2Y8GA

Structure of the ran-binding domain from human ranbp3 (e352a-r353v double mutant)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
124
structure length
122
Chain Sequence
ESNVLQMQCKLFVFDKTSQSWVAVGRGLLRLNDMASTDDGTLQSRLVMRTQGSLRLILNTKLWAQMQIDKASEKSIRITAMDDQGVKVFLISASSKDTGQLYAALHHRILALRSRVEQEQEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights Into the Function of the Crm1 Cofactor Ranbp3 from the Structure of its Ran-Binding Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords RAN-BINDING PROTEIN 3
total genus 28
structure length 122
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2y8gA00
2MDXA 4MY6A 5C5BA 1FHXA 5C5BB 4A6KA 4P7IA 2W2XD 3X23A 2DA0A 2MWNB 5C16A 2RUKB 3HW2B 4XWXA 1BAKA 2ELAA 5JP4A 2Y8FA 4WJ7A 2AL6A 5HE3A 3FSSA 3UZTA 4L6EA 1P3RA 2Y7BA 2ELBA 2J0MA 1FGYA 4Z2NA 2LYDA 3M1IB 3VIAA 4HB2B 2P8VA 4IOYX 1AQCA 2DKPA 1RRPB 3WA0A 1RJ2A 1SGHA 2IYBA 2M38A 1I2HA 2CODA 3KY9A 2DYNA 3V5WA 1NTVA 1UPQA 1ZC4B 3QWMA 1NI2A 2KCJA 1E5WA 5HE2A 3KZ1A 4HDOA 4DX8A 2GCJA 5KCVA 4HAWB 5HE0A 2DLWA 3SNHA 1V5MA 2P0DA 1W1HA 1V5PA 2ROZB 2RVBB 2DHIA 1BTNA 2EC1A 2LOZA 3PP2A 2AEHA 2ADZA 1J19A 2YT0A 4GPTB 3D8DA 1Z87A 2EJ8A 3SYXA 1K5DB 4YL8A 3DXCA 2W2XC 3T06A 3BJIA 3MPXA 1FHWA 2OTXA 1EGXA 1Q67A 2DHJA 1B55A 2CAYA 3LJUX 2VRWB 2JP2A 3CXBB 1MK9B 3A8PA 1FHOA 1AWEA 3HQCA 3TCAA 3NSUA 3PSCA 5D3WA 1PLSA 3RCPA 2Y8GA 3FM8C 2RSGA 1U29A 1WJMA 5D3XA 2IFSA 4WVFB 5J3QA 2FJLA 1XD4A 4HB4B 3ZDTA 4Z2MB 3U7DA 4TKNA 2R09A 4WSFA 2L1CA 3ODOA 1NU2A 3MDBC 4KHAA 2VSZA 3CIKA 4IFSA 1ZC3B 1UNPA 1NTYA 4MT7A 2GCLA 4HAXB 4GXBA 1ISNA 2EMSA 5DIFB 1OQNA 2COCA 1M7RA 4PQ0A 3PVWA 1SHCA 4NSWA 1QQGA 5EFXA 1ZVRA 3PVUA 4KHOA 2YS5A 4Y94A 1U2BA 3ML4A 3F5RA 3VOQA 4DX90 3GYPA 2I1KA 5LONB 2RLOA 1I7AA 4A6FA 2UZRA 2N0YA 2DYQA 3QBVB 3ULBA 4HB0B 3SV1A 3AU5A 4HATB 4YONA 3HK0A 2I5FA 2UVMA 1V89A 3PEGA 5DI9B 1BWNA 5JHHA 2G35A 5LOPB 2D11A 2MKRA 2Z0PA 1J0WA 1IRSA 3GYOA 4DBBA 2ZPYA 2Z0QA 2J0KA 5J3YA 5L81A 5J3TA 3F0WA 3ODXA 2P0HA 5KQ1A 4GMXB 2I5CA 1EF1A 1ZM0A 2D10A 2D9ZA 4CHMA 4PNKA 4TYZA 4C0AA 1X86A 3ULCA 1DDWA 1FB8A 4MK0A 5HE1A 1BTKA 2RNRB 2HTHB 3ZVRA 3PVLA 1UNRA 1K5GB 2YT1A 4EJNA 2L2IA 3N7CA 1DYNA 1MAIA 3A98B 4F7HA 1FOEA 1DDMA 1MIZB 4NY0A 4DXAB 1P5TA 1WG7A 1WVHA 1U5DA 2I1JA 4BBKA 4ZRKA 4KHBB 1WGUA 4HAZB 1WI1A 5DHFB 4A6HA 1ZSQA 4HAUB 3IVFA 4HAYB 2D2QA 3D8EA 4H8SA 1KI1B 2COFA 4K2PA 1LB1A 3D8FA 5D3VA 1EAZA 4A6FB 3A8QA 2XQNM 2GJYA 1WGQA 4GZUA 5CLQB 1FGZA 4B6HA 2D9WA 2UZSA 3TO1A 1LW3A 2YVCA 2HE7A 2CRFA 2EMTA 2K2UA 1OY2A 2BCJA 2H7EA 2OQBA 2R0DA 1UPRA 2GS0A 1X05A 2NZ8B 1X11A 2DKQA 2LOXA 4ZRJA 1TQZA 4K17A 2D4QA 1PMSA 5C6RA 2LG1A 2COAA 2QKMA 1XODA 2YSZA 1M7EA 2YF0A 1Y5OA 1EVHA 2DN6A 3AJ4A 4K2OA 2D9YA 3KSYA 1KZGA 4IAPA 3FEHA 2ROVA 1U5FA 3O96A 1W1DA 2J59M 1KZ7A 1MPHA 2CY5A 5D27A 2E2XA 4CHJA 2K2JA 2PZ1A 3DXEA 1DBHA 1UNQA 2N23A 5C79A 2W2WA 3TW1A 2P0FA 1V5UA 4HDQA 1V61A 2D9VA 2MFQA 2QKLA 4ZRIA 1MIXA 3P7ZA 4D0NB 1MK7B 