4A6FA

Crystal structure of slm1-ph domain in complex with phosphoserine
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
117
structure length
105
Chain Sequence
PFTEIKSGFLERRSKFLKSYSKGYYVLTPNFLHEFKTADRKKDLVPVMSLALSECTVTEHSRKNSGSDAKFVLHAKQRGHNWVFKADSYESMMSWFDNLKILTST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords PHOSPHATIDYLINOSITOL 4,5-BISPHOSPHATE-BINDING PROTEIN SLM1
publication title Structural Analyses of Slm1-Ph Domain Demonstrate Ligand Binding in the Non-Canonical Site
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 22
structure length 105
sequence length 117
ec nomenclature
pdb deposition date 2011-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4a6fA00
1ZC4B 2YVCA 4A6KA 3UZTA 2DX1A 2MWNB 1DROA 1NTVA 1P5TA 1KZGA 1FHOA 2XQNM 4GZUA 1WVHA 2MKRA 2KGXB 1X1GA 5EFXA 1EVHA 2YS3A 4CHJA 4TKNA 1I7AA 1LB1A 2EC1A 1AQCA 1V88A 1FGZA 1P3RA 2GCLA 1M7EA 1GG3A 3G9WA 2VKIA 3IVFA 3SO6A 3P6AA 4YL8A 5C5BB 2YS1A 4B6HA 3RCPA 2RGNB 1OY2A 2EJ8A 1DBHA 2Y7BA 1P6SA 2LYDA 3PP2A 4MK0A 2JP2A 1UNRA 2COCA 2GJYA 2ADZA 2OTXA 3VOQA 4CYEA 3N7CA 3ZVRA 2MDXA 1TQZA 2VSZA 2MFQA 4HATB 5HE1A 3BINA 1X11A 1QC6A 1RRPB 4HB4B 5HE3A 2CRFA 2ZPYA 2YS5A 1RJ2A 4ZRKA 1DDMA 3AJ4A 4A5KA 2ELBA 2AL6A 2DHKA 2IFSA 2DA0A 2I1JA 5DHFB 3GYOA 4MT7A 1N3HA 3HQCA 2W2WA 2W2XD 3D8DA 5J3QA 2W2XC 1NTYA 3ML4A 2R0DA 5D27A 4HAYB 1EGXA 4K2PA 3V5WA 2EMSA 1QQGA 4PQ0A 2RNRB 1DDVA 1OQNA 2ROZB 1DDWA 2GS0A 1XKEA 1BAKA 1J0WA 2I1KA 3PZDA 3FEHA 3BJIA 2D9ZA 1BTKA 4H8SA 5D3WA 1ISNA 5C16A 4Y94A 1MIXA 5DIFB 4DX90 2RSGA 4EJNA 2H7DA 3ODWA 2DX5A 3TFMA 3TVVA 2E2XA 4HAVB 4WSFA 5KQ4A 1XX0A 2J0JA 4A6FA 2I5CA 2UZSA 1UPQA 1V89A 5C6RA 3QWMA 1WJ1A 4DXAB 2D9YA 5C79A 2V76A 5JHHA 2NZ8B 1WI1A 3ODOA 5KQ1A 2K00A 4DBBA 2I5FA 4HAXB 3O96A 3DXEA 2UZRA 1U29A 2Z0QA 1ZM0A 2LKOA 4Z2MB 4BBKA 2P0DA 1KI1B 3PVUA 3VIAA 3OANA 1MK7B 4K81A 3KRWA 1DYNA 3F0WA 4F7HA 1GC7A 4DX8A 1H10A 4IFSA 1UNPA 1ZVRA 1K5GB 2KCJA 1U27A 2GCJA 2HE7A 1U5FA 2D10A 3ZDTA 3HW2B 4KHAA 2J0KA 3ULBA 3QIJA 1Q67A 1XCGA 2N23A 4K17A 1UNQA 2D9VA 3AU5A 1KZ7A 4IAPA 3ODXA 3D8EA 2P0FA 2D9XA 4GXBA 1I2HA 5D3XA 1WGQA 5KCVA 4HAWB 3PG7A 2DYNA 1SHCA 1FHWA 1FGYA 1OMWA 3AU4A 2QKMA 4XWXA 3NSUA 3X23A 4C0AA 3LJUX 5FI1A 4F7UP 2DN6A 2DHJA 1U5DA 1J19A 5GOWB 1EF1A 4HDQA 1BTNA 3PVLA 2YF0A 3KRXA 1WG7A 5JP4A 4ZRIA 2D2QA 4ZRJA 3FM8C 5LONB 4HB3B 4KHBB 2AEHA 2CY4A 3KSYA 3T06A 1V5UA 2UVMA 4HDOA 2PZ1A 3F5RA 5LOPB 1W1GA 2M38A 5J3YA 3M1IB 2DKQA 4GN1A 2VRWB 4IOYX 1PFJA 2G35A 4NSWA 3WA0A 1WGUA 5HE0A 1MK9B 2FJLA 5C5BA 2P0HA 1U5EA 1M7RA 3SV1A 1U5GA 2K2JA 1U2BA 4GMVA 1Y5OA 2DFKA 2YT1A 2YT0A 3TW1A 2YRYA 1XODA 4KAXB 3SYXA 2DTCA 4KVGB 3WYFB 2OQBA 1X05A 2L1CA 4GPTB 1X86A 3TCAA 4GMXB 2H7EA 1UPRA 2DYQA 1PLSA 5JLJB 1WJMA 1Y19B 1FAOA 1TJ6A 2Y8FA 4WVFB 2D4QA 3KZ1A 1GC6A 1UEFA 2BCJA 2LOXA 3MDBC 1AWEA 3MPXA 1K5DB 2IYBA 2RVBB 4F7GA 3PSCA 5HE2A 3SUZA 4PNKA 1ZC3B 4HAZB 4EKUA 1BWNA 4L6EA 2CY5A 3PEGA 4D0NB 3A8QA 3CIKA 2ROVA 