4A6FA

Crystal structure of slm1-ph domain in complex with phosphoserine
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
117
structure length
105
Chain Sequence
PFTEIKSGFLERRSKFLKSYSKGYYVLTPNFLHEFKTADRKKDLVPVMSLALSECTVTEHSRKNSGSDAKFVLHAKQRGHNWVFKADSYESMMSWFDNLKILTST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHOSPHATIDYLINOSITOL 4,5-BISPHOSPHATE-BINDING PROTEIN SLM1
publication title Structural Analyses of Slm1-Ph Domain Demonstrate Ligand Binding in the Non-Canonical Site
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 22
structure length 105
sequence length 117
ec nomenclature
pdb deposition date 2011-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4a6fA00
1MK9B 1AQCA 4DBBA 3F0WA 1NI2A 1MAIA 1U29A 4L6EA 2COAA 5JP4A 2Y8FA 4A6FA 2Y7BA 1N3HA 4HDOA 1MK7B 2RSGA 5GOWB 4Z2MB 2BCJA 2Z0PA 3ULCA 2YS5A 2DX1A 4IOYX 5JLJB 1EAZA 3VOQA 2YSZA 1XCGA 4NY0A 1B55A 5D27A 2COFA 4KHOA 2XQNM 1E5WA 2N23A 2UZRA 4HAWB 1J0WA 1IRSA 1WI1A 2DA0A 2YS3A 2ZPYA 1KZ7A 2L2IA 4DXAB 1DYNA 3X23A 2MKRA 4HB0B 4K2OA 1BAKA 4Z2NA 5DHFB 2CRFA 1P6SA 2IYBA 4A5KA 4HAZB 1ZM0A 2LOZA 3KZ1A 2K2JA 1FOEA 1FB8A 3IVFA 1NU2A 2I1KA 4Y94A 3D8FA 3LJUX 1H10A 4K17A 4HHVA 5FI0A 4HB2B 2JP2A 2VRWB 5D3YA 4HATB 1UPQA 2PZ1A 1PFJA 1Y19B 1FHWA 4HB4B 2J0MA 4ZRKA 2DN6A 4TYZA 2W2XD 2LULA 3TFMA 1FGYA 2EMSA 3AU4A 3M1IB 2LKOA 2M14A 4ZRIA 1WJMA 1V5PA 4K2PA 1NTYA 2MWNB 2V76A 1UPRA 4A6FB 4C0AA 4KHAA 2EMTA 2KGXB 1V5MA 4K81A 3A8PA 2ELBA 2MDXA 3A8QA 1FHOA 5CLLB 1I2HA 2QKMA 3TCAA 2Y8GA 3ML4A 5C79A 4HAXB 3A98B 2W2WA 1GC6A 4WVFB 3ZVRA 4YONA 3HK0A 3F5RA 4GXBA 2DYNA 3HQCA 4NSWA 3WA0A 2DTCA 1U5DA 2ROZB 1QC6A 4P7IA 4HB3B 1KI1B 2D4QA 1XR0B 3DXDA 3SNHA 1TJ6A 1TXDA 1PMSA 2QKLA 4KHBB 3O96A 3SO6A 1ISNA 4IFSA 3AJ4A 4MY6A 4WJ7A 2GCJA 1X05A 4MK0A 4A6KA 3U7DA 2I5FA 1BTNA 5C16A 2M38A 2E2XA 2AL6A 2J0KA 3GYPA 2H7EA 4CHJA 1FHXA 2D9ZA 1GG3A 2W2XC 3P7ZA 3OANA 4B6HA 1EF1A 4PNKA 3PG7A 2R0DA 3ULBA 1SGHA 3PEGA 4GZUA 3MDBC 2RNRB 1DDWA 1Q67A 2DHIA 1XX0A 1KZGA 3SV1A 3N7CA 4GN1A 5D3WA 1U5GA 2RLOA 5C6RA 1X11A 3PZDA 2FJLA 2CY4A 4KVGB 1MIXA 1RJ2A 2VKIA 2CY5A 3ZDTA 4F7UP 2ROVA 2J0JA 4HAYB 3U8ZA 2L1CA 4DX8A 5D3XA 1X86A 4DX90 1LW3A 1NTVA 4PQ0A 2OQBA 2DFKA 1XKEA 3BJIA 3PP2A 4XWXA 2NZ8B 5C5BA 1SHCA 2P0HA 2D9VA 1P5TA 2N0YA 1M7EA 2DHJA 3TVVA 1EVHA 2YF0A 3CIKA 1P3RA 4GMXB 3AU5A 2P0FA 3FM8C 3V5WA 1MPHA 2COCA 5LOPB 2H7DA 1DROA 2VSZA 2YT1A 1GC7A 1BWNA 2CAYA 1FGZA 1I7AA 3G9WA 1FAOA 1WVHA 2K00A 4GMVA 3VIAA 2R09A 2MFQA 5HE3A 2GS0A 3QBVB 2IFSA 2LG1A 2LYDA 2Z0OA 3BINA 4A6HA 4F7HA 1UNQA 3RCPA 3QWMA 1LB1A 3MPXA 1W1HA 4YL8A 4BBKA 3PVLA 5DH9B 2D9YA 3PVUA 3D8DA 4GPTB 3KSYA 5HE0A 3TW1A 5KQ1A 1MIZB 1X1FA 2HTHB 1ZC3B 2D2QA 2Z0QA 1MKEA 2CODA 1AWEA 3FEHA 3DXEA 3SUZA 1M7RA 2DHKA 4HAVB 5FI1A 5D3VA 2P0DA 5EFXA 3SYXA 4WSFA 1XODA 5HE1A 3KRXA 4EKUA 1WGQA 1Z87A 3PSCA 5LONB 3UZTA 1WJ1A 5DHAB 2OTXA 5KQ4A 1UNRA 4EMOA 3CXBB 1BTKA 5J3TA 3NSUA 2EC1A 2K2UA 4CYEA 1WGUA 4TKNA 3QIJA 