5JLJB 2DFKA 1GC6A 2K00A 2DX1A 1TXDA 1XKEA 2V76A 1N3HA 2KGXB 5FI0A 2RGNB 5D3YA 2VKIA 4HB3B 2YS1A 4HHVA 1GG3A 4F7GA 2X18A 4EKUA 1UEFA 5GOWB 2Q13A 2CY4A 1XCGA 5KQ4A 2DTCA 2LKOA 1QC6A 1X1FA 5FI1A 2DHKA 3TVVA 1DDVA 3P6AA 1H10A 1WJ1A 4A5KA 4KAXB 4F7UP 3BINA 3TFMA 1U27A 1FAOA 3QIJA 1DROA 2M14A 3ODWA 2YS3A 1XX0A 3PG7A 2YRYA 3KRXA 4GMVA 3PZDA 1X1GA 2DX5A 5DH9B 3AU4A 2J0JA 1PFJA 3G9WA 2D9XA 1W1GA 1U5EA 3SO6A 4GN1A 1V88A 1GC7A 1Y19B 1MKEA 1XR0B 2NMBA 5DHAB 1OMWA 1U5GA 4CYEA 1TJ6A 1H4RA 4K81A 3U8ZA 2KUPA 2LULA 3WYFB 5CLLB 2H7DA 5JHGA 4KVGB 2Z0OA 4HAVB 1P6SA 3OANA 4EMOA 3SUZA 3KRWA 3DXDA
chains in the Genus database with same CATH superfamily
2MDXA 3FVCA 4MY6A 5C5BA 1FHXA 5C5BB 4A6KA 4P7IA 2W2XD 3X23A 2DA0A 2MWNB 5C16A 2RUKB 3HW2B 4XWXA 1BAKA 2ELAA 5JP4A 2Y8FA 4WJ7A 2AL6A 5HE3A 3FSSA 4QXAB 3UZTA 4L6EA 1P3RA 2Y7BA 2ELBA 2J0MA 1FGYA 1T77A 4Z2NA 2LYDA 3M1IB 3VIAA 4HB2B 2P8VA 4GOUA 4IOYX 1AQCA 2DKPA 1RRPB 3WA0A 1RJ2A 3A58A 1SGHA 2IYBA 2M38A 1I2HA 2Z14A 2CODA 3KY9A 2DYNA 3V5WA 1NTVA 1UPQA 1ZC4B 3QWMA 1NI2A 2KCJA 1E5WA 5HE2A 3KZ1A 1ZYIA 4DIXA 4HDOA 4DX8A 2KR0A 2GCJA 5KCVA 4HAWB 5HE0A 2DLWA 3SNHA 1V5MA 2P0DA 1W1HA 1V5PA 2ROZB 2RVBB 2DHIA 1BTNA 2EC1A 2LOZA 3PP2A 2AEHA 2ADZA 1J19A 2YT0A 4GPTB 3D8DA 1Z87A 2EJ8A 3SYXA 1K5DB 4YL8A 3DXCA 2W2XC 3T06A 3BJIA 3MPXA 1FHWA 2OTXA 1EGXA 1Q67A 2DHJA 1B55A 3HSAA 2K49A 2CAYA 3LJUX 2VRWB 2JP2A 3CXBB 1MK9B 3A8PA 1MI1A 4L1RA 1FHOA 1AWEA 3HQCA 3TCAA 3NSUA 2GUMA 3PSCA 5D3WA 1PLSA 3RCPA 2Y8GA 3FM8C 4HSIA 2RSGA 1U29A 1WJMA 5D3XA 2IFSA 3NW8A 4WVFB 5J3QA 2FJLA 1XD4A 3B77A 4HB4B 3ZDTA 4Z2MB 3U7DA 4TKNA 2R09A 4WSFA 2L1CA 3ODOA 1NU2A 3MDBC 4KHAA 2VSZA 3CIKA 4IFSA 1ZC3B 1UNPA 1NTYA 4MT7A 2GCLA 4HAXB 4GXBA 1ISNA 2EMSA 5DIFB 1OQNA 2COCA 1M7RA 4PQ0A 3PVWA 1SHCA 4NSWA 1QQGA 3HIEA 5EFXA 1ZVRA 3PVUA 4KHOA 4OT1A 2YS5A 4Y94A 1U2BA 3ML4A 3DCXA 5I2MA 3F5RA 3VOQA 4DX90 3GYPA 2I1KA 5LONB 2RLOA 2Z59A 1I7AA 4A6FA 2UZRA 2N0YA 2DYQA 3QBVB 3ULBA 4HB0B 3SV1A 3AU5A 4HATB 4YONA 3HK0A 2I5FA 2KIGA 2UVMA 1V89A 3PEGA 5DI9B 1BWNA 5JHHA 2G35A 5LOPB 2D11A 2MKRA 2Z0PA 1J0WA 1IRSA 3GYOA 4DBBA 2ZPYA 2Z0QA 2J0KA 5J3YA 5L81A 5J3TA 3F0WA 3ODXA 4GNKB 2P0HA 5KQ1A 4GMXB 2I5CA 1EF1A 1ZM0A 2D10A 2D9ZA 4CHMA 4PNKA 4TYZA 4C0AA 1X86A 3ULCA 1DDWA 1FB8A 4MK0A 5LG4B 5HE1A 1BTKA 2RNRB 2HTHB 3ZVRA 3PVLA 1UNRA 1K5GB 2YT1A 4EJNA 2L2IA 3N7CA 1DYNA 1MAIA 3A98B 2ZKMX 4F7HA 1FOEA 1DDMA 1MIZB 4NY0A 4DXAB 1P5TA 1WG7A 1WVHA 1U5DA 2I1JA 4BBKA 4ZRKA 4KHBB 1WGUA 4HAZB 4QJ4B 1WI1A 5DHFB 4A6HA 2K8EA 1ZSQA 4HAUB 3IVFA 4HAYB 2D2QA 3D8EA 4H8SA 1KI1B 2COFA 4K2PA 1LB1A 3D8FA 5D3VA 1EAZA 4A6FB 3A8QA 2XQNM 5IRSA 2GJYA 1WGQA 2RRFA 4GZUA 5CLQB 2NBVA 1FGZA 2R2YA 3NWFA 4B6HA 2D9WA 2UZSA 3TO1A 1LW3A 2YVCA 2HE7A 5M4YB 2CRFA 2EMTA 2K2UA 2KUQA 4KHBA 1OY2A 2BCJA 2H7EA 2OQBA 2R0DA 1UPRA 2Z4DA 2GS0A 1X05A 2NZ8B 4OSNA 1X11A 2DKQA 2LOXA 4ZRJA 2FJUB 1TQZA 4K17A 2D4QA 1PMSA 2Z13A 5C6RA 2LG1A 3NWAA 2COAA 2QKMA 1XODA 2YSZA 1M7EA 