;  4QJ4 B;  2R09 A;  5JHG A;  2J0K A;  4GXB A;  2K00 A;  2J59 M;  3VIA A;  1UNR A;  1GG3 A;  2EMS A;  4DX8 A;  1EGX A;  1MIZ B;  5D3W A;  4K17 A;  3D8D A;  2EJ8 A;  5DHA B;  2CRF A;  5HE2 A;  1FHW A;  4PQ0 A;  5D3V A;  2DN6 A;  1Y5O A;  1WGU A;  2FJL A;  2N0Y A;  2W2W A;  4IOY X;  5JHH A;  2FJU B;  2LOX A;  1SGH A;  2DFK A;  1ISN A;  1KZ7 A;  1J0W A;  2R2Y A;  1J19 A;  1EVH A;  1ZYI A;  5CLL B;  2LKO A;  3T06 A;  2RLO A;  1MAI A;  3KZ1 A;  4A6K A;  3BJI A;  1XCG A;  2IYB A;  4MK0 A;  3MPX A;  3PVW A;  3NWD A;  3WA0 A;  2YT2 A;  3A58 A;  3QWM A;  1DYN A;  1WI1 A;  3U8Z A;  1NTV A;  4CSQ A;  3VOQ A;  1BTN A;  3SNH A;  1RRP B;  2YSZ A;  5HE0 A;  4EMO A;  2G35 A;  1NI2 A;  2CY4 A;  2D2Q A;  4QXA B;  1Y19 B;  3PG7 A;  5C16 A;  1EAZ A;  4ZRK A;  1DDM A;  2ELA A;  3PEG A;  2VKI A;  1W1H A;  4HAX B;  2DX1 A;  3PP2 A;  2MWN B;  4XWX A;  1KI1 B;  2UZR A;  3TCA A;  3PVU A;  3RCP A;  4QJ3 B;  3ULB A;  4EJN A;  2MKR A;  2I1K A;  5L81 A;  2D9X A;  2D4Q A;  1FHO A;  3A8P A;  5C6R A;  2M14 A;  1WG7 A;  3PSC A;  2L1C A;  4F7H A;  5D3X A;  4K2O A;  1X1G A;  2E2X A;  2K2U A;  1GC6 A;  3ODX A;  2COD A;  2JP2 A;  5DI9 B;  3ULC A;  4NY0 A;  2ZPY A;  3OAN A;  2COF A;  1X1F A;  3O96 A;  2DYQ A;  3U7D A;  3ODO A;  3QBV B;  1X86 A;  2GCL A;  2YT1 A;  3WYF B;  2KUP A;  3QIJ A;  3TO1 A;  1H4R A;  2PZ1 A;  4D0N B;  1DDV A;  5J3Q A;  5KQ4 A;  5HE1 A;  2P0D A;  3D8E A;  3FEH A;  1PMS A;  1V88 A;  2KIE A;  3DXC A;  1PFJ A;  4C0A A;  3PVL A;  2OTX A;  5DH9 B;  2DTC A;  3UZT A;  4QJ5 B;  3PZD A;  1IRS A;  2GUM A;  4D6W A;  5C5B A;  2R0D A;  4GMX B;  5DHF B;  1X11 A;  2VRW B;  2Y7B A;  1LW3 A;  4MY6 A;  4DX9 0;  4ZRI A;  2I1J A;  5DIF B;  2EC1 A;  1FAO A;  3DCX A;  1OMW A;  1I7A A;  2LOZ A;  2KCJ A;  4A6H A;  1WVH A;  3N7C A;  5GOW B;  4MT7 A;  3OHM B;  4DXA B;  4OSN A;  2AL6 A;  2P0F A;  1U5F A;  2I5C A;  4K2P A;  1K5G B;  4TYZ A;  2RGN B;  2KUQ A;  2N23 A;  2Y8G A;  3HK0 A;  1MIX A;  2J0M A;  5D3Y A;  1E5W A;  1WJ1 A;  2D9V A;  3KSY A;  1MPH A;  4A6F A;  2I5F A;  2W2X D;  1MK7 B;  