4A6FA

Crystal structure of slm1-ph domain in complex with phosphoserine
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
117
structure length
105
Chain Sequence
b'PFTEIKSGFLERRSKFLKSYSKGYYVLTPNFLHEFKTADRKKDLVPVMSLALSECTVTEHSRKNSGSDAKFVLHAKQRGHNWVFKADSYESMMSWFDNLKILTST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHOSPHATIDYLINOSITOL 4,5-BISPHOSPHATE-BINDING PROTEIN SLM1
publication title Structural Analyses of Slm1-Ph Domain Demonstrate Ligand Binding in the Non-Canonical Site
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 22
structure length 105
sequence length 117
ec nomenclature
pdb deposition date 2011-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4a6fA00
4Z2MB 1FGYA 2YS3A 4KHOA 2JP2A 1ZC3B 4K17A 3FM8C 4GMVA 1BTNA 1Y19B 5JP4A 2LULA 1MKEA 2Z0PA 1LB1A 2YRYA 4MY6A 1XD4A 3HW2B 3TO1A 3G9WA 4KHBB 2IFSA 2LYDA 2ROZB 2YSZA 1RRPB 2MWNB 4HATB 2GS0A 5JHHA 3PG7A 2ZPYA 3TCAA 4ZRIA 1NTYA 3PSCA 3AU4A 2COFA 3DXDA 3UZTA 2G35A 1MPHA 2EC1A 3OANA 3HK0A 3TW1A 1UNQA 2YVCA 4GZUA 4GMXB 2D9YA 2HTHB 3QIJA 4DX8A 2RLOA 3D8EA 1U5GA 2N23A 5J3QA 5C79A 2Z0OA 2D9WA 1ZC4B 2K2JA 1X11A 2Q13A 3BJIA 3TFMA 2YT0A 1DDVA 1XX0A 2DHKA 1GC7A 2D2QA 2QKLA 4HB3B 4HAWB 4IOYX 5D3WA 5LONB 1SHCA 1MK9B 2UZRA 5HE1A 1OQNA 1QC6A 2EMSA 3ODXA 2NZ8B 4HHVA 2J0KA 1XODA 1FGZA 5KQ4A 1DDMA 4HDQA 2QKMA 1K5DB 4A6HA 1KI1B 2CRFA 1PMSA 1XKEA 2COCA 3PZDA 4K2PA 2DYNA 1J0WA 1RJ2A 3PVWA 1FHOA 2DX5A 1PFJA 2P8VA 5DH9B 5KQ1A 5FI0A 4P7IA 3A8QA 4NSWA 1OY2A 1X86A 2D11A 1EVHA 5J3TA 5HE3A 4KVGB 1FOEA 5J3YA 3RCPA 1EF1A 4XWXA 1KZ7A 1U5FA 2MDXA 3PVUA 3FSSA 1X05A 3N7CA 2OTXA 2P0DA 1NI2A 3MPXA 2LOZA 3O96A 2YS1A 4NY0A 1V5MA 1XCGA 1WGUA 2DHIA 2DN6A 5EFXA 2J59M 2Y7BA 3F0WA 2ELBA 2M14A 4CHMA 5D3XA 2AEHA 3GYOA 2KUPA 3ODWA 1WVHA 3P6AA 3PP2A 1MIXA 1OMWA 1V89A 1EGXA 1W1DA 2VKIA 2Y8FA 4DBBA 1V88A 4DX90 4GPTB 1M7EA 3WA0A 3VOQA 1AQCA 1LW3A 4HAYB 2E2XA 2YT1A 2FJLA 3SV1A 1UPRA 2EJ8A 2NMBA 1XR0B 1P6SA 2P0HA 1WJMA 2DA0A 2DLWA 1UNPA 4PQ0A 1ZVRA 4KHAA 4HB4B 1DYNA 3IVFA 1BWNA 3WYFB 1K5GB 5CLLB 4HAXB 3U8ZA 2M38A 3CXBB 4CHJA 2DKQA 2N0YA 1UPQA 2XQNM 1UEFA 2L2IA 3P7ZA 5JLJB 1DDWA 1TQZA 2LOXA 1ISNA 5LOPB 1Y5OA 2DKPA 2RSGA 4IAPA 2H7EA 2CY4A 2YS5A 3KSYA 4A5KA 2I5FA 2X18A 5DHFB 2J0MA 4H8SA 3GYPA 2RGNB 2K2UA 3M1IB 2UZSA 5DIFB 3BINA 4EMOA 4PNKA 3KY9A 1B55A 1E5WA 1P5TA 2AL6A 5C5BA 4Y94A 4C0AA 1N3HA 2DFKA 4GXBA 2BCJA 2GJYA 4A6FA 5D27A 1X1FA 3ZVRA 2Y8GA 1U29A 3D8DA 2CY5A 4HAZB 1Z87A 3ULBA 1TJ6A 4HDOA 2CODA 3CIKA 1IRSA 2I1KA 5C16A 1AWEA 1KZGA 1W1HA 1ZSQA 2ROVA 3FEHA 1GG3A 4WSFA 5HE2A 3KZ1A 1DROA 1Q67A 2KGXB 2D9XA 3KRWA 1WGQA 3SUZA 1EAZA 1GC6A 1BAKA 4WJ7A 1FAOA 1FHXA 1U27A 2GCLA 4MT7A 1MAIA 2J0JA 5D3VA 4EKUA 2R09A 3PVLA 3VIAA 2LG1A 5GOWB 4D0NB 3MDBC 2ELAA 1V5UA 2L1CA 1NTVA 2HE7A 3X23A 2VRWB 3AU5A 2GCJA 3D8FA 2DHJA 3A98B 2D9VA 4F7HA 1WI1A 1MIZB 5FI1A 2PZ1A 1I7AA 1NU2A 1FB8A 2MKRA 4YONA 5JHGA 2UVMA 2ADZA 2DX1A 2RNRB 4A6KA 1DBHA 2H7DA 2I5CA 3HQCA 