2Y8GA

Structure of the ran-binding domain from human ranbp3 (e352a-r353v double mutant)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
124
structure length
122
Chain Sequence
ESNVLQMQCKLFVFDKTSQSWVAVGRGLLRLNDMASTDDGTLQSRLVMRTQGSLRLILNTKLWAQMQIDKASEKSIRITAMDDQGVKVFLISASSKDTGQLYAALHHRILALRSRVEQEQEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RAN-BINDING PROTEIN 3
publication title Insights Into the Function of the Crm1 Cofactor Ranbp3 from the Structure of its Ran-Binding Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 28
structure length 122
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2y8gA00
2QKLA 1J0WA 2I5FA 2ROZB 2AL6A 1U29A 1SHCA 1OQNA 1DROA 1MKEA 3KRXA 2DN6A 1M7EA 3DXCA 5HE3A 2EC1A 2N0YA 2EJ8A 2DKQA 5KQ1A 4KHBB 4EKUA 1ZC4B 1X86A 2K2JA 2E2XA 3KSYA 4YONA 3T06A 4K2PA 2M14A 2Q13A 5KCVA 1P3RA 3PG7A 2J59M 4EMOA 4A5KA 1P6SA 2RVBB 3SYXA 3TW1A 2XQNM 2COCA 1FAOA 3GYOA 5C16A 3UZTA 3A98B 1FGZA 1PLSA 1M7RA 1V61A 3FEHA 1WVHA 1IRSA 4BBKA 2IFSA 1MK9B 1W1HA 5D3YA 3U8ZA 2YVCA 3PVUA 4NSWA 4DX90 1ZC3B 3ODWA 3M1IB 2I1KA 2UZSA 1MK7B 2LULA 1NTVA 4IAPA 2YRYA 1AQCA 1UNQA 2D9WA 2BCJA 4HDQA 2GCLA 4F7HA 1X1GA 2RSGA 2AEHA 2K00A 4CHJA 3PEGA 2D10A 2L1CA 5L81A 2DLWA 5CLQB 1ZVRA 3KZ1A 1KZGA 2UVMA 3QIJA 4GMVA 2HTHB 2J0MA 5JP4A 2P8VA 3MPXA 2PZ1A 3ULCA 3KY9A 1V5MA 5J3YA 1U5GA 4PQ0A 3CXBB 1Y5OA 1RJ2A 3P7ZA 2COAA 2VKIA 2YS3A 3AU5A 1U27A 4HB4B 2NZ8B 4CHMA 2J0JA 1ISNA 1U2BA 5DI9B 5DHAB 2YS1A 1X05A 3QBVB 1DDMA 1X1FA 4HB3B 1PMSA 5D3WA 1BWNA 2LOXA 5JLJB 2NMBA 2MDXA 2R09A 2DYNA 1UNRA 2W2XD 2KGXB 2DTCA 2Z0QA 1XKEA 2R0DA 3MDBC 2MKRA 1Y19B 4KVGB 3SUZA 3GYPA 1I7AA 4TYZA 3G9WA 3ZDTA 1MIZB 1FGYA 1TXDA 1AWEA 2CY5A 2D9XA 5JHHA 1LB1A 2COFA 2ROVA 1FB8A 2RLOA 3TCAA 2W2WA 1W1DA 2X18A 2D4QA 2MWNB 3OANA 4HAWB 1TQZA 5HE1A 4HB2B 3HW2B 2DA0A 2FJLA 4F7GA 3TO1A 4MT7A 4D0NB 2DYQA 3RCPA 5FI1A 2DX5A 1KZ7A 2CRFA 4A6HA 5J3TA 2RGNB 1MAIA 2G35A 5FI0A 1DDVA 1EVHA 1RRPB 4DBBA 1U5EA 1PFJA 1WGUA 2V76A 3F0WA 1XD4A 1LW3A 3ODXA 4IOYX 3SO6A 2I5CA 5DH9B 1UPRA 2DX1A 4XWXA 5LONB 3PVLA 1FHOA 4K2OA 4HAUB 5HE2A 2Z0OA 2P0DA 2DHJA 1XCGA 4HAVB 3AJ4A 2GS0A 1BTKA 2KUPA 1WGQA 5HE0A 2ELAA 4DXAB 2CAYA 1ZM0A 2YF0A 5JHGA 2D2QA 4H8SA 3D8FA 5C5BA 1U5DA 1FHXA 2YSZA 3U7DA 1WJ1A 1GC6A 1QQGA 3ODOA 1GC7A 1I2HA 2J0KA 1WG7A 2CY4A 2RUKB 2CODA 2D11A 1NU2A 4HAXB 2GCJA 3FM8C 2OTXA 4A6FB 5LOPB 4HAYB 3VIAA 4ZRIA 4HATB 1OY2A 2W2XC 1E5WA 4KAXB 5DIFB 3DXDA 5D3VA 2LKOA 4DX8A 2M38A 1DDWA 5EFXA 4GN1A 3LJUX 1U5FA 1P5TA 5DHFB 3PVWA 1BAKA 1NTYA 1XODA 4ZRKA 4F7UP 4K17A 3A8PA 1OMWA 4Y94A 4HDOA 2MFQA 2ELBA 2LYDA 4KHAA 1SGHA 2P0HA 1H4RA 2YT0A 1MPHA 2EMSA 5C6RA 1FHWA 3V5WA 3O96A 2D9YA 1W1GA 2L2IA 1DBHA 1J19A 1K5DB 3FSSA 3ML4A 2EMTA 2RNRB 2ZPYA 2ADZA 4TKNA 4YL8A 3TVVA 1WJMA 3PP2A 3WA0A 1EGXA 2I1JA 3DXEA 2QKMA 4K81A 1EF1A 3HQCA 3D8EA 2Y8GA 4L6EA 1QC6A 2JP2A 3BINA 1XR0B 2VRWB 3CIKA 1XX0A 1UPQA 1V5PA 2HE7A 3N7CA 4HAZB 1N3HA 4GXBA 3NSUA 