2CAY A;  1BWN A;  1MI1 A;  2BCJ A;  3ZDT A;  4KVG B;  4B6H A;  1FGZ A;  3HIE A;  4H8S A;  1NTY A;  2QKL A;  2K2J A;  2LYD A;  4PNK A;  3GYO A;  1BAK A;  2K8E A;  2DLW A;  2YT0 A;  1ZM0 A;  2EMT A;  1DBH A;  5LOP B;  3HQC A;  5C5B B;  3ML4 A;  4HDO A;  1FOE A;  4KAX B;  4CHM A;  2LUL A;  1UNP A;  3BIN A;  4GZU A;  4OT1 A;  1MKE A;  2H7D A;  2Z4D A;  4HAT B;  2YS5 A;  1Z87 A;  5J3Y A;  1ZSQ A;  4F7G A;  4K81 A;  2COA A;  4YON A;  4NSW A;  2AEH A;  3P6A A;  1AWE A;  2D11 A;  4HB4 B;  4KHO A;  1BTK A;  3SYX A;  3U12 A;  5LG4 B;  1UNQ A;  1V5P A;  2KR0 A;  1W1G A;  4Z2M B;  2KGX B;  3NWA A;  2MFQ A;  4WJ7 A;  1H10 A;  2ADZ A;  2Z13 A;  1KZG A;  1XD4 A;  4HB3 B;  2RSG A;  3KY9 A;  2Z14 A;  4L6E A;  1SHC A;  4EKU A;  1RJ2 A;  4A6F B;  2DKP A;  1X05 A;  5EFX A;  1WGQ A;  4HDQ A;  4GN1 A;  3NWF A;  4IAP A;  1MK9 B;  5LON B;  5I2M A;  2YS3 A;  4YL8 A;  1P3R A;  2D9Y A;  2UZS A;  3X23 A;  2YS1 A;  2H7E A;  3AU5 A;  4F7U P;  4HAZ B;  5I2S A;  4WVF B;  2DX5 A;  2K49 A;  1DRO A;  3G9W A;  3NW8 A;  2D9W A;  2D10 A;  4GMV A;  1V5M A;  2NMB A;  3AU4 A;  1FGY A;  3FSS A;  1Q67 A;  2W2X C;  3HSA A;  1EF1 A;  1V5U A;  2DKQ A;  2NBV A;  1UPQ A;  4P7I A;  4WSF A;  1ZC3 B;  2RUK B;  1U5G A;  2YVC A;  5C79 A;  3ZVR A;  1WJM A;  5D27 A;  3P7Z A;  1W1D A;  1XR0 B;  2P8V A;  2QKM A;  2Z59 A;  4KHA A;  3F0W A;  3TVV A;  1U2B A;  2Z0O A;  3GYP A;  4BBK A;  2GS0 A;  1I2H A;  1FHX A;  4GOU A;  4ZRJ A;  1NU2 A;  2CY5 A;  5FI0 A;  1XOD A;  4Z2N A;  4HB0 B;  1FB8 A;  1PLS A;  5JP4 A;  1U27 A;  2YF0 A;  1U5E A;  4GNK B;  2ROV A;  4HAV B;  2J0J A;  2P0H A;  1ZC4 B;  2D9Z A;  1OQN A;  1U5D A;  2Q13 A;  2IFS A;  2ELB A;  3CXB B;  3AJ4 A;  1P5T A;  2HTH B;  2X18 A;  2Z0Q A;  1ZVR A;  2KIG A;  5KCV A;  2XQN M;  4KHB A; 
#chains in the Genus database with same CATH homology
