2Y8GA

Structure of the ran-binding domain from human ranbp3 (e352a-r353v double mutant)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
124
structure length
122
Chain Sequence
ESNVLQMQCKLFVFDKTSQSWVAVGRGLLRLNDMASTDDGTLQSRLVMRTQGSLRLILNTKLWAQMQIDKASEKSIRITAMDDQGVKVFLISASSKDTGQLYAALHHRILALRSRVEQEQEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights Into the Function of the Crm1 Cofactor Ranbp3 from the Structure of its Ran-Binding Domain
pubmed doi rcsb
molecule keywords RAN-BINDING PROTEIN 3
source organism Homo sapiens
molecule tags Protein transport
total genus 28
structure length 122
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2y8gA00
2CAYA 1XX0A 3TFMA 1QQGA 3A98B 3KZ1A 1PFJA 5JLJB 1U5GA 4K2OA 3G9WA 1TJ6A 2OQBA 2LKOA 3HK0A 3PZDA 2K00A 1FGZA 4NY0A 1M7EA 4ZRJA 2CODA 1UNRA 3KRXA 2EMSA 1ZM0A 1B55A 3A8PA 1V5MA 2R0DA 1AQCA 4EMOA 4C0AA 2DN6A 4HB4B 4YONA 4WJ7A 1DDMA 2W2XC 3DXDA 2RGNB 2D9YA 2LG1A 5D3WA 1SGHA 2VKIA 1U2BA 4KHBB 1J19A 4KVGB 4L6EA 2D9WA 1PLSA 2CY5A 1WGUA 3O96A 1E5WA 1GG3A 2VSZA 1DDWA 3GYOA 3VOQA 1TQZA 1LW3A 3SYXA 1WJ1A 3D8EA 3P6AA 2D9XA 4HB0B 3DXCA 1Y19B 2I5CA 4MT7A 1U27A 3LJUX 4HAXB 1N3HA 2Z0QA 4EJNA 1H4RA 2AL6A 2P8VA 3MPXA 2GS0A 4CYEA 1U29A 5C5BA 2DLWA 2ROVA 4A5KA 3D8FA 2DKPA 5CLQB 4CHJA 2GCLA 3FSSA 2LOZA 2UZRA 1DBHA 4TKNA 4GMXB 3UZTA 1GC7A 3TVVA 2YS3A 2ELBA 1MAIA 2RVBB 2Y8FA 3TW1A 5C5BB 1UNQA 4XWXA 1XCGA 5C6RA 4GXBA 4TYZA 1J0WA 2Z0OA 2J59M 2M38A 5C79A 3BINA 4H8SA 3D8DA 1P6SA 2YVCA 3ODWA 2LYDA 5FI0A 3P7ZA 1FOEA 2RNRB 1IRSA 2GCJA 3NSUA 2XQNM 2D9VA 4A6FA 1ZVRA 2DHJA 2OTXA 1SHCA 2DX5A 2L2IA 3TCAA 4D0NB 5J3YA 3QBVB 2NMBA 4P7IA 5C16A 4PQ0A 1BTNA 4HDQA 3KSYA 1V5UA 2YT0A 1H10A 2KCJA 2MDXA 3A8QA 2DFKA 3OANA 1FHOA 1WJMA 2DHKA 2Z0PA 4HDOA 2I5FA 3MDBC 3PG7A 2DTCA 3WYFB 1MIZB 2AEHA 4HAYB 2CY4A 1RRPB 1KZ7A 