2LULA 2P8VA 2Z0OA 1MPHA 1V5MA 3A98B 1W1DA 5DHAB 2CODA 1V5PA 5CLQB 2LOZA 4A6HA 1NU2A 1XD4A 5DI9B 2LG1A 3KY9A 2L2IA 1XR0B 4NY0A 5FI0A 4A6FB 4HB0B 3U8ZA 1Z87A 2YSZA 2EMTA 2M14A 3ULCA 1W1HA 4Z2NA 2Y8GA 4EMOA 5D3YA 2RLOA 2J0MA 2HTHB 3SNHA 1LW3A 1MAIA 4KHOA 3DXDA 3U7DA 3FSSA 1FOEA 2X18A 4P7IA 2D9WA 4TYZA 2R09A 2DLWA 1X1FA 2K2UA 1IRSA 4HHVA 3PVWA 1FHXA 4YONA 5JHGA 2N0YA 2QKLA 3A8PA 4HB2B 4WJ7A 1FB8A 4K2OA 2COFA 3DXCA 3HK0A 2CAYA 1SGHA 1ZSQA 2RUKB 1MIZB 2COAA 1NI2A 1V61A 2DHIA 4MY6A 3D8FA 1E5WA 3CXBB 1B55A 2NMBA 1TXDA 2Z0PA 4HAUB 4CHMA 5DH9B 2DKPA 2J59M 1EAZA 1H4RA 5D3VA 2KUPA 3GYPA 1PMSA 5J3TA 3P7ZA 5L81A 2D11A 2Q13A 5CLLB 3TO1A 3QBVB 1MKEA 2ELAA
chains in the Genus database with same CATH superfamily
1ZC4B 2YVCA 4A6KA 3UZTA 2DX1A 2MWNB 1DROA 1NTVA 1P5TA 1KZGA 1FHOA 2XQNM 4GZUA 1WVHA 2MKRA 2KGXB 4D6WA 1X1GA 5EFXA 1EVHA 2YS3A 4KHBA 4CHJA 4TKNA 1I7AA 2Z4DA 1LB1A 2EC1A 1AQCA 1V88A 4OT1A 1FGZA 1P3RA 2GCLA 2K49A 1M7EA 1GG3A 3G9WA 2VKIA 3IVFA 3SO6A 4DIXA 3P6AA 4YL8A 5C5BB 2YS1A 4B6HA 3RCPA 3HIEA 2RGNB 1OY2A 2EJ8A 1DBHA 2Y7BA 1P6SA 2LYDA 3PP2A 4MK0A 2JP2A 1UNRA 2COCA 2GJYA 2ADZA 2OTXA 3VOQA 3OHMB 4CYEA 3N7CA 3ZVRA 2MDXA 2NBVA 1TQZA 2VSZA 2MFQA 4HATB 5HE1A 3BINA 1X11A 1QC6A 1RRPB 4HB4B 5HE3A 2CRFA 2ZPYA 2YS5A 1RJ2A 4ZRKA 1DDMA 3AJ4A 4A5KA 2ELBA 2AL6A 2DHKA 2IFSA 2DA0A 2I1JA 5DHFB 3GYOA 4MT7A 1N3HA 3HQCA 2W2WA 2W2XD 3D8DA 3DCXA 2ZKMX 5J3QA 2W2XC 1NTYA 3ML4A 2R0DA 5D27A 4HAYB 1EGXA 4K2PA 3V5WA 3NW8A 2EMSA 1QQGA 4PQ0A 2RNRB 1DDVA 1OQNA 2ROZB 1DDWA 2GS0A 1XKEA 1BAKA 1J0WA 2I1KA 3PZDA 3FEHA 3BJIA 2D9ZA 1BTKA 4H8SA 5D3WA 1ISNA 5C16A 4Y94A 2KUQA 2K8EA 1MIXA 5DIFB 4DX90 2RSGA 4EJNA 2H7DA 3ODWA 5I2MA 2DX5A 3TFMA 3TVVA 2E2XA 4HAVB 2FJUB 4WSFA 5KQ4A 1XX0A 2J0JA 4A6FA 2I5CA 2UZSA 1UPQA 1V89A 5C6RA 3QWMA 1WJ1A 4DXAB 2D9YA 5C79A 2V76A 5JHHA 2NZ8B 1WI1A 3ODOA 5KQ1A 2K00A 4DBBA 2I5FA 3NWAA 4HAXB 3O96A 3DXEA 2UZRA 4QXAB 1U29A 2Z0QA 1ZM0A 2LKOA 4Z2MB 4BBKA 2P0DA 1KI1B 3PVUA 3VIAA 3OANA 4GNKB 1MK7B 4K81A 3KRWA 1ZYIA 1DYNA 3F0WA 4F7HA 1GC7A 4DX8A 1H10A 4IFSA 1UNPA 1ZVRA 1K5GB 2KCJA 1U27A 5LG4B 2GCJA 2HE7A 3NWFA 1U5FA 2D10A 3ZDTA 3HW2B 4CSQA 4KHAA 2J0KA 3ULBA 3QIJA 1Q67A 1XCGA 2N23A 4K17A 1UNQA 2D9VA 3AU5A 1KZ7A 4IAPA 3ODXA 2KIEA 3D8EA 4QJ5B 2P0FA 2D9XA 4GXBA 1I2HA 5D3XA 1WGQA 5KCVA 4HAWB 3PG7A 2DYNA 1SHCA 1FHWA 1FGYA 1OMWA 3AU4A 2QKMA 4XWXA 3A58A 3NSUA 3X23A 4C0AA 3LJUX 5FI1A 4F7UP 2DN6A 2DHJA 1U5DA 1J19A 5GOWB 1EF1A 4HDQA 1BTNA 3PVLA 2YF0A 3NWDA 3KRXA 1WG7A 5JP4A 4ZRIA 2D2QA 4ZRJA 3FM8C 5LONB 4HB3B 4KHBB 2AEHA 2CY4A 3KSYA 3T06A 1V5UA 2UVMA 4HDOA 2PZ1A 3F5RA 5LOPB 1W1GA 2M38A 5J3YA 3M1IB 2DKQA 5M4YB 4GN1A 4QJ3B 2VRWB 4IOYX 4HSIA 1PFJA 2KR0A 2G35A 4NSWA 3WA0A 1WGUA 5HE0A 1MK9B 2FJLA 5C5BA 2P0HA 1U5EA 1M7RA 3SV1A 1U5GA 1MI1A 2K2JA 1U2BA 4GMVA 1Y5OA 2DFKA 2YT1A 2YT0A 3TW1A 2YRYA 1XODA 4KAXB 3SYXA 2DTCA 4KVGB 3WYFB 2OQBA 1X05A 2L1CA 4GPTB 1X86A 3TCAA 4GMXB 2H7EA 1UPRA 2DYQA 1PLSA 5JLJB 1WJMA 