1WJ1A 3A8PA 4EJNA 3SYXA 5DI9B 3QWMA 2YF0A 2KCJA 4Z2NA 3DXEA 2RVBB 2MFQA 2P0FA 5DHAB 3ML4A 2D10A 2D9ZA 4BBKA 3F5RA 2W2WA 1H10A 4HAUB 2LKOA 3V5WA 1TXDA 4TKNA 3SNHA 5D3YA 1UNRA 4K2OA 2EMTA 5CLQB 1U5EA 4F7UP 1MK7B 4TYZA 1W1GA 5C5BB 1H4RA 3NSUA 2R0DA 4L6EA 3LJUX 2I1JA 2IYBA 3AJ4A 4A6FB 2K00A 1FHWA 1WG7A 2W2XC 3PEGA 4HB0B 4DXAB 4HAVB 4WVFB 4GN1A 5HE0A 2COAA 3SO6A 4K81A 1U2BA 4CYEA 3ZDTA 3U7DA 3ODOA 1U5DA 1I2HA 2VSZA 3DXCA 1QQGA 1X1GA 4YL8A 2V76A 4F7GA 4KAXB 3T06A 4HB2B 4ZRJA 4B6HA 2Z0QA 2RUKB 3ULCA 2DTCA 4ZRKA 2CAYA 1J19A 2D4QA 3TVVA 1P3RA 1V61A 1ZM0A 2DYQA 4MK0A 2OQBA 4IFSA 5C6RA 1PLSA 5L81A 5KCVA 3QBVB 1M7RA 3KRXA 1SGHA 1V5PA 1BTKA 2W2XD
chains in the Genus database with same CATH superfamily
4Z2MB 1FGYA 2YS3A 3A58A 2JP2A 4KHOA 1ZC3B 4K17A 3FM8C 4GMVA 1BTNA 1Y19B 5JP4A 2LULA 1MKEA 2Z0PA 1LB1A 2YRYA 2YT2A 4MY6A 1XD4A 3HW2B 3TO1A 3G9WA 4KHBB 2IFSA 2LYDA 2ROZB 2YSZA 1RRPB 2MWNB 4HATB 2GS0A 5JHHA 3PG7A 2ZPYA 3TCAA 4ZRIA 4HSIA 1NTYA 3PSCA 3AU4A 2COFA 3DXDA 3UZTA 1ZYIA 2G35A 1MPHA 2EC1A 3OANA 3HK0A 3TW1A 1UNQA 2YVCA 4GZUA 4GMXB 2D9YA 2HTHB 3QIJA 4DX8A 2RLOA 3D8EA 1U5GA 2N23A 5J3QA 5C79A 2Z0OA 2D9WA 1ZC4B 2K2JA 1X11A 2Q13A 3BJIA 3TFMA 2YT0A 3B77A 1DDVA 1XX0A 2DHKA 1GC7A 2D2QA 2QKLA 4HB3B 4HAWB 4IOYX 5D3WA 5LONB 1SHCA 1MK9B 2UZRA 5HE1A 1OQNA 1QC6A 2EMSA 3ODXA 4DIXA 2NZ8B 4HHVA 2J0KA 1XODA 1FGZA 5KQ4A 3HIEA 1DDMA 3HSAA 4HDQA 2QKMA 1K5DB 4A6HA 1KI1B 2CRFA 1PMSA 1XKEA 2COCA 3PZDA 4K2PA 2DYNA 1J0WA 3U12A 3FVCA 1RJ2A 3PVWA 1FHOA 2DX5A 1PFJA 2P8VA 4GOUA 5DH9B 5KQ1A 5FI0A 4P7IA 3A8QA 4NSWA 2FJUB 1OY2A 1X86A 2D11A 1EVHA 5J3TA 5HE3A 4KVGB 1FOEA 5J3YA 3RCPA 1EF1A 4XWXA 1KZ7A 1U5FA 2MDXA 3PVUA 3FSSA 1X05A 3N7CA 1T77A 2OTXA 2P0DA 1NI2A 3MPXA 2LOZA 3O96A 2YS1A 4NY0A 2KR0A 1V5MA 1XCGA 1WGUA 2DHIA 2DN6A 5EFXA 2J59M 2Y7BA 3F0WA 2ELBA 2M14A 4CHMA 5D3XA 2AEHA 3GYOA 2KUPA 2RRFA 3ODWA 1WVHA 3NW8A 3P6AA 3PP2A 1MIXA 1OMWA 4OSNA 1V89A 1EGXA 1W1DA 2VKIA 2Y8FA 4DBBA 1V88A 4DX90 4GPTB 1M7EA 3WA0A 3NWDA 3VOQA 1AQCA 1LW3A 4HAYB 2E2XA 2YT1A 2FJLA 3SV1A 1UPRA 2EJ8A 2NMBA 1XR0B 1P6SA 2P0HA 1WJMA 2DA0A 2DLWA 1UNPA 4PQ0A 1ZVRA 4KHAA 4HB4B 1DYNA 3IVFA 1BWNA 3WYFB 1K5GB 5CLLB 4HAXB 3U8ZA 2M38A 3CXBB 4CHJA 2DKQA 3NWFA 2N0YA 1UPQA 2XQNM 1UEFA 2L2IA 3P7ZA 5JLJB 1DDWA 2KIGA 1TQZA 2LOXA 1ISNA 5LOPB 1Y5OA 2DKPA 2RSGA 4IAPA 2H7EA 2CY4A 2YS5A 3KSYA 4A5KA 2I5FA 2X18A 5DHFB 2J0MA 4H8SA 3GYPA 2RGNB 2K2UA 2GUMA 3M1IB 2UZSA 5DIFB 3BINA 4EMOA 4PNKA 3KY9A 4OT1A 1B55A 1E5WA 1P5TA 2AL6A 5C5BA 4Y94A 5I2MA 4C0AA 1N3HA 2DFKA 4GXBA 2BCJA 2GJYA 4A6FA 5D27A 1X1FA 3ZVRA 2Y8GA 1U29A 3D8DA 2CY5A 4HAZB 1Z87A 3ULBA 1TJ6A 4QJ4B 4HDOA 2CODA 3CIKA 1IRSA 2KUQA 2I1KA 5C16A 1AWEA 1KZGA 1W1HA 1ZSQA 2ROVA 3FEHA 1MI1A 1GG3A 4WSFA 5HE2A 3KZ1A 1DROA 1Q67A 2KGXB 2D9XA 4QJ3B 3KRWA 1WGQA 3SUZA 1EAZA 1GC6A 2Z14A 1BAKA 4WJ7A 4QJ5B 1FAOA 1FHXA 2R2YA 1U27A 2GCLA 4MT7A 1MAIA 5I2SA 2J0JA 5D3VA 4EKUA 2Z13A 2R09A 3DCXA 3PVLA 3VIAA 5IRSA 2LG1A 5GOWB 