1OMWA 2I5CA 2DKQA 1H4RA 2AEHA 5C5BB 2NMBA 2X18A 2J59M 1RRPB 4HDQA 1WG7A 2ELAA 1OQNA 2Q13A 3P6AA 2EJ8A 2UVMA 3D8EA 2D9WA 2GJYA 1W1GA 3PVWA 1K5DB 5HE2A 2P8VA 1J19A 1EGXA 1V5UA 2D9XA 2G35A 1K5GB 1TQZA 2KCJA 3ODWA 4H8SA 1XD4A 2DYQA 1U2BA 2RGNB 1OY2A 1U5EA 3T06A 2D10A 2I1JA 5JHGA 2YT0A 1PLSA 2GCLA 1ZSQA 3HW2B 1ZVRA 4F7GA 1QQGA 5JHHA 1UNPA 2ADZA 5J3YA 2HE7A 5L81A 4MT7A 2RUKB 1Y5OA 3GYOA 4KAXB 2YS1A 2UZSA 5J3QA 3ODXA 3TO1A 4EJNA 4ZRJA 1V89A 1DDMA 1X1GA 1DDVA 2DKPA 2DLWA 1W1DA 1UEFA 5DIFB 2YRYA 1U27A 1DBHA 4D0NB 1V88A 2YVCA 3ODOA 2RVBB 5CLQB 4HAUB 3FSSA 3KRWA 1U5FA 2LOXA 5DI9B 3WYFB 2KUPA 1ZC4B 1V61A 4CHMA 5KCVA 2DX5A 3KY9A 4IAPA 2D11A 3DXCA
chains in the Genus database with same CATH superfamily
1MK9B 1AQCA 4DBBA 3F0WA 1NI2A 1MAIA 1U29A 4L6EA 2COAA 5JP4A 4QJ4B 2Y8FA 4A6FA 2Y7BA 1N3HA 5I2SA 4HDOA 1MK7B 2RSGA 5GOWB 4Z2MB 3NWAA 2BCJA 2Z0PA 3ULCA 2YS5A 2DX1A 4IOYX 5JLJB 1EAZA 3VOQA 2YSZA 1XCGA 4NY0A 1B55A 5D27A 2COFA 4KHOA 3NW8A 2XQNM 1E5WA 2N23A 2UZRA 4HAWB 1J0WA 1IRSA 1WI1A 2DA0A 2YS3A 2ZPYA 1KZ7A 2L2IA 2KR0A 4DXAB 1DYNA 3X23A 2MKRA 4HB0B 4K2OA 1BAKA 4Z2NA 5DHFB 2CRFA 1P6SA 2IYBA 4A5KA 4HAZB 1ZM0A 2LOZA 3KZ1A 4KHBA 2K2JA 1FOEA 1FB8A 5LG4B 3IVFA 1NU2A 2I1KA 5I2MA 4Y94A 3D8FA 3LJUX 3A58A 1H10A 4K17A 2K49A 4HHVA 3HIEA 5FI0A 4HB2B 2JP2A 2VRWB 5D3YA 4HATB 1UPQA 2PZ1A 1PFJA 4HSIA 1Y19B 1FHWA 2Z59A 4HB4B 2J0MA 4ZRKA 2DN6A 4TYZA 2W2XD 2LULA 3TFMA 4DIXA 1FGYA 2EMSA 2GUMA 3AU4A 3M1IB 2LKOA 2M14A 4ZRIA 1WJMA 1V5PA 4K2PA 1NTYA 2MWNB 2V76A 4L1RA 1UPRA 4A6FB 1ZYIA 4C0AA 4KHAA 2EMTA 2KGXB 1V5MA 4K81A 3A8PA 2ELBA 2MDXA 3A8QA 2RRFA 1FHOA 5CLLB 1I2HA 2QKMA 3TCAA 2Y8GA 4OT1A 3ML4A 5C79A 4HAXB 3A98B 2W2WA 1GC6A 4WVFB 3ZVRA 4YONA 3HK0A 3F5RA 4GXBA 2DYNA 3FVCA 4QJ5B 3HQCA 4NSWA 3WA0A 2DTCA 1U5DA 1T77A 2FJUB 2ROZB 1QC6A 4P7IA 4HB3B 1KI1B 2D4QA 1XR0B 3DXDA 3SNHA 1TJ6A 1TXDA 1PMSA 2QKLA 4KHBB 3O96A 2KUQA 3SO6A 1ISNA 4IFSA 3AJ4A 4MY6A 4WJ7A 3NWDA 2GCJA 1X05A 4MK0A 4A6KA 3U7DA 2I5FA 1BTNA 5C16A 2M38A 2E2XA 2AL6A 2J0KA 3GYPA 2H7EA 4CHJA 1FHXA 2D9ZA 4QXAB 1GG3A 3HSAA 3NWFA 2W2XC 3P7ZA 3OANA 4B6HA 1EF1A 4GNKB 4PNKA 3PG7A 2R0DA 3ULBA 1SGHA 3PEGA 4GZUA 3MDBC 2RNRB 1DDWA 1Q67A 2DHIA 1XX0A 2R2YA 1KZGA 3SV1A 3N7CA 4GN1A 5D3WA 3OHMB 1U5GA 2RLOA 2Z14A 5C6RA 1X11A 3PZDA 2FJLA 2CY4A 4KVGB 1MIXA 1RJ2A 2VKIA 2CY5A 3ZDTA 4F7UP 2ROVA 2J0JA 4QJ3B 4HAYB 3U8ZA 2L1CA 4DX8A 5D3XA 1X86A 4DX90 1LW3A 1NTVA 4PQ0A 2OQBA 2DFKA 1XKEA 3BJIA 3PP2A 4XWXA 2Z4DA 2NZ8B 5C5BA 1SHCA 2P0HA 2D9VA 1P5TA 2N0YA 1M7EA 2DHJA 3TVVA 1EVHA 2YF0A 3CIKA 1P3RA 4GMXB 3AU5A 2P0FA 3FM8C 3V5WA 1MPHA 2COCA 4D6WA 5LOPB 2H7DA 1DROA 2VSZA 2YT1A 1GC7A 1BWNA 2CAYA 1FGZA 1I7AA 3G9WA 1FAOA 1WVHA 2K00A 4GMVA 3VIAA 2R09A 2MFQA 5HE3A 2GS0A 3QBVB 2IFSA 2LG1A 2LYDA 2Z0OA 2YT2A 3BINA 4A6HA 4F7HA 1UNQA 3RCPA 3QWMA 1LB1A 3MPXA 1W1HA 4YL8A 4BBKA 1MI1A 3PVLA 5DH9B 2D9YA 3PVUA 3D8DA 4GPTB 3KSYA 5HE0A 3TW1A 5KQ1A 1MIZB 1X1FA 2HTHB 1ZC3B 2D2QA 2Z0QA 1MKEA 2CODA 