1Y19B 4QJ4B 1FAOA 1TJ6A 2Y8FA 4WVFB 2D4QA 3KZ1A 4OSNA 1GC6A 1UEFA 2BCJA 2LOXA 3MDBC 1AWEA 3MPXA 1K5DB 2IYBA 2RVBB 4F7GA 3PSCA 5HE2A 3SUZA 2KIGA 4PNKA 1ZC3B 4HAZB 3HSAA 2Z14A 4EKUA 1BWNA 4L6EA 2CY5A 3PEGA 4D0NB 3A8QA 3CIKA 2ROVA 2LULA 2P8VA 2Z0OA 1MPHA 1V5MA 3A98B 1W1DA 5DHAB 2CODA 1V5PA 4L1RA 5CLQB 2LOZA 4A6HA 1NU2A 1XD4A 5DI9B 2LG1A 2RRFA 3KY9A 2L2IA 1XR0B 4NY0A 5FI0A 4A6FB 4HB0B 2YT2A 1Z87A 3U8ZA 2YSZA 2EMTA 2M14A 3ULCA 1W1HA 4Z2NA 2Y8GA 4EMOA 5D3YA 2RLOA 2J0MA 2HTHB 3SNHA 1LW3A 1MAIA 4KHOA 3DXDA 3U7DA 2Z59A 3FSSA 1FOEA 2X18A 4P7IA 2D9WA 4TYZA 3B77A 2R09A 2DLWA 1X1FA 3U12A 2GUMA 2K2UA 1IRSA 4HHVA 3PVWA 1FHXA 4YONA 5JHGA 4GOUA 2N0YA 2QKLA 3A8PA 4HB2B 4WJ7A 5I2SA 2Z13A 1FB8A 4K2OA 2COFA 3DXCA 3HK0A 2CAYA 1T77A 1SGHA 1ZSQA 2RUKB 1MIZB 2COAA 1NI2A 1V61A 2R2YA 2DHIA 3FVCA 4MY6A 3D8FA 1E5WA 3CXBB 1B55A 2NMBA 1TXDA 2Z0PA 5IRSA 4HAUB 4CHMA 5DH9B 2DKPA 2J59M 1EAZA 1H4RA 5D3VA 2KUPA 3GYPA 1PMSA 5J3TA 3P7ZA 5L81A 2D11A 2Q13A 5CLLB 3TO1A 3QBVB 1MKEA 2ELAA
chains in the Genus database with same CATH topology
1ZC4B 2YVCA 4A6KA 3UZTA 2DX1A 2MWNB 1DROA 1NTVA 1P5TA 1KZGA 1FHOA 2XQNM 4GZUA 1WVHA 2MKRA 2KGXB 1X1GA 5EFXA 1EVHA 2YS3A 4CHJA 4TKNA 1I7AA 1LB1A 2EC1A 1AQCA 1V88A 1FGZA 1P3RA 2GCLA 1M7EA 1GG3A 3G9WA 2VKIA 3IVFA 3SO6A 3P6AA 4YL8A 5C5BB 2YS1A 4B6HA 3RCPA 2RGNB 1OY2A 2EJ8A 1DBHA 2Y7BA 1P6SA 2LYDA 3PP2A 4MK0A 2JP2A 1UNRA 2COCA 2GJYA 2ADZA 2OTXA 3VOQA 4CYEA 3N7CA 3ZVRA 2MDXA 1TQZA 2VSZA 2MFQA 4HATB 5HE1A 3BINA 1X11A 1QC6A 1RRPB 4HB4B 5HE3A 2CRFA 2ZPYA 2YS5A 1RJ2A 4ZRKA 1DDMA 3AJ4A 4A5KA 2ELBA 2AL6A 2DHKA 2IFSA 2DA0A 2I1JA 5DHFB 3GYOA 4MT7A 1N3HA 3HQCA 2W2WA 2W2XD 3D8DA 5J3QA 2W2XC 1NTYA 3ML4A 2R0DA 5D27A 4HAYB 1EGXA 4K2PA 3V5WA 2EMSA 1QQGA 4PQ0A 2RNRB 1DDVA 1OQNA 2ROZB 1DDWA 2GS0A 1XKEA 1BAKA 1J0WA 2I1KA 3PZDA 3FEHA 3BJIA 2D9ZA 1BTKA 4H8SA 5D3WA 1ISNA 5C16A 4Y94A 1MIXA 5DIFB 4DX90 2RSGA 4EJNA 2H7DA 3ODWA 2DX5A 3TFMA 3TVVA 2E2XA 4HAVB 4WSFA 5KQ4A 1XX0A 2J0JA 4A6FA 2I5CA 2UZSA 1UPQA 1V89A 5C6RA 3QWMA 1WJ1A 4DXAB 2D9YA 5C79A 2V76A 5JHHA 2NZ8B 1WI1A 3ODOA 5KQ1A 2K00A 4DBBA 2I5FA 4HAXB 3O96A 3DXEA 2UZRA 1U29A 2Z0QA 1ZM0A 2LKOA 4Z2MB 4BBKA 2P0DA 1KI1B 3PVUA 3VIAA 3OANA 1MK7B 4K81A 3KRWA 1DYNA 3F0WA 4F7HA 1GC7A 4DX8A 1H10A 4IFSA 1UNPA 1ZVRA 1K5GB 2KCJA 1U27A 2GCJA 2HE7A 1U5FA 2D10A 3ZDTA 3HW2B 4KHAA 2J0KA 3ULBA 3QIJA 1Q67A 1XCGA 2N23A 4K17A 1UNQA 2D9VA 3AU5A 1KZ7A 4IAPA 3ODXA 3D8EA 2P0FA 2D9XA 4GXBA 1I2HA 5D3XA 1WGQA 5KCVA 4HAWB 3PG7A 2DYNA 1SHCA 1FHWA 1FGYA 1OMWA 3AU4A 2QKMA 4XWXA 3NSUA 3X23A 4C0AA 3LJUX 5FI1A 4F7UP 2DN6A 2DHJA 1U5DA 1J19A 5GOWB 1EF1A 4HDQA 1BTNA 3PVLA 2YF0A 3KRXA 1WG7A 5JP4A 4ZRIA 2D2QA 4ZRJA 3FM8C 5LONB 4HB3B 4KHBB 2AEHA 2CY4A 3KSYA 3T06A 1V5UA 2UVMA 4HDOA 2PZ1A 3F5RA 5LOPB 1W1GA 2M38A 5J3YA 3M1IB 2DKQA 4GN1A 2VRWB 4IOYX 1PFJA 2G35A 4NSWA 3WA0A 1WGUA 5HE0A 1MK9B 2FJLA 5C5BA 2P0HA 1U5EA 1M7RA 3SV1A 1U5GA 2K2JA 1U2BA 4GMVA 1Y5OA 2DFKA 2YT1A 2YT0A 3TW1A 2YRYA 