4D0NB 3MDBC 2ELAA 1V5UA 4GNKB 2L1CA 1NTVA 2HE7A 3X23A 2VRWB 3AU5A 2GCJA 3D8FA 2DHJA 3A98B 2D9VA 4F7HA 1WI1A 1MIZB 5FI1A 2PZ1A 1I7AA 1NU2A 1FB8A 2MKRA 4YONA 2ZKMX 5JHGA 2UVMA 2ADZA 2DX1A 2RNRB 4A6KA 1DBHA 2H7DA 2I5CA 3HQCA 1WJ1A 3A8PA 4KHBA 4EJNA 4CSQA 3SYXA 5DI9B 3QWMA 2YF0A 2KCJA 4Z2NA 3DXEA 2RVBB 2MFQA 2P0FA 2K49A 5DHAB 4D6WA 3ML4A 2D10A 2D9ZA 4BBKA 3F5RA 2W2WA 1H10A 4HAUB 2LKOA 3V5WA 1TXDA 4TKNA 3SNHA 5D3YA 1UNRA 4K2OA 2EMTA 5CLQB 2Z4DA 1U5EA 4F7UP 1MK7B 4TYZA 1W1GA 5C5BB 5LG4B 2K8EA 3NWAA 1H4RA 3NSUA 2R0DA 2Z59A 2NBVA 3LJUX 4L6EA 2I1JA 2IYBA 3AJ4A 4A6FB 2K00A 1FHWA 1WG7A 2W2XC 3PEGA 4HB0B 4DXAB 4HAVB 4WVFB 4L1RA 4GN1A 5HE0A 2COAA 3SO6A 5M4YB 4K81A 1U2BA 4CYEA 3ZDTA 3U7DA 3ODOA 1U5DA 1I2HA 2VSZA 3DXCA 1QQGA 1X1GA 4YL8A 2V76A 4F7GA 4KAXB 3OHMB 3T06A 4HB2B 4ZRJA 4QXAB 4B6HA 2Z0QA 2RUKB 3ULCA 2DTCA 4ZRKA 2CAYA 1J19A 2D4QA 3TVVA 1P3RA 1V61A 1ZM0A 2KIEA 2DYQA 4MK0A 2OQBA 4IFSA 5C6RA 1PLSA 5L81A 5KCVA 3QBVB 1M7RA 3KRXA 1SGHA 1V5PA 1BTKA 2W2XD
chains in the Genus database with same CATH topology
4Z2MB 1FGYA 2YS3A 4KHOA 2JP2A 1ZC3B 4K17A 3FM8C 4GMVA 1BTNA 1Y19B 5JP4A 2LULA 1MKEA 2Z0PA 1LB1A 2YRYA 4MY6A 1XD4A 3HW2B 3TO1A 3G9WA 4KHBB 2IFSA 2LYDA 2ROZB 2YSZA 1RRPB 2MWNB 4HATB 2GS0A 5JHHA 3PG7A 2ZPYA 3TCAA 4ZRIA 1NTYA 3PSCA 3AU4A 2COFA 3DXDA 3UZTA 2G35A 1MPHA 2EC1A 3OANA 3HK0A 3TW1A 1UNQA 2YVCA 4GZUA 4GMXB 2D9YA 2HTHB 3QIJA 4DX8A 2RLOA 3D8EA 1U5GA 2N23A 5J3QA 5C79A 2Z0OA 2D9WA 1ZC4B 2K2JA 1X11A 2Q13A 3BJIA 3TFMA 2YT0A 1DDVA 1XX0A 2DHKA 1GC7A 2D2QA 2QKLA 4HB3B 4HAWB 4IOYX 5D3WA 5LONB 1SHCA 1MK9B 2UZRA 5HE1A 1OQNA 1QC6A 2EMSA 3ODXA 2NZ8B 4HHVA 2J0KA 1XODA 1FGZA 5KQ4A 1DDMA 4HDQA 2QKMA 1K5DB 4A6HA 1KI1B 2CRFA 1PMSA 1XKEA 2COCA 3PZDA 4K2PA 2DYNA 1J0WA 1RJ2A 3PVWA 1FHOA 2DX5A 1PFJA 2P8VA 5DH9B 5KQ1A 5FI0A 4P7IA 3A8QA 4NSWA 1OY2A 1X86A 2D11A 1EVHA 5J3TA 5HE3A 4KVGB 1FOEA 5J3YA 3RCPA 1EF1A 4XWXA 1KZ7A 1U5FA 2MDXA 3PVUA 3FSSA 1X05A 3N7CA 2OTXA 2P0DA 1NI2A 3MPXA 2LOZA 3O96A 2YS1A 4NY0A 1V5MA 1XCGA 1WGUA 2DHIA 2DN6A 5EFXA 2J59M 2Y7BA 3F0WA 2ELBA 2M14A 4CHMA 5D3XA 2AEHA 3GYOA 2KUPA 3ODWA 1WVHA 3P6AA 3PP2A 1MIXA 1OMWA 1V89A 1EGXA 1W1DA 2VKIA 2Y8FA 4DBBA 1V88A 4DX90 4GPTB 1M7EA 3WA0A 3VOQA 1AQCA 1LW3A 4HAYB 2E2XA 2YT1A 2FJLA 3SV1A 1UPRA 2EJ8A 2NMBA 1XR0B 1P6SA 2P0HA 1WJMA 2DA0A 2DLWA 1UNPA 4PQ0A 1ZVRA 4KHAA 4HB4B 1DYNA 3IVFA 1BWNA 3WYFB 1K5GB 5CLLB 4HAXB 3U8ZA 2M38A 3CXBB 4CHJA 2DKQA 2N0YA 1UPQA 2XQNM 1UEFA 2L2IA 3P7ZA 5JLJB 1DDWA 1TQZA 2LOXA 1ISNA 5LOPB 1Y5OA 2DKPA 2RSGA 4IAPA 2H7EA 2CY4A 2YS5A 3KSYA 4A5KA 2I5FA 2X18A 5DHFB 2J0MA 4H8SA 3GYPA 2RGNB 2K2UA 3M1IB 2UZSA 5DIFB 3BINA 4EMOA 4PNKA 3KY9A 1B55A 1E5WA 1P5TA 2AL6A 5C5BA 4Y94A 4C0AA 1N3HA 2DFKA 4GXBA 2BCJA 2GJYA 4A6FA 5D27A 1X1FA 3ZVRA 2Y8GA 1U29A 3D8DA 2CY5A 4HAZB 1Z87A 3ULBA 1TJ6A 4HDOA 2CODA 3CIKA 1IRSA 2I1KA 5C16A 1AWEA 1KZGA 1W1HA 1ZSQA 2ROVA 3FEHA 1GG3A 4WSFA 5HE2A 3KZ1A 1DROA 1Q67A 2KGXB 2D9XA 3KRWA 1WGQA 3SUZA 