4A6FA

Crystal structure of slm1-ph domain in complex with phosphoserine
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
117
structure length
105
Chain Sequence
PFTEIKSGFLERRSKFLKSYSKGYYVLTPNFLHEFKTADRKKDLVPVMSLALSECTVTEHSRKNSGSDAKFVLHAKQRGHNWVFKADSYESMMSWFDNLKILTST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Analyses of Slm1-Ph Domain Demonstrate Ligand Binding in the Non-Canonical Site
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
molecule keywords PHOSPHATIDYLINOSITOL 4,5-BISPHOSPHATE-BINDING PROTEIN SLM1
total genus 22
structure length 105
sequence length 117
ec nomenclature
pdb deposition date 2011-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4a6fA00
1V88A 3D8EA 3A8QA 5HE2A 5C16A 3CIKA 2YRYA 3PVUA 2I1JA 1K5GB 4IOYX 1U27A 3A8PA 4L6EA 1QC6A 2CAYA 4HDQA 2Z0PA 4GMXB 3MPXA 2YVCA 1GC7A 2G35A 2OQBA 1NU2A 4IAPA 3TCAA 1DYNA 2QKLA 1MK7B 4MT7A 3N7CA 1H4RA 4HB0B 5KQ1A 1FGZA 5DIFB 5EFXA 4PNKA 5C79A 4A6FB 1MIXA 1Y5OA 1Y19B 2RGNB 4ZRKA 5HE1A 4K2OA 2J0KA 1XCGA 2I5CA 1P6SA 3P7ZA 1P3RA 4MY6A 2DTCA 1M7EA 2J0MA 3WA0A 2DLWA 2FJLA 5DHAB 2LOXA 2RVBB 4NY0A 4ZRJA 2N23A 3V5WA 3PVLA 3OANA 2W2WA 4HB3B 1W1DA 5D3VA 1Q67A 2DN6A 2PZ1A 4K81A 4NSWA 3SNHA 1M7RA 1WVHA 3KRXA 3ZDTA 2GS0A 2RUKB 1ZM0A 1WJ1A 1V61A 3SYXA 2V76A 5DH9B 2YS5A 4P7IA 2ELAA 4Y94A 4F7GA 1FGYA 2W2XC 3PVWA 4DXAB 4HAVB 1XODA 2M38A 1WGUA 2XQNM 2DHKA 2MDXA 1FHXA 3GYPA 3PZDA 3T06A 2H7DA 3HW2B 3PP2A 5DHFB 2YSZA 1DBHA 1FOEA 1MK9B 3UZTA 5GOWB 2D9VA 2CRFA 3QBVB 3KZ1A 1ISNA 1SGHA 2GJYA 2DX1A 2VKIA 3RCPA 2DA0A 2E2XA 1W1GA 1ZVRA 2EMSA 2YF0A 3X23A 4CHMA 1QQGA 1MKEA 2P0DA 3TVVA 3G9WA 2VRWB 3MDBC 1U5EA 1ZC4B 1I7AA 1AWEA 4KHOA 4C0AA 1UNQA 3ZVRA 3F5RA 4KVGB 1ZSQA 4HAXB 4ZRIA 2HE7A 3BINA 3NSUA 2YS1A 2YS3A 1DDMA 4HAZB 2DX5A 4DX8A 1NI2A 4GMVA 1U29A 3AU4A 4HB2B 4KAXB 2UZRA 3BJIA 1LW3A 2K00A 3M1IB 2R0DA 3TFMA 4DBBA 5C5BA 3GYOA 2UVMA 4DX90 1PFJA 1WGQA 5JLJB 2LYDA 1V5MA 2COCA 2YT0A 2W2XD 3KY9A 4WVFB 3FEHA 1J0WA 2DYNA 2D11A 2K2UA 1X1GA 4IFSA 5D3YA 1BTNA 1XKEA 5KQ4A 1DROA 4CHJA 2ROVA 3CXBB 1Z87A 5JHHA 5HE3A 2DHIA 2OTXA 1BAKA 2D9YA 4HATB 2Z0OA 1J19A 4D0NB 4TKNA 1K5DB 2D9XA 2RLOA 1GC6A 5JHGA 3QWMA 1NTVA 2Y7BA 2EMTA 2Y8GA 1UPQA 4CYEA 5J3TA 2DKQA 4K2PA 1N3HA 2AEHA 5JP4A 1NTYA 1ZC3B 4HAYB 1X86A 1GG3A 3PSCA 2LOZA 4A5KA 3KSYA 4Z2NA 1MAIA 1U5GA 5C6RA 3QIJA 1TXDA 3VIAA 2M14A 2D9ZA 1XR0B 5HE0A 1U2BA 5CLLB 2J0JA 4A6KA 2RSGA 2Z0QA 1WG7A 3SO6A 4KHAA 1X05A 3P6AA 1UPRA 1DDWA 1I2HA 2ADZA 1E5WA 5LOPB 5D3WA 3PEGA 1B55A 1KI1B 2HTHB 2RNRB 5FI1A 1UNPA 4HAWB 4TYZA 2D9WA 2MFQA 1TJ6A 2ROZB 1W1HA 3DXEA 4WSFA 4K17A 2I5FA 3AJ4A 1FAOA 4EMOA 2P0HA 1H10A 2DHJA 3HK0A 3ML4A 2ZPYA 3D8FA 1X1FA 2EJ8A 5J3QA 3ULBA 2CODA 3U8ZA 1MIZB 5D27A 1UNRA 2MKRA 1LB1A 1KZGA 1XD4A 3FM8C 2I1KA 2DKPA 4WJ7A 2J59M 3A98B 1EGXA 4PQ0A 1U5FA 1V5PA 5C5BB 2R09A 3ODXA 1UEFA 3ULCA 4XWXA 3TO1A 2AL6A 1EVHA 1WI1A 3D8DA 1AQCA 2EC1A 4GZUA 1FHOA 3ODOA 2KUPA 2COFA 2L1CA 2D10A 2CY4A 