2YF0A 3NWDA 1Y5OA 1EVHA 3OHMB 4D6WA 2DN6A 3AJ4A 2D9YA 4K2OA 3KSYA 1KZGA 4IAPA 3FEHA 2ROVA 1U5FA 3O96A 1W1DA 2J59M 1KZ7A 1MPHA 2CY5A 5D27A 2E2XA 4CHJA 2K2JA 2PZ1A 3DXEA 1DBHA 1UNQA 2N23A 5C79A 2W2WA 3TW1A 2P0FA 1V5UA 4CSQA 4HDQA 1V61A 2D9VA 2MFQA 2QKLA 4QJ3B 4ZRIA 1MIXA 3P7ZA 4D0NB 1MK7B 5JLJB 2DFKA 2YT2A 1GC6A 2K00A 2DX1A 1TXDA 1XKEA 2V76A 1N3HA 2KGXB 5FI0A 2RGNB 5D3YA 2VKIA 4HB3B 2YS1A 4HHVA 1GG3A 4F7GA 2X18A 4EKUA 1UEFA 5GOWB 2Q13A 2CY4A 1XCGA 5KQ4A 2DTCA 2LKOA 1QC6A 1X1FA 5FI1A 2DHKA 2KIEA 3TVVA 1DDVA 3P6AA 1H10A 1WJ1A 4A5KA 4KAXB 4F7UP 3BINA 3TFMA 1U27A 1FAOA 3QIJA 1DROA 2M14A 3ODWA 2YS3A 1XX0A 3PG7A 2YRYA 3KRXA 4QJ5B 4GMVA 3PZDA 1X1GA 2DX5A 5DH9B 5I2SA 3AU4A 2J0JA 1PFJA 3G9WA 2D9XA 1W1GA 1U5EA 3SO6A 1V88A 4GN1A 1GC7A 1Y19B 1MKEA 1XR0B 2NMBA 5DHAB 1OMWA 1U5GA 4CYEA 1TJ6A 1H4RA 4K81A 3U8ZA 2KUPA 2LULA 3WYFB 5CLLB 2H7DA 5JHGA 4KVGB 2Z0OA 4HAVB 1P6SA 3OANA 4EMOA 3SUZA 3U12A 3KRWA 3DXDA
chains in the Genus database with same CATH topology
2MDXA 4MY6A 5C5BA 1FHXA 5C5BB 4A6KA 4P7IA 2W2XD 3X23A 2DA0A 2MWNB 5C16A 2RUKB 3HW2B 4XWXA 1BAKA 2ELAA 5JP4A 2Y8FA 4WJ7A 2AL6A 5HE3A 3FSSA 3UZTA 4L6EA 1P3RA 2Y7BA 2ELBA 2J0MA 1FGYA 4Z2NA 2LYDA 3M1IB 3VIAA 4HB2B 2P8VA 4IOYX 1AQCA 2DKPA 1RRPB 3WA0A 1RJ2A 1SGHA 2IYBA 2M38A 1I2HA 2CODA 3KY9A 2DYNA 3V5WA 1NTVA 1UPQA 1ZC4B 3QWMA 1NI2A 2KCJA 1E5WA 5HE2A 3KZ1A 4HDOA 4DX8A 2GCJA 5KCVA 4HAWB 5HE0A 2DLWA 3SNHA 1V5MA 2P0DA 1W1HA 1V5PA 2ROZB 2RVBB 2DHIA 1BTNA 2EC1A 2LOZA 3PP2A 2AEHA 2ADZA 1J19A 2YT0A 4GPTB 3D8DA 1Z87A 2EJ8A 3SYXA 1K5DB 4YL8A 3DXCA 2W2XC 3T06A 3BJIA 3MPXA 1FHWA 2OTXA 1EGXA 1Q67A 2DHJA 1B55A 2CAYA 3LJUX 2VRWB 2JP2A 3CXBB 1MK9B 3A8PA 1FHOA 1AWEA 3HQCA 3TCAA 3NSUA 3PSCA 5D3WA 1PLSA 3RCPA 2Y8GA 3FM8C 2RSGA 1U29A 1WJMA 5D3XA 2IFSA 4WVFB 5J3QA 2FJLA 1XD4A 4HB4B 3ZDTA 4Z2MB 3U7DA 4TKNA 2R09A 4WSFA 2L1CA 3ODOA 1NU2A 3MDBC 4KHAA 2VSZA 3CIKA 4IFSA 1ZC3B 1UNPA 1NTYA 4MT7A 2GCLA 4HAXB 4GXBA 1ISNA 2EMSA 5DIFB 1OQNA 2COCA 1M7RA 4PQ0A 3PVWA 1SHCA 4NSWA 1QQGA 5EFXA 1ZVRA 3PVUA 4KHOA 2YS5A 4Y94A 1U2BA 3ML4A 3F5RA 3VOQA 4DX90 3GYPA 2I1KA 5LONB 2RLOA 1I7AA 4A6FA 2UZRA 2N0YA 2DYQA 3QBVB 3ULBA 4HB0B 3SV1A 3AU5A 4HATB 4YONA 3HK0A 2I5FA 2UVMA 1V89A 3PEGA 5DI9B 1BWNA 5JHHA 2G35A 5LOPB 2D11A 2MKRA 2Z0PA 1J0WA 1IRSA 3GYOA 4DBBA 2ZPYA 2Z0QA 2J0KA 5J3YA 5L81A 5J3TA 3F0WA 3ODXA 2P0HA 5KQ1A 4GMXB 2I5CA 1EF1A 1ZM0A 2D10A 2D9ZA 4CHMA 4PNKA 4TYZA 4C0AA 1X86A 3ULCA 1DDWA 1FB8A 4MK0A 5HE1A 1BTKA 2RNRB 2HTHB 3ZVRA 3PVLA 1UNRA 1K5GB 2YT1A 4EJNA 2L2IA 3N7CA 1DYNA 1MAIA 3A98B 4F7HA 1FOEA 1DDMA 1MIZB 4NY0A 4DXAB 1P5TA 1WG7A 1WVHA 1U5DA 2I1JA 4BBKA 4ZRKA 4KHBB 1WGUA 4HAZB 1WI1A 5DHFB 4A6HA 1ZSQA 4HAUB 3IVFA 4HAYB 2D2QA 3D8EA 4H8SA 1KI1B 2COFA 4K2PA 1LB1A 3D8FA 5D3VA 1EAZA 4A6FB 3A8QA 2XQNM 2GJYA 1WGQA 4GZUA 5CLQB 1FGZA 4B6HA 2D9WA 2UZSA 3TO1A 1LW3A 2YVCA 2HE7A 2CRFA 2EMTA 2K2UA 1OY2A 2BCJA 2H7EA 2OQBA 2R0DA 1UPRA 2GS0A 1X05A 2NZ8B 1X11A 2DKQA 2LOXA 