1AWEA 3FEHA 3DXEA 3SUZA 1M7RA 2DHKA 4HAVB 5FI1A 5D3VA 2P0DA 5EFXA 3SYXA 4WSFA 1XODA 5HE1A 3KRXA 4EKUA 1WGQA 1Z87A 3PSCA 3U12A 5LONB 3UZTA 1WJ1A 5DHAB 2OTXA 5KQ4A 1UNRA 4EMOA 3CXBB 1BTKA 2K8EA 5J3TA 3NSUA 2EC1A 2K2UA 4CYEA 1WGUA 4TKNA 3QIJA 1OMWA 2I5CA 2DKQA 5IRSA 2ZKMX 1H4RA 2AEHA 5C5BB 2NMBA 2X18A 2J59M 3DCXA 1RRPB 4HDQA 1WG7A 2ELAA 1OQNA 2Q13A 3P6AA 2EJ8A 2UVMA 2NBVA 3D8EA 2D9WA 2GJYA 1W1GA 3PVWA 1K5DB 5HE2A 2Z13A 2P8VA 1J19A 1EGXA 1V5UA 3B77A 2D9XA 2G35A 1K5GB 1TQZA 2KCJA 3ODWA 4H8SA 1XD4A 2DYQA 4CSQA 1U2BA 2RGNB 1OY2A 1U5EA 3T06A 4GOUA 2D10A 2I1JA 5JHGA 2KIEA 2YT0A 1PLSA 2GCLA 1ZSQA 3HW2B 1ZVRA 4F7GA 1QQGA 5JHHA 1UNPA 2ADZA 5J3YA 2HE7A 5L81A 4MT7A 4OSNA 2RUKB 1Y5OA 3GYOA 4KAXB 2YS1A 5M4YB 2UZSA 5J3QA 3ODXA 3TO1A 4EJNA 4ZRJA 1V89A 1DDMA 1X1GA 1DDVA 2DKPA 2DLWA 1W1DA 1UEFA 5DIFB 2YRYA 1U27A 1DBHA 4D0NB 1V88A 2YVCA 3ODOA 2RVBB 5CLQB 4HAUB 3FSSA 3KRWA 1U5FA 2LOXA 5DI9B 2KIGA 3WYFB 2KUPA 1ZC4B 1V61A 4CHMA 5KCVA 2DX5A 3KY9A 4IAPA 2D11A 3DXCA
chains in the Genus database with same CATH topology
1MK9B 1AQCA 4DBBA 3F0WA 1NI2A 1MAIA 1U29A 4L6EA 2COAA 5JP4A 2Y8FA 4A6FA 2Y7BA 1N3HA 4HDOA 1MK7B 2RSGA 5GOWB 4Z2MB 2BCJA 2Z0PA 3ULCA 2YS5A 2DX1A 4IOYX 5JLJB 1EAZA 3VOQA 2YSZA 1XCGA 4NY0A 1B55A 5D27A 2COFA 4KHOA 2XQNM 1E5WA 2N23A 2UZRA 4HAWB 1J0WA 1IRSA 1WI1A 2DA0A 2YS3A 2ZPYA 1KZ7A 2L2IA 4DXAB 1DYNA 3X23A 2MKRA 4HB0B 4K2OA 1BAKA 4Z2NA 5DHFB 2CRFA 1P6SA 2IYBA 4A5KA 4HAZB 1ZM0A 2LOZA 3KZ1A 2K2JA 1FOEA 1FB8A 3IVFA 1NU2A 2I1KA 4Y94A 3D8FA 3LJUX 1H10A 4K17A 4HHVA 5FI0A 4HB2B 2JP2A 2VRWB 5D3YA 4HATB 1UPQA 2PZ1A 1PFJA 1Y19B 1FHWA 4HB4B 2J0MA 4ZRKA 2DN6A 4TYZA 2W2XD 2LULA 3TFMA 1FGYA 2EMSA 3AU4A 3M1IB 2LKOA 2M14A 4ZRIA 1WJMA 1V5PA 4K2PA 1NTYA 2MWNB 2V76A 1UPRA 4A6FB 4C0AA 4KHAA 2EMTA 2KGXB 1V5MA 4K81A 3A8PA 2ELBA 2MDXA 3A8QA 1FHOA 5CLLB 1I2HA 2QKMA 3TCAA 2Y8GA 3ML4A 5C79A 4HAXB 3A98B 2W2WA 1GC6A 4WVFB 3ZVRA 4YONA 3HK0A 3F5RA 4GXBA 2DYNA 3HQCA 4NSWA 3WA0A 2DTCA 1U5DA 2ROZB 1QC6A 4P7IA 4HB3B 1KI1B 2D4QA 1XR0B 3DXDA 3SNHA 1TJ6A 1TXDA 1PMSA 2QKLA 4KHBB 3O96A 3SO6A 1ISNA 4IFSA 3AJ4A 4MY6A 4WJ7A 2GCJA 1X05A 4MK0A 4A6KA 3U7DA 2I5FA 1BTNA 5C16A 2M38A 2E2XA 2AL6A 2J0KA 3GYPA 2H7EA 4CHJA 1FHXA 2D9ZA 1GG3A 2W2XC 3P7ZA 3OANA 4B6HA 1EF1A 4PNKA 3PG7A 2R0DA 3ULBA 1SGHA 3PEGA 4GZUA 3MDBC 2RNRB 1DDWA 1Q67A 2DHIA 1XX0A 1KZGA 3SV1A 3N7CA 4GN1A 5D3WA 1U5GA 2RLOA 5C6RA 1X11A 3PZDA 2FJLA 2CY4A 4KVGB 1MIXA 1RJ2A 2VKIA 2CY5A 3ZDTA 4F7UP 2ROVA 2J0JA 4HAYB 3U8ZA 2L1CA 4DX8A 5D3XA 1X86A 4DX90 1LW3A 1NTVA 4PQ0A 2OQBA 2DFKA 1XKEA 3BJIA 3PP2A 4XWXA 2NZ8B 5C5BA 1SHCA 2P0HA 2D9VA 1P5TA 2N0YA 1M7EA 2DHJA 3TVVA 1EVHA 2YF0A 3CIKA 1P3RA 4GMXB 3AU5A 2P0FA 3FM8C 3V5WA 1MPHA 2COCA 5LOPB 2H7DA 1DROA 2VSZA 2YT1A 1GC7A 1BWNA 2CAYA 1FGZA 1I7AA 3G9WA 1FAOA 1WVHA 2K00A 4GMVA 3VIAA 2R09A 2MFQA 5HE3A 2GS0A 3QBVB 2IFSA 2LG1A 2LYDA 2Z0OA 3BINA 4A6HA 4F7HA 1UNQA 3RCPA 3QWMA 1LB1A 3MPXA 1W1HA 4YL8A 4BBKA 3PVLA 5DH9B 2D9YA 