3HQCA 3VOQA 3AU5A 4HHVA 2GCLA 4HDOA 5D3XA 4GPTB 4A6FA 5FI0A 1MPHA 2GCJA 4F7HA 2K2JA 2NZ8B 2P0FA 2LG1A 4F7UP 2DYQA 4A6HA 1KZ7A 1V89A 1WJMA 2NMBA 4KHBB 3O96A 1P5TA 4EJNA 4GXBA 3SV1A 4HB4B 3DXCA 3LJUX 2JP2A 2L2IA 1EF1A 1RRPB 2CY5A 1TQZA 4Z2MB 3SUZA 1PLSA 1V5UA 2LULA 1IRSA 3FSSA 3PG7A 4GN1A 1OY2A 2QKMA 3ODWA 2DFKA 3U7DA 3DXDA 5L81A 5KCVA 4HAUB 5DI9B 1BTKA 1FB8A 4MK0A 2D4QA 4EKUA 2VSZA 2KCJA 5J3YA 1EAZA 2UZSA 1PMSA 4YL8A 2P8VA 2D2QA 1DDVA 1RJ2A 2N0YA 2COAA 1OQNA 1XX0A 1U5DA 5LONB 3WYFB 3KRWA 2IFSA 1FHWA 1BWNA 2X18A 4H8SA 3TW1A 2BCJA 2KGXB 1OMWA 2Y8FA 5CLQB 2MWNB 2YT1A 3IVFA 2H7EA 2ELBA 1X11A 3F0WA 2IYBA 4B6HA 4BBKA 4YONA 1SHCA 2LKOA 2Q13A
chains in the Genus database with same CATH superfamily
1V88A 3D8EA 3A8QA 5HE2A 4QJ5B 5C16A 3CIKA 2YRYA 3PVUA 2I1JA 1K5GB 2Z14A 5I2MA 4IOYX 1U27A 3A58A 3A8PA 4L6EA 1QC6A 2CAYA 4HDQA 2Z0PA 4GMXB 3MPXA 2YVCA 1GC7A 2G35A 3B77A 4L1RA 2OQBA 1NU2A 4IAPA 3TCAA 2KIGA 1DYNA 2QKLA 4D6WA 1MK7B 4MT7A 3N7CA 1H4RA 4HB0B 5KQ1A 1FGZA 5DIFB 5EFXA 4PNKA 5C79A 4A6FB 1MIXA 1Y5OA 1Y19B 3DCXA 2RGNB 4ZRKA 5HE1A 4K2OA 2J0KA 1XCGA 2I5CA 1P6SA 3P7ZA 1P3RA 4MY6A 2DTCA 5I2SA 2YT2A 1M7EA 2J0MA 3NWDA 3WA0A 2DLWA 2FJLA 5DHAB 2LOXA 2RVBB 4OT1A 4NY0A 4ZRJA 2N23A 3V5WA 3PVLA 3OANA 2W2WA 4HB3B 1W1DA 5D3VA 1Q67A 2DN6A 2PZ1A 4K81A 4NSWA 3SNHA 1M7RA 1T77A 1WVHA 3KRXA 3ZDTA 2GS0A 2RUKB 1ZM0A 1MI1A 1WJ1A 1V61A 3SYXA 2V76A 5DH9B 2YS5A 4P7IA 2ELAA 4Y94A 4F7GA 1FGYA 2W2XC 3PVWA 4DXAB 4HAVB 1XODA 2M38A 1WGUA 2XQNM 2DHKA 2MDXA 1FHXA 3GYPA 3PZDA 3T06A 2H7DA 3HW2B 5LG4B 3PP2A 5DHFB 2YSZA 1DBHA 1FOEA 1MK9B 3UZTA 5GOWB 2D9VA 2CRFA 5IRSA 3QBVB 3KZ1A 1ISNA 1SGHA 2GJYA 2DX1A 2VKIA 3RCPA 2DA0A 2E2XA 1W1GA 1ZVRA 2EMSA 2YF0A 3X23A 4CHMA 1QQGA 1MKEA 2P0DA 3TVVA 3G9WA 3HIEA 2VRWB 3MDBC 1U5EA 1ZC4B 1I7AA 1AWEA 4KHOA 4C0AA 1UNQA 3ZVRA 3F5RA 4KVGB 3NW8A 1ZSQA 4HAXB 4ZRIA 2HE7A 4QXAB 3BINA 3NSUA 2YS1A 2YS3A 1DDMA 4HAZB 2DX5A 4DX8A 1NI2A 4GMVA 1U29A 3AU4A 4HB2B 4KAXB 2UZRA 3BJIA 1LW3A 2K00A 3M1IB 2R0DA 3TFMA 4DBBA 5C5BA 3GYOA 2UVMA 4DX90 1PFJA 1WGQA 5JLJB 2LYDA 1V5MA 2COCA 2YT0A 2W2XD 3KY9A 4WVFB 3FEHA 1J0WA 2DYNA 2D11A 2K2UA 3U12A 1X1GA 2K8EA 4IFSA 5D3YA 1BTNA 2KIEA 1XKEA 5KQ4A 1DROA 4CHJA 2ROVA 3CXBB 1Z87A 5JHHA 5HE3A 2DHIA 2OTXA 1BAKA 2R2YA 2D9YA 4HATB 2Z0OA 1J19A 4D0NB 4TKNA 1K5DB 2D9XA 5M4YB 2RLOA 1GC6A 5JHGA 3QWMA 1NTVA 2Z4DA 3OHMB 4KHBA 2Y7BA 2EMTA 2Y8GA 1UPQA 4HSIA 4CYEA 5J3TA 2DKQA 4K2PA 1N3HA 2AEHA 5JP4A 1NTYA 1ZC3B 4HAYB 1X86A 1GG3A 4GOUA 3PSCA 2GUMA 2LOZA 4A5KA 3KSYA 4Z2NA 1MAIA 3NWAA 1U5GA 5C6RA 3QIJA 1TXDA 3VIAA 2M14A 2D9ZA 1XR0B 5HE0A 1U2BA 5CLLB 2J0JA 4A6KA 1ZYIA 2RSGA 2Z0QA 1WG7A 4GNKB 3SO6A 4KHAA 1X05A 3P6AA 1UPRA 1DDWA 1I2HA 2ADZA 1E5WA 5LOPB 5D3WA 3PEGA 1B55A 1KI1B 2HTHB 2RNRB 5FI1A 1UNPA 4HAWB 4TYZA 2D9WA 2MFQA 1TJ6A 2ROZB 1W1HA 3DXEA 4WSFA 4K17A 2I5FA 3AJ4A 1FAOA 4EMOA 2P0HA 1H10A 2DHJA 3HK0A 3ML4A 2ZPYA 3D8FA 1X1FA 2EJ8A 5J3QA 3ULBA 2CODA 3U8ZA 1MIZB 5D27A 1UNRA 