1XODA 4KAXB 3SYXA 2DTCA 4KVGB 3WYFB 2OQBA 1X05A 2L1CA 4GPTB 1X86A 3TCAA 4GMXB 2H7EA 1UPRA 2DYQA 1PLSA 5JLJB 1WJMA 1Y19B 1FAOA 1TJ6A 2Y8FA 4WVFB 2D4QA 3KZ1A 1GC6A 1UEFA 2BCJA 2LOXA 3MDBC 1AWEA 3MPXA 1K5DB 2IYBA 2RVBB 4F7GA 3PSCA 5HE2A 3SUZA 4PNKA 1ZC3B 4HAZB 4EKUA 1BWNA 4L6EA 2CY5A 3PEGA 4D0NB 3A8QA 3CIKA 2ROVA 2LULA 2P8VA 2Z0OA 1MPHA 1V5MA 3A98B 1W1DA 5DHAB 2CODA 1V5PA 5CLQB 2LOZA 4A6HA 1NU2A 1XD4A 5DI9B 2LG1A 3KY9A 2L2IA 1XR0B 4NY0A 5FI0A 4A6FB 4HB0B 3U8ZA 1Z87A 2YSZA 2EMTA 2M14A 3ULCA 1W1HA 4Z2NA 2Y8GA 4EMOA 5D3YA 2RLOA 2J0MA 2HTHB 3SNHA 1LW3A 1MAIA 4KHOA 3DXDA 3U7DA 3FSSA 1FOEA 2X18A 4P7IA 2D9WA 4TYZA 2R09A 2DLWA 1X1FA 2K2UA 1IRSA 4HHVA 3PVWA 1FHXA 4YONA 5JHGA 2N0YA 2QKLA 3A8PA 4HB2B 4WJ7A 1FB8A 4K2OA 2COFA 3DXCA 3HK0A 2CAYA 1SGHA 1ZSQA 2RUKB 1MIZB 2COAA 1NI2A 1V61A 2DHIA 4MY6A 3D8FA 1E5WA 3CXBB 1B55A 2NMBA 1TXDA 2Z0PA 4HAUB 4CHMA 5DH9B 2DKPA 2J59M 1EAZA 1H4RA 5D3VA 2KUPA 3GYPA 1PMSA 5J3TA 3P7ZA 5L81A 2D11A 2Q13A 5CLLB 3TO1A 3QBVB 1MKEA 2ELAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZC4 B;  2YVC A;  4A6K A;  3UZT A;  2DX1 A;  2MWN B;  1DRO A;  1NTV A;  1P5T A;  1KZG A;  1FHO A;  2XQN M;  4GZU A;  1WVH A;  2MKR A;  2KGX B;  1X1G A;  5EFX A;  1EVH A;  2YS3 A;  4CHJ A;  4TKN A;  1I7A A;  1LB1 A;  2EC1 A;  1AQC A;  1V88 A;  1FGZ A;  1P3R A;  2GCL A;  1M7E A;  1GG3 A;  3G9W A;  2VKI A;  3IVF A;  3SO6 A;  3P6A A;  4YL8 A;  5C5B B;  2YS1 A;  4B6H A;  3RCP A;  2RGN B;  1OY2 A;  2EJ8 A;  1DBH A;  2Y7B A;  1P6S A;  2LYD A;  3PP2 A;  4MK0 A;  2JP2 A;  1UNR A;  2COC A;  2GJY A;  2ADZ A;  2OTX A;  3VOQ A;  4CYE A;  3N7C A;  3ZVR A;  2MDX A;  1TQZ A;  2VSZ A;  2MFQ A;  4HAT B;  5HE1 A;  3BIN A;  1X11 A;  1QC6 A;  1RRP B;  4HB4 B;  5HE3 A;  2CRF A;  2ZPY A;  2YS5 A;  1RJ2 A;  4ZRK A;  1DDM A;  3AJ4 A;  4A5K A;  2ELB A;  2AL6 A;  2DHK A;  2IFS A;  2DA0 A;  2I1J A;  5DHF B;  3GYO A;  4MT7 A;  1N3H A;  3HQC A;  2W2W A;  2W2X D;  3D8D A;  5J3Q A;  2W2X C;  1NTY A;  3ML4 A;  2R0D A;  5D27 A;  4HAY B;  1EGX A;  4K2P A;  3V5W A;  2EMS A;  1QQG A;  4PQ0 A;  2RNR B;  1DDV A;  1OQN A;  2ROZ B;  1DDW A;  2GS0 A;  1XKE A;  1BAK A;  1J0W A;  2I1K A;  3PZD A;  3FEH A;  3BJI A;  2D9Z A;  1BTK A;  4H8S A;  5D3W A;  1ISN A;  5C16 A;  4Y94 A;  1MIX A;  5DIF B;  4DX9 0;  2RSG A;  4EJN A;  2H7D A;  3ODW A;  2DX5 A;  3TFM A;  3TVV A;  2E2X A;  4HAV B;  4WSF A;  5KQ4 A;  1XX0 A;  2J0J A;  4A6F A;  2I5C A;  2UZS A;  1UPQ A;  1V89 A;  5C6R A;  3QWM A;  1WJ1 A;  4DXA B;  2D9Y A;  5C79 A;  2V76 A;  5JHH A;  2NZ8 B;  1WI1 A;  3ODO A;  5KQ1 A;  2K00 A;  4DBB A;  2I5F A;  4HAX B;  3O96 A;  3DXE A;  2UZR A;  1U29 A;  2Z0Q A;  1ZM0 A;  2LKO A;  4Z2M B;  4BBK A;  2P0D A;  1KI1 B;  3PVU A;  3VIA A;  3OAN A;  1MK7 B;  4K81 A;  3KRW A;  1DYN A;  3F0W A;  4F7H A;  1GC7 A;  4DX8 A;  1H10 A;  4IFS A;  1UNP A;  1ZVR A;  1K5G B;  2KCJ A;  1U27 A;  2GCJ A;  2HE7 A;  1U5F A;  2D10 A;  3ZDT A;  3HW2 