4IFSA 1TJ6A 2P0FA 3A8QA 5D3XA 3SNHA 4HB0B 4CYEA 1NI2A 3PZDA 1DYNA 3ULBA 1EAZA 1UEFA 3P6AA 4GZUA 3X23A 4A6KA 1V5UA 1KI1B 3BJIA 4MK0A 1B55A 4NY0A 5KQ4A 1FOEA 3SV1A 2H7EA 4GMXB 2GJYA 1MIXA 3F5RA 2N23A 4ZRJA 3KRWA 1V88A 2Z0PA 5D27A 1Z87A 2KCJA 4PNKA 4MY6A 4Z2NA 1V89A 2H7DA 2OQBA 1GG3A 2YS5A 2UZRA 4GPTB 5J3QA 4WVFB 4Z2MB 4C0AA 3QWMA 3PSCA 3HK0A 5C5BB 3ZVRA 1X11A 5C79A 5CLLB 3AU4A 1ZSQA 4EJNA 2Y7BA 1WI1A 2D9ZA 2DKPA 2YT1A 2DHKA 4KHOA 2D9VA 2Y8FA 1UNPA 3D8DA 3VOQA 1H10A 4P7IA 3WYFB 4WJ7A 1K5GB 3TFMA 3IVFA 4WSFA 2DHIA 2LOZA 2K2UA 2LG1A 2VSZA 4A6FA 4B6HA 2IYBA 1Q67A 4HHVA 2DFKA 1BTNA 5GOWB
chains in the Genus database with same CATH superfamily
2QKLA 1J0WA 2I5FA 2ROZB 2AL6A 1U29A 1SHCA 1OQNA 1DROA 1MKEA 3KRXA 2DN6A 1M7EA 3DXCA 5HE3A 2EC1A 2N0YA 2EJ8A 2DKQA 5KQ1A 3B77A 4KHBB 4GOUA 4EKUA 1ZC4B 1X86A 2K2JA 2E2XA 3KSYA 4YONA 3T06A 4K2PA 2M14A 2Q13A 5KCVA 2RRFA 1P3RA 3PG7A 2Z4DA 2J59M 4EMOA 3NWAA 4A5KA 1P6SA 2RVBB 3SYXA 3TW1A 2XQNM 2COCA 1FAOA 3GYOA 5C16A 3UZTA 3A98B 1FGZA 1PLSA 1M7RA 1V61A 3FEHA 1WVHA 1IRSA 4L1RA 4BBKA 2IFSA 1MK9B 1W1HA 5D3YA 3U8ZA 2YVCA 3PVUA 4NSWA 4DX90 1ZC3B 3ODWA 3M1IB 2I1KA 2UZSA 1MK7B 2LULA 3U12A 1NTVA 4IAPA 4OT1A 2YRYA 1AQCA 3NW8A 1UNQA 2D9WA 2BCJA 5I2MA 4HDQA 2GCLA 4F7HA 1X1GA 2RSGA 2AEHA 2K00A 4CHJA 3PEGA 2D10A 2L1CA 5L81A 2DLWA 5CLQB 1ZVRA 3A58A 3KZ1A 5M4YB 1KZGA 2UVMA 3QIJA 4DIXA 4GMVA 2HTHB 2J0MA 5JP4A 2P8VA 3MPXA 2PZ1A 3ULCA 3KY9A 2KIEA 1V5MA 5J3YA 4D6WA 1U5GA 4PQ0A 3CXBB 1Y5OA 1RJ2A 3P7ZA 2COAA 2VKIA 2YS3A 3AU5A 1U27A 4HB4B 2NZ8B 2KR0A 4CHMA 2J0JA 1ISNA 1U2BA 5DI9B 5DHAB 2YS1A 1X05A 3QBVB 1DDMA 4HSIA 1X1FA 2YT2A 2Z59A 4HB3B 1PMSA 5D3WA 1BWNA 2LOXA 5JLJB 2NMBA 2MDXA 3DCXA 2R09A 2DYNA 1UNRA 2W2XD 2KGXB 2DTCA 2Z0QA 1XKEA 2R0DA 3MDBC 5IRSA 2MKRA 1Y19B 4KVGB 3SUZA 3GYPA 1I7AA 4TYZA 3G9WA 3ZDTA 1MIZB 1FGYA 1TXDA 1AWEA 2CY5A 2D9XA 5JHHA 1LB1A 2COFA 2ROVA 1FB8A 2RLOA 3FVCA 3TCAA 2W2WA 4KHBA 4QJ3B 1W1DA 2X18A 2D4QA 2MWNB 3OANA 4HAWB 1TQZA 5HE1A 4HB2B 2K49A 3HW2B 2DA0A 2FJLA 4F7GA 3TO1A 4MT7A 2NBVA 4D0NB 2DYQA 3RCPA 5FI1A 2DX5A 1KZ7A 2CRFA 4A6HA 5J3TA 2RGNB 1MAIA 3NWFA 2G35A 5FI0A 1DDVA 1EVHA 1RRPB 4DBBA 3HIEA 4QJ5B 1U5EA 1PFJA 1WGUA 2V76A 2FJUB 3F0WA 1XD4A 1LW3A 3ODXA 4IOYX 3SO6A 2I5CA 5DH9B 1UPRA 2DX1A 2KUQA 4XWXA 5LONB 3PVLA 1FHOA 4K2OA 4HAUB 5HE2A 2Z0OA 2P0DA 2DHJA 1XCGA 4HAVB 3AJ4A 2GS0A 3NWDA 1BTKA 2KUPA 1WGQA 5HE0A 2ELAA 4DXAB 2CAYA 1ZM0A 2YF0A 4GNKB 5JHGA 2D2QA 4H8SA 3D8FA 5C5BA 1U5DA 1FHXA 2YSZA 3U7DA 1WJ1A 1GC6A 1QQGA 2R2YA 3ODOA 1GC7A 1I2HA 2J0KA 1WG7A 2CY4A 2RUKB 2CODA 2D11A 1NU2A 4HAXB 2GCJA 3FM8C 2Z13A 2OTXA 4A6FB 5LOPB 4HAYB 3VIAA 4ZRIA 4HATB 1OY2A 2W2XC 1E5WA 4KAXB 5DIFB 3DXDA 5D3VA 2LKOA 4DX8A 2M38A 1DDWA 5EFXA 4GN1A 3LJUX 1U5FA 1P5TA 5DHFB 3PVWA 1BAKA 1NTYA 1XODA 4ZRKA 4F7UP 4K17A 3A8PA 1OMWA 4Y94A 4HDOA 2MFQA 2ELBA 2LYDA 4KHAA 1SGHA 2P0HA 2ZKMX 1H4RA 2YT0A 1MPHA 2EMSA 3OHMB 5C6RA 1FHWA 3V5WA 3O96A 2D9YA 1W1GA 2L2IA 1DBHA 