2MKRA 2FJUB 1LB1A 1KZGA 1XD4A 3FM8C 2I1KA 2DKPA 4WJ7A 2J59M 3A98B 1EGXA 4PQ0A 1U5FA 1V5PA 5C5BB 2R09A 3ODXA 1UEFA 3ULCA 4XWXA 3TO1A 2AL6A 1EVHA 1WI1A 3D8DA 1AQCA 2EC1A 2RRFA 2KR0A 4GZUA 1FHOA 3ODOA 2KUPA 2COFA 2ZKMX 2L1CA 2D10A 2CY4A 3HQCA 3HSAA 3VOQA 3AU5A 4HHVA 2GCLA 4HDOA 4OSNA 5D3XA 4GPTB 4A6FA 5FI0A 1MPHA 2GCJA 4F7HA 2K2JA 2NBVA 2NZ8B 2KUQA 4QJ4B 2P0FA 2LG1A 4F7UP 2DYQA 4A6HA 1KZ7A 1V89A 1WJMA 4QJ3B 2NMBA 4KHBB 3O96A 1P5TA 4EJNA 4GXBA 3SV1A 4HB4B 3FVCA 3DXCA 3LJUX 2JP2A 2L2IA 1EF1A 1RRPB 2CY5A 1TQZA 4Z2MB 3SUZA 1PLSA 1V5UA 2LULA 1IRSA 3FSSA 3PG7A 4GN1A 1OY2A 2QKMA 3ODWA 2DFKA 3U7DA 3DXDA 5L81A 5KCVA 4HAUB 5DI9B 3NWFA 1BTKA 4DIXA 1FB8A 4MK0A 2D4QA 4EKUA 2VSZA 2KCJA 5J3YA 2K49A 1EAZA 2UZSA 1PMSA 4YL8A 2P8VA 2D2QA 1DDVA 1RJ2A 2N0YA 2COAA 1OQNA 2Z59A 1XX0A 1U5DA 5LONB 3WYFB 4CSQA 3KRWA 2IFSA 1FHWA 1BWNA 2X18A 4H8SA 3TW1A 2BCJA 2KGXB 1OMWA 2Y8FA 5CLQB 2MWNB 2YT1A 3IVFA 2H7EA 2ELBA 1X11A 3F0WA 2IYBA 4B6HA 4BBKA 4YONA 2Z13A 1SHCA 2LKOA 2Q13A
chains in the Genus database with same CATH topology
1V88A 3D8EA 3A8QA 5HE2A 5C16A 3CIKA 2YRYA 3PVUA 2I1JA 1K5GB 4IOYX 1U27A 3A8PA 4L6EA 1QC6A 2CAYA 4HDQA 2Z0PA 4GMXB 3MPXA 2YVCA 1GC7A 2G35A 2OQBA 1NU2A 4IAPA 3TCAA 1DYNA 2QKLA 1MK7B 4MT7A 3N7CA 1H4RA 4HB0B 5KQ1A 1FGZA 5DIFB 5EFXA 4PNKA 5C79A 4A6FB 1MIXA 1Y5OA 1Y19B 2RGNB 4ZRKA 5HE1A 4K2OA 2J0KA 1XCGA 2I5CA 1P6SA 3P7ZA 1P3RA 4MY6A 2DTCA 1M7EA 2J0MA 3WA0A 2DLWA 2FJLA 5DHAB 2LOXA 2RVBB 4NY0A 4ZRJA 2N23A 3V5WA 3PVLA 3OANA 2W2WA 4HB3B 1W1DA 5D3VA 1Q67A 2DN6A 2PZ1A 4K81A 4NSWA 3SNHA 1M7RA 1WVHA 3KRXA 3ZDTA 2GS0A 2RUKB 1ZM0A 1WJ1A 1V61A 3SYXA 2V76A 5DH9B 2YS5A 4P7IA 2ELAA 4Y94A 4F7GA 1FGYA 2W2XC 3PVWA 4DXAB 4HAVB 1XODA 2M38A 1WGUA 2XQNM 2DHKA 2MDXA 1FHXA 3GYPA 3PZDA 3T06A 2H7DA 3HW2B 3PP2A 5DHFB 2YSZA 1DBHA 1FOEA 1MK9B 3UZTA 5GOWB 2D9VA 2CRFA 3QBVB 3KZ1A 1ISNA 1SGHA 2GJYA 2DX1A 2VKIA 3RCPA 2DA0A 2E2XA 1W1GA 1ZVRA 2EMSA 2YF0A 3X23A 4CHMA 1QQGA 1MKEA 2P0DA 3TVVA 3G9WA 2VRWB 3MDBC 1U5EA 1ZC4B 1I7AA 1AWEA 4KHOA 4C0AA 1UNQA 3ZVRA 3F5RA 4KVGB 1ZSQA 4HAXB 4ZRIA 2HE7A 3BINA 3NSUA 2YS1A 2YS3A 1DDMA 4HAZB 2DX5A 4DX8A 1NI2A 4GMVA 1U29A 3AU4A 4HB2B 4KAXB 2UZRA 3BJIA 1LW3A 2K00A 3M1IB 2R0DA 3TFMA 4DBBA 5C5BA 3GYOA 2UVMA 4DX90 1PFJA 1WGQA 5JLJB 2LYDA 1V5MA 2COCA 2YT0A 2W2XD 3KY9A 4WVFB 3FEHA 1J0WA 2DYNA 2D11A 2K2UA 1X1GA 4IFSA 5D3YA 1BTNA 1XKEA 5KQ4A 1DROA 4CHJA 2ROVA 3CXBB 1Z87A 5JHHA 5HE3A 2DHIA 2OTXA 1BAKA 2D9YA 4HATB 2Z0OA 1J19A 4D0NB 4TKNA 1K5DB 2D9XA 2RLOA 1GC6A 5JHGA 3QWMA 1NTVA 2Y7BA 2EMTA 2Y8GA 1UPQA 4CYEA 5J3TA 2DKQA 4K2PA 1N3HA 2AEHA 5JP4A 1NTYA 1ZC3B 4HAYB 1X86A 1GG3A 3PSCA 2LOZA 4A5KA 3KSYA 4Z2NA 1MAIA 1U5GA 5C6RA 3QIJA 1TXDA 3VIAA 2M14A 2D9ZA 1XR0B 5HE0A 1U2BA 5CLLB 2J0JA 4A6KA 2RSGA 2Z0QA 1WG7A 3SO6A 4KHAA 1X05A 3P6AA 1UPRA 1DDWA 1I2HA 2ADZA 1E5WA 5LOPB 5D3WA 3PEGA 1B55A 1KI1B 2HTHB 2RNRB 5FI1A 1UNPA 4HAWB 4TYZA 2D9WA 2MFQA 1TJ6A 2ROZB 1W1HA 3DXEA 4WSFA 4K17A 2I5FA 3AJ4A 