B;  4KHA A;  2J0K A;  3ULB A;  3QIJ A;  1Q67 A;  1XCG A;  2N23 A;  4K17 A;  1UNQ A;  2D9V A;  3AU5 A;  1KZ7 A;  4IAP A;  3ODX A;  3D8E A;  2P0F A;  2D9X A;  4GXB A;  1I2H A;  5D3X A;  1WGQ A;  5KCV A;  4HAW B;  3PG7 A;  2DYN A;  1SHC A;  1FHW A;  1FGY A;  1OMW A;  3AU4 A;  2QKM A;  4XWX A;  3NSU A;  3X23 A;  4C0A A;  3LJU X;  5FI1 A;  4F7U P;  2DN6 A;  2DHJ A;  1U5D A;  1J19 A;  5GOW B;  1EF1 A;  4HDQ A;  1BTN A;  3PVL A;  2YF0 A;  3KRX A;  1WG7 A;  5JP4 A;  4ZRI A;  2D2Q A;  4ZRJ A;  3FM8 C;  5LON B;  4HB3 B;  4KHB B;  2AEH A;  2CY4 A;  3KSY A;  3T06 A;  1V5U A;  2UVM A;  4HDO A;  2PZ1 A;  3F5R A;  5LOP B;  1W1G A;  2M38 A;  5J3Y A;  3M1I B;  2DKQ A;  4GN1 A;  2VRW B;  4IOY X;  1PFJ A;  2G35 A;  4NSW A;  3WA0 A;  1WGU A;  5HE0 A;  1MK9 B;  2FJL A;  5C5B A;  2P0H A;  1U5E A;  1M7R A;  3SV1 A;  1U5G A;  2K2J A;  1U2B A;  4GMV A;  1Y5O A;  2DFK A;  2YT1 A;  2YT0 A;  3TW1 A;  2YRY A;  1XOD A;  4KAX B;  3SYX A;  2DTC A;  4KVG B;  3WYF B;  2OQB A;  1X05 A;  2L1C A;  4GPT B;  1X86 A;  3TCA A;  4GMX B;  2H7E A;  1UPR A;  2DYQ A;  1PLS A;  5JLJ B;  1WJM A;  1Y19 B;  1FAO A;  1TJ6 A;  2Y8F A;  4WVF B;  2D4Q A;  3KZ1 A;  1GC6 A;  1UEF A;  2BCJ A;  2LOX A;  3MDB C;  1AWE A;  3MPX A;  1K5D B;  2IYB A;  2RVB B;  4F7G A;  3PSC A;  5HE2 A;  3SUZ A;  4PNK A;  1ZC3 B;  4HAZ B;  4EKU A;  1BWN A;  4L6E A;  2CY5 A;  3PEG A;  4D0N B;  3A8Q A;  3CIK A;  2ROV A;  2LUL A;  2P8V A;  2Z0O A;  1MPH A;  1V5M A;  3A98 B;  1W1D A;  5DHA B;  2COD A;  1V5P A;  5CLQ B;  2LOZ A;  4A6H A;  1NU2 A;  1XD4 A;  5DI9 B;  2LG1 A;  3KY9 A;  2L2I A;  1XR0 B;  4NY0 A;  5FI0 A;  4A6F B;  4HB0 B;  3U8Z A;  1Z87 A;  2YSZ A;  2EMT A;  2M14 A;  3ULC A;  1W1H A;  4Z2N A;  2Y8G A;  4EMO A;  5D3Y A;  2RLO A;  2J0M A;  2HTH B;  3SNH A;  1LW3 A;  1MAI A;  4KHO A;  3DXD A;  3U7D A;  3FSS A;  1FOE A;  2X18 A;  4P7I A;  2D9W A;  4TYZ A;  2R09 A;  2DLW A;  1X1F A;  2K2U A;  1IRS A;  4HHV A;  3PVW A;  1FHX A;  4YON A;  5JHG A;  2N0Y A;  2QKL A;  3A8P A;  4HB2 B;  4WJ7 A;  1FB8 A;  4K2O A;  2COF A;  3DXC A;  3HK0 A;  2CAY A;  1SGH A;  1ZSQ A;  2RUK B;  1MIZ B;  2COA A;  1NI2 A;  1V61 A;  2DHI A;  4MY6 A;  3D8F A;  1E5W A;  3CXB B;  1B55 A;  2NMB A;  1TXD A;  2Z0P A;  4HAU B;  4CHM A;  5DH9 B;  2DKP A;  2J59 M;  1EAZ A;  1H4R A;  5D3V A;  2KUP A;  3GYP A;  1PMS A;  5J3T A;  3P7Z A;  5L81 A;  2D11 A;  2Q13 A;  5CLL B;  3TO1 A;  3QBV B;  1MKE A;  2ELA A; 
#chains in the Genus database with same CATH topology