3PVUA 3D8DA 4GPTB 3KSYA 5HE0A 3TW1A 5KQ1A 1MIZB 1X1FA 2HTHB 1ZC3B 2D2QA 2Z0QA 1MKEA 2CODA 1AWEA 3FEHA 3DXEA 3SUZA 1M7RA 2DHKA 4HAVB 5FI1A 5D3VA 2P0DA 5EFXA 3SYXA 4WSFA 1XODA 5HE1A 3KRXA 4EKUA 1WGQA 1Z87A 3PSCA 5LONB 3UZTA 1WJ1A 5DHAB 2OTXA 5KQ4A 1UNRA 4EMOA 3CXBB 1BTKA 5J3TA 3NSUA 2EC1A 2K2UA 4CYEA 1WGUA 4TKNA 3QIJA 1OMWA 2I5CA 2DKQA 1H4RA 2AEHA 5C5BB 2NMBA 2X18A 2J59M 1RRPB 4HDQA 1WG7A 2ELAA 1OQNA 2Q13A 3P6AA 2EJ8A 2UVMA 3D8EA 2D9WA 2GJYA 1W1GA 3PVWA 1K5DB 5HE2A 2P8VA 1J19A 1EGXA 1V5UA 2D9XA 2G35A 1K5GB 1TQZA 2KCJA 3ODWA 4H8SA 1XD4A 2DYQA 1U2BA 2RGNB 1OY2A 1U5EA 3T06A 2D10A 2I1JA 5JHGA 2YT0A 1PLSA 2GCLA 1ZSQA 3HW2B 1ZVRA 4F7GA 1QQGA 5JHHA 1UNPA 2ADZA 5J3YA 2HE7A 5L81A 4MT7A 2RUKB 1Y5OA 3GYOA 4KAXB 2YS1A 2UZSA 5J3QA 3ODXA 3TO1A 4EJNA 4ZRJA 1V89A 1DDMA 1X1GA 1DDVA 2DKPA 2DLWA 1W1DA 1UEFA 5DIFB 2YRYA 1U27A 1DBHA 4D0NB 1V88A 2YVCA 3ODOA 2RVBB 5CLQB 4HAUB 3FSSA 3KRWA 1U5FA 2LOXA 5DI9B 3WYFB 2KUPA 1ZC4B 1V61A 4CHMA 5KCVA 2DX5A 3KY9A 4IAPA 2D11A 3DXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MK9 B;  1AQC A;  4DBB A;  3F0W A;  1NI2 A;  1MAI A;  1U29 A;  4L6E A;  2COA A;  5JP4 A;  2Y8F A;  4A6F A;  2Y7B A;  1N3H A;  4HDO A;  1MK7 B;  2RSG A;  5GOW B;  4Z2M B;  2BCJ A;  2Z0P A;  3ULC A;  2YS5 A;  2DX1 A;  4IOY X;  5JLJ B;  1EAZ A;  3VOQ A;  2YSZ A;  1XCG A;  4NY0 A;  1B55 A;  5D27 A;  2COF A;  4KHO A;  2XQN M;  1E5W A;  2N23 A;  2UZR A;  4HAW B;  1J0W A;  1IRS A;  1WI1 A;  2DA0 A;  2YS3 A;  2ZPY A;  1KZ7 A;  2L2I A;  4DXA B;  1DYN A;  3X23 A;  2MKR A;  4HB0 B;  4K2O A;  1BAK A;  4Z2N A;  5DHF B;  2CRF A;  1P6S A;  2IYB A;  4A5K A;  4HAZ B;  1ZM0 A;  2LOZ A;  3KZ1 A;  2K2J A;  1FOE A;  1FB8 A;  3IVF A;  1NU2 A;  2I1K A;  4Y94 A;  3D8F A;  3LJU X;  1H10 A;  4K17 A;  4HHV A;  5FI0 A;  4HB2 B;  2JP2 A;  2VRW B;  5D3Y A;  4HAT B;  1UPQ A;  2PZ1 A;  1PFJ A;  1Y19 B;  1FHW A;  4HB4 B;  2J0M A;  4ZRK A;  2DN6 A;  4TYZ A;  2W2X D;  2LUL A;  3TFM A;  1FGY A;  2EMS A;  3AU4 A;  3M1I B;  2LKO A;  2M14 A;  4ZRI A;  1WJM A;  1V5P A;  4K2P A;  1NTY A;  2MWN B;  2V76 A;  1UPR A;  4A6F B;  4C0A A;  4KHA A;  2EMT A;  2KGX B;  1V5M A;  4K81 A;  3A8P A;  2ELB A;  2MDX A;  3A8Q A;  1FHO A;  5CLL B;  1I2H A;  2QKM A;  3TCA A;  2Y8G A;  3ML4 A;  5C79 A;  4HAX B;  3A98 B;  2W2W A;  1GC6 A;  4WVF B;  3ZVR A;  4YON A;  3HK0 A;  3F5R A;  4GXB A;  2DYN A;  3HQC A;  4NSW A;  3WA0 A;  2DTC A;  1U5D A;  2ROZ B;  1QC6 A;  4P7I A;  4HB3 B;  1KI1 B;  2D4Q A;  1XR0 B;  3DXD A;  3SNH A;  1TJ6 A;  1TXD A;  1PMS A;  2QKL A;  4KHB B;  3O96 A;  3SO6 A;  1ISN A;  4IFS A;  3AJ4 A;  4MY6 A;  4WJ7 A;  2GCJ A;  1X05 A;  4MK0 A;  4A6K A;  3U7D A;  2I5F A;  1BTN A;  5C16 A;  2M38 A;  2E2X A;  2AL6 A;  2J0K A;  3GYP A;  2H7E A;  4CHJ A;  1FHX A;  2D9Z A;  1GG3 A;  2W2X C;  3P7Z A;  3OAN A;  4B6H A;  1EF1 A;  4PNK A;  3PG7 A;  2R0D A;  3ULB A;  1SGH A;  3PEG A;  4GZU A;  3MDB C;  2RNR B;  1DDW A;  1Q67 