4ZRJA 1TQZA 4K17A 2D4QA 1PMSA 5C6RA 2LG1A 2COAA 2QKMA 1XODA 2YSZA 1M7EA 2YF0A 1Y5OA 1EVHA 2DN6A 3AJ4A 4K2OA 2D9YA 3KSYA 1KZGA 4IAPA 3FEHA 2ROVA 1U5FA 3O96A 1W1DA 2J59M 1KZ7A 1MPHA 2CY5A 5D27A 2E2XA 4CHJA 2K2JA 2PZ1A 3DXEA 1DBHA 1UNQA 2N23A 5C79A 2W2WA 3TW1A 2P0FA 1V5UA 4HDQA 1V61A 2D9VA 2MFQA 2QKLA 4ZRIA 1MIXA 3P7ZA 4D0NB 1MK7B 5JLJB 2DFKA 1GC6A 2K00A 2DX1A 1TXDA 1XKEA 2V76A 1N3HA 2KGXB 5FI0A 2RGNB 5D3YA 2VKIA 4HB3B 2YS1A 4HHVA 1GG3A 4F7GA 2X18A 4EKUA 1UEFA 5GOWB 2Q13A 2CY4A 1XCGA 5KQ4A 2DTCA 2LKOA 1QC6A 1X1FA 5FI1A 2DHKA 3TVVA 1DDVA 3P6AA 1H10A 1WJ1A 4A5KA 4KAXB 4F7UP 3BINA 3TFMA 1U27A 1FAOA 3QIJA 1DROA 2M14A 3ODWA 2YS3A 1XX0A 3PG7A 2YRYA 3KRXA 4GMVA 3PZDA 1X1GA 2DX5A 5DH9B 3AU4A 2J0JA 1PFJA 3G9WA 2D9XA 1W1GA 1U5EA 3SO6A 4GN1A 1V88A 1GC7A 1Y19B 1MKEA 1XR0B 2NMBA 5DHAB 1OMWA 1U5GA 4CYEA 1TJ6A 1H4RA 4K81A 3U8ZA 2KUPA 2LULA 3WYFB 5CLLB 2H7DA 5JHGA 4KVGB 2Z0OA 4HAVB 1P6SA 3OANA 4EMOA 3SUZA 3KRWA 3DXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MDX A;  4MY6 A;  5C5B A;  1FHX A;  5C5B B;  4A6K A;  4P7I A;  2W2X D;  3X23 A;  2DA0 A;  2MWN B;  5C16 A;  2RUK B;  3HW2 B;  4XWX A;  1BAK A;  2ELA A;  5JP4 A;  2Y8F A;  4WJ7 A;  2AL6 A;  5HE3 A;  3FSS A;  3UZT A;  4L6E A;  1P3R A;  2Y7B A;  2ELB A;  2J0M A;  1FGY A;  4Z2N A;  2LYD A;  3M1I B;  3VIA A;  4HB2 B;  2P8V A;  4IOY X;  1AQC A;  2DKP A;  1RRP B;  3WA0 A;  1RJ2 A;  1SGH A;  2IYB A;  2M38 A;  1I2H A;  2COD A;  3KY9 A;  2DYN A;  3V5W A;  1NTV A;  1UPQ A;  1ZC4 B;  3QWM A;  1NI2 A;  2KCJ A;  1E5W A;  5HE2 A;  3KZ1 A;  4HDO A;  4DX8 A;  2GCJ A;  5KCV A;  4HAW B;  5HE0 A;  2DLW A;  3SNH A;  1V5M A;  2P0D A;  1W1H A;  1V5P A;  2ROZ B;  2RVB B;  2DHI A;  1BTN A;  2EC1 A;  2LOZ A;  3PP2 A;  2AEH A;  2ADZ A;  1J19 A;  2YT0 A;  4GPT B;  3D8D A;  1Z87 A;  2EJ8 A;  3SYX A;  1K5D B;  4YL8 A;  3DXC A;  2W2X C;  3T06 A;  3BJI A;  3MPX A;  1FHW A;  2OTX A;  1EGX A;  1Q67 A;  2DHJ A;  1B55 A;  2CAY A;  3LJU X;  2VRW B;  2JP2 A;  3CXB B;  1MK9 B;  3A8P A;  1FHO A;  1AWE A;  3HQC A;  3TCA A;  3NSU A;  3PSC A;  5D3W A;  1PLS A;  3RCP A;  2Y8G A;  3FM8 C;  2RSG A;  1U29 A;  1WJM A;  5D3X A;  2IFS A;  4WVF B;  5J3Q A;  2FJL A;  1XD4 A;  4HB4 B;  3ZDT A;  4Z2M B;  3U7D A;  4TKN A;  2R09 A;  4WSF A;  2L1C A;  3ODO A;  1NU2 A;  3MDB C;  4KHA A;  2VSZ A;  3CIK A;  4IFS A;  1ZC3 B;  1UNP A;  1NTY A;  4MT7 A;  2GCL A;  4HAX B;  4GXB A;  1ISN A;  2EMS A;  5DIF B;  1OQN A;  2COC A;  1M7R A;  4PQ0 A;  3PVW A;  1SHC A;  4NSW A;  1QQG A;  5EFX A;  1ZVR A;  3PVU A;  4KHO A;  2YS5 A;  4Y94 A;  1U2B A;  3ML4 A;  3F5R A;  3VOQ A;  4DX9 0;  3GYP A;  2I1K A;  5LON B;  2RLO A;  1I7A A;  4A6F A;  2UZR A;  2N0Y A;  2DYQ A;  3QBV B;  3ULB A;  4HB0 B;  3SV1 A;  3AU5 A;  4HAT B;  4YON A;  3HK0 A;  2I5F A;  2UVM A;  1V89 A;  3PEG A;  5DI9 B;  1BWN A;  5JHH A;  2G35 A;  5LOP B;  2D11 A;  2MKR A;  2Z0P A;  1J0W A;  1IRS A;  3GYO A;  4DBB