1FAOA 4EMOA 2P0HA 1H10A 2DHJA 3HK0A 3ML4A 2ZPYA 3D8FA 1X1FA 2EJ8A 5J3QA 3ULBA 2CODA 3U8ZA 1MIZB 5D27A 1UNRA 2MKRA 1LB1A 1KZGA 1XD4A 3FM8C 2I1KA 2DKPA 4WJ7A 2J59M 3A98B 1EGXA 4PQ0A 1U5FA 1V5PA 5C5BB 2R09A 3ODXA 1UEFA 3ULCA 4XWXA 3TO1A 2AL6A 1EVHA 1WI1A 3D8DA 1AQCA 2EC1A 4GZUA 1FHOA 3ODOA 2KUPA 2COFA 2L1CA 2D10A 2CY4A 3HQCA 3VOQA 3AU5A 4HHVA 2GCLA 4HDOA 5D3XA 4GPTB 4A6FA 5FI0A 1MPHA 2GCJA 4F7HA 2K2JA 2NZ8B 2P0FA 2LG1A 4F7UP 2DYQA 4A6HA 1KZ7A 1V89A 1WJMA 2NMBA 4KHBB 3O96A 1P5TA 4EJNA 4GXBA 3SV1A 4HB4B 3DXCA 3LJUX 2JP2A 2L2IA 1EF1A 1RRPB 2CY5A 1TQZA 4Z2MB 3SUZA 1PLSA 1V5UA 2LULA 1IRSA 3FSSA 3PG7A 4GN1A 1OY2A 2QKMA 3ODWA 2DFKA 3U7DA 3DXDA 5L81A 5KCVA 4HAUB 5DI9B 1BTKA 1FB8A 4MK0A 2D4QA 4EKUA 2VSZA 2KCJA 5J3YA 1EAZA 2UZSA 1PMSA 4YL8A 2P8VA 2D2QA 1DDVA 1RJ2A 2N0YA 2COAA 1OQNA 1XX0A 1U5DA 5LONB 3WYFB 3KRWA 2IFSA 1FHWA 1BWNA 2X18A 4H8SA 3TW1A 2BCJA 2KGXB 1OMWA 2Y8FA 5CLQB 2MWNB 2YT1A 3IVFA 2H7EA 2ELBA 1X11A 3F0WA 2IYBA 4B6HA 4BBKA 4YONA 1SHCA 2LKOA 2Q13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V88 A;  3D8E A;  3A8Q A;  5HE2 A;  5C16 A;  3CIK A;  2YRY A;  3PVU A;  2I1J A;  1K5G B;  4IOY X;  1U27 A;  3A8P A;  4L6E A;  1QC6 A;  2CAY A;  4HDQ A;  2Z0P A;  4GMX B;  3MPX A;  2YVC A;  1GC7 A;  2G35 A;  2OQB A;  1NU2 A;  4IAP A;  3TCA A;  1DYN A;  2QKL A;  1MK7 B;  4MT7 A;  3N7C A;  1H4R A;  4HB0 B;  5KQ1 A;  1FGZ A;  5DIF B;  5EFX A;  4PNK A;  5C79 A;  4A6F B;  1MIX A;  1Y5O A;  1Y19 B;  2RGN B;  4ZRK A;  5HE1 A;  4K2O A;  2J0K A;  1XCG A;  2I5C A;  1P6S A;  3P7Z A;  1P3R A;  4MY6 A;  2DTC A;  1M7E A;  2J0M A;  3WA0 A;  2DLW A;  2FJL A;  5DHA B;  2LOX A;  2RVB B;  4NY0 A;  4ZRJ A;  2N23 A;  3V5W A;  3PVL A;  3OAN A;  2W2W A;  4HB3 B;  1W1D A;  5D3V A;  1Q67 A;  2DN6 A;  2PZ1 A;  4K81 A;  4NSW A;  3SNH A;  1M7R A;  1WVH A;  3KRX A;  3ZDT A;  2GS0 A;  2RUK B;  1ZM0 A;  1WJ1 A;  1V61 A;  3SYX A;  2V76 A;  5DH9 B;  2YS5 A;  4P7I A;  2ELA A;  4Y94 A;  4F7G A;  1FGY A;  2W2X C;  3PVW A;  4DXA B;  4HAV B;  1XOD A;  2M38 A;  1WGU A;  2XQN M;  2DHK A;  2MDX A;  1FHX A;  3GYP A;  3PZD A;  3T06 A;  2H7D A;  3HW2 B;  3PP2 A;  5DHF B;  2YSZ A;  1DBH A;  1FOE A;  1MK9 B;  3UZT A;  5GOW B;  2D9V A;  2CRF A;  3QBV B;  3KZ1 A;  1ISN A;  1SGH A;  2GJY A;  2DX1 A;  2VKI A;  3RCP A;  2DA0 A;  2E2X A;  1W1G A;  1ZVR A;  2EMS A;  2YF0 A;  3X23 A;  4CHM A;  1QQG A;  1MKE A;  2P0D A;  3TVV A;  3G9W A;  2VRW B;  3MDB C;  1U5E A;  1ZC4 B;  1I7A A;  1AWE A;  4KHO A;  4C0A A;  1UNQ A;  3ZVR A;  3F5R A;  4KVG B;  1ZSQ A;  4HAX B;  4ZRI A;  2HE7 A;  3BIN A;  3NSU A;  2YS1 A;  2YS3 A;  1DDM A;  4HAZ B;  2DX5 A;  4DX8 A;  1NI2 A;  4GMV A;  1U29 A;  3AU4 A;  4HB2 B;  4KAX B;  2UZR A;  3BJI A;  1LW3 A;  2K00 A;  3M1I B;  2R0D A;  3TFM A;  4DBB A;  5C5B A;  3GYO A;  2UVM A;  4DX9 0;  1PFJ A;  1WGQ A;  5JLJ B;  2LYD A;  1V5M A;  2COC A;  2YT0 A;  2W2X D;  3KY9 A;  4WVF B;  3FEH A;  1J0W A;  2DYN