1PMSA 1UPQA 1FB8A 2ADZA 5JHHA 1U5DA 2BCJA 1FHWA 4KAXB 1WVHA 2KUPA 4GZUA 1U5FA 2GJYA 1NTVA 1XR0B 2DYQA 2RUKB 2DYNA 4DX8A 3ODXA 2QKLA 1NTYA 5J3TA 1XKEA 3N7CA 5KQ4A 2KGXB 2EMTA 5D3VA 3IVFA 2UZSA 2YS5A 4EKUA 1BWNA 1X1GA 1FHXA 3V5WA 4Z2MB 3F5RA 2ZPYA 1WI1A 2I1JA 3KY9A 2D11A 4ZRKA 4WVFB 2HE7A 2LULA 3SNHA 1LB1A 4HAWB 4CHMA 2LOXA 2J0MA 3SO6A 2PZ1A 4NSWA 1KZGA 1K5GB 1XODA 2E2XA 2P0FA 3GYPA 1W1HA 3PVWA 5LONB 1P5TA 4A6HA 2JP2A 4DXAB 4K2PA 3ULBA 2L1CA 2DKQA 3ML4A 5HE1A 2YRYA 3PSCA 2Y8GA 2YT1A 5FI1A 2YF0A 2D2QA 4GN1A 1I7AA 3FM8C 2NZ8B 2W2WA 5DI9B 1OQNA 1X1FA 3PVUA 3SUZA 4B6HA 1Y5OA 4IFSA 3QIJA 4KHAA 1OY2A 4IOYX 1BAKA 5KCVA 2D9ZA 1U5EA 2Y7BA 3CIKA 2P0HA 3RCPA 3FEHA 2J0JA 2IFSA 3BJIA 1Q67A 1ZC4B 2N0YA 2YS1A 1X05A 1XD4A 1WGQA 2H7EA 2IYBA 4F7GA 3ZVRA 1FGYA 1KI1B 2VRWB 5D27A 1MIXA 1RJ2A 1MK7B 1AWEA 1FAOA 2R09A 4K17A 4A6FB 1NI2A 1K5DB 2J0KA 3U8ZA 4K81A 3WA0A 4GMVA 4ZRIA 2MWNB 1W1DA 5KQ1A 1DROA 2G35A 3AU4A 2X18A 2HTHB 5HE0A 5JHGA 2I1KA 5HE2A 3HQCA 3X23A 2DA0A 2FJLA 4HAZB 1EAZA 4HAUB 2COFA 3M1IB 1W1GA 3SV1A 1ZSQA 4PNKA 3AJ4A 4IAPA 4MK0A 2DX1A 2D4QA 4F7HA 3VIAA 3ZDTA 5DHFB 1MKEA 1BTKA 2Q13A 2ROZB 4KHOA 1MPHA 2K2UA 1Z87A 2CRFA 1M7RA 2COAA 1V89A 1TXDA 2QKMA 1I2HA 1MK9B 3HW2B 1UPRA 2K2JA 2W2XD 2MKRA 5D3YA 2H7DA 4HAVB 1GC6A 5D3XA 3U7DA 2ELAA 4Z2NA 4HB3B 1ZC3B 4WSFA 3KRWA 5JP4A 1X11A 3ODOA 2D10A 4A6KA 1OMWA 3CXBB 5EFXA 2MFQA 3PVLA 2P0DA 4YL8A 4DBBA 1DYNA 3F0WA 1UNPA 2YSZA 3PP2A 1V5PA 4HB2B 3TO1A 4HHVA 1V61A 1DDVA 1X86A 3AU5A 1WG7A 5DH9B 5J3QA 2RSGA 1EVHA 1UEFA 4GPTB 4BBKA 2N23A 4MY6A 2EC1A 2UVMA 4HATB 5L81A 1V88A 5LOPB 1EF1A 1QC6A 3PEGA 2DHIA 2RLOA 2EJ8A 4Y94A 2COCA 1P3RA 3T06A 1NU2A 3DXEA 1EGXA 5DHAB 5CLLB 3ULCA 4F7UP 2M14A 5DIFB 5HE3A 2V76A 3QWMA 1ISNA 5GOWB 4DX90
chains in the Genus database with same CATH superfamily