A;  2ZPY A;  2Z0Q A;  2J0K A;  5J3Y A;  5L81 A;  5J3T A;  3F0W A;  3ODX A;  2P0H A;  5KQ1 A;  4GMX B;  2I5C A;  1EF1 A;  1ZM0 A;  2D10 A;  2D9Z A;  4CHM A;  4PNK A;  4TYZ A;  4C0A A;  1X86 A;  3ULC A;  1DDW A;  1FB8 A;  4MK0 A;  5HE1 A;  1BTK A;  2RNR B;  2HTH B;  3ZVR A;  3PVL A;  1UNR A;  1K5G B;  2YT1 A;  4EJN A;  2L2I A;  3N7C A;  1DYN A;  1MAI A;  3A98 B;  4F7H A;  1FOE A;  1DDM A;  1MIZ B;  4NY0 A;  4DXA B;  1P5T A;  1WG7 A;  1WVH A;  1U5D A;  2I1J A;  4BBK A;  4ZRK A;  4KHB B;  1WGU A;  4HAZ B;  1WI1 A;  5DHF B;  4A6H A;  1ZSQ A;  4HAU B;  3IVF A;  4HAY B;  2D2Q A;  3D8E A;  4H8S A;  1KI1 B;  2COF A;  4K2P A;  1LB1 A;  3D8F A;  5D3V A;  1EAZ A;  4A6F B;  3A8Q A;  2XQN M;  2GJY A;  1WGQ A;  4GZU A;  5CLQ B;  1FGZ A;  4B6H A;  2D9W A;  2UZS A;  3TO1 A;  1LW3 A;  2YVC A;  2HE7 A;  2CRF A;  2EMT A;  2K2U A;  1OY2 A;  2BCJ A;  2H7E A;  2OQB A;  2R0D A;  1UPR A;  2GS0 A;  1X05 A;  2NZ8 B;  1X11 A;  2DKQ A;  2LOX A;  4ZRJ A;  1TQZ A;  4K17 A;  2D4Q A;  1PMS A;  5C6R A;  2LG1 A;  2COA A;  2QKM A;  1XOD A;  2YSZ A;  1M7E A;  2YF0 A;  1Y5O A;  1EVH A;  2DN6 A;  3AJ4 A;  4K2O A;  2D9Y A;  3KSY A;  1KZG A;  4IAP A;  3FEH A;  2ROV A;  1U5F A;  3O96 A;  1W1D A;  2J59 M;  1KZ7 A;  1MPH A;  2CY5 A;  5D27 A;  2E2X A;  4CHJ A;  2K2J A;  2PZ1 A;  3DXE A;  1DBH A;  1UNQ A;  2N23 A;  5C79 A;  2W2W A;  3TW1 A;  2P0F A;  1V5U A;  4HDQ A;  1V61 A;  2D9V A;  2MFQ A;  2QKL A;  4ZRI A;  1MIX A;  3P7Z A;  4D0N B;  1MK7 B;  5JLJ B;  2DFK A;  1GC6 A;  2K00 A;  2DX1 A;  1TXD A;  1XKE A;  2V76 A;  1N3H A;  2KGX B;  5FI0 A;  2RGN B;  5D3Y A;  2VKI A;  4HB3 B;  2YS1 A;  4HHV A;  1GG3 A;  4F7G A;  2X18 A;  4EKU A;  1UEF A;  5GOW B;  2Q13 A;  2CY4 A;  1XCG A;  5KQ4 A;  2DTC A;  2LKO A;  1QC6 A;  1X1F A;  5FI1 A;  2DHK A;  3TVV A;  1DDV A;  3P6A A;  1H10 A;  1WJ1 A;  4A5K A;  4KAX B;  4F7U P;  3BIN A;  3TFM A;  1U27 A;  1FAO A;  3QIJ A;  1DRO A;  2M14 A;  3ODW A;  2YS3 A;  1XX0 A;  3PG7 A;  2YRY A;  3KRX A;  4GMV A;  3PZD A;  1X1G A;  2DX5 A;  5DH9 B;  3AU4 A;  2J0J A;  1PFJ A;  3G9W A;  2D9X A;  1W1G A;  1U5E A;  3SO6 A;  4GN1 A;  1V88 A;  1GC7 A;  1Y19 B;  1MKE A;  1XR0 B;  2NMB A;  5DHA B;  1OMW A;  1U5G A;  4CYE A;  1TJ6 A;  1H4R A;  4K81 A;  3U8Z A;  2KUP A;  2LUL A;  3WYF B;  5CLL B;  2H7D A;  5JHG A;  4KVG B;  2Z0O A;  4HAV B;  1P6S A;  3OAN A;  4EMO A;  3SUZ A;  3KRW A;  3DXD A; 
#chains in the Genus database with same CATH topology
 2MDX A;  3FVC A;  4MY6 A;  5C5B A;  1FHX A;  5C5B B;  4A6K A;  4P7I A;  2W2X D;  3X23 A;  2DA0 A;  2MWN B;  5C16 A;  2RUK B;  3HW2 B;  4XWX A;  1BAK A;  2ELA A;  5JP4 A;  2Y8F A;  4WJ7 A;  2AL6 A;  5HE3 A;  3FSS A;  4QXA B;  3UZT A;  4L6E A;  1P3R A;  2Y7B A;  2ELB A;  2J0M A;  1FGY A;  1T77 A;  4Z2N A;  2LYD A;  3M1I B;  3VIA A;  4HB2 B;  2P8V A;  4GOU A;  4IOY X;  1AQC A;  2DKP A;  1RRP B;  3WA0 A;  1RJ2 A;  3A58 A;  1SGH A;  2IYB A;  