A;  2D11 A;  2K2U A;  1X1G A;  4IFS A;  5D3Y A;  1BTN A;  1XKE A;  5KQ4 A;  1DRO A;  4CHJ A;  2ROV A;  3CXB B;  1Z87 A;  5JHH A;  5HE3 A;  2DHI A;  2OTX A;  1BAK A;  2D9Y A;  4HAT B;  2Z0O A;  1J19 A;  4D0N B;  4TKN A;  1K5D B;  2D9X A;  2RLO A;  1GC6 A;  5JHG A;  3QWM A;  1NTV A;  2Y7B A;  2EMT A;  2Y8G A;  1UPQ A;  4CYE A;  5J3T A;  2DKQ A;  4K2P A;  1N3H A;  2AEH A;  5JP4 A;  1NTY A;  1ZC3 B;  4HAY B;  1X86 A;  1GG3 A;  3PSC A;  2LOZ A;  4A5K A;  3KSY A;  4Z2N A;  1MAI A;  1U5G A;  5C6R A;  3QIJ A;  1TXD A;  3VIA A;  2M14 A;  2D9Z A;  1XR0 B;  5HE0 A;  1U2B A;  5CLL B;  2J0J A;  4A6K A;  2RSG A;  2Z0Q A;  1WG7 A;  3SO6 A;  4KHA A;  1X05 A;  3P6A A;  1UPR A;  1DDW A;  1I2H A;  2ADZ A;  1E5W A;  5LOP B;  5D3W A;  3PEG A;  1B55 A;  1KI1 B;  2HTH B;  2RNR B;  5FI1 A;  1UNP A;  4HAW B;  4TYZ A;  2D9W A;  2MFQ A;  1TJ6 A;  2ROZ B;  1W1H A;  3DXE A;  4WSF A;  4K17 A;  2I5F A;  3AJ4 A;  1FAO A;  4EMO A;  2P0H A;  1H10 A;  2DHJ A;  3HK0 A;  3ML4 A;  2ZPY A;  3D8F A;  1X1F A;  2EJ8 A;  5J3Q A;  3ULB A;  2COD A;  3U8Z A;  1MIZ B;  5D27 A;  1UNR A;  2MKR A;  1LB1 A;  1KZG A;  1XD4 A;  3FM8 C;  2I1K A;  2DKP A;  4WJ7 A;  2J59 M;  3A98 B;  1EGX A;  4PQ0 A;  1U5F A;  1V5P A;  5C5B B;  2R09 A;  3ODX A;  1UEF A;  3ULC A;  4XWX A;  3TO1 A;  2AL6 A;  1EVH A;  1WI1 A;  3D8D A;  1AQC A;  2EC1 A;  4GZU A;  1FHO A;  3ODO A;  2KUP A;  2COF A;  2L1C A;  2D10 A;  2CY4 A;  3HQC A;  3VOQ A;  3AU5 A;  4HHV A;  2GCL A;  4HDO A;  5D3X A;  4GPT B;  4A6F A;  5FI0 A;  1MPH A;  2GCJ A;  4F7H A;  2K2J A;  2NZ8 B;  2P0F A;  2LG1 A;  4F7U P;  2DYQ A;  4A6H A;  1KZ7 A;  1V89 A;  1WJM A;  2NMB A;  4KHB B;  3O96 A;  1P5T A;  4EJN A;  4GXB A;  3SV1 A;  4HB4 B;  3DXC A;  3LJU X;  2JP2 A;  2L2I A;  1EF1 A;  1RRP B;  2CY5 A;  1TQZ A;  4Z2M B;  3SUZ A;  1PLS A;  1V5U A;  2LUL A;  1IRS A;  3FSS A;  3PG7 A;  4GN1 A;  1OY2 A;  2QKM A;  3ODW A;  2DFK A;  3U7D A;  3DXD A;  5L81 A;  5KCV A;  4HAU B;  5DI9 B;  1BTK A;  1FB8 A;  4MK0 A;  2D4Q A;  4EKU A;  2VSZ A;  2KCJ A;  5J3Y A;  1EAZ A;  2UZS A;  1PMS A;  4YL8 A;  2P8V A;  2D2Q A;  1DDV A;  1RJ2 A;  2N0Y A;  2COA A;  1OQN A;  1XX0 A;  1U5D A;  5LON B;  3WYF B;  3KRW A;  2IFS A;  1FHW A;  1BWN A;  2X18 A;  4H8S A;  3TW1 A;  2BCJ A;  2KGX B;  1OMW A;  2Y8F A;  5CLQ B;  2MWN B;  2YT1 A;  3IVF A;  2H7E A;  2ELB A;  1X11 A;  3F0W A;  2IYB A;  4B6H A;  4BBK A;  4YON A;  1SHC A;  2LKO A;  2Q13 A; 
#chains in the Genus database with same CATH topology