A;  2DHI A;  1XX0 A;  1KZG A;  3SV1 A;  3N7C A;  4GN1 A;  5D3W A;  1U5G A;  2RLO A;  5C6R A;  1X11 A;  3PZD A;  2FJL A;  2CY4 A;  4KVG B;  1MIX A;  1RJ2 A;  2VKI A;  2CY5 A;  3ZDT A;  4F7U P;  2ROV A;  2J0J A;  4HAY B;  3U8Z A;  2L1C A;  4DX8 A;  5D3X A;  1X86 A;  4DX9 0;  1LW3 A;  1NTV A;  4PQ0 A;  2OQB A;  2DFK A;  1XKE A;  3BJI A;  3PP2 A;  4XWX A;  2NZ8 B;  5C5B A;  1SHC A;  2P0H A;  2D9V A;  1P5T A;  2N0Y A;  1M7E A;  2DHJ A;  3TVV A;  1EVH A;  2YF0 A;  3CIK A;  1P3R A;  4GMX B;  3AU5 A;  2P0F A;  3FM8 C;  3V5W A;  1MPH A;  2COC A;  5LOP B;  2H7D A;  1DRO A;  2VSZ A;  2YT1 A;  1GC7 A;  1BWN A;  2CAY A;  1FGZ A;  1I7A A;  3G9W A;  1FAO A;  1WVH A;  2K00 A;  4GMV A;  3VIA A;  2R09 A;  2MFQ A;  5HE3 A;  2GS0 A;  3QBV B;  2IFS A;  2LG1 A;  2LYD A;  2Z0O A;  3BIN A;  4A6H A;  4F7H A;  1UNQ A;  3RCP A;  3QWM A;  1LB1 A;  3MPX A;  1W1H A;  4YL8 A;  4BBK A;  3PVL A;  5DH9 B;  2D9Y A;  3PVU A;  3D8D A;  4GPT B;  3KSY A;  5HE0 A;  3TW1 A;  5KQ1 A;  1MIZ B;  1X1F A;  2HTH B;  1ZC3 B;  2D2Q A;  2Z0Q A;  1MKE A;  2COD A;  1AWE A;  3FEH A;  3DXE A;  3SUZ A;  1M7R A;  2DHK A;  4HAV B;  5FI1 A;  5D3V A;  2P0D A;  5EFX A;  3SYX A;  4WSF A;  1XOD A;  5HE1 A;  3KRX A;  4EKU A;  1WGQ A;  1Z87 A;  3PSC A;  5LON B;  3UZT A;  1WJ1 A;  5DHA B;  2OTX A;  5KQ4 A;  1UNR A;  4EMO A;  3CXB B;  1BTK A;  5J3T A;  3NSU A;  2EC1 A;  2K2U A;  4CYE A;  1WGU A;  4TKN A;  3QIJ A;  1OMW A;  2I5C A;  2DKQ A;  1H4R A;  2AEH A;  5C5B B;  2NMB A;  2X18 A;  2J59 M;  1RRP B;  4HDQ A;  1WG7 A;  2ELA A;  1OQN A;  2Q13 A;  3P6A A;  2EJ8 A;  2UVM A;  3D8E A;  2D9W A;  2GJY A;  1W1G A;  3PVW A;  1K5D B;  5HE2 A;  2P8V A;  1J19 A;  1EGX A;  1V5U A;  2D9X A;  2G35 A;  1K5G B;  1TQZ A;  2KCJ A;  3ODW A;  4H8S A;  1XD4 A;  2DYQ A;  1U2B A;  2RGN B;  1OY2 A;  1U5E A;  3T06 A;  2D10 A;  2I1J A;  5JHG A;  2YT0 A;  1PLS A;  2GCL A;  1ZSQ A;  3HW2 B;  1ZVR A;  4F7G A;  1QQG A;  5JHH A;  1UNP A;  2ADZ A;  5J3Y A;  2HE7 A;  5L81 A;  4MT7 A;  2RUK B;  1Y5O A;  3GYO A;  4KAX B;  2YS1 A;  2UZS A;  5J3Q A;  3ODX A;  3TO1 A;  4EJN A;  4ZRJ A;  1V89 A;  1DDM A;  1X1G A;  1DDV A;  2DKP A;  2DLW A;  1W1D A;  1UEF A;  5DIF B;  2YRY A;  1U27 A;  1DBH A;  4D0N B;  1V88 A;  2YVC A;  3ODO A;  2RVB B;  5CLQ B;  4HAU B;  3FSS A;  3KRW A;  1U5F A;  2LOX A;  5DI9 B;  3WYF B;  2KUP A;  1ZC4 B;  1V61 A;  4CHM A;  5KCV A;  2DX5 A;  3KY9 A;  4IAP A;  2D11 A;  3DXC A; 
#chains in the Genus database with same CATH topology