1J19A 1K5DB 3FSSA 3ML4A 2EMTA 2RNRB 2ZPYA 2ADZA 4TKNA 4YL8A 3TVVA 1WJMA 3PP2A 3WA0A 1EGXA 2I1JA 3DXEA 2QKMA 4K81A 1EF1A 3HQCA 3D8EA 2Y8GA 5LG4B 4L6EA 1QC6A 2JP2A 3BINA 1XR0B 2VRWB 3CIKA 1XX0A 1UPQA 1V5PA 2HE7A 3N7CA 4QXAB 4HAZB 1N3HA 4GXBA 3NSUA 4IFSA 1TJ6A 2P0FA 3A8QA 5D3XA 3SNHA 4HB0B 4CYEA 1NI2A 3PZDA 1DYNA 3ULBA 3HSAA 1EAZA 1UEFA 3P6AA 2Z14A 4GZUA 3X23A 4A6KA 1V5UA 1KI1B 3BJIA 4MK0A 1B55A 4NY0A 5KQ4A 1FOEA 1T77A 1ZYIA 3SV1A 2H7EA 4GMXB 2GJYA 1MIXA 3F5RA 2N23A 4ZRJA 3KRWA 1V88A 2Z0PA 5D27A 1Z87A 2KCJA 4PNKA 4MY6A 5I2SA 4Z2NA 1V89A 2H7DA 2OQBA 1GG3A 2YS5A 2UZRA 4GPTB 5J3QA 4WVFB 4Z2MB 4C0AA 3QWMA 3PSCA 3HK0A 4OSNA 2KIGA 5C5BB 3ZVRA 1X11A 5C79A 5CLLB 2GUMA 3AU4A 1ZSQA 4EJNA 2Y7BA 4QJ4B 1WI1A 2D9ZA 2DKPA 2YT1A 2DHKA 4KHOA 2D9VA 2Y8FA 1UNPA 3D8DA 3VOQA 1H10A 4P7IA 3WYFB 4WJ7A 1K5GB 3TFMA 3IVFA 4WSFA 2DHIA 2LOZA 2K2UA 4CSQA 2K8EA 2LG1A 2VSZA 1MI1A 4A6FA 4B6HA 2IYBA 1Q67A 4HHVA 2DFKA 1BTNA 5GOWB
chains in the Genus database with same CATH topology
2QKLA 1J0WA 2I5FA 2ROZB 2AL6A 1U29A 1SHCA 1OQNA 1DROA 1MKEA 3KRXA 2DN6A 1M7EA 3DXCA 5HE3A 2EC1A 2N0YA 2EJ8A 2DKQA 5KQ1A 4KHBB 4EKUA 1ZC4B 1X86A 2K2JA 2E2XA 3KSYA 4YONA 3T06A 4K2PA 2M14A 2Q13A 5KCVA 1P3RA 3PG7A 2J59M 4EMOA 4A5KA 1P6SA 2RVBB 3SYXA 3TW1A 2XQNM 2COCA 1FAOA 3GYOA 5C16A 3UZTA 3A98B 1FGZA 1PLSA 1M7RA 1V61A 3FEHA 1WVHA 1IRSA 4BBKA 2IFSA 1MK9B 1W1HA 5D3YA 3U8ZA 2YVCA 3PVUA 4NSWA 4DX90 1ZC3B 3ODWA 3M1IB 2I1KA 2UZSA 1MK7B 2LULA 1NTVA 4IAPA 2YRYA 1AQCA 1UNQA 2D9WA 2BCJA 4HDQA 2GCLA 4F7HA 1X1GA 2RSGA 2AEHA 2K00A 4CHJA 3PEGA 2D10A 2L1CA 5L81A 2DLWA 5CLQB 1ZVRA 3KZ1A 1KZGA 2UVMA 3QIJA 4GMVA 2HTHB 2J0MA 5JP4A 2P8VA 3MPXA 2PZ1A 3ULCA 3KY9A 1V5MA 5J3YA 1U5GA 4PQ0A 3CXBB 1Y5OA 1RJ2A 3P7ZA 2COAA 2VKIA 2YS3A 3AU5A 1U27A 4HB4B 2NZ8B 4CHMA 2J0JA 1ISNA 1U2BA 5DI9B 5DHAB 2YS1A 1X05A 3QBVB 1DDMA 1X1FA 4HB3B 1PMSA 5D3WA 1BWNA 2LOXA 5JLJB 2NMBA 2MDXA 2R09A 2DYNA 1UNRA 2W2XD 2KGXB 2DTCA 2Z0QA 1XKEA 2R0DA 3MDBC 2MKRA 1Y19B 4KVGB 3SUZA 3GYPA 1I7AA 4TYZA 3G9WA 3ZDTA 1MIZB 1FGYA 1TXDA 1AWEA 2CY5A 2D9XA 5JHHA 1LB1A 2COFA 2ROVA 1FB8A 2RLOA 3TCAA 2W2WA 1W1DA 2X18A 2D4QA 2MWNB 3OANA 4HAWB 1TQZA 5HE1A 4HB2B 3HW2B 2DA0A 2FJLA 4F7GA 3TO1A 4MT7A 4D0NB 2DYQA 3RCPA 5FI1A 2DX5A 1KZ7A 2CRFA 4A6HA 5J3TA 2RGNB 1MAIA 2G35A 5FI0A 1DDVA 1EVHA 1RRPB 4DBBA 1U5EA 1PFJA 1WGUA 2V76A 3F0WA 1XD4A 1LW3A 3ODXA 4IOYX 3SO6A 2I5CA 5DH9B 1UPRA 2DX1A 4XWXA 5LONB 3PVLA 1FHOA 4K2OA 4HAUB 5HE2A 2Z0OA 2P0DA 2DHJA 1XCGA 4HAVB 3AJ4A 2GS0A 1BTKA 2KUPA 1WGQA 5HE0A 2ELAA 4DXAB 2CAYA 1ZM0A 2YF0A 5JHGA 2D2QA 4H8SA 3D8FA 5C5BA 1U5DA 1FHXA 2YSZA 3U7DA 1WJ1A 1GC6A 1QQGA 3ODOA 1GC7A 1I2HA 2J0KA 1WG7A 2CY4A 2RUKB 2CODA 2D11A 1NU2A 4HAXB 2GCJA 3FM8C 2OTXA 4A6FB 5LOPB 4HAYB 3VIAA 4ZRIA 4HATB 1OY2A 2W2XC 1E5WA 4KAXB 5DIFB 3DXDA 5D3VA 2LKOA 4DX8A 2M38A 1DDWA 5EFXA 4GN1A 3LJUX 1U5FA 1P5TA 5DHFB 3PVWA 1BAKA 1NTYA 1XODA 4ZRKA 4F7UP 4K17A 3A8PA 1OMWA 4Y94A 4HDOA 2MFQA 2ELBA 