1EAZA 1GC6A 1BAKA 4WJ7A 1FAOA 1FHXA 1U27A 2GCLA 4MT7A 1MAIA 2J0JA 5D3VA 4EKUA 2R09A 3PVLA 3VIAA 2LG1A 5GOWB 4D0NB 3MDBC 2ELAA 1V5UA 2L1CA 1NTVA 2HE7A 3X23A 2VRWB 3AU5A 2GCJA 3D8FA 2DHJA 3A98B 2D9VA 4F7HA 1WI1A 1MIZB 5FI1A 2PZ1A 1I7AA 1NU2A 1FB8A 2MKRA 4YONA 5JHGA 2UVMA 2ADZA 2DX1A 2RNRB 4A6KA 1DBHA 2H7DA 2I5CA 3HQCA 1WJ1A 3A8PA 4EJNA 3SYXA 5DI9B 3QWMA 2YF0A 2KCJA 4Z2NA 3DXEA 2RVBB 2MFQA 2P0FA 5DHAB 3ML4A 2D10A 2D9ZA 4BBKA 3F5RA 2W2WA 1H10A 4HAUB 2LKOA 3V5WA 1TXDA 4TKNA 3SNHA 5D3YA 1UNRA 4K2OA 2EMTA 5CLQB 1U5EA 4F7UP 1MK7B 4TYZA 1W1GA 5C5BB 1H4RA 3NSUA 2R0DA 4L6EA 3LJUX 2I1JA 2IYBA 3AJ4A 4A6FB 2K00A 1FHWA 1WG7A 2W2XC 3PEGA 4HB0B 4DXAB 4HAVB 4WVFB 4GN1A 5HE0A 2COAA 3SO6A 4K81A 1U2BA 4CYEA 3ZDTA 3U7DA 3ODOA 1U5DA 1I2HA 2VSZA 3DXCA 1QQGA 1X1GA 4YL8A 2V76A 4F7GA 4KAXB 3T06A 4HB2B 4ZRJA 4B6HA 2Z0QA 2RUKB 3ULCA 2DTCA 4ZRKA 2CAYA 1J19A 2D4QA 3TVVA 1P3RA 1V61A 1ZM0A 2DYQA 4MK0A 2OQBA 4IFSA 5C6RA 1PLSA 5L81A 5KCVA 3QBVB 1M7RA 3KRXA 1SGHA 1V5PA 1BTKA 2W2XD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z2M B;  1FGY A;  2YS3 A;  4KHO A;  2JP2 A;  1ZC3 B;  4K17 A;  3FM8 C;  4GMV A;  1BTN A;  1Y19 B;  5JP4 A;  2LUL A;  1MKE A;  2Z0P A;  1LB1 A;  2YRY A;  4MY6 A;  1XD4 A;  3HW2 B;  3TO1 A;  3G9W A;  4KHB B;  2IFS A;  2LYD A;  2ROZ B;  2YSZ A;  1RRP B;  2MWN B;  4HAT B;  2GS0 A;  5JHH A;  3PG7 A;  2ZPY A;  3TCA A;  4ZRI A;  1NTY A;  3PSC A;  3AU4 A;  2COF A;  3DXD A;  3UZT A;  2G35 A;  1MPH A;  2EC1 A;  3OAN A;  3HK0 A;  3TW1 A;  1UNQ A;  2YVC A;  4GZU A;  4GMX B;  2D9Y A;  2HTH B;  3QIJ A;  4DX8 A;  2RLO A;  3D8E A;  1U5G A;  2N23 A;  5J3Q A;  5C79 A;  2Z0O A;  2D9W A;  1ZC4 B;  2K2J A;  1X11 A;  2Q13 A;  3BJI A;  3TFM A;  2YT0 A;  1DDV A;  1XX0 A;  2DHK A;  1GC7 A;  2D2Q A;  2QKL A;  4HB3 B;  4HAW B;  4IOY X;  5D3W A;  5LON B;  1SHC A;  1MK9 B;  2UZR A;  5HE1 A;  1OQN A;  1QC6 A;  2EMS A;  3ODX A;  2NZ8 B;  4HHV A;  2J0K A;  1XOD A;  1FGZ A;  5KQ4 A;  1DDM A;  4HDQ A;  2QKM A;  1K5D B;  4A6H A;  1KI1 B;  2CRF A;  1PMS A;  1XKE A;  2COC A;  3PZD A;  4K2P A;  2DYN A;  1J0W A;  1RJ2 A;  3PVW A;  1FHO A;  2DX5 A;  1PFJ A;  2P8V A;  5DH9 B;  5KQ1 A;  5FI0 A;  4P7I A;  3A8Q A;  4NSW A;  1OY2 A;  1X86 A;  2D11 A;  1EVH A;  5J3T A;  5HE3 A;  4KVG B;  1FOE A;  5J3Y A;  3RCP A;  1EF1 A;  4XWX A;  1KZ7 A;  1U5F A;  2MDX A;  3PVU A;  3FSS A;  1X05 A;  3N7C A;  2OTX A;  2P0D A;  1NI2 A;  3MPX A;  2LOZ A;  3O96 A;  2YS1 A;  4NY0 A;  1V5M A;  1XCG A;  1WGU A;  2DHI A;  2DN6 A;  5EFX A;  2J59 M;  2Y7B A;  3F0W A;  2ELB A;  2M14 A;  4CHM A;  5D3X A;  2AEH A;  3GYO A;  2KUP A;  3ODW A;  1WVH A;  3P6A A;  3PP2 A;  1MIX A;  1OMW A;  1V89 A;  1EGX A;  1W1D A;  2VKI A;  2Y8F A;  4DBB A;  1V88 A;  4DX9 0;  4GPT B;  1M7E A;  3WA0 A;  3VOQ A;  1AQC A;  1LW3 A;  4HAY B;  2E2X A;  2YT1 A;  2FJL A;  3SV1 A;  1UPR A;  2EJ8 A;  2NMB A;  1XR0 B;  1P6S A;  2P0H A;  1WJM A;  2DA0 A;  2DLW A;  1UNP