2M38 A;  1I2H A;  2Z14 A;  2COD A;  3KY9 A;  2DYN A;  3V5W A;  1NTV A;  1UPQ A;  1ZC4 B;  3QWM A;  1NI2 A;  2KCJ A;  1E5W A;  5HE2 A;  3KZ1 A;  1ZYI A;  4DIX A;  4HDO A;  4DX8 A;  2KR0 A;  2GCJ A;  5KCV A;  4HAW B;  5HE0 A;  2DLW A;  3SNH A;  1V5M A;  2P0D A;  1W1H A;  1V5P A;  2ROZ B;  2RVB B;  2DHI A;  1BTN A;  2EC1 A;  2LOZ A;  3PP2 A;  2AEH A;  2ADZ A;  1J19 A;  2YT0 A;  4GPT B;  3D8D A;  1Z87 A;  2EJ8 A;  3SYX A;  1K5D B;  4YL8 A;  3DXC A;  2W2X C;  3T06 A;  3BJI A;  3MPX A;  1FHW A;  2OTX A;  1EGX A;  1Q67 A;  2DHJ A;  1B55 A;  3HSA A;  2K49 A;  2CAY A;  3LJU X;  2VRW B;  2JP2 A;  3CXB B;  1MK9 B;  3A8P A;  1MI1 A;  4L1R A;  1FHO A;  1AWE A;  3HQC A;  3TCA A;  3NSU A;  2GUM A;  3PSC A;  5D3W A;  1PLS A;  3RCP A;  2Y8G A;  3FM8 C;  4HSI A;  2RSG A;  1U29 A;  1WJM A;  5D3X A;  2IFS A;  3NW8 A;  4WVF B;  5J3Q A;  2FJL A;  1XD4 A;  3B77 A;  4HB4 B;  3ZDT A;  4Z2M B;  3U7D A;  4TKN A;  2R09 A;  4WSF A;  2L1C A;  3ODO A;  1NU2 A;  3MDB C;  4KHA A;  2VSZ A;  3CIK A;  4IFS A;  1ZC3 B;  1UNP A;  1NTY A;  4MT7 A;  2GCL A;  4HAX B;  4GXB A;  1ISN A;  2EMS A;  5DIF B;  1OQN A;  2COC A;  1M7R A;  4PQ0 A;  3PVW A;  1SHC A;  4NSW A;  1QQG A;  3HIE A;  5EFX A;  1ZVR A;  3PVU A;  4KHO A;  4OT1 A;  2YS5 A;  4Y94 A;  1U2B A;  3ML4 A;  3DCX A;  5I2M A;  3F5R A;  3VOQ A;  4DX9 0;  3GYP A;  2I1K A;  5LON B;  2RLO A;  2Z59 A;  1I7A A;  4A6F A;  2UZR A;  2N0Y A;  2DYQ A;  3QBV B;  3ULB A;  4HB0 B;  3SV1 A;  3AU5 A;  4HAT B;  4YON A;  3HK0 A;  2I5F A;  2KIG A;  2UVM A;  1V89 A;  3PEG A;  5DI9 B;  1BWN A;  5JHH A;  2G35 A;  5LOP B;  2D11 A;  2MKR A;  2Z0P A;  1J0W A;  1IRS A;  3GYO A;  4DBB A;  2ZPY A;  2Z0Q A;  2J0K A;  5J3Y A;  5L81 A;  5J3T A;  3F0W A;  3ODX A;  4GNK B;  2P0H A;  5KQ1 A;  4GMX B;  2I5C A;  1EF1 A;  1ZM0 A;  2D10 A;  2D9Z A;  4CHM A;  4PNK A;  4TYZ A;  4C0A A;  1X86 A;  3ULC A;  1DDW A;  1FB8 A;  4MK0 A;  5LG4 B;  5HE1 A;  1BTK A;  2RNR B;  2HTH B;  3ZVR A;  3PVL A;  1UNR A;  1K5G B;  2YT1 A;  4EJN A;  2L2I A;  3N7C A;  1DYN A;  1MAI A;  3A98 B;  2ZKM X;  4F7H A;  1FOE A;  1DDM A;  1MIZ B;  4NY0 A;  4DXA B;  1P5T A;  1WG7 A;  1WVH A;  1U5D A;  2I1J A;  4BBK A;  4ZRK A;  4KHB B;  1WGU A;  4HAZ B;  4QJ4 B;  1WI1 A;  5DHF B;  4A6H A;  2K8E A;  1ZSQ A;  4HAU B;  3IVF A;  4HAY B;  2D2Q A;  3D8E A;  4H8S A;  1KI1 B;  2COF A;  4K2P A;  1LB1 A;  3D8F A;  5D3V A;  1EAZ A;  4A6F B;  3A8Q A;  2XQN M;  5IRS A;  2GJY A;  1WGQ A;  2RRF A;  4GZU A;  5CLQ B;  2NBV A;  1FGZ A;  2R2Y A;  3NWF A;  4B6H A;  2D9W A;  2UZS A;  3TO1 A;  1LW3 A;  2YVC A;  2HE7 A;  5M4Y B;  2CRF A;  2EMT A;  2K2U A;  2KUQ A;  4KHB A;  1OY2 A;  2BCJ A;  2H7E A;  2OQB A;  2R0D A;  1UPR A;  2Z4D A;  2GS0 A;  1X05 A;  2NZ8 B;  4OSN A;  1X11 A;  2DKQ A;  2LOX A;  4ZRJ A;  2FJU B;  1TQZ A;  4K17 A;  2D4Q A;  1PMS A;  2Z13 A;  5C6R A;  2LG1 A;  3NWA A;  2COA A;  2QKM A;  1XOD A;  2YSZ A;  1M7E