2LYDA 4KHAA 1SGHA 2P0HA 1H4RA 2YT0A 1MPHA 2EMSA 5C6RA 1FHWA 3V5WA 3O96A 2D9YA 1W1GA 2L2IA 1DBHA 1J19A 1K5DB 3FSSA 3ML4A 2EMTA 2RNRB 2ZPYA 2ADZA 4TKNA 4YL8A 3TVVA 1WJMA 3PP2A 3WA0A 1EGXA 2I1JA 3DXEA 2QKMA 4K81A 1EF1A 3HQCA 3D8EA 2Y8GA 4L6EA 1QC6A 2JP2A 3BINA 1XR0B 2VRWB 3CIKA 1XX0A 1UPQA 1V5PA 2HE7A 3N7CA 4HAZB 1N3HA 4GXBA 3NSUA 4IFSA 1TJ6A 2P0FA 3A8QA 5D3XA 3SNHA 4HB0B 4CYEA 1NI2A 3PZDA 1DYNA 3ULBA 1EAZA 1UEFA 3P6AA 4GZUA 3X23A 4A6KA 1V5UA 1KI1B 3BJIA 4MK0A 1B55A 4NY0A 5KQ4A 1FOEA 3SV1A 2H7EA 4GMXB 2GJYA 1MIXA 3F5RA 2N23A 4ZRJA 3KRWA 1V88A 2Z0PA 5D27A 1Z87A 2KCJA 4PNKA 4MY6A 4Z2NA 1V89A 2H7DA 2OQBA 1GG3A 2YS5A 2UZRA 4GPTB 5J3QA 4WVFB 4Z2MB 4C0AA 3QWMA 3PSCA 3HK0A 5C5BB 3ZVRA 1X11A 5C79A 5CLLB 3AU4A 1ZSQA 4EJNA 2Y7BA 1WI1A 2D9ZA 2DKPA 2YT1A 2DHKA 4KHOA 2D9VA 2Y8FA 1UNPA 3D8DA 3VOQA 1H10A 4P7IA 3WYFB 4WJ7A 1K5GB 3TFMA 3IVFA 4WSFA 2DHIA 2LOZA 2K2UA 2LG1A 2VSZA 4A6FA 4B6HA 2IYBA 1Q67A 4HHVA 2DFKA 1BTNA 5GOWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QKL A;  1J0W A;  2I5F A;  2ROZ B;  2AL6 A;  1U29 A;  1SHC A;  1OQN A;  1DRO A;  1MKE A;  3KRX A;  2DN6 A;  1M7E A;  3DXC A;  5HE3 A;  2EC1 A;  2N0Y A;  2EJ8 A;  2DKQ A;  5KQ1 A;  4KHB B;  4EKU A;  1ZC4 B;  1X86 A;  2K2J A;  2E2X A;  3KSY A;  4YON A;  3T06 A;  4K2P A;  2M14 A;  2Q13 A;  5KCV A;  1P3R A;  3PG7 A;  2J59 M;  4EMO A;  4A5K A;  1P6S A;  2RVB B;  3SYX A;  3TW1 A;  2XQN M;  2COC A;  1FAO A;  3GYO A;  5C16 A;  3UZT A;  3A98 B;  1FGZ A;  1PLS A;  1M7R A;  1V61 A;  3FEH A;  1WVH A;  1IRS A;  4BBK A;  2IFS A;  1MK9 B;  1W1H A;  5D3Y A;  3U8Z A;  2YVC A;  3PVU A;  4NSW A;  4DX9 0;  1ZC3 B;  3ODW A;  3M1I B;  2I1K A;  2UZS A;  1MK7 B;  2LUL A;  1NTV A;  4IAP A;  2YRY A;  1AQC A;  1UNQ A;  2D9W A;  2BCJ A;  4HDQ A;  2GCL A;  4F7H A;  1X1G A;  2RSG A;  2AEH A;  2K00 A;  4CHJ A;  3PEG A;  2D10 A;  2L1C A;  5L81 A;  2DLW A;  5CLQ B;  1ZVR A;  3KZ1 A;  1KZG A;  2UVM A;  3QIJ A;  4GMV A;  2HTH B;  2J0M A;  5JP4 A;  2P8V A;  3MPX A;  2PZ1 A;  3ULC A;  3KY9 A;  1V5M A;  5J3Y A;  1U5G A;  4PQ0 A;  3CXB B;  1Y5O A;  1RJ2 A;  3P7Z A;  2COA A;  2VKI A;  2YS3 A;  3AU5 A;  1U27 A;  4HB4 B;  2NZ8 B;  4CHM A;  2J0J A;  1ISN A;  1U2B A;  5DI9 B;  5DHA B;  2YS1 A;  1X05 A;  3QBV B;  1DDM A;  1X1F A;  4HB3 B;  1PMS A;  5D3W A;  1BWN A;  2LOX A;  5JLJ B;  2NMB A;  2MDX A;  2R09 A;  2DYN A;  1UNR A;  2W2X D;  2KGX B;  2DTC A;  2Z0Q A;  1XKE A;  2R0D A;  3MDB C;  2MKR A;  1Y19 B;  4KVG B;  3SUZ A;  3GYP A;  1I7A A;  4TYZ A;  3G9W A;  3ZDT A;  1MIZ B;  1FGY A;  1TXD A;  1AWE A;  2CY5 A;  2D9X A;  5JHH A;  1LB1 A;  2COF A;  2ROV A;  1FB8 A;  2RLO A;  3TCA A;  2W2W A;  1W1D A;  2X18 A;  2D4Q A;  2MWN B;  3OAN A;  4HAW B;  1TQZ A;  5HE1 A;  4HB2 B;  3HW2 B;  2DA0 A;  2FJL A;  4F7G A;  3TO1 A;  4MT7 A;  4D0N B;  2DYQ A;  3RCP A;  5FI1 A;  2DX5 A;  1KZ7 A;  2CRF A;  4A6H A;  5J3T A;  2RGN B;  1MAI A;  2G35 A;  5FI0 A;  