 1QQG A;  3CIK A;  1P6S A;  1V61 A;  1TJ6 A;  2GJY A;  1QC6 A;  2MDX A;  2GCJ A;  4Y94 A;  1UPR A;  3HW2 B;  3D8F A;  3F5R A;  2ROZ B;  2DHI A;  3KRW A;  5FI1 A;  4CYE A;  4IFS A;  4A5K A;  5JLJ B;  4CHJ A;  1OY2 A;  1TXD A;  1TQZ A;  3M1I B;  2DA0 A;  3LJU X;  2YRY A;  1V89 A;  2M38 A;  2LG1 A;  2UVM A;  3TFM A;  2COC A;  2HE7 A;  2RVB B;  3IVF A;  2DHK A;  3NSU A;  2DYN A;  1U29 A;  3DXD A;  3DXE A;  3ODW A;  3SUZ A;  4HAU B;  1N3H A;  1DDW A;  2Z0P A;  1XX0 A;  3V5W A;  5KQ1 A;  3MDB C;  3A98 B;  1M7R A;  2V76 A;  4HAW B;  2VSZ A;  1LB1 A;  2L2I A;  4DBB A;  3KRX A;  4HB2 B;  1M7E A;  4HAY B;  3SO6 A;  4HHV A;  1B55 A;  3FM8 C;  5J3T A;  1AQC A;  2NZ8 B;  5HE3 A;  3SV1 A;  1XKE A;  2DHJ A;  2RNR B;  2OQB A;  1UEF A;  2Y8F A;  5CLQ B;  1K5D B;  4TKN A;  3A8Q A;  4GPT B;  4KHB B;  3TW1 A;  1GC7 A;  2R09 A;  5JHG A;  2J0K A;  4GXB A;  2K00 A;  2J59 M;  3VIA A;  1UNR A;  1GG3 A;  2EMS A;  4DX8 A;  1EGX A;  1MIZ B;  5D3W A;  4K17 A;  3D8D A;  2EJ8 A;  5DHA B;  2CRF A;  5HE2 A;  1FHW A;  4PQ0 A;  5D3V A;  2DN6 A;  1Y5O A;  1WGU A;  2FJL A;  2N0Y A;  2W2W A;  4IOY X;  5JHH A;  2LOX A;  1SGH A;  2DFK A;  1ISN A;  1KZ7 A;  1J0W A;  1J19 A;  1EVH A;  5CLL B;  2LKO A;  3T06 A;  2RLO A;  1MAI A;  3KZ1 A;  4A6K A;  3BJI A;  1XCG A;  2IYB A;  4MK0 A;  3MPX A;  3PVW A;  3WA0 A;  3QWM A;  1DYN A;  1WI1 A;  3U8Z A;  1NTV A;  3VOQ A;  1BTN A;  3SNH A;  1RRP B;  2YSZ A;  5HE0 A;  4EMO A;  2G35 A;  1NI2 A;  2CY4 A;  2D2Q A;  1Y19 B;  3PG7 A;  5C16 A;  1EAZ A;  4ZRK A;  1DDM A;  2ELA A;  3PEG A;  2VKI A;  1W1H A;  4HAX B;  2DX1 A;  3PP2 A;  2MWN B;  4XWX A;  1KI1 B;  2UZR A;  3TCA A;  3PVU A;  3RCP A;  3ULB A;  4EJN A;  2MKR A;  2I1K A;  5L81 A;  2D9X A;  2D4Q A;  1FHO A;  3A8P A;  5C6R A;  2M14 A;  1WG7 A;  3PSC A;  2L1C A;  4F7H A;  5D3X A;  4K2O A;  1X1G A;  2E2X A;  2K2U A;  1GC6 A;  3ODX A;  2COD A;  2JP2 A;  5DI9 B;  3ULC A;  4NY0 A;  2ZPY A;  3OAN A;  2COF A;  1X1F A;  3O96 A;  2DYQ A;  3U7D A;  3ODO A;  3QBV B;  1X86 A;  2GCL A;  2YT1 A;  3WYF B;  2KUP A;  3QIJ A;  3TO1 A;  1H4R A;  2PZ1 A;  4D0N B;  1DDV A;  5J3Q A;  5KQ4 A;  5HE1 A;  2P0D A;  3D8E A;  3FEH A;  1PMS A;  1V88 A;  3DXC A;  1PFJ A;  4C0A A;  3PVL A;  2OTX A;  5DH9 B;  2DTC A;  3UZT A;  3PZD A;  1IRS A;  5C5B