A;  4PQ0 A;  1ZVR A;  4KHA A;  4HB4 B;  1DYN A;  3IVF A;  1BWN A;  3WYF B;  1K5G B;  5CLL B;  4HAX B;  3U8Z A;  2M38 A;  3CXB B;  4CHJ A;  2DKQ A;  2N0Y A;  1UPQ A;  2XQN M;  1UEF A;  2L2I A;  3P7Z A;  5JLJ B;  1DDW A;  1TQZ A;  2LOX A;  1ISN A;  5LOP B;  1Y5O A;  2DKP A;  2RSG A;  4IAP A;  2H7E A;  2CY4 A;  2YS5 A;  3KSY A;  4A5K A;  2I5F A;  2X18 A;  5DHF B;  2J0M A;  4H8S A;  3GYP A;  2RGN B;  2K2U A;  3M1I B;  2UZS A;  5DIF B;  3BIN A;  4EMO A;  4PNK A;  3KY9 A;  1B55 A;  1E5W A;  1P5T A;  2AL6 A;  5C5B A;  4Y94 A;  4C0A A;  1N3H A;  2DFK A;  4GXB A;  2BCJ A;  2GJY A;  4A6F A;  5D27 A;  1X1F A;  3ZVR A;  2Y8G A;  1U29 A;  3D8D A;  2CY5 A;  4HAZ B;  1Z87 A;  3ULB A;  1TJ6 A;  4HDO A;  2COD A;  3CIK A;  1IRS A;  2I1K A;  5C16 A;  1AWE A;  1KZG A;  1W1H A;  1ZSQ A;  2ROV A;  3FEH A;  1GG3 A;  4WSF A;  5HE2 A;  3KZ1 A;  1DRO A;  1Q67 A;  2KGX B;  2D9X A;  3KRW A;  1WGQ A;  3SUZ A;  1EAZ A;  1GC6 A;  1BAK A;  4WJ7 A;  1FAO A;  1FHX A;  1U27 A;  2GCL A;  4MT7 A;  1MAI A;  2J0J A;  5D3V A;  4EKU A;  2R09 A;  3PVL A;  3VIA A;  2LG1 A;  5GOW B;  4D0N B;  3MDB C;  2ELA A;  1V5U A;  2L1C A;  1NTV A;  2HE7 A;  3X23 A;  2VRW B;  3AU5 A;  2GCJ A;  3D8F A;  2DHJ A;  3A98 B;  2D9V A;  4F7H A;  1WI1 A;  1MIZ B;  5FI1 A;  2PZ1 A;  1I7A A;  1NU2 A;  1FB8 A;  2MKR A;  4YON A;  5JHG A;  2UVM A;  2ADZ A;  2DX1 A;  2RNR B;  4A6K A;  1DBH A;  2H7D A;  2I5C A;  3HQC A;  1WJ1 A;  3A8P A;  4EJN A;  3SYX A;  5DI9 B;  3QWM A;  2YF0 A;  2KCJ A;  4Z2N A;  3DXE A;  2RVB B;  2MFQ A;  2P0F A;  5DHA B;  3ML4 A;  2D10 A;  2D9Z A;  4BBK A;  3F5R A;  2W2W A;  1H10 A;  4HAU B;  2LKO A;  3V5W A;  1TXD A;  4TKN A;  3SNH A;  5D3Y A;  1UNR A;  4K2O A;  2EMT A;  5CLQ B;  1U5E A;  4F7U P;  1MK7 B;  4TYZ A;  1W1G A;  5C5B B;  1H4R A;  3NSU A;  2R0D A;  4L6E A;  3LJU X;  2I1J A;  2IYB A;  3AJ4 A;  4A6F B;  2K00 A;  1FHW A;  1WG7 A;  2W2X C;  3PEG A;  4HB0 B;  4DXA B;  4HAV B;  4WVF B;  4GN1 A;  5HE0 A;  2COA A;  3SO6 A;  4K81 A;  1U2B A;  4CYE A;  3ZDT A;  3U7D A;  3ODO A;  1U5D A;  1I2H A;  2VSZ A;  3DXC A;  1QQG A;  1X1G A;  4YL8 A;  2V76 A;  4F7G A;  4KAX B;  3T06 A;  4HB2 B;  4ZRJ A;  4B6H A;  2Z0Q A;  2RUK B;  3ULC A;  2DTC A;  4ZRK A;  2CAY A;  1J19 A;  2D4Q A;  3TVV A;  1P3R A;  1V61 A;  1ZM0 A;  2DYQ A;  4MK0 A;  2OQB A;  4IFS A;  5C6R A;  1PLS A;  5L81 A;  5KCV A;  3QBV B;  1M7R A;  3KRX A;  1SGH A;  1V5P A;  1BTK A;  2W2X D; 
#chains in the Genus database with same CATH topology