 1ZC4 B;  2YVC A;  4A6K A;  3UZT A;  2DX1 A;  2MWN B;  1DRO A;  1NTV A;  1P5T A;  1KZG A;  1FHO A;  2XQN M;  4GZU A;  1WVH A;  2MKR A;  2KGX B;  4D6W A;  1X1G A;  5EFX A;  1EVH A;  2YS3 A;  4KHB A;  4CHJ A;  4TKN A;  1I7A A;  2Z4D A;  1LB1 A;  2EC1 A;  1AQC A;  1V88 A;  4OT1 A;  1FGZ A;  1P3R A;  2GCL A;  2K49 A;  1M7E A;  1GG3 A;  3G9W A;  2VKI A;  3IVF A;  3SO6 A;  4DIX A;  3P6A A;  4YL8 A;  5C5B B;  2YS1 A;  4B6H A;  3RCP A;  3HIE A;  2RGN B;  1OY2 A;  2EJ8 A;  1DBH A;  2Y7B A;  1P6S A;  2LYD A;  3PP2 A;  4MK0 A;  2JP2 A;  1UNR A;  2COC A;  2GJY A;  2ADZ A;  2OTX A;  3VOQ A;  3OHM B;  4CYE A;  3N7C A;  3ZVR A;  2MDX A;  2NBV A;  1TQZ A;  2VSZ A;  2MFQ A;  4HAT B;  5HE1 A;  3BIN A;  1X11 A;  1QC6 A;  1RRP B;  4HB4 B;  5HE3 A;  2CRF A;  2ZPY A;  2YS5 A;  1RJ2 A;  4ZRK A;  1DDM A;  3AJ4 A;  4A5K A;  2ELB A;  2AL6 A;  2DHK A;  2IFS A;  2DA0 A;  2I1J A;  5DHF B;  3GYO A;  4MT7 A;  1N3H A;  3HQC A;  2W2W A;  2W2X D;  3D8D A;  3DCX A;  2ZKM X;  5J3Q A;  2W2X C;  1NTY A;  3ML4 A;  2R0D A;  5D27 A;  4HAY B;  1EGX A;  4K2P A;  3V5W A;  3NW8 A;  2EMS A;  1QQG A;  4PQ0 A;  2RNR B;  1DDV A;  1OQN A;  2ROZ B;  1DDW A;  2GS0 A;  1XKE A;  1BAK A;  1J0W A;  2I1K A;  3PZD A;  3FEH A;  3BJI A;  2D9Z A;  1BTK A;  4H8S A;  5D3W A;  1ISN A;  5C16 A;  4Y94 A;  2KUQ A;  2K8E A;  1MIX A;  5DIF B;  4DX9 0;  2RSG A;  4EJN A;  2H7D A;  3ODW A;  5I2M A;  2DX5 A;  3TFM A;  3TVV A;  2E2X A;  4HAV B;  2FJU B;  4WSF A;  5KQ4 A;  1XX0 A;  2J0J A;  4A6F A;  2I5C A;  2UZS A;  1UPQ A;  1V89 A;  5C6R A;  3QWM A;  1WJ1 A;  4DXA B;  2D9Y A;  5C79 A;  2V76 A;  5JHH A;  2NZ8 B;  1WI1 A;  3ODO A;  5KQ1 A;  2K00 A;  4DBB A;  2I5F A;  3NWA A;  4HAX B;  3O96 A;  3DXE A;  2UZR A;  4QXA B;  1U29 A;  2Z0Q A;  1ZM0 A;  2LKO A;  4Z2M B;  4BBK A;  2P0D A;  1KI1 B;  3PVU A;  3VIA A;  3OAN A;  4GNK B;  1MK7 B;  4K81 A;  3KRW A;  1ZYI A;  1DYN A;  3F0W A;  4F7H A;  1GC7 A;  4DX8 A;  1H10 A;  4IFS A;  1UNP A;  1ZVR A;  1K5G B;  2KCJ A;  1U27 A;  5LG4 B;  2GCJ A;  2HE7 A;  3NWF A;  1U5F A;  2D10 A;  3ZDT A;  3HW2 B;  4CSQ A;  4KHA A;  2J0K A;  3ULB A;  3QIJ A;  1Q67 A;  1XCG A;  2N23 A;  4K17 A;  1UNQ A;  2D9V A;  3AU5 A;  1KZ7 A;  4IAP A;  3ODX A;  2KIE A;  3D8E A;  4QJ5 B;  2P0F A;  2D9X A;  4GXB A;  1I2H A;  5D3X A;  1WGQ A;  5KCV A;  4HAW B;  3PG7 A;  2DYN A;  1SHC A;  1FHW A;  1FGY A;  1OMW A;  3AU4 A;  2QKM A;  4XWX A;  3A58 A;  3NSU A;  3X23 A;  4C0A A;  3LJU X;  5FI1 A;  4F7U P;  2DN6 A;  2DHJ A;  1U5D A;  1J19 A;  5GOW B;  1EF1 A;  4HDQ A;  1BTN A;  3PVL A;  2YF0 A;  3NWD A;  3KRX A;  1WG7 A;  5JP4 A;  4ZRI A;  2D2Q A;  4ZRJ A;  3FM8 C;  5LON B;  4HB3 B;  4KHB B;  2AEH A;  2CY4 A;  3KSY A;  3T06 A;  1V5U A;  2UVM A;  4HDO A;  2PZ1 A;  3F5R A;  5LOP B;  1W1G A;  2M38 A;  5J3Y A;  3M1I B;  2DKQ A;  5M4Y B;  4GN1 A;  4QJ3 B;  2VRW B;  4IOY X;  4HSI A;  1PFJ A;  2KR0 A;  2G35 A;  4NSW A;  3WA0 A;  1WGU A;  5HE0 A;  1MK9 B;  2FJL A;  5C5B A;  2P0H A;  1U5E A;  1M7R A;  3SV1 A;  1U5G A;  1MI1 A;  2K2J A;  1U2B A;  4GMV A;  1Y5O A;  2DFK A;  2YT1 A;  2YT0 A;  3TW1 A;  2YRY A;  1XOD A;  4KAX B;  3SYX A;  2DTC A;  4KVG B;  3WYF B;  2OQB A;  1X05 A;  2L1C A;  4GPT B;  1X86 A;  3TCA A;  4GMX B;  2H7E A;  1UPR A;  2DYQ A;  1PLS A;  5JLJ B;  1WJM A;  1Y19 B;  4QJ4 B;  1FAO A;  1TJ6 A;  2Y8F A;  4WVF B;  2D4Q A;  3KZ1 