1DDV A;  1EVH A;  1RRP B;  4DBB A;  1U5E A;  1PFJ A;  1WGU A;  2V76 A;  3F0W A;  1XD4 A;  1LW3 A;  3ODX A;  4IOY X;  3SO6 A;  2I5C A;  5DH9 B;  1UPR A;  2DX1 A;  4XWX A;  5LON B;  3PVL A;  1FHO A;  4K2O A;  4HAU B;  5HE2 A;  2Z0O A;  2P0D A;  2DHJ A;  1XCG A;  4HAV B;  3AJ4 A;  2GS0 A;  1BTK A;  2KUP A;  1WGQ A;  5HE0 A;  2ELA A;  4DXA B;  2CAY A;  1ZM0 A;  2YF0 A;  5JHG A;  2D2Q A;  4H8S A;  3D8F A;  5C5B A;  1U5D A;  1FHX A;  2YSZ A;  3U7D A;  1WJ1 A;  1GC6 A;  1QQG A;  3ODO A;  1GC7 A;  1I2H A;  2J0K A;  1WG7 A;  2CY4 A;  2RUK B;  2COD A;  2D11 A;  1NU2 A;  4HAX B;  2GCJ A;  3FM8 C;  2OTX A;  4A6F B;  5LOP B;  4HAY B;  3VIA A;  4ZRI A;  4HAT B;  1OY2 A;  2W2X C;  1E5W A;  4KAX B;  5DIF B;  3DXD A;  5D3V A;  2LKO A;  4DX8 A;  2M38 A;  1DDW A;  5EFX A;  4GN1 A;  3LJU X;  1U5F A;  1P5T A;  5DHF B;  3PVW A;  1BAK A;  1NTY A;  1XOD A;  4ZRK A;  4F7U P;  4K17 A;  3A8P A;  1OMW A;  4Y94 A;  4HDO A;  2MFQ A;  2ELB A;  2LYD A;  4KHA A;  1SGH A;  2P0H A;  1H4R A;  2YT0 A;  1MPH A;  2EMS A;  5C6R A;  1FHW A;  3V5W A;  3O96 A;  2D9Y A;  1W1G A;  2L2I A;  1DBH A;  1J19 A;  1K5D B;  3FSS A;  3ML4 A;  2EMT A;  2RNR B;  2ZPY A;  2ADZ A;  4TKN A;  4YL8 A;  3TVV A;  1WJM A;  3PP2 A;  3WA0 A;  1EGX A;  2I1J A;  3DXE A;  2QKM A;  4K81 A;  1EF1 A;  3HQC A;  3D8E A;  2Y8G A;  4L6E A;  1QC6 A;  2JP2 A;  3BIN A;  1XR0 B;  2VRW B;  3CIK A;  1XX0 A;  1UPQ A;  1V5P A;  2HE7 A;  3N7C A;  4HAZ B;  1N3H A;  4GXB A;  3NSU A;  4IFS A;  1TJ6 A;  2P0F A;  3A8Q A;  5D3X A;  3SNH A;  4HB0 B;  4CYE A;  1NI2 A;  3PZD A;  1DYN A;  3ULB A;  1EAZ A;  1UEF A;  3P6A A;  4GZU A;  3X23 A;  4A6K A;  1V5U A;  1KI1 B;  3BJI A;  4MK0 A;  1B55 A;  4NY0 A;  5KQ4 A;  1FOE A;  3SV1 A;  2H7E A;  4GMX B;  2GJY A;  1MIX A;  3F5R A;  2N23 A;  4ZRJ A;  3KRW A;  1V88 A;  2Z0P A;  5D27 A;  1Z87 A;  2KCJ A;  4PNK A;  4MY6 A;  4Z2N A;  1V89 A;  2H7D A;  2OQB A;  1GG3 A;  2YS5 A;  2UZR A;  4GPT B;  5J3Q A;  4WVF B;  4Z2M B;  4C0A A;  3QWM A;  3PSC A;  3HK0 A;  5C5B B;  3ZVR A;  1X11 A;  5C79 A;  5CLL B;  3AU4 A;  1ZSQ A;  4EJN A;  2Y7B A;  1WI1 A;  2D9Z A;  2DKP A;  2YT1 A;  2DHK A;  4KHO A;  2D9V A;  2Y8F A;  1UNP A;  3D8D A;  3VOQ A;  1H10 A;  4P7I A;  3WYF B;  4WJ7 A;  1K5G B;  3TFM A;  3IVF A;  4WSF A;  2DHI A;  2LOZ A;  2K2U A;  2LG1 A;  2VSZ A;  4A6F A;  4B6H A;  2IYB A;  1Q67 A;  4HHV A;  2DFK A;  1BTN A;  5GOW B; 
#chains in the Genus database with same CATH topology
 2QKL A;  1J0W A;  2I5F A;  2ROZ B;  2AL6 A;  1U29 A;  1SHC A;  1OQN A;  1DRO A;  1MKE A;  3KRX A;  2DN6 A;  1M7E A;  3DXC A;  5HE3 A;  2EC1 A;  2N0Y A;  2EJ8 A;  2DKQ A;  5KQ1 A;  3B77 A;  4KHB B;  4GOU A;  4EKU A;  1ZC4 B;  1X86 A;  2K2J A;  2E2X A;  3KSY A;  4YON A;  3T06 A;  4K2P A;  2M14 A;  2Q13 A;  5KCV A;  2RRF A;  1P3R A;  3PG7 A;  2Z4D A;  2J59 M;  4EMO A;  3NWA A;  4A5K A;  1P6S A;  2RVB B;  3SYX A;  3TW1 A;  2XQN M;  2COC A;  