 1V88 A;  3D8E A;  3A8Q A;  5HE2 A;  4QJ5 B;  5C16 A;  3CIK A;  2YRY A;  3PVU A;  2I1J A;  1K5G B;  2Z14 A;  5I2M A;  4IOY X;  1U27 A;  3A58 A;  3A8P A;  4L6E A;  1QC6 A;  2CAY A;  4HDQ A;  2Z0P A;  4GMX B;  3MPX A;  2YVC A;  1GC7 A;  2G35 A;  3B77 A;  4L1R A;  2OQB A;  1NU2 A;  4IAP A;  3TCA A;  2KIG A;  1DYN A;  2QKL A;  4D6W A;  1MK7 B;  4MT7 A;  3N7C A;  1H4R A;  4HB0 B;  5KQ1 A;  1FGZ A;  5DIF B;  5EFX A;  4PNK A;  5C79 A;  4A6F B;  1MIX A;  1Y5O A;  1Y19 B;  3DCX A;  2RGN B;  4ZRK A;  5HE1 A;  4K2O A;  2J0K A;  1XCG A;  2I5C A;  1P6S A;  3P7Z A;  1P3R A;  4MY6 A;  2DTC A;  5I2S A;  2YT2 A;  1M7E A;  2J0M A;  3NWD A;  3WA0 A;  2DLW A;  2FJL A;  5DHA B;  2LOX A;  2RVB B;  4OT1 A;  4NY0 A;  4ZRJ A;  2N23 A;  3V5W A;  3PVL A;  3OAN A;  2W2W A;  4HB3 B;  1W1D A;  5D3V A;  1Q67 A;  2DN6 A;  2PZ1 A;  4K81 A;  4NSW A;  3SNH A;  1M7R A;  1T77 A;  1WVH A;  3KRX A;  3ZDT A;  2GS0 A;  2RUK B;  1ZM0 A;  1MI1 A;  1WJ1 A;  1V61 A;  3SYX A;  2V76 A;  5DH9 B;  2YS5 A;  4P7I A;  2ELA A;  4Y94 A;  4F7G A;  1FGY A;  2W2X C;  3PVW A;  4DXA B;  4HAV B;  1XOD A;  2M38 A;  1WGU A;  2XQN M;  2DHK A;  2MDX A;  1FHX A;  3GYP A;  3PZD A;  3T06 A;  2H7D A;  3HW2 B;  5LG4 B;  3PP2 A;  5DHF B;  2YSZ A;  1DBH A;  1FOE A;  1MK9 B;  3UZT A;  5GOW B;  2D9V A;  2CRF A;  5IRS A;  3QBV B;  3KZ1 A;  1ISN A;  1SGH A;  2GJY A;  2DX1 A;  2VKI A;  3RCP A;  2DA0 A;  2E2X A;  1W1G A;  1ZVR A;  2EMS A;  2YF0 A;  3X23 A;  4CHM A;  1QQG A;  1MKE A;  2P0D A;  3TVV A;  3G9W A;  3HIE A;  2VRW B;  3MDB C;  1U5E A;  1ZC4 B;  1I7A A;  1AWE A;  4KHO A;  4C0A A;  1UNQ A;  3ZVR A;  3F5R A;  4KVG B;  3NW8 A;  1ZSQ A;  4HAX B;  4ZRI A;  2HE7 A;  4QXA B;  3BIN A;  3NSU A;  2YS1 A;  2YS3 A;  1DDM A;  4HAZ B;  2DX5 A;  4DX8 A;  1NI2 A;  4GMV A;  1U29 A;  3AU4 A;  4HB2 B;  4KAX B;  2UZR A;  3BJI A;  1LW3 A;  2K00 A;  3M1I B;  2R0D A;  3TFM A;  4DBB A;  5C5B A;  3GYO A;  2UVM A;  4DX9 0;  1PFJ A;  1WGQ A;  5JLJ B;  2LYD A;  1V5M A;  2COC A;  2YT0 A;  2W2X D;  3KY9 A;  4WVF B;  3FEH A;  1J0W A;  2DYN A;  2D11 A;  2K2U A;  3U12 A;  1X1G A;  2K8E A;  4IFS A;  5D3Y A;  1BTN A;  2KIE A;  1XKE A;  5KQ4 A;  1DRO A;  4CHJ A;  2ROV A;  3CXB B;  1Z87 A;  5JHH A;  5HE3 A;  2DHI A;  2OTX A;  1BAK A;  2R2Y A;  2D9Y A;  4HAT B;  2Z0O A;  1J19 A;  4D0N B;  4TKN A;  1K5D B;  2D9X A;  5M4Y B;  2RLO A;  1GC6 A;  5JHG A;  3QWM A;  1NTV A;  2Z4D A;  3OHM B;  4KHB A;  2Y7B A;  2EMT A;  2Y8G A;  1UPQ A;  4HSI A;  4CYE A;  5J3T A;  2DKQ A;  4K2P A;  1N3H A;  2AEH A;  5JP4 A;  1NTY A;  1ZC3 B;  4HAY B;  1X86 A;  1GG3 A;  4GOU A;  3PSC A;  2GUM A;  2LOZ A;  4A5K A;  3KSY A;  4Z2N A;  1MAI A;  3NWA A;  1U5G A;  5C6R A;  3QIJ A;  1TXD A;  3VIA A;  2M14 A;  2D9Z A;  1XR0 B;  5HE0 A;  1U2B A;  5CLL B;  2J0J A;  4A6K A;  1ZYI A;  2RSG A;  2Z0Q A;  1WG7 A;  4GNK B;  3SO6 A;  4KHA A;  1X05 A;  3P6A A;  1UPR A;  1DDW A;  1I2H A;  2ADZ A;  1E5W A;  5LOP B;  5D3W A;  3PEG A;  1B55 A;  1KI1 B;  2HTH B;  2RNR B;  5FI1 A;  1UNP A;  4HAW B;  4TYZ A;  2D9W A;  2MFQ A;  1TJ6 A;  2ROZ B;  1W1H A;  3DXE A;  4WSF A;  4K17 A;  2I5F A;  3AJ4 A;  1FAO A;  4EMO A;  2P0H A;  1H10 A;  2DHJ A;  3HK0 A;  3ML4 A;  2ZPY A;  3D8F A;  1X1F A;  2EJ8 A;  5J3Q A;  3ULB A;  2COD A;  3U8Z A;  1MIZ B;  5D27 A;  1UNR A;  2MKR A;  2FJU B;  1LB1 A;  1KZG A;  1XD4 A;  3FM8 C;  2I1K