A;  4OSN A;  1GC6 A;  1UEF A;  2BCJ A;  2LOX A;  3MDB C;  1AWE A;  3MPX A;  1K5D B;  2IYB A;  2RVB B;  4F7G A;  3PSC A;  5HE2 A;  3SUZ A;  2KIG A;  4PNK A;  1ZC3 B;  4HAZ B;  3HSA A;  2Z14 A;  4EKU A;  1BWN A;  4L6E A;  2CY5 A;  3PEG A;  4D0N B;  3A8Q A;  3CIK A;  2ROV A;  2LUL A;  2P8V A;  2Z0O A;  1MPH A;  1V5M A;  3A98 B;  1W1D A;  5DHA B;  2COD A;  1V5P A;  4L1R A;  5CLQ B;  2LOZ A;  4A6H A;  1NU2 A;  1XD4 A;  5DI9 B;  2LG1 A;  2RRF A;  3KY9 A;  2L2I A;  1XR0 B;  4NY0 A;  5FI0 A;  4A6F B;  4HB0 B;  2YT2 A;  1Z87 A;  3U8Z A;  2YSZ A;  2EMT A;  2M14 A;  3ULC A;  1W1H A;  4Z2N A;  2Y8G A;  4EMO A;  5D3Y A;  2RLO A;  2J0M A;  2HTH B;  3SNH A;  1LW3 A;  1MAI A;  4KHO A;  3DXD A;  3U7D A;  2Z59 A;  3FSS A;  1FOE A;  2X18 A;  4P7I A;  2D9W A;  4TYZ A;  3B77 A;  2R09 A;  2DLW A;  1X1F A;  3U12 A;  2GUM A;  2K2U A;  1IRS A;  4HHV A;  3PVW A;  1FHX A;  4YON A;  5JHG A;  4GOU A;  2N0Y A;  2QKL A;  3A8P A;  4HB2 B;  4WJ7 A;  5I2S A;  2Z13 A;  1FB8 A;  4K2O A;  2COF A;  3DXC A;  3HK0 A;  2CAY A;  1T77 A;  1SGH A;  1ZSQ A;  2RUK B;  1MIZ B;  2COA A;  1NI2 A;  1V61 A;  2R2Y A;  2DHI A;  3FVC A;  4MY6 A;  3D8F A;  1E5W A;  3CXB B;  1B55 A;  2NMB A;  1TXD A;  2Z0P A;  5IRS A;  4HAU B;  4CHM A;  5DH9 B;  2DKP A;  2J59 M;  1EAZ A;  1H4R A;  5D3V A;  2KUP A;  3GYP A;  1PMS A;  5J3T A;  3P7Z A;  5L81 A;  2D11 A;  2Q13 A;  5CLL B;  3TO1 A;  3QBV B;  1MKE A;  2ELA A; 
#chains in the Genus database with same CATH homology
 1ZC4 B;  2YVC A;  4A6K A;  3UZT A;  2DX1 A;  2MWN B;  1DRO A;  1NTV A;  1P5T A;  1KZG A;  1FHO A;  2XQN M;  4GZU A;  1WVH A;  2MKR A;  2KGX B;  1X1G A;  5EFX A;  1EVH A;  2YS3 A;  4CHJ A;  4TKN A;  1I7A A;  1LB1 A;  2EC1 A;  1AQC A;  1V88 A;  1FGZ A;  1P3R A;  2GCL A;  1M7E A;  1GG3 A;  3G9W A;  2VKI A;  3IVF A;  3SO6 A;  3P6A A;  4YL8 A;  5C5B B;  2YS1 A;  4B6H A;  3RCP A;  2RGN B;  1OY2 A;  2EJ8 A;  1DBH A;  2Y7B A;  1P6S A;  2LYD A;  3PP2 A;  4MK0 A;  2JP2 A;  1UNR A;  2COC A;  2GJY A;  2ADZ A;  2OTX A;  3VOQ A;  4CYE A;  3N7C A;  3ZVR A;  2MDX A;  1TQZ A;  2VSZ A;  2MFQ A;  4HAT B;  5HE1 A;  3BIN A;  1X11 A;  1QC6 A;  1RRP B;  4HB4 B;  5HE3 A;  2CRF A;  2ZPY A;  2YS5 A;  1RJ2 A;  4ZRK A;  1DDM A;  3AJ4 A;  4A5K A;  2ELB A;  2AL6 A;  2DHK A;  2IFS A;  2DA0 A;  2I1J A;  5DHF B;  3GYO A;  4MT7 A;  1N3H A;  3HQC A;  2W2W A;  2W2X D;  3D8D A;  5J3Q A;  2W2X C;  1NTY A;  3ML4 A;  2R0D A;  5D27 A;  4HAY B;  1EGX A;  4K2P A;  3V5W A;  2EMS A;  1QQG A;  4PQ0 A;  2RNR B;  1DDV A;  1OQN A;  2ROZ B;  1DDW A;  2GS0 A;  1XKE A;  1BAK A;  1J0W A;  2I1K A;  3PZD A;  3FEH A;  3BJI A;  2D9Z A;  1BTK A;  4H8S A;  5D3W A;  1ISN A;  5C16 A;  4Y94 A;  1MIX A;  5DIF B;  4DX9 0;  2RSG A;  4EJN A;  2H7D A;  3ODW A;  2DX5 A;  3TFM A;  3TVV A;  2E2X A;  4HAV B;  4WSF A;  5KQ4 A;  1XX0 A;  2J0J A;  4A6F A;  2I5C A;  2UZS A;  1UPQ A;  1V89 A;  5C6R A;  3QWM A;  1WJ1 A;  4DXA B;  