A;  2YF0 A;  3NWD A;  1Y5O A;  1EVH A;  3OHM B;  4D6W A;  2DN6 A;  3AJ4 A;  2D9Y A;  4K2O A;  3KSY A;  1KZG A;  4IAP A;  3FEH A;  2ROV A;  1U5F A;  3O96 A;  1W1D A;  2J59 M;  1KZ7 A;  1MPH A;  2CY5 A;  5D27 A;  2E2X A;  4CHJ A;  2K2J A;  2PZ1 A;  3DXE A;  1DBH A;  1UNQ A;  2N23 A;  5C79 A;  2W2W A;  3TW1 A;  2P0F A;  1V5U A;  4CSQ A;  4HDQ A;  1V61 A;  2D9V A;  2MFQ A;  2QKL A;  4QJ3 B;  4ZRI A;  1MIX A;  3P7Z A;  4D0N B;  1MK7 B;  5JLJ B;  2DFK A;  2YT2 A;  1GC6 A;  2K00 A;  2DX1 A;  1TXD A;  1XKE A;  2V76 A;  1N3H A;  2KGX B;  5FI0 A;  2RGN B;  5D3Y A;  2VKI A;  4HB3 B;  2YS1 A;  4HHV A;  1GG3 A;  4F7G A;  2X18 A;  4EKU A;  1UEF A;  5GOW B;  2Q13 A;  2CY4 A;  1XCG A;  5KQ4 A;  2DTC A;  2LKO A;  1QC6 A;  1X1F A;  5FI1 A;  2DHK A;  2KIE A;  3TVV A;  1DDV A;  3P6A A;  1H10 A;  1WJ1 A;  4A5K A;  4KAX B;  4F7U P;  3BIN A;  3TFM A;  1U27 A;  1FAO A;  3QIJ A;  1DRO A;  2M14 A;  3ODW A;  2YS3 A;  1XX0 A;  3PG7 A;  2YRY A;  3KRX A;  4QJ5 B;  4GMV A;  3PZD A;  1X1G A;  2DX5 A;  5DH9 B;  5I2S A;  3AU4 A;  2J0J A;  1PFJ A;  3G9W A;  2D9X A;  1W1G A;  1U5E A;  3SO6 A;  1V88 A;  4GN1 A;  1GC7 A;  1Y19 B;  1MKE A;  1XR0 B;  2NMB A;  5DHA B;  1OMW A;  1U5G A;  4CYE A;  1TJ6 A;  1H4R A;  4K81 A;  3U8Z A;  2KUP A;  2LUL A;  3WYF B;  5CLL B;  2H7D A;  5JHG A;  4KVG B;  2Z0O A;  4HAV B;  1P6S A;  3OAN A;  4EMO A;  3SUZ A;  3U12 A;  3KRW A;  3DXD A; 
#chains in the Genus database with same CATH homology
 2MDX A;  4MY6 A;  5C5B A;  1FHX A;  5C5B B;  4A6K A;  4P7I A;  2W2X D;  3X23 A;  2DA0 A;  2MWN B;  5C16 A;  2RUK B;  3HW2 B;  4XWX A;  1BAK A;  2ELA A;  5JP4 A;  2Y8F A;  4WJ7 A;  2AL6 A;  5HE3 A;  3FSS A;  3UZT A;  4L6E A;  1P3R A;  2Y7B A;  2ELB A;  2J0M A;  1FGY A;  4Z2N A;  2LYD A;  3M1I B;  3VIA A;  4HB2 B;  2P8V A;  4IOY X;  1AQC A;  2DKP A;  1RRP B;  3WA0 A;  1RJ2 A;  1SGH A;  2IYB A;  2M38 A;  1I2H A;  2COD A;  3KY9 A;  2DYN A;  3V5W A;  1NTV A;  1UPQ A;  1ZC4 B;  3QWM A;  1NI2 A;  2KCJ A;  1E5W A;  5HE2 A;  3KZ1 A;  4HDO A;  4DX8 A;  2GCJ A;  5KCV A;  4HAW B;  5HE0 A;  2DLW A;  3SNH A;  1V5M A;  2P0D A;  1W1H A;  1V5P A;  2ROZ B;  2RVB B;  2DHI A;  1BTN A;  2EC1 A;  2LOZ A;  3PP2 A;  2AEH A;  2ADZ A;  1J19 A;  2YT0 A;  4GPT B;  3D8D A;  1Z87 A;  2EJ8 A;  3SYX A;  1K5D B;  4YL8 A;  3DXC A;  2W2X C;  3T06 A;  3BJI A;  3MPX A;  1FHW A;  2OTX A;  1EGX A;  1Q67 A;  2DHJ A;  1B55 A;  2CAY A;  3LJU X;  2VRW B;  2JP2 A;  3CXB B;  1MK9 B;  3A8P A;  1FHO A;  1AWE A;  3HQC A;  3TCA A;  3NSU A;  3PSC A;  5D3W A;  1PLS A;  3RCP A;  2Y8G A;  3FM8 C;  2RSG A;  1U29 A;  1WJM A;  5D3X A;  2IFS A;  4WVF B;  5J3Q A;  2FJL A;  1XD4 A;  4HB4 B;  3ZDT A;  4Z2M B;  3U7D A;  4TKN A;  2R09 A;  4WSF A;  2L1C A;  3ODO A;  1NU2 A;  3MDB C;  4KHA A;  2VSZ A;  3CIK A;  4IFS A;  1ZC3 B;  1UNP A;  1NTY A;  4MT7 A;  2GCL A;  4HAX B;  4GXB A;  1ISN A;  2EMS A;  5DIF B;  1OQN A;  2COC A;  