1FAO A;  3GYO A;  5C16 A;  3UZT A;  3A98 B;  1FGZ A;  1PLS A;  1M7R A;  1V61 A;  3FEH A;  1WVH A;  1IRS A;  4L1R A;  4BBK A;  2IFS A;  1MK9 B;  1W1H A;  5D3Y A;  3U8Z A;  2YVC A;  3PVU A;  4NSW A;  4DX9 0;  1ZC3 B;  3ODW A;  3M1I B;  2I1K A;  2UZS A;  1MK7 B;  2LUL A;  3U12 A;  1NTV A;  4IAP A;  4OT1 A;  2YRY A;  1AQC A;  3NW8 A;  1UNQ A;  2D9W A;  2BCJ A;  5I2M A;  4HDQ A;  2GCL A;  4F7H A;  1X1G A;  2RSG A;  2AEH A;  2K00 A;  4CHJ A;  3PEG A;  2D10 A;  2L1C A;  5L81 A;  2DLW A;  5CLQ B;  1ZVR A;  3A58 A;  3KZ1 A;  5M4Y B;  1KZG A;  2UVM A;  3QIJ A;  4DIX A;  4GMV A;  2HTH B;  2J0M A;  5JP4 A;  2P8V A;  3MPX A;  2PZ1 A;  3ULC A;  3KY9 A;  2KIE A;  1V5M A;  5J3Y A;  4D6W A;  1U5G A;  4PQ0 A;  3CXB B;  1Y5O A;  1RJ2 A;  3P7Z A;  2COA A;  2VKI A;  2YS3 A;  3AU5 A;  1U27 A;  4HB4 B;  2NZ8 B;  2KR0 A;  4CHM A;  2J0J A;  1ISN A;  1U2B A;  5DI9 B;  5DHA B;  2YS1 A;  1X05 A;  3QBV B;  1DDM A;  4HSI A;  1X1F A;  2YT2 A;  2Z59 A;  4HB3 B;  1PMS A;  5D3W A;  1BWN A;  2LOX A;  5JLJ B;  2NMB A;  2MDX A;  3DCX A;  2R09 A;  2DYN A;  1UNR A;  2W2X D;  2KGX B;  2DTC A;  2Z0Q A;  1XKE A;  2R0D A;  3MDB C;  5IRS A;  2MKR A;  1Y19 B;  4KVG B;  3SUZ A;  3GYP A;  1I7A A;  4TYZ A;  3G9W A;  3ZDT A;  1MIZ B;  1FGY A;  1TXD A;  1AWE A;  2CY5 A;  2D9X A;  5JHH A;  1LB1 A;  2COF A;  2ROV A;  1FB8 A;  2RLO A;  3FVC A;  3TCA A;  2W2W A;  4KHB A;  4QJ3 B;  1W1D A;  2X18 A;  2D4Q A;  2MWN B;  3OAN A;  4HAW B;  1TQZ A;  5HE1 A;  4HB2 B;  2K49 A;  3HW2 B;  2DA0 A;  2FJL A;  4F7G A;  3TO1 A;  4MT7 A;  2NBV A;  4D0N B;  2DYQ A;  3RCP A;  5FI1 A;  2DX5 A;  1KZ7 A;  2CRF A;  4A6H A;  5J3T A;  2RGN B;  1MAI A;  3NWF A;  2G35 A;  5FI0 A;  1DDV A;  1EVH A;  1RRP B;  4DBB A;  3HIE A;  4QJ5 B;  1U5E A;  1PFJ A;  1WGU A;  2V76 A;  2FJU B;  3F0W A;  1XD4 A;  1LW3 A;  3ODX A;  4IOY X;  3SO6 A;  2I5C A;  5DH9 B;  1UPR A;  2DX1 A;  2KUQ A;  4XWX A;  5LON B;  3PVL A;  1FHO A;  4K2O A;  4HAU B;  5HE2 A;  2Z0O A;  2P0D A;  2DHJ A;  1XCG A;  4HAV B;  3AJ4 A;  2GS0 A;  3NWD A;  1BTK A;  2KUP A;  1WGQ A;  5HE0 A;  2ELA A;  4DXA B;  2CAY A;  1ZM0 A;  2YF0 A;  4GNK B;  5JHG A;  2D2Q A;  4H8S A;  3D8F A;  5C5B A;  1U5D A;  1FHX A;  2YSZ A;  3U7D A;  1WJ1 A;  1GC6 A;  1QQG A;  2R2Y A;  3ODO A;  1GC7 A;  1I2H A;  2J0K A;  1WG7 A;  2CY4 A;  2RUK B;  2COD A;  2D11 A;  1NU2 A;  4HAX B;  2GCJ A;  3FM8 C;  2Z13 A;  2OTX A;  4A6F B;  5LOP B;  4HAY B;  3VIA A;  4ZRI A;  4HAT B;  1OY2 A;  2W2X C;  1E5W A;  4KAX B;  5DIF B;  3DXD A;  5D3V A;  2LKO A;  4DX8 A;  2M38 A;  1DDW A;  5EFX A;  4GN1 A;  3LJU X;  1U5F A;  1P5T A;  5DHF B;  3PVW A;  1BAK A;  1NTY A;  1XOD A;  4ZRK A;  4F7U P;  4K17 A;  3A8P A;  1OMW A;  4Y94 A;  4HDO A;  2MFQ A;  2ELB A;  2LYD A;  4KHA A;  1SGH A;  2P0H A;  2ZKM X;  1H4R A;  2YT0 A;  1MPH A;  2EMS A;  3OHM B;  5C6R A;  1FHW A;  3V5W A;  3O96 A;  2D9Y A;  1W1G A;  2L2I A;  1DBH A;  1J19 