 4Z2M B;  1FGY A;  2YS3 A;  3A58 A;  2JP2 A;  4KHO A;  1ZC3 B;  4K17 A;  3FM8 C;  4GMV A;  1BTN A;  1Y19 B;  5JP4 A;  2LUL A;  1MKE A;  2Z0P A;  1LB1 A;  2YRY A;  2YT2 A;  4MY6 A;  1XD4 A;  3HW2 B;  3TO1 A;  3G9W A;  4KHB B;  2IFS A;  2LYD A;  2ROZ B;  2YSZ A;  1RRP B;  2MWN B;  4HAT B;  2GS0 A;  5JHH A;  3PG7 A;  2ZPY A;  3TCA A;  4ZRI A;  4HSI A;  1NTY A;  3PSC A;  3AU4 A;  2COF A;  3DXD A;  3UZT A;  1ZYI A;  2G35 A;  1MPH A;  2EC1 A;  3OAN A;  3HK0 A;  3TW1 A;  1UNQ A;  2YVC A;  4GZU A;  4GMX B;  2D9Y A;  2HTH B;  3QIJ A;  4DX8 A;  2RLO A;  3D8E A;  1U5G A;  2N23 A;  5J3Q A;  5C79 A;  2Z0O A;  2D9W A;  1ZC4 B;  2K2J A;  1X11 A;  2Q13 A;  3BJI A;  3TFM A;  2YT0 A;  3B77 A;  1DDV A;  1XX0 A;  2DHK A;  1GC7 A;  2D2Q A;  2QKL A;  4HB3 B;  4HAW B;  4IOY X;  5D3W A;  5LON B;  1SHC A;  1MK9 B;  2UZR A;  5HE1 A;  1OQN A;  1QC6 A;  2EMS A;  3ODX A;  4DIX A;  2NZ8 B;  4HHV A;  2J0K A;  1XOD A;  1FGZ A;  5KQ4 A;  3HIE A;  1DDM A;  3HSA A;  4HDQ A;  2QKM A;  1K5D B;  4A6H A;  1KI1 B;  2CRF A;  1PMS A;  1XKE A;  2COC A;  3PZD A;  4K2P A;  2DYN A;  1J0W A;  3U12 A;  3FVC A;  1RJ2 A;  3PVW A;  1FHO A;  2DX5 A;  1PFJ A;  2P8V A;  4GOU A;  5DH9 B;  5KQ1 A;  5FI0 A;  4P7I A;  3A8Q A;  4NSW A;  2FJU B;  1OY2 A;  1X86 A;  2D11 A;  1EVH A;  5J3T A;  5HE3 A;  4KVG B;  1FOE A;  5J3Y A;  3RCP A;  1EF1 A;  4XWX A;  1KZ7 A;  1U5F A;  2MDX A;  3PVU A;  3FSS A;  1X05 A;  3N7C A;  1T77 A;  2OTX A;  2P0D A;  1NI2 A;  3MPX A;  2LOZ A;  3O96 A;  2YS1 A;  4NY0 A;  2KR0 A;  1V5M A;  1XCG A;  1WGU A;  2DHI A;  2DN6 A;  5EFX A;  2J59 M;  2Y7B A;  3F0W A;  2ELB A;  2M14 A;  4CHM A;  5D3X A;  2AEH A;  3GYO A;  2KUP A;  2RRF A;  3ODW A;  1WVH A;  3NW8 A;  3P6A A;  3PP2 A;  1MIX A;  1OMW A;  4OSN A;  1V89 A;  1EGX A;  1W1D A;  2VKI A;  2Y8F A;  4DBB A;  1V88 A;  4DX9 0;  4GPT B;  1M7E A;  3WA0 A;  3NWD A;  3VOQ A;  1AQC A;  1LW3 A;  4HAY B;  2E2X A;  2YT1 A;  2FJL A;  3SV1 A;  1UPR A;  2EJ8 A;  2NMB A;  1XR0 B;  1P6S A;  2P0H A;  1WJM A;  2DA0 A;  2DLW A;  1UNP A;  4PQ0 A;  1ZVR A;  4KHA A;  4HB4 B;  1DYN A;  3IVF A;  1BWN A;  3WYF B;  1K5G B;  5CLL B;  4HAX B;  3U8Z A;  2M38 A;  3CXB B;  4CHJ A;  2DKQ A;  3NWF A;  2N0Y A;  1UPQ A;  2XQN M;  1UEF A;  2L2I A;  3P7Z A;  5JLJ B;  1DDW A;  2KIG A;  1TQZ A;  2LOX A;  1ISN A;  5LOP B;  1Y5O A;  2DKP A;  2RSG A;  4IAP A;  2H7E A;  2CY4 A;  2YS5 A;  3KSY A;  4A5K A;  2I5F A;  2X18 A;  5DHF B;  2J0M A;  4H8S A;  3GYP A;  2RGN B;  2K2U A;  2GUM A;  3M1I B;  2UZS A;  5DIF B;  3BIN A;  4EMO A;  4PNK A;  3KY9 A;  4OT1 A;  1B55 A;  1E5W A;  1P5T A;  2AL6 A;  5C5B A;  4Y94 A;  5I2M A;  4C0A A;  1N3H A;  2DFK A;  4GXB A;  2BCJ A;  2GJY A;  4A6F A;  5D27 A;  1X1F A;  3ZVR A;  2Y8G A;  1U29 A;  3D8D A;  2CY5 A;  4HAZ B;  1Z87 A;  3ULB A;  1TJ6 A;  4QJ4 B;  4HDO A;  2COD A;  3CIK A;  1IRS A;  2KUQ A;  2I1K A;  5C16 A;  1AWE A;  1KZG A;  1W1H A;  1ZSQ A;  2ROV A;  3FEH A;  1MI1 A;  1GG3 A;  4WSF A;  5HE2 A;  3KZ1 A;  1DRO A;  1Q67 A;  2KGX B;  2D9X A;  4QJ3 B;  3KRW A;  1WGQ A;  3SUZ A;  1EAZ A;  1GC6 A;  2Z14 A;  1BAK A;  4WJ7 A;  4QJ5 B;  1FAO A;  1FHX A;  2R2Y A;  1U27 A;  2GCL A;  4MT7 A;  1MAI A;  5I2S A;  2J0J A;  5D3V A;  4EKU A;  2Z13 A;  2R09 A;  3DCX A;  3PVL A;  3VIA A;  5IRS A;  2LG1 A;  5GOW B;  4D0N B;  3MDB C;  2ELA A;  1V5U A;  4GNK B;  2L1C A;  1NTV