1M7R A;  4PQ0 A;  3PVW A;  1SHC A;  4NSW A;  1QQG A;  5EFX A;  1ZVR A;  3PVU A;  4KHO A;  2YS5 A;  4Y94 A;  1U2B A;  3ML4 A;  3F5R A;  3VOQ A;  4DX9 0;  3GYP A;  2I1K A;  5LON B;  2RLO A;  1I7A A;  4A6F A;  2UZR A;  2N0Y A;  2DYQ A;  3QBV B;  3ULB A;  4HB0 B;  3SV1 A;  3AU5 A;  4HAT B;  4YON A;  3HK0 A;  2I5F A;  2UVM A;  1V89 A;  3PEG A;  5DI9 B;  1BWN A;  5JHH A;  2G35 A;  5LOP B;  2D11 A;  2MKR A;  2Z0P A;  1J0W A;  1IRS A;  3GYO A;  4DBB A;  2ZPY A;  2Z0Q A;  2J0K A;  5J3Y A;  5L81 A;  5J3T A;  3F0W A;  3ODX A;  2P0H A;  5KQ1 A;  4GMX B;  2I5C A;  1EF1 A;  1ZM0 A;  2D10 A;  2D9Z A;  4CHM A;  4PNK A;  4TYZ A;  4C0A A;  1X86 A;  3ULC A;  1DDW A;  1FB8 A;  4MK0 A;  5HE1 A;  1BTK A;  2RNR B;  2HTH B;  3ZVR A;  3PVL A;  1UNR A;  1K5G B;  2YT1 A;  4EJN A;  2L2I A;  3N7C A;  1DYN A;  1MAI A;  3A98 B;  4F7H A;  1FOE A;  1DDM A;  1MIZ B;  4NY0 A;  4DXA B;  1P5T A;  1WG7 A;  1WVH A;  1U5D A;  2I1J A;  4BBK A;  4ZRK A;  4KHB B;  1WGU A;  4HAZ B;  1WI1 A;  5DHF B;  4A6H A;  1ZSQ A;  4HAU B;  3IVF A;  4HAY B;  2D2Q A;  3D8E A;  4H8S A;  1KI1 B;  2COF A;  4K2P A;  1LB1 A;  3D8F A;  5D3V A;  1EAZ A;  4A6F B;  3A8Q A;  2XQN M;  2GJY A;  1WGQ A;  4GZU A;  5CLQ B;  1FGZ A;  4B6H A;  2D9W A;  2UZS A;  3TO1 A;  1LW3 A;  2YVC A;  2HE7 A;  2CRF A;  2EMT A;  2K2U A;  1OY2 A;  2BCJ A;  2H7E A;  2OQB A;  2R0D A;  1UPR A;  2GS0 A;  1X05 A;  2NZ8 B;  1X11 A;  2DKQ A;  2LOX A;  4ZRJ A;  1TQZ A;  4K17 A;  2D4Q A;  1PMS A;  5C6R A;  2LG1 A;  2COA A;  2QKM A;  1XOD A;  2YSZ A;  1M7E A;  2YF0 A;  1Y5O A;  1EVH A;  2DN6 A;  3AJ4 A;  4K2O A;  2D9Y A;  3KSY A;  1KZG A;  4IAP A;  3FEH A;  2ROV A;  1U5F A;  3O96 A;  1W1D A;  2J59 M;  1KZ7 A;  1MPH A;  2CY5 A;  5D27 A;  2E2X A;  4CHJ A;  2K2J A;  2PZ1 A;  3DXE A;  1DBH A;  1UNQ A;  2N23 A;  5C79 A;  2W2W A;  3TW1 A;  2P0F A;  1V5U A;  4HDQ A;  1V61 A;  2D9V A;  2MFQ A;  2QKL A;  4ZRI A;  1MIX A;  3P7Z A;  4D0N B;  1MK7 B;  5JLJ B;  2DFK A;  1GC6 A;  2K00 A;  2DX1 A;  1TXD A;  1XKE A;  2V76 A;  1N3H A;  2KGX B;  5FI0 A;  2RGN B;  5D3Y A;  2VKI A;  4HB3 B;  2YS1 A;  4HHV A;  1GG3 A;  4F7G A;  2X18 A;  4EKU A;  1UEF A;  5GOW B;  2Q13 A;  2CY4 A;  1XCG A;  5KQ4 A;  2DTC A;  2LKO A;  1QC6 A;  1X1F A;  5FI1 A;  2DHK A;  3TVV A;  1DDV A;  3P6A A;  1H10 A;  1WJ1 A;  4A5K A;  4KAX B;  4F7U P;  3BIN A;  3TFM A;  1U27 A;  1FAO A;  3QIJ A;  1DRO A;  2M14 A;  3ODW A;  2YS3 A;  1XX0 A;  3PG7 A;  2YRY A;  3KRX A;  4GMV A;  3PZD A;  1X1G A;  2DX5 A;  5DH9 B;  3AU4 A;  2J0J A;  1PFJ A;  3G9W A;  2D9X A;  1W1G A;  1U5E A;  3SO6 A;  4GN1 A;  1V88 A;  1GC7 A;  1Y19 B;  1MKE A;  1XR0 B;  2NMB A;  5DHA B;  1OMW A;  1U5G A;  4CYE A;  1TJ6 A;  1H4R A;  4K81 A;  3U8Z A;  2KUP A;  2LUL A;  3WYF B;  5CLL B;  2H7D A;  5JHG A;  4KVG B;  2Z0O A;  4HAV B;  1P6S A;  3OAN A;  4EMO A;  3SUZ A;  3KRW A;  3DXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...