2CAYA 4L1RA 1XX0A 3TFMA 1QQGA 3A98B 3KZ1A 1PFJA 5JLJB 1U5GA 4K2OA 3G9WA 5I2MA 1TJ6A 2OQBA 2LKOA 3HK0A 3PZDA 2K00A 1FGZA 1T77A 4NY0A 1M7EA 4ZRJA 2CODA 4KHBA 1UNRA 3KRXA 2EMSA 1ZM0A 1B55A 3A8PA 1V5MA 2R0DA 1AQCA 4EMOA 4C0AA 2DN6A 4HB4B 4YONA 4WJ7A 1DDMA 2W2XC 3DXDA 2RGNB 2K8EA 4QXAB 2D9YA 2LG1A 5D3WA 1SGHA 2VKIA 1U2BA 4KHBB 1J19A 3DCXA 4KVGB 5M4YB 4L6EA 2D9WA 1PLSA 2CY5A 1WGUA 3O96A 1E5WA 1GG3A 2VSZA 1DDWA 3GYOA 3VOQA 1TQZA 1LW3A 2KR0A 3SYXA 3A58A 1WJ1A 3D8EA 3P6AA 2D9XA 4HB0B 3DXCA 1Y19B 2I5CA 4MT7A 1U27A 3LJUX 4HAXB 1N3HA 2Z0QA 4EJNA 1H4RA 2AL6A 2KIEA 2P8VA 3MPXA 3HIEA 2GS0A 4CYEA 1U29A 5C5BA 2DLWA 2ROVA 4A5KA 3D8FA 2DKPA 5CLQB 4CHJA 2GCLA 5LG4B 3FSSA 2LOZA 4OT1A 2UZRA 1DBHA 4TKNA 4GMXB 3UZTA 1GC7A 3TVVA 2YS3A 2ELBA 2YT2A 4CSQA 1MAIA 2RVBB 2Y8FA 3TW1A 5C5BB 1UNQA 4XWXA 1XCGA 5C6RA 2K49A 4GXBA 4TYZA 1J0WA 2NBVA 2Z0OA 2J59M 2M38A 5C79A 3BINA 4H8SA 3D8DA 1P6SA 2GUMA 2YVCA 2R2YA 3ODWA 2LYDA 5FI0A 3P7ZA 1FOEA 2RNRB 3B77A 1IRSA 2GCJA 3NSUA 2XQNM 2ZKMX 2D9VA 4A6FA 1ZVRA 2DHJA 3HSAA 4QJ3B 4QJ4B 2OTXA 1SHCA 2DX5A 2L2IA 3TCAA 4D0NB 5J3YA 3QBVB 2NMBA 4P7IA 5C16A 4PQ0A 1BTNA 4HDQA 3KSYA 1V5UA 2YT0A 1H10A 2KCJA 2MDXA 3A8QA 2DFKA 3OANA 3NWFA 1FHOA 1WJMA 2DHKA 2Z0PA 4HDOA 2I5FA 3MDBC 3PG7A 2DTCA 3WYFB 1MIZB 2AEHA 4HAYB 2CY4A 1RRPB 1KZ7A 1PMSA 1UPQA 1FB8A 2ADZA 5JHHA 1U5DA 2BCJA 1FHWA 4KAXB 1WVHA 2KUPA 4GZUA 1U5FA 2GJYA 1NTVA 1XR0B 2DYQA 2RUKB 2DYNA 2Z4DA 4DX8A 3ODXA 2QKLA 1NTYA 5J3TA 1XKEA 3N7CA 5KQ4A 2KGXB 1MI1A 2EMTA 5D3VA 3IVFA 2Z13A 2UZSA 2YS5A 5IRSA 4EKUA 1BWNA 1X1GA 1FHXA 3V5WA 4Z2MB 3F5RA 2ZPYA 3U12A 4HSIA 1WI1A 2I1JA 3KY9A 2D11A 3NWDA 4ZRKA 4WVFB 2HE7A 2LULA 3SNHA 1LB1A 4HAWB 4CHMA 2LOXA 2J0MA 3SO6A 2PZ1A 4NSWA 1KZGA 1K5GB 1XODA 2E2XA 2P0FA 3GYPA 1W1HA 3PVWA 5LONB 1P5TA 4A6HA 2JP2A 4DXAB 4K2PA 3ULBA 2L1CA 4GNKB 2DKQA 3ML4A 5HE1A 2YRYA 3PSCA 2Y8GA 2YT1A 