A;  1K5D B;  3FSS A;  3ML4 A;  2EMT A;  2RNR B;  2ZPY A;  2ADZ A;  4TKN A;  4YL8 A;  3TVV A;  1WJM A;  3PP2 A;  3WA0 A;  1EGX A;  2I1J A;  3DXE A;  2QKM A;  4K81 A;  1EF1 A;  3HQC A;  3D8E A;  2Y8G A;  5LG4 B;  4L6E A;  1QC6 A;  2JP2 A;  3BIN A;  1XR0 B;  2VRW B;  3CIK A;  1XX0 A;  1UPQ A;  1V5P A;  2HE7 A;  3N7C A;  4QXA B;  4HAZ B;  1N3H A;  4GXB A;  3NSU A;  4IFS A;  1TJ6 A;  2P0F A;  3A8Q A;  5D3X A;  3SNH A;  4HB0 B;  4CYE A;  1NI2 A;  3PZD A;  1DYN A;  3ULB A;  3HSA A;  1EAZ A;  1UEF A;  3P6A A;  2Z14 A;  4GZU A;  3X23 A;  4A6K A;  1V5U A;  1KI1 B;  3BJI A;  4MK0 A;  1B55 A;  4NY0 A;  5KQ4 A;  1FOE A;  1T77 A;  1ZYI A;  3SV1 A;  2H7E A;  4GMX B;  2GJY A;  1MIX A;  3F5R A;  2N23 A;  4ZRJ A;  3KRW A;  1V88 A;  2Z0P A;  5D27 A;  1Z87 A;  2KCJ A;  4PNK A;  4MY6 A;  5I2S A;  4Z2N A;  1V89 A;  2H7D A;  2OQB A;  1GG3 A;  2YS5 A;  2UZR A;  4GPT B;  5J3Q A;  4WVF B;  4Z2M B;  4C0A A;  3QWM A;  3PSC A;  3HK0 A;  4OSN A;  2KIG A;  5C5B B;  3ZVR A;  1X11 A;  5C79 A;  5CLL B;  2GUM A;  3AU4 A;  1ZSQ A;  4EJN A;  2Y7B A;  4QJ4 B;  1WI1 A;  2D9Z A;  2DKP A;  2YT1 A;  2DHK A;  4KHO A;  2D9V A;  2Y8F A;  1UNP A;  3D8D A;  3VOQ A;  1H10 A;  4P7I A;  3WYF B;  4WJ7 A;  1K5G B;  3TFM A;  3IVF A;  4WSF A;  2DHI A;  2LOZ A;  2K2U A;  4CSQ A;  2K8E A;  2LG1 A;  2VSZ A;  1MI1 A;  4A6F A;  4B6H A;  2IYB A;  1Q67 A;  4HHV A;  2DFK A;  1BTN A;  5GOW B; 
#chains in the Genus database with same CATH homology
 2QKL A;  1J0W A;  2I5F A;  2ROZ B;  2AL6 A;  1U29 A;  1SHC A;  1OQN A;  1DRO A;  1MKE A;  3KRX A;  2DN6 A;  1M7E A;  3DXC A;  5HE3 A;  2EC1 A;  2N0Y A;  2EJ8 A;  2DKQ A;  5KQ1 A;  4KHB B;  4EKU A;  1ZC4 B;  1X86 A;  2K2J A;  2E2X A;  3KSY A;  4YON A;  3T06 A;  4K2P A;  2M14 A;  2Q13 A;  5KCV A;  1P3R A;  3PG7 A;  2J59 M;  4EMO A;  4A5K A;  1P6S A;  2RVB B;  3SYX A;  3TW1 A;  2XQN M;  2COC A;  1FAO A;  3GYO A;  5C16 A;  3UZT A;  3A98 B;  1FGZ A;  1PLS A;  1M7R A;  1V61 A;  3FEH A;  1WVH A;  1IRS A;  4BBK A;  2IFS A;  1MK9 B;  1W1H A;  5D3Y A;  3U8Z A;  2YVC A;  3PVU A;  4NSW A;  4DX9 0;  1ZC3 B;  3ODW A;  3M1I B;  2I1K A;  2UZS A;  1MK7 B;  2LUL A;  1NTV A;  4IAP A;  2YRY A;  1AQC A;  1UNQ A;  2D9W A;  2BCJ A;  4HDQ A;  2GCL A;  4F7H A;  1X1G A;  2RSG A;  2AEH A;  2K00 A;  4CHJ A;  3PEG A;  2D10 A;  2L1C A;  5L81 A;  2DLW A;  5CLQ B;  1ZVR A;  3KZ1 A;  1KZG A;  2UVM A;  3QIJ A;  4GMV A;  2HTH B;  2J0M A;  5JP4 A;  2P8V A;  3MPX A;  2PZ1 A;  3ULC A;  3KY9 A;  1V5M A;  5J3Y A;  1U5G A;  4PQ0 A;  3CXB B;  1Y5O A;  1RJ2 A;  3P7Z A;  2COA A;  2VKI A;  2YS3 A;  3AU5 A;  1U27 A;  4HB4 B;  2NZ8 B;  4CHM A;  2J0J A;  1ISN A;  1U2B A;  5DI9 B;  5DHA B;  2YS1 A;  1X05 A;  3QBV B;  1DDM A;  1X1F A;  4HB3 B;  1PMS A;  5D3W A;  1BWN A;  2LOX A;  5JLJ B;  2NMB A;  2MDX A;  2R09 A;  2DYN A;  1UNR A;  2W2X D;  2KGX B;  2DTC A;  2Z0Q A;  1XKE A;  2R0D A;  3MDB C;  2MKR A;  1Y19 B;  