A;  2DKP A;  4WJ7 A;  2J59 M;  3A98 B;  1EGX A;  4PQ0 A;  1U5F A;  1V5P A;  5C5B B;  2R09 A;  3ODX A;  1UEF A;  3ULC A;  4XWX A;  3TO1 A;  2AL6 A;  1EVH A;  1WI1 A;  3D8D A;  1AQC A;  2EC1 A;  2RRF A;  2KR0 A;  4GZU A;  1FHO A;  3ODO A;  2KUP A;  2COF A;  2ZKM X;  2L1C A;  2D10 A;  2CY4 A;  3HQC A;  3HSA A;  3VOQ A;  3AU5 A;  4HHV A;  2GCL A;  4HDO A;  4OSN A;  5D3X A;  4GPT B;  4A6F A;  5FI0 A;  1MPH A;  2GCJ A;  4F7H A;  2K2J A;  2NBV A;  2NZ8 B;  2KUQ A;  4QJ4 B;  2P0F A;  2LG1 A;  4F7U P;  2DYQ A;  4A6H A;  1KZ7 A;  1V89 A;  1WJM A;  4QJ3 B;  2NMB A;  4KHB B;  3O96 A;  1P5T A;  4EJN A;  4GXB A;  3SV1 A;  4HB4 B;  3FVC A;  3DXC A;  3LJU X;  2JP2 A;  2L2I A;  1EF1 A;  1RRP B;  2CY5 A;  1TQZ A;  4Z2M B;  3SUZ A;  1PLS A;  1V5U A;  2LUL A;  1IRS A;  3FSS A;  3PG7 A;  4GN1 A;  1OY2 A;  2QKM A;  3ODW A;  2DFK A;  3U7D A;  3DXD A;  5L81 A;  5KCV A;  4HAU B;  5DI9 B;  3NWF A;  1BTK A;  4DIX A;  1FB8 A;  4MK0 A;  2D4Q A;  4EKU A;  2VSZ A;  2KCJ A;  5J3Y A;  2K49 A;  1EAZ A;  2UZS A;  1PMS A;  4YL8 A;  2P8V A;  2D2Q A;  1DDV A;  1RJ2 A;  2N0Y A;  2COA A;  1OQN A;  2Z59 A;  1XX0 A;  1U5D A;  5LON B;  3WYF B;  4CSQ A;  3KRW A;  2IFS A;  1FHW A;  1BWN A;  2X18 A;  4H8S A;  3TW1 A;  2BCJ A;  2KGX B;  1OMW A;  2Y8F A;  5CLQ B;  2MWN B;  2YT1 A;  3IVF A;  2H7E A;  2ELB A;  1X11 A;  3F0W A;  2IYB A;  4B6H A;  4BBK A;  4YON A;  2Z13 A;  1SHC A;  2LKO A;  2Q13 A; 
#chains in the Genus database with same CATH homology
 1V88 A;  3D8E A;  3A8Q A;  5HE2 A;  5C16 A;  3CIK A;  2YRY A;  3PVU A;  2I1J A;  1K5G B;  4IOY X;  1U27 A;  3A8P A;  4L6E A;  1QC6 A;  2CAY A;  4HDQ A;  2Z0P A;  4GMX B;  3MPX A;  2YVC A;  1GC7 A;  2G35 A;  2OQB A;  1NU2 A;  4IAP A;  3TCA A;  1DYN A;  2QKL A;  1MK7 B;  4MT7 A;  3N7C A;  1H4R A;  4HB0 B;  5KQ1 A;  1FGZ A;  5DIF B;  5EFX A;  4PNK A;  5C79 A;  4A6F B;  1MIX A;  1Y5O A;  1Y19 B;  2RGN B;  4ZRK A;  5HE1 A;  4K2O A;  2J0K A;  1XCG A;  2I5C A;  1P6S A;  3P7Z A;  1P3R A;  4MY6 A;  2DTC A;  1M7E A;  2J0M A;  3WA0 A;  2DLW A;  2FJL A;  5DHA B;  2LOX A;  2RVB B;  4NY0 A;  4ZRJ A;  2N23 A;  3V5W A;  3PVL A;  3OAN A;  2W2W A;  4HB3 B;  1W1D A;  5D3V A;  1Q67 A;  2DN6 A;  2PZ1 A;  4K81 A;  4NSW A;  3SNH A;  1M7R A;  1WVH A;  3KRX A;  3ZDT A;  2GS0 A;  2RUK B;  1ZM0 A;  1WJ1 A;  1V61 A;  3SYX A;  2V76 A;  5DH9 B;  2YS5 A;  4P7I A;  2ELA A;  4Y94 A;  4F7G A;  1FGY A;  2W2X C;  3PVW A;  4DXA B;  4HAV B;  1XOD A;  2M38 A;  1WGU A;  2XQN M;  2DHK A;  2MDX A;  1FHX A;  3GYP A;  3PZD A;  3T06 A;  2H7D A;  3HW2 B;  3PP2 A;  5DHF B;  2YSZ A;  1DBH A;  1FOE A;  1MK9 B;  3UZT A;  5GOW B;  2D9V A;  2CRF A;  3QBV B;  3KZ1 A;  1ISN A;  1SGH A;  2GJY A;  2DX1 A;  2VKI A;  3RCP A;  2DA0 A;  2E2X A;  1W1G A;  1ZVR A;  2EMS A;  2YF0 A;  3X23 A;  4CHM A;  1QQG A;  1MKE A;  2P0D A;  3TVV A;  3G9W A;  2VRW B;  3MDB C;  1U5E A;  1ZC4 B;  1I7A A;  1AWE A;  4KHO A;  4C0A A;  