 1MK9 B;  1AQC A;  4DBB A;  3F0W A;  1NI2 A;  1MAI A;  1U29 A;  4L6E A;  2COA A;  5JP4 A;  4QJ4 B;  2Y8F A;  4A6F A;  2Y7B A;  1N3H A;  5I2S A;  4HDO A;  1MK7 B;  2RSG A;  5GOW B;  4Z2M B;  3NWA A;  2BCJ A;  2Z0P A;  3ULC A;  2YS5 A;  2DX1 A;  4IOY X;  5JLJ B;  1EAZ A;  3VOQ A;  2YSZ A;  1XCG A;  4NY0 A;  1B55 A;  5D27 A;  2COF A;  4KHO A;  3NW8 A;  2XQN M;  1E5W A;  2N23 A;  2UZR A;  4HAW B;  1J0W A;  1IRS A;  1WI1 A;  2DA0 A;  2YS3 A;  2ZPY A;  1KZ7 A;  2L2I A;  2KR0 A;  4DXA B;  1DYN A;  3X23 A;  2MKR A;  4HB0 B;  4K2O A;  1BAK A;  4Z2N A;  5DHF B;  2CRF A;  1P6S A;  2IYB A;  4A5K A;  4HAZ B;  1ZM0 A;  2LOZ A;  3KZ1 A;  4KHB A;  2K2J A;  1FOE A;  1FB8 A;  5LG4 B;  3IVF A;  1NU2 A;  2I1K A;  5I2M A;  4Y94 A;  3D8F A;  3LJU X;  3A58 A;  1H10 A;  4K17 A;  2K49 A;  4HHV A;  3HIE A;  5FI0 A;  4HB2 B;  2JP2 A;  2VRW B;  5D3Y A;  4HAT B;  1UPQ A;  2PZ1 A;  1PFJ A;  4HSI A;  1Y19 B;  1FHW A;  2Z59 A;  4HB4 B;  2J0M A;  4ZRK A;  2DN6 A;  4TYZ A;  2W2X D;  2LUL A;  3TFM A;  4DIX A;  1FGY A;  2EMS A;  2GUM A;  3AU4 A;  3M1I B;  2LKO A;  2M14 A;  4ZRI A;  1WJM A;  1V5P A;  4K2P A;  1NTY A;  2MWN B;  2V76 A;  4L1R A;  1UPR A;  4A6F B;  1ZYI A;  4C0A A;  4KHA A;  2EMT A;  2KGX B;  1V5M A;  4K81 A;  3A8P A;  2ELB A;  2MDX A;  3A8Q A;  2RRF A;  1FHO A;  5CLL B;  1I2H A;  2QKM A;  3TCA A;  2Y8G A;  4OT1 A;  3ML4 A;  5C79 A;  4HAX B;  3A98 B;  2W2W A;  1GC6 A;  4WVF B;  3ZVR A;  4YON A;  3HK0 A;  3F5R A;  4GXB A;  2DYN A;  3FVC A;  4QJ5 B;  3HQC A;  4NSW A;  3WA0 A;  2DTC A;  1U5D A;  1T77 A;  2FJU B;  2ROZ B;  1QC6 A;  4P7I A;  4HB3 B;  1KI1 B;  2D4Q A;  1XR0 B;  3DXD A;  3SNH A;  1TJ6 A;  1TXD A;  1PMS A;  2QKL A;  4KHB B;  3O96 A;  2KUQ A;  3SO6 A;  1ISN A;  4IFS A;  3AJ4 A;  4MY6 A;  4WJ7 A;  3NWD A;  2GCJ A;  1X05 A;  4MK0 A;  4A6K A;  3U7D A;  2I5F A;  1BTN A;  5C16 A;  2M38 A;  2E2X A;  2AL6 A;  2J0K A;  3GYP A;  2H7E A;  4CHJ A;  1FHX A;  2D9Z A;  4QXA B;  1GG3 A;  3HSA A;  3NWF A;  2W2X C;  3P7Z A;  3OAN A;  4B6H A;  1EF1 A;  4GNK B;  4PNK A;  3PG7 A;  2R0D A;  3ULB A;  1SGH A;  3PEG A;  4GZU A;  3MDB C;  2RNR B;  1DDW A;  1Q67 A;  2DHI A;  1XX0 A;  2R2Y A;  1KZG A;  3SV1 A;  3N7C A;  4GN1 A;  5D3W A;  3OHM B;  1U5G A;  2RLO A;  2Z14 A;  5C6R A;  1X11 A;  3PZD A;  2FJL A;  2CY4 A;  4KVG B;  1MIX A;  1RJ2 A;  2VKI A;  2CY5 A;  3ZDT A;  4F7U P;  2ROV A;  2J0J A;  4QJ3 B;  4HAY B;  3U8Z A;  2L1C A;  4DX8 A;  5D3X A;  1X86 A;  4DX9 0;  1LW3 A;  1NTV A;  4PQ0 A;  2OQB A;  2DFK A;  1XKE A;  3BJI A;  3PP2 A;  4XWX A;  2Z4D A;  2NZ8 B;  5C5B A;  1SHC A;  2P0H A;  2D9V A;  1P5T A;  2N0Y A;  1M7E A;  2DHJ A;  3TVV A;  1EVH A;  2YF0 A;  3CIK A;  1P3R A;  4GMX B;  3AU5 A;  2P0F A;  3FM8 C;  3V5W A;  1MPH A;  2COC A;  4D6W A;  5LOP B;  2H7D A;  1DRO A;  2VSZ A;  2YT1 A;  1GC7 A;  1BWN A;  2CAY A;  1FGZ A;  1I7A A;  3G9W A;  1FAO A;  1WVH A;  2K00 A;  4GMV A;  3VIA A;  2R09 A;  2MFQ A;  5HE3 A;  2GS0 A;  3QBV B;  2IFS A;  2LG1 A;  2LYD A;  2Z0O A;  2YT2 A;  3BIN A;  4A6H A;  4F7H A;  1UNQ A;  3RCP A;  3QWM A;  1LB1 A;  3MPX A;  1W1H A;  4YL8 A;  4BBK A;  1MI1 A;  3PVL A;  5DH9 B;  2D9Y A;  3PVU A;  3D8D A;  4GPT B;  3KSY A;  5HE0 A;  3TW1 A;  5KQ1 A;  1MIZ B;  1X1F A;  2HTH B;  1ZC3 B;  2D2Q A;  2Z0Q A;  1MKE A;  2COD A;  1AWE A;  3FEH A;  3DXE A;  3SUZ A;  1M7R A;  2DHK A;  4HAV