5FI1A 2YF0A 2D2QA 4GN1A 1I7AA 3FM8C 2NZ8B 2W2WA 5DI9B 1OQNA 1X1FA 3PVUA 3SUZA 4B6HA 1Y5OA 4IFSA 3QIJA 4KHAA 4D6WA 1OY2A 4IOYX 1BAKA 5KCVA 2D9ZA 1U5EA 2Y7BA 3CIKA 2P0HA 3RCPA 3FEHA 2J0JA 2IFSA 3BJIA 1Q67A 1ZC4B 2N0YA 2YS1A 1X05A 1XD4A 1WGQA 2H7EA 2IYBA 4F7GA 3ZVRA 1FGYA 1KI1B 2VRWB 5D27A 1MIXA 1RJ2A 1MK7B 1AWEA 1FAOA 4OSNA 2R09A 4K17A 4A6FB 1NI2A 1K5DB 2J0KA 3U8ZA 4K81A 3WA0A 4GMVA 4ZRIA 2MWNB 1W1DA 5KQ1A 1DROA 2G35A 3AU4A 2X18A 2HTHB 5HE0A 5JHGA 2I1KA 5HE2A 3HQCA 3X23A 2DA0A 2FJLA 5I2SA 4HAZB 1EAZA 4HAUB 2COFA 3M1IB 1W1GA 4GOUA 3SV1A 1ZSQA 4PNKA 3AJ4A 4IAPA 3FVCA 4MK0A 2DX1A 2D4QA 4F7HA 3VIAA 3ZDTA 3NWAA 5DHFB 1MKEA 1BTKA 2Q13A 2ROZB 2Z14A 4KHOA 1MPHA 2K2UA 1Z87A 2CRFA 2RRFA 1M7RA 2COAA 2Z59A 1V89A 1TXDA 2QKMA 1I2HA 1MK9B 4QJ5B 3HW2B 1UPRA 2K2JA 2W2XD 2MKRA 5D3YA 2H7DA 4HAVB 1GC6A 5D3XA 3U7DA 2ELAA 2KUQA 4Z2NA 4HB3B 1ZC3B 4WSFA 3KRWA 5JP4A 1X11A 3ODOA 2D10A 4A6KA 1OMWA 3CXBB 5EFXA 2MFQA 1ZYIA 3OHMB 3PVLA 2P0DA 4YL8A 4DBBA 1DYNA 3F0WA 1UNPA 2YSZA 3PP2A 1V5PA 4HB2B 3TO1A 4HHVA 1V61A 4DIXA 2KIGA 1DDVA 1X86A 3AU5A 1WG7A 5DH9B 5J3QA 3NW8A 2RSGA 1EVHA 1UEFA 4GPTB 4BBKA 2N23A 4MY6A 2EC1A 2UVMA 4HATB 5L81A 1V88A 5LOPB 1EF1A 1QC6A 3PEGA 2DHIA 2RLOA 2EJ8A 4Y94A 2COCA 1P3RA 2FJUB 3T06A 1NU2A 3DXEA 1EGXA 5DHAB 5CLLB 3ULCA 4F7UP 2M14A 5DIFB 5HE3A 2V76A 3QWMA 1ISNA 5GOWB 4DX90
chains in the Genus database with same CATH topology
2CAYA 1XX0A 3TFMA 1QQGA 3A98B 3KZ1A 1PFJA 5JLJB 1U5GA 4K2OA 3G9WA 1TJ6A 2OQBA 2LKOA 3HK0A 3PZDA 2K00A 1FGZA 4NY0A 1M7EA 4ZRJA 2CODA 1UNRA 3KRXA 2EMSA 1ZM0A 1B55A 3A8PA 1V5MA 2R0DA 1AQCA 4EMOA 4C0AA 2DN6A 4HB4B 4YONA 4WJ7A 1DDMA 2W2XC 3DXDA 2RGNB 2D9YA 2LG1A 5D3WA 1SGHA 2VKIA 1U2BA 4KHBB 1J19A 4KVGB 4L6EA 2D9WA 1PLSA 2CY5A 1WGUA 3O96A 1E5WA 1GG3A 2VSZA 1DDWA 3GYOA 3VOQA 1TQZA 1LW3A 3SYXA 1WJ1A 3D8EA 3P6AA 2D9XA 