A;  2HE7 A;  3X23 A;  2VRW B;  3AU5 A;  2GCJ A;  3D8F A;  2DHJ A;  3A98 B;  2D9V A;  4F7H A;  1WI1 A;  1MIZ B;  5FI1 A;  2PZ1 A;  1I7A A;  1NU2 A;  1FB8 A;  2MKR A;  4YON A;  2ZKM X;  5JHG A;  2UVM A;  2ADZ A;  2DX1 A;  2RNR B;  4A6K A;  1DBH A;  2H7D A;  2I5C A;  3HQC A;  1WJ1 A;  3A8P A;  4KHB A;  4EJN A;  4CSQ A;  3SYX A;  5DI9 B;  3QWM A;  2YF0 A;  2KCJ A;  4Z2N A;  3DXE A;  2RVB B;  2MFQ A;  2P0F A;  2K49 A;  5DHA B;  4D6W A;  3ML4 A;  2D10 A;  2D9Z A;  4BBK A;  3F5R A;  2W2W A;  1H10 A;  4HAU B;  2LKO A;  3V5W A;  1TXD A;  4TKN A;  3SNH A;  5D3Y A;  1UNR A;  4K2O A;  2EMT A;  5CLQ B;  2Z4D A;  1U5E A;  4F7U P;  1MK7 B;  4TYZ A;  1W1G A;  5C5B B;  5LG4 B;  2K8E A;  3NWA A;  1H4R A;  3NSU A;  2R0D A;  2Z59 A;  2NBV A;  3LJU X;  4L6E A;  2I1J A;  2IYB A;  3AJ4 A;  4A6F B;  2K00 A;  1FHW A;  1WG7 A;  2W2X C;  3PEG A;  4HB0 B;  4DXA B;  4HAV B;  4WVF B;  4L1R A;  4GN1 A;  5HE0 A;  2COA A;  3SO6 A;  5M4Y B;  4K81 A;  1U2B A;  4CYE A;  3ZDT A;  3U7D A;  3ODO A;  1U5D A;  1I2H A;  2VSZ A;  3DXC A;  1QQG A;  1X1G A;  4YL8 A;  2V76 A;  4F7G A;  4KAX B;  3OHM B;  3T06 A;  4HB2 B;  4ZRJ A;  4QXA B;  4B6H A;  2Z0Q A;  2RUK B;  3ULC A;  2DTC A;  4ZRK A;  2CAY A;  1J19 A;  2D4Q A;  3TVV A;  1P3R A;  1V61 A;  1ZM0 A;  2KIE A;  2DYQ A;  4MK0 A;  2OQB A;  4IFS A;  5C6R A;  1PLS A;  5L81 A;  5KCV A;  3QBV B;  1M7R A;  3KRX A;  1SGH A;  1V5P A;  1BTK A;  2W2X D; 
#chains in the Genus database with same CATH homology
 4Z2M B;  1FGY A;  2YS3 A;  4KHO A;  2JP2 A;  1ZC3 B;  4K17 A;  3FM8 C;  4GMV A;  1BTN A;  1Y19 B;  5JP4 A;  2LUL A;  1MKE A;  2Z0P A;  1LB1 A;  2YRY A;  4MY6 A;  1XD4 A;  3HW2 B;  3TO1 A;  3G9W A;  4KHB B;  2IFS A;  2LYD A;  2ROZ B;  2YSZ A;  1RRP B;  2MWN B;  4HAT B;  2GS0 A;  5JHH A;  3PG7 A;  2ZPY A;  3TCA A;  4ZRI A;  1NTY A;  3PSC A;  3AU4 A;  2COF A;  3DXD A;  3UZT A;  2G35 A;  1MPH A;  2EC1 A;  3OAN A;  3HK0 A;  3TW1 A;  1UNQ A;  2YVC A;  4GZU A;  4GMX B;  2D9Y A;  2HTH B;  3QIJ A;  4DX8 A;  2RLO A;  3D8E A;  1U5G A;  2N23 A;  5J3Q A;  5C79 A;  2Z0O A;  2D9W A;  1ZC4 B;  2K2J A;  1X11 A;  2Q13 A;  3BJI A;  3TFM A;  2YT0 A;  1DDV A;  1XX0 A;  2DHK A;  1GC7 A;  2D2Q A;  2QKL A;  4HB3 B;  4HAW B;  4IOY X;  5D3W A;  5LON B;  1SHC A;  1MK9 B;  2UZR A;  5HE1 A;  1OQN A;  1QC6 A;  2EMS A;  3ODX A;  2NZ8 B;  4HHV A;  2J0K A;  1XOD A;  1FGZ A;  5KQ4 A;  1DDM A;  4HDQ A;  2QKM A;  1K5D B;  4A6H A;  1KI1 B;  2CRF A;  1PMS A;  1XKE A;  2COC A;  3PZD A;  4K2P A;  2DYN A;  1J0W A;  1RJ2 A;  3PVW A;  1FHO A;  2DX5 A;  1PFJ A;  2P8V A;  5DH9 B;  5KQ1 A;  5FI0 A;  4P7I A;  3A8Q A;  4NSW A;  1OY2 A;  1X86 A;  2D11 A;  1EVH A;  5J3T A;  5HE3 A;  4KVG B;  1FOE A;  5J3Y A;  3RCP A;  1EF1 A;  4XWX A;  1KZ7 A;  1U5F A;  2MDX A;  3PVU A;  3FSS A;  1X05 A;  3N7C A;  2OTX A;  2P0D A;  1NI2 A;  3MPX A;  2LOZ A;  3O96 A;  2YS1 A;  4NY0 A;  1V5M A;  1XCG A;  1WGU A;  2DHI A;  