B;  5FI1 A;  5D3V A;  2P0D A;  5EFX A;  3SYX A;  4WSF A;  1XOD A;  5HE1 A;  3KRX A;  4EKU A;  1WGQ A;  1Z87 A;  3PSC A;  3U12 A;  5LON B;  3UZT A;  1WJ1 A;  5DHA B;  2OTX A;  5KQ4 A;  1UNR A;  4EMO A;  3CXB B;  1BTK A;  2K8E A;  5J3T A;  3NSU A;  2EC1 A;  2K2U A;  4CYE A;  1WGU A;  4TKN A;  3QIJ A;  1OMW A;  2I5C A;  2DKQ A;  5IRS A;  2ZKM X;  1H4R A;  2AEH A;  5C5B B;  2NMB A;  2X18 A;  2J59 M;  3DCX A;  1RRP B;  4HDQ A;  1WG7 A;  2ELA A;  1OQN A;  2Q13 A;  3P6A A;  2EJ8 A;  2UVM A;  2NBV A;  3D8E A;  2D9W A;  2GJY A;  1W1G A;  3PVW A;  1K5D B;  5HE2 A;  2Z13 A;  2P8V A;  1J19 A;  1EGX A;  1V5U A;  3B77 A;  2D9X A;  2G35 A;  1K5G B;  1TQZ A;  2KCJ A;  3ODW A;  4H8S A;  1XD4 A;  2DYQ A;  4CSQ A;  1U2B A;  2RGN B;  1OY2 A;  1U5E A;  3T06 A;  4GOU A;  2D10 A;  2I1J A;  5JHG A;  2KIE A;  2YT0 A;  1PLS A;  2GCL A;  1ZSQ A;  3HW2 B;  1ZVR A;  4F7G A;  1QQG A;  5JHH A;  1UNP A;  2ADZ A;  5J3Y A;  2HE7 A;  5L81 A;  4MT7 A;  4OSN A;  2RUK B;  1Y5O A;  3GYO A;  4KAX B;  2YS1 A;  5M4Y B;  2UZS A;  5J3Q A;  3ODX A;  3TO1 A;  4EJN A;  4ZRJ A;  1V89 A;  1DDM A;  1X1G A;  1DDV A;  2DKP A;  2DLW A;  1W1D A;  1UEF A;  5DIF B;  2YRY A;  1U27 A;  1DBH A;  4D0N B;  1V88 A;  2YVC A;  3ODO A;  2RVB B;  5CLQ B;  4HAU B;  3FSS A;  3KRW A;  1U5F A;  2LOX A;  5DI9 B;  2KIG A;  3WYF B;  2KUP A;  1ZC4 B;  1V61 A;  4CHM A;  5KCV A;  2DX5 A;  3KY9 A;  4IAP A;  2D11 A;  3DXC A; 
#chains in the Genus database with same CATH homology
 1MK9 B;  1AQC A;  4DBB A;  3F0W A;  1NI2 A;  1MAI A;  1U29 A;  4L6E A;  2COA A;  5JP4 A;  2Y8F A;  4A6F A;  2Y7B A;  1N3H A;  4HDO A;  1MK7 B;  2RSG A;  5GOW B;  4Z2M B;  2BCJ A;  2Z0P A;  3ULC A;  2YS5 A;  2DX1 A;  4IOY X;  5JLJ B;  1EAZ A;  3VOQ A;  2YSZ A;  1XCG A;  4NY0 A;  1B55 A;  5D27 A;  2COF A;  4KHO A;  2XQN M;  1E5W A;  2N23 A;  2UZR A;  4HAW B;  1J0W A;  1IRS A;  1WI1 A;  2DA0 A;  2YS3 A;  2ZPY A;  1KZ7 A;  2L2I A;  4DXA B;  1DYN A;  3X23 A;  2MKR A;  4HB0 B;  4K2O A;  1BAK A;  4Z2N A;  5DHF B;  2CRF A;  1P6S A;  2IYB A;  4A5K A;  4HAZ B;  1ZM0 A;  2LOZ A;  3KZ1 A;  2K2J A;  1FOE A;  1FB8 A;  3IVF A;  1NU2 A;  2I1K A;  4Y94 A;  3D8F A;  3LJU X;  1H10 A;  4K17 A;  4HHV A;  5FI0 A;  4HB2 B;  2JP2 A;  2VRW B;  5D3Y A;  4HAT B;  1UPQ A;  2PZ1 A;  1PFJ A;  1Y19 B;  1FHW A;  4HB4 B;  2J0M A;  4ZRK A;  2DN6 A;  4TYZ A;  2W2X D;  2LUL A;  3TFM A;  1FGY A;  2EMS A;  3AU4 A;  3M1I B;  2LKO A;  2M14 A;  4ZRI A;  1WJM A;  1V5P A;  4K2P A;  1NTY A;  2MWN B;  2V76 A;  1UPR A;  4A6F B;  4C0A A;  4KHA A;  2EMT A;  2KGX B;  1V5M A;  4K81 A;  3A8P A;  2ELB A;  2MDX A;  3A8Q A;  1FHO A;  5CLL B;  1I2H A;  2QKM A;  3TCA A;  2Y8G A;  3ML4 A;  5C79 A;  4HAX B;  3A98 B;  2W2W A;  1GC6 A;  4WVF B;  3ZVR A;  4YON A;  3HK0 A;  3F5R A;  4GXB A;  2DYN A;  3HQC A;  4NSW A;  3WA0 A;  2DTC A;  1U5D A;  2ROZ B;  1QC6 A;  4P7I A;  4HB3 B;  1KI1 B;  2D4Q A;  1XR0 B;  3DXD A;  