4KVG B;  3SUZ A;  3GYP A;  1I7A A;  4TYZ A;  3G9W A;  3ZDT A;  1MIZ B;  1FGY A;  1TXD A;  1AWE A;  2CY5 A;  2D9X A;  5JHH A;  1LB1 A;  2COF A;  2ROV A;  1FB8 A;  2RLO A;  3TCA A;  2W2W A;  1W1D A;  2X18 A;  2D4Q A;  2MWN B;  3OAN A;  4HAW B;  1TQZ A;  5HE1 A;  4HB2 B;  3HW2 B;  2DA0 A;  2FJL A;  4F7G A;  3TO1 A;  4MT7 A;  4D0N B;  2DYQ A;  3RCP A;  5FI1 A;  2DX5 A;  1KZ7 A;  2CRF A;  4A6H A;  5J3T A;  2RGN B;  1MAI A;  2G35 A;  5FI0 A;  1DDV A;  1EVH A;  1RRP B;  4DBB A;  1U5E A;  1PFJ A;  1WGU A;  2V76 A;  3F0W A;  1XD4 A;  1LW3 A;  3ODX A;  4IOY X;  3SO6 A;  2I5C A;  5DH9 B;  1UPR A;  2DX1 A;  4XWX A;  5LON B;  3PVL A;  1FHO A;  4K2O A;  4HAU B;  5HE2 A;  2Z0O A;  2P0D A;  2DHJ A;  1XCG A;  4HAV B;  3AJ4 A;  2GS0 A;  1BTK A;  2KUP A;  1WGQ A;  5HE0 A;  2ELA A;  4DXA B;  2CAY A;  1ZM0 A;  2YF0 A;  5JHG A;  2D2Q A;  4H8S A;  3D8F A;  5C5B A;  1U5D A;  1FHX A;  2YSZ A;  3U7D A;  1WJ1 A;  1GC6 A;  1QQG A;  3ODO A;  1GC7 A;  1I2H A;  2J0K A;  1WG7 A;  2CY4 A;  2RUK B;  2COD A;  2D11 A;  1NU2 A;  4HAX B;  2GCJ A;  3FM8 C;  2OTX A;  4A6F B;  5LOP B;  4HAY B;  3VIA A;  4ZRI A;  4HAT B;  1OY2 A;  2W2X C;  1E5W A;  4KAX B;  5DIF B;  3DXD A;  5D3V A;  2LKO A;  4DX8 A;  2M38 A;  1DDW A;  5EFX A;  4GN1 A;  3LJU X;  1U5F A;  1P5T A;  5DHF B;  3PVW A;  1BAK A;  1NTY A;  1XOD A;  4ZRK A;  4F7U P;  4K17 A;  3A8P A;  1OMW A;  4Y94 A;  4HDO A;  2MFQ A;  2ELB A;  2LYD A;  4KHA A;  1SGH A;  2P0H A;  1H4R A;  2YT0 A;  1MPH A;  2EMS A;  5C6R A;  1FHW A;  3V5W A;  3O96 A;  2D9Y A;  1W1G A;  2L2I A;  1DBH A;  1J19 A;  1K5D B;  3FSS A;  3ML4 A;  2EMT A;  2RNR B;  2ZPY A;  2ADZ A;  4TKN A;  4YL8 A;  3TVV A;  1WJM A;  3PP2 A;  3WA0 A;  1EGX A;  2I1J A;  3DXE A;  2QKM A;  4K81 A;  1EF1 A;  3HQC A;  3D8E A;  2Y8G A;  4L6E A;  1QC6 A;  2JP2 A;  3BIN A;  1XR0 B;  2VRW B;  3CIK A;  1XX0 A;  1UPQ A;  1V5P A;  2HE7 A;  3N7C A;  4HAZ B;  1N3H A;  4GXB A;  3NSU A;  4IFS A;  1TJ6 A;  2P0F A;  3A8Q A;  5D3X A;  3SNH A;  4HB0 B;  4CYE A;  1NI2 A;  3PZD A;  1DYN A;  3ULB A;  1EAZ A;  1UEF A;  3P6A A;  4GZU A;  3X23 A;  4A6K A;  1V5U A;  1KI1 B;  3BJI A;  4MK0 A;  1B55 A;  4NY0 A;  5KQ4 A;  1FOE A;  3SV1 A;  2H7E A;  4GMX B;  2GJY A;  1MIX A;  3F5R A;  2N23 A;  4ZRJ A;  3KRW A;  1V88 A;  2Z0P A;  5D27 A;  1Z87 A;  2KCJ A;  4PNK A;  4MY6 A;  4Z2N A;  1V89 A;  2H7D A;  2OQB A;  1GG3 A;  2YS5 A;  2UZR A;  4GPT B;  5J3Q A;  4WVF B;  4Z2M B;  4C0A A;  3QWM A;  3PSC A;  3HK0 A;  5C5B B;  3ZVR A;  1X11 A;  5C79 A;  5CLL B;  3AU4 A;  1ZSQ A;  4EJN A;  2Y7B A;  1WI1 A;  2D9Z A;  2DKP A;  2YT1 A;  2DHK A;  4KHO A;  2D9V A;  2Y8F A;  1UNP A;  3D8D A;  3VOQ A;  1H10 A;  4P7I A;  3WYF B;  4WJ7 A;  1K5G B;  3TFM A;  3IVF A;  4WSF A;  2DHI A;  2LOZ A;  2K2U A;  2LG1 A;  2VSZ A;  4A6F A;  4B6H A;  2IYB A;  1Q67 A;  4HHV A;  2DFK A;  1BTN A;  5GOW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...