2D9Y A;  5C79 A;  2V76 A;  5JHH A;  2NZ8 B;  1WI1 A;  3ODO A;  5KQ1 A;  2K00 A;  4DBB A;  2I5F A;  4HAX B;  3O96 A;  3DXE A;  2UZR A;  1U29 A;  2Z0Q A;  1ZM0 A;  2LKO A;  4Z2M B;  4BBK A;  2P0D A;  1KI1 B;  3PVU A;  3VIA A;  3OAN A;  1MK7 B;  4K81 A;  3KRW A;  1DYN A;  3F0W A;  4F7H A;  1GC7 A;  4DX8 A;  1H10 A;  4IFS A;  1UNP A;  1ZVR A;  1K5G B;  2KCJ A;  1U27 A;  2GCJ A;  2HE7 A;  1U5F A;  2D10 A;  3ZDT A;  3HW2 B;  4KHA A;  2J0K A;  3ULB A;  3QIJ A;  1Q67 A;  1XCG A;  2N23 A;  4K17 A;  1UNQ A;  2D9V A;  3AU5 A;  1KZ7 A;  4IAP A;  3ODX A;  3D8E A;  2P0F A;  2D9X A;  4GXB A;  1I2H A;  5D3X A;  1WGQ A;  5KCV A;  4HAW B;  3PG7 A;  2DYN A;  1SHC A;  1FHW A;  1FGY A;  1OMW A;  3AU4 A;  2QKM A;  4XWX A;  3NSU A;  3X23 A;  4C0A A;  3LJU X;  5FI1 A;  4F7U P;  2DN6 A;  2DHJ A;  1U5D A;  1J19 A;  5GOW B;  1EF1 A;  4HDQ A;  1BTN A;  3PVL A;  2YF0 A;  3KRX A;  1WG7 A;  5JP4 A;  4ZRI A;  2D2Q A;  4ZRJ A;  3FM8 C;  5LON B;  4HB3 B;  4KHB B;  2AEH A;  2CY4 A;  3KSY A;  3T06 A;  1V5U A;  2UVM A;  4HDO A;  2PZ1 A;  3F5R A;  5LOP B;  1W1G A;  2M38 A;  5J3Y A;  3M1I B;  2DKQ A;  4GN1 A;  2VRW B;  4IOY X;  1PFJ A;  2G35 A;  4NSW A;  3WA0 A;  1WGU A;  5HE0 A;  1MK9 B;  2FJL A;  5C5B A;  2P0H A;  1U5E A;  1M7R A;  3SV1 A;  1U5G A;  2K2J A;  1U2B A;  4GMV A;  1Y5O A;  2DFK A;  2YT1 A;  2YT0 A;  3TW1 A;  2YRY A;  1XOD A;  4KAX B;  3SYX A;  2DTC A;  4KVG B;  3WYF B;  2OQB A;  1X05 A;  2L1C A;  4GPT B;  1X86 A;  3TCA A;  4GMX B;  2H7E A;  1UPR A;  2DYQ A;  1PLS A;  5JLJ B;  1WJM A;  1Y19 B;  1FAO A;  1TJ6 A;  2Y8F A;  4WVF B;  2D4Q A;  3KZ1 A;  1GC6 A;  1UEF A;  2BCJ A;  2LOX A;  3MDB C;  1AWE A;  3MPX A;  1K5D B;  2IYB A;  2RVB B;  4F7G A;  3PSC A;  5HE2 A;  3SUZ A;  4PNK A;  1ZC3 B;  4HAZ B;  4EKU A;  1BWN A;  4L6E A;  2CY5 A;  3PEG A;  4D0N B;  3A8Q A;  3CIK A;  2ROV A;  2LUL A;  2P8V A;  2Z0O A;  1MPH A;  1V5M A;  3A98 B;  1W1D A;  5DHA B;  2COD A;  1V5P A;  5CLQ B;  2LOZ A;  4A6H A;  1NU2 A;  1XD4 A;  5DI9 B;  2LG1 A;  3KY9 A;  2L2I A;  1XR0 B;  4NY0 A;  5FI0 A;  4A6F B;  4HB0 B;  3U8Z A;  1Z87 A;  2YSZ A;  2EMT A;  2M14 A;  3ULC A;  1W1H A;  4Z2N A;  2Y8G A;  4EMO A;  5D3Y A;  2RLO A;  2J0M A;  2HTH B;  3SNH A;  1LW3 A;  1MAI A;  4KHO A;  3DXD A;  3U7D A;  3FSS A;  1FOE A;  2X18 A;  4P7I A;  2D9W A;  4TYZ A;  2R09 A;  2DLW A;  1X1F A;  2K2U A;  1IRS A;  4HHV A;  3PVW A;  1FHX A;  4YON A;  5JHG A;  2N0Y A;  2QKL A;  3A8P A;  4HB2 B;  4WJ7 A;  1FB8 A;  4K2O A;  2COF A;  3DXC A;  3HK0 A;  2CAY A;  1SGH A;  1ZSQ A;  2RUK B;  1MIZ B;  2COA A;  1NI2 A;  1V61 A;  2DHI A;  4MY6 A;  3D8F A;  1E5W A;  3CXB B;  1B55 A;  2NMB A;  1TXD A;  2Z0P A;  4HAU B;  4CHM A;  5DH9 B;  2DKP A;  2J59 M;  1EAZ A;  1H4R A;  5D3V A;  2KUP A;  3GYP A;  1PMS A;  5J3T A;  3P7Z A;  5L81 A;  2D11 A;  2Q13 A;  5CLL B;  3TO1 A;  3QBV B;  1MKE A;  2ELA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...