3SNH A;  1TJ6 A;  1TXD A;  1PMS A;  2QKL A;  4KHB B;  3O96 A;  3SO6 A;  1ISN A;  4IFS A;  3AJ4 A;  4MY6 A;  4WJ7 A;  2GCJ A;  1X05 A;  4MK0 A;  4A6K A;  3U7D A;  2I5F A;  1BTN A;  5C16 A;  2M38 A;  2E2X A;  2AL6 A;  2J0K A;  3GYP A;  2H7E A;  4CHJ A;  1FHX A;  2D9Z A;  1GG3 A;  2W2X C;  3P7Z A;  3OAN A;  4B6H A;  1EF1 A;  4PNK A;  3PG7 A;  2R0D A;  3ULB A;  1SGH A;  3PEG A;  4GZU A;  3MDB C;  2RNR B;  1DDW A;  1Q67 A;  2DHI A;  1XX0 A;  1KZG A;  3SV1 A;  3N7C A;  4GN1 A;  5D3W A;  1U5G A;  2RLO A;  5C6R A;  1X11 A;  3PZD A;  2FJL A;  2CY4 A;  4KVG B;  1MIX A;  1RJ2 A;  2VKI A;  2CY5 A;  3ZDT A;  4F7U P;  2ROV A;  2J0J A;  4HAY B;  3U8Z A;  2L1C A;  4DX8 A;  5D3X A;  1X86 A;  4DX9 0;  1LW3 A;  1NTV A;  4PQ0 A;  2OQB A;  2DFK A;  1XKE A;  3BJI A;  3PP2 A;  4XWX A;  2NZ8 B;  5C5B A;  1SHC A;  2P0H A;  2D9V A;  1P5T A;  2N0Y A;  1M7E A;  2DHJ A;  3TVV A;  1EVH A;  2YF0 A;  3CIK A;  1P3R A;  4GMX B;  3AU5 A;  2P0F A;  3FM8 C;  3V5W A;  1MPH A;  2COC A;  5LOP B;  2H7D A;  1DRO A;  2VSZ A;  2YT1 A;  1GC7 A;  1BWN A;  2CAY A;  1FGZ A;  1I7A A;  3G9W A;  1FAO A;  1WVH A;  2K00 A;  4GMV A;  3VIA A;  2R09 A;  2MFQ A;  5HE3 A;  2GS0 A;  3QBV B;  2IFS A;  2LG1 A;  2LYD A;  2Z0O A;  3BIN A;  4A6H A;  4F7H A;  1UNQ A;  3RCP A;  3QWM A;  1LB1 A;  3MPX A;  1W1H A;  4YL8 A;  4BBK A;  3PVL A;  5DH9 B;  2D9Y A;  3PVU A;  3D8D A;  4GPT B;  3KSY A;  5HE0 A;  3TW1 A;  5KQ1 A;  1MIZ B;  1X1F A;  2HTH B;  1ZC3 B;  2D2Q A;  2Z0Q A;  1MKE A;  2COD A;  1AWE A;  3FEH A;  3DXE A;  3SUZ A;  1M7R A;  2DHK A;  4HAV B;  5FI1 A;  5D3V A;  2P0D A;  5EFX A;  3SYX A;  4WSF A;  1XOD A;  5HE1 A;  3KRX A;  4EKU A;  1WGQ A;  1Z87 A;  3PSC A;  5LON B;  3UZT A;  1WJ1 A;  5DHA B;  2OTX A;  5KQ4 A;  1UNR A;  4EMO A;  3CXB B;  1BTK A;  5J3T A;  3NSU A;  2EC1 A;  2K2U A;  4CYE A;  1WGU A;  4TKN A;  3QIJ A;  1OMW A;  2I5C A;  2DKQ A;  1H4R A;  2AEH A;  5C5B B;  2NMB A;  2X18 A;  2J59 M;  1RRP B;  4HDQ A;  1WG7 A;  2ELA A;  1OQN A;  2Q13 A;  3P6A A;  2EJ8 A;  2UVM A;  3D8E A;  2D9W A;  2GJY A;  1W1G A;  3PVW A;  1K5D B;  5HE2 A;  2P8V A;  1J19 A;  1EGX A;  1V5U A;  2D9X A;  2G35 A;  1K5G B;  1TQZ A;  2KCJ A;  3ODW A;  4H8S A;  1XD4 A;  2DYQ A;  1U2B A;  2RGN B;  1OY2 A;  1U5E A;  3T06 A;  2D10 A;  2I1J A;  5JHG A;  2YT0 A;  1PLS A;  2GCL A;  1ZSQ A;  3HW2 B;  1ZVR A;  4F7G A;  1QQG A;  5JHH A;  1UNP A;  2ADZ A;  5J3Y A;  2HE7 A;  5L81 A;  4MT7 A;  2RUK B;  1Y5O A;  3GYO A;  4KAX B;  2YS1 A;  2UZS A;  5J3Q A;  3ODX A;  3TO1 A;  4EJN A;  4ZRJ A;  1V89 A;  1DDM A;  1X1G A;  1DDV A;  2DKP A;  2DLW A;  1W1D A;  1UEF A;  5DIF B;  2YRY A;  1U27 A;  1DBH A;  4D0N B;  1V88 A;  2YVC A;  3ODO A;  2RVB B;  5CLQ B;  4HAU B;  3FSS A;  3KRW A;  1U5F A;  2LOX A;  5DI9 B;  3WYF B;  2KUP A;  1ZC4 B;  1V61 A;  4CHM A;  5KCV A;  2DX5 A;  3KY9 A;  4IAP A;  2D11 A;  3DXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...