A;  2R0D A;  4GMX B;  5DHF B;  1X11 A;  2VRW B;  2Y7B A;  1LW3 A;  4MY6 A;  4DX9 0;  4ZRI A;  2I1J A;  5DIF B;  2EC1 A;  1FAO A;  1OMW A;  1I7A A;  2LOZ A;  2KCJ A;  4A6H A;  1WVH A;  3N7C A;  5GOW B;  4MT7 A;  4DXA B;  2AL6 A;  2P0F A;  1U5F A;  2I5C A;  4K2P A;  1K5G B;  4TYZ A;  2RGN B;  2N23 A;  2Y8G A;  3HK0 A;  1MIX A;  2J0M A;  5D3Y A;  1E5W A;  1WJ1 A;  2D9V A;  3KSY A;  1MPH A;  4A6F A;  2I5F A;  2W2X D;  1MK7 B;  2CAY A;  1BWN A;  2BCJ A;  3ZDT A;  4KVG B;  4B6H A;  1FGZ A;  4H8S A;  1NTY A;  2QKL A;  2K2J A;  2LYD A;  4PNK A;  3GYO A;  1BAK A;  2DLW A;  2YT0 A;  1ZM0 A;  2EMT A;  1DBH A;  5LOP B;  3HQC A;  5C5B B;  3ML4 A;  4HDO A;  1FOE A;  4KAX B;  4CHM A;  2LUL A;  1UNP A;  3BIN A;  4GZU A;  1MKE A;  2H7D A;  4HAT B;  2YS5 A;  1Z87 A;  5J3Y A;  1ZSQ A;  4F7G A;  4K81 A;  2COA A;  4YON A;  4NSW A;  2AEH A;  3P6A A;  1AWE A;  2D11 A;  4HB4 B;  4KHO A;  1BTK A;  3SYX A;  1UNQ A;  1V5P A;  1W1G A;  4Z2M B;  2KGX B;  2MFQ A;  4WJ7 A;  1H10 A;  2ADZ A;  1KZG A;  1XD4 A;  4HB3 B;  2RSG A;  3KY9 A;  4L6E A;  1SHC A;  4EKU A;  1RJ2 A;  4A6F B;  2DKP A;  1X05 A;  5EFX A;  1WGQ A;  4HDQ A;  4GN1 A;  4IAP A;  1MK9 B;  5LON B;  2YS3 A;  4YL8 A;  1P3R A;  2D9Y A;  2UZS A;  3X23 A;  2YS1 A;  2H7E A;  3AU5 A;  4F7U P;  4HAZ B;  4WVF B;  2DX5 A;  1DRO A;  3G9W A;  2D9W A;  2D10 A;  4GMV A;  1V5M A;  2NMB A;  3AU4 A;  1FGY A;  3FSS A;  1Q67 A;  2W2X C;  1EF1 A;  1V5U A;  2DKQ A;  4P7I A;  1UPQ A;  4WSF A;  1ZC3 B;  2RUK B;  1U5G A;  2YVC A;  5C79 A;  3ZVR A;  1WJM A;  5D27 A;  3P7Z A;  1W1D A;  1XR0 B;  2P8V A;  2QKM A;  4KHA A;  3F0W A;  3TVV A;  1U2B A;  2Z0O A;  3GYP A;  4BBK A;  2GS0 A;  1I2H A;  1FHX A;  4ZRJ A;  1NU2 A;  2CY5 A;  5FI0 A;  1XOD A;  4Z2N A;  4HB0 B;  1FB8 A;  1PLS A;  5JP4 A;  1U27 A;  2YF0 A;  1U5E A;  2ROV A;  4HAV B;  2J0J A;  2P0H A;  1ZC4 B;  2D9Z A;  1OQN A;  1U5D A;  2Q13 A;  2IFS A;  2ELB A;  3CXB B;  1P5T A;  2X18 A;  2HTH B;  3AJ4 A;  2Z0Q A;  1ZVR A;  5KCV A;  2XQN M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...