1UNQ A;  3ZVR A;  3F5R A;  4KVG B;  1ZSQ A;  4HAX B;  4ZRI A;  2HE7 A;  3BIN A;  3NSU A;  2YS1 A;  2YS3 A;  1DDM A;  4HAZ B;  2DX5 A;  4DX8 A;  1NI2 A;  4GMV A;  1U29 A;  3AU4 A;  4HB2 B;  4KAX B;  2UZR A;  3BJI A;  1LW3 A;  2K00 A;  3M1I B;  2R0D A;  3TFM A;  4DBB A;  5C5B A;  3GYO A;  2UVM A;  4DX9 0;  1PFJ A;  1WGQ A;  5JLJ B;  2LYD A;  1V5M A;  2COC A;  2YT0 A;  2W2X D;  3KY9 A;  4WVF B;  3FEH A;  1J0W A;  2DYN A;  2D11 A;  2K2U A;  1X1G A;  4IFS A;  5D3Y A;  1BTN A;  1XKE A;  5KQ4 A;  1DRO A;  4CHJ A;  2ROV A;  3CXB B;  1Z87 A;  5JHH A;  5HE3 A;  2DHI A;  2OTX A;  1BAK A;  2D9Y A;  4HAT B;  2Z0O A;  1J19 A;  4D0N B;  4TKN A;  1K5D B;  2D9X A;  2RLO A;  1GC6 A;  5JHG A;  3QWM A;  1NTV A;  2Y7B A;  2EMT A;  2Y8G A;  1UPQ A;  4CYE A;  5J3T A;  2DKQ A;  4K2P A;  1N3H A;  2AEH A;  5JP4 A;  1NTY A;  1ZC3 B;  4HAY B;  1X86 A;  1GG3 A;  3PSC A;  2LOZ A;  4A5K A;  3KSY A;  4Z2N A;  1MAI A;  1U5G A;  5C6R A;  3QIJ A;  1TXD A;  3VIA A;  2M14 A;  2D9Z A;  1XR0 B;  5HE0 A;  1U2B A;  5CLL B;  2J0J A;  4A6K A;  2RSG A;  2Z0Q A;  1WG7 A;  3SO6 A;  4KHA A;  1X05 A;  3P6A A;  1UPR A;  1DDW A;  1I2H A;  2ADZ A;  1E5W A;  5LOP B;  5D3W A;  3PEG A;  1B55 A;  1KI1 B;  2HTH B;  2RNR B;  5FI1 A;  1UNP A;  4HAW B;  4TYZ A;  2D9W A;  2MFQ A;  1TJ6 A;  2ROZ B;  1W1H A;  3DXE A;  4WSF A;  4K17 A;  2I5F A;  3AJ4 A;  1FAO A;  4EMO A;  2P0H A;  1H10 A;  2DHJ A;  3HK0 A;  3ML4 A;  2ZPY A;  3D8F A;  1X1F A;  2EJ8 A;  5J3Q A;  3ULB A;  2COD A;  3U8Z A;  1MIZ B;  5D27 A;  1UNR A;  2MKR A;  1LB1 A;  1KZG A;  1XD4 A;  3FM8 C;  2I1K A;  2DKP A;  4WJ7 A;  2J59 M;  3A98 B;  1EGX A;  4PQ0 A;  1U5F A;  1V5P A;  5C5B B;  2R09 A;  3ODX A;  1UEF A;  3ULC A;  4XWX A;  3TO1 A;  2AL6 A;  1EVH A;  1WI1 A;  3D8D A;  1AQC A;  2EC1 A;  4GZU A;  1FHO A;  3ODO A;  2KUP A;  2COF A;  2L1C A;  2D10 A;  2CY4 A;  3HQC A;  3VOQ A;  3AU5 A;  4HHV A;  2GCL A;  4HDO A;  5D3X A;  4GPT B;  4A6F A;  5FI0 A;  1MPH A;  2GCJ A;  4F7H A;  2K2J A;  2NZ8 B;  2P0F A;  2LG1 A;  4F7U P;  2DYQ A;  4A6H A;  1KZ7 A;  1V89 A;  1WJM A;  2NMB A;  4KHB B;  3O96 A;  1P5T A;  4EJN A;  4GXB A;  3SV1 A;  4HB4 B;  3DXC A;  3LJU X;  2JP2 A;  2L2I A;  1EF1 A;  1RRP B;  2CY5 A;  1TQZ A;  4Z2M B;  3SUZ A;  1PLS A;  1V5U A;  2LUL A;  1IRS A;  3FSS A;  3PG7 A;  4GN1 A;  1OY2 A;  2QKM A;  3ODW A;  2DFK A;  3U7D A;  3DXD A;  5L81 A;  5KCV A;  4HAU B;  5DI9 B;  1BTK A;  1FB8 A;  4MK0 A;  2D4Q A;  4EKU A;  2VSZ A;  2KCJ A;  5J3Y A;  1EAZ A;  2UZS A;  1PMS A;  4YL8 A;  2P8V A;  2D2Q A;  1DDV A;  1RJ2 A;  2N0Y A;  2COA A;  1OQN A;  1XX0 A;  1U5D A;  5LON B;  3WYF B;  3KRW A;  2IFS A;  1FHW A;  1BWN A;  2X18 A;  4H8S A;  3TW1 A;  2BCJ A;  2KGX B;  1OMW A;  2Y8F A;  5CLQ B;  2MWN B;  2YT1 A;  3IVF A;  2H7E A;  2ELB A;  1X11 A;  3F0W A;  2IYB A;  4B6H A;  4BBK A;  4YON A;  1SHC A;  2LKO A;  2Q13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...