2DN6 A;  5EFX A;  2J59 M;  2Y7B A;  3F0W A;  2ELB A;  2M14 A;  4CHM A;  5D3X A;  2AEH A;  3GYO A;  2KUP A;  3ODW A;  1WVH A;  3P6A A;  3PP2 A;  1MIX A;  1OMW A;  1V89 A;  1EGX A;  1W1D A;  2VKI A;  2Y8F A;  4DBB A;  1V88 A;  4DX9 0;  4GPT B;  1M7E A;  3WA0 A;  3VOQ A;  1AQC A;  1LW3 A;  4HAY B;  2E2X A;  2YT1 A;  2FJL A;  3SV1 A;  1UPR A;  2EJ8 A;  2NMB A;  1XR0 B;  1P6S A;  2P0H A;  1WJM A;  2DA0 A;  2DLW A;  1UNP A;  4PQ0 A;  1ZVR A;  4KHA A;  4HB4 B;  1DYN A;  3IVF A;  1BWN A;  3WYF B;  1K5G B;  5CLL B;  4HAX B;  3U8Z A;  2M38 A;  3CXB B;  4CHJ A;  2DKQ A;  2N0Y A;  1UPQ A;  2XQN M;  1UEF A;  2L2I A;  3P7Z A;  5JLJ B;  1DDW A;  1TQZ A;  2LOX A;  1ISN A;  5LOP B;  1Y5O A;  2DKP A;  2RSG A;  4IAP A;  2H7E A;  2CY4 A;  2YS5 A;  3KSY A;  4A5K A;  2I5F A;  2X18 A;  5DHF B;  2J0M A;  4H8S A;  3GYP A;  2RGN B;  2K2U A;  3M1I B;  2UZS A;  5DIF B;  3BIN A;  4EMO A;  4PNK A;  3KY9 A;  1B55 A;  1E5W A;  1P5T A;  2AL6 A;  5C5B A;  4Y94 A;  4C0A A;  1N3H A;  2DFK A;  4GXB A;  2BCJ A;  2GJY A;  4A6F A;  5D27 A;  1X1F A;  3ZVR A;  2Y8G A;  1U29 A;  3D8D A;  2CY5 A;  4HAZ B;  1Z87 A;  3ULB A;  1TJ6 A;  4HDO A;  2COD A;  3CIK A;  1IRS A;  2I1K A;  5C16 A;  1AWE A;  1KZG A;  1W1H A;  1ZSQ A;  2ROV A;  3FEH A;  1GG3 A;  4WSF A;  5HE2 A;  3KZ1 A;  1DRO A;  1Q67 A;  2KGX B;  2D9X A;  3KRW A;  1WGQ A;  3SUZ A;  1EAZ A;  1GC6 A;  1BAK A;  4WJ7 A;  1FAO A;  1FHX A;  1U27 A;  2GCL A;  4MT7 A;  1MAI A;  2J0J A;  5D3V A;  4EKU A;  2R09 A;  3PVL A;  3VIA A;  2LG1 A;  5GOW B;  4D0N B;  3MDB C;  2ELA A;  1V5U A;  2L1C A;  1NTV A;  2HE7 A;  3X23 A;  2VRW B;  3AU5 A;  2GCJ A;  3D8F A;  2DHJ A;  3A98 B;  2D9V A;  4F7H A;  1WI1 A;  1MIZ B;  5FI1 A;  2PZ1 A;  1I7A A;  1NU2 A;  1FB8 A;  2MKR A;  4YON A;  5JHG A;  2UVM A;  2ADZ A;  2DX1 A;  2RNR B;  4A6K A;  1DBH A;  2H7D A;  2I5C A;  3HQC A;  1WJ1 A;  3A8P A;  4EJN A;  3SYX A;  5DI9 B;  3QWM A;  2YF0 A;  2KCJ A;  4Z2N A;  3DXE A;  2RVB B;  2MFQ A;  2P0F A;  5DHA B;  3ML4 A;  2D10 A;  2D9Z A;  4BBK A;  3F5R A;  2W2W A;  1H10 A;  4HAU B;  2LKO A;  3V5W A;  1TXD A;  4TKN A;  3SNH A;  5D3Y A;  1UNR A;  4K2O A;  2EMT A;  5CLQ B;  1U5E A;  4F7U P;  1MK7 B;  4TYZ A;  1W1G A;  5C5B B;  1H4R A;  3NSU A;  2R0D A;  4L6E A;  3LJU X;  2I1J A;  2IYB A;  3AJ4 A;  4A6F B;  2K00 A;  1FHW A;  1WG7 A;  2W2X C;  3PEG A;  4HB0 B;  4DXA B;  4HAV B;  4WVF B;  4GN1 A;  5HE0 A;  2COA A;  3SO6 A;  4K81 A;  1U2B A;  4CYE A;  3ZDT A;  3U7D A;  3ODO A;  1U5D A;  1I2H A;  2VSZ A;  3DXC A;  1QQG A;  1X1G A;  4YL8 A;  2V76 A;  4F7G A;  4KAX B;  3T06 A;  4HB2 B;  4ZRJ A;  4B6H A;  2Z0Q A;  2RUK B;  3ULC A;  2DTC A;  4ZRK A;  2CAY A;  1J19 A;  2D4Q A;  3TVV A;  1P3R A;  1V61 A;  1ZM0 A;  2DYQ A;  4MK0 A;  2OQB A;  4IFS A;  5C6R A;  1PLS A;  5L81 A;  5KCV A;  3QBV B;  1M7R A;  3KRX A;  1SGH A;  1V5P A;  1BTK A;  2W2X D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...