4HB0B 3DXCA 1Y19B 2I5CA 4MT7A 1U27A 3LJUX 4HAXB 1N3HA 2Z0QA 4EJNA 1H4RA 2AL6A 2P8VA 3MPXA 2GS0A 4CYEA 1U29A 5C5BA 2DLWA 2ROVA 4A5KA 3D8FA 2DKPA 5CLQB 4CHJA 2GCLA 3FSSA 2LOZA 2UZRA 1DBHA 4TKNA 4GMXB 3UZTA 1GC7A 3TVVA 2YS3A 2ELBA 1MAIA 2RVBB 2Y8FA 3TW1A 5C5BB 1UNQA 4XWXA 1XCGA 5C6RA 4GXBA 4TYZA 1J0WA 2Z0OA 2J59M 2M38A 5C79A 3BINA 4H8SA 3D8DA 1P6SA 2YVCA 3ODWA 2LYDA 5FI0A 3P7ZA 1FOEA 2RNRB 1IRSA 2GCJA 3NSUA 2XQNM 2D9VA 4A6FA 1ZVRA 2DHJA 2OTXA 1SHCA 2DX5A 2L2IA 3TCAA 4D0NB 5J3YA 3QBVB 2NMBA 4P7IA 5C16A 4PQ0A 1BTNA 4HDQA 3KSYA 1V5UA 2YT0A 1H10A 2KCJA 2MDXA 3A8QA 2DFKA 3OANA 1FHOA 1WJMA 2DHKA 2Z0PA 4HDOA 2I5FA 3MDBC 3PG7A 2DTCA 3WYFB 1MIZB 2AEHA 4HAYB 2CY4A 1RRPB 1KZ7A 1PMSA 1UPQA 1FB8A 2ADZA 5JHHA 1U5DA 2BCJA 1FHWA 4KAXB 1WVHA 2KUPA 4GZUA 1U5FA 2GJYA 1NTVA 1XR0B 2DYQA 2RUKB 2DYNA 4DX8A 3ODXA 2QKLA 1NTYA 5J3TA 1XKEA 3N7CA 5KQ4A 2KGXB 2EMTA 5D3VA 3IVFA 2UZSA 2YS5A 4EKUA 1BWNA 1X1GA 1FHXA 3V5WA 4Z2MB 3F5RA 2ZPYA 1WI1A 2I1JA 3KY9A 2D11A 4ZRKA 4WVFB 2HE7A 2LULA 3SNHA 1LB1A 4HAWB 4CHMA 2LOXA 2J0MA 3SO6A 2PZ1A 4NSWA 1KZGA 1K5GB 1XODA 2E2XA 2P0FA 3GYPA 1W1HA 3PVWA 5LONB 1P5TA 4A6HA 2JP2A 4DXAB 4K2PA 3ULBA 2L1CA 2DKQA 3ML4A 5HE1A 2YRYA 3PSCA 2Y8GA 2YT1A 5FI1A 2YF0A 2D2QA 4GN1A 1I7AA 3FM8C 2NZ8B 2W2WA 5DI9B 1OQNA 1X1FA 3PVUA 3SUZA 4B6HA 1Y5OA 4IFSA 3QIJA 4KHAA 1OY2A 4IOYX 1BAKA 5KCVA 2D9ZA 1U5EA 2Y7BA 3CIKA 2P0HA 3RCPA 3FEHA 2J0JA 2IFSA 3BJIA 1Q67A 1ZC4B 2N0YA 2YS1A 1X05A 1XD4A 1WGQA 2H7EA 2IYBA 4F7GA 3ZVRA 1FGYA 1KI1B 2VRWB 5D27A 1MIXA 1RJ2A 1MK7B 1AWEA 1FAOA 2R09A 4K17A 4A6FB 1NI2A 1K5DB 2J0KA 3U8ZA 4K81A 3WA0A 4GMVA 4ZRIA 2MWNB 1W1DA 5KQ1A 1DROA 2G35A 3AU4A 2X18A 2HTHB 5HE0A 5JHGA 2I1KA 5HE2A 3HQCA 3X23A 2DA0A 2FJLA 4HAZB 1EAZA 4HAUB 2COFA 3M1IB 1W1GA 3SV1A 1ZSQA 4PNKA 3AJ4A 4IAPA 4MK0A 2DX1A 2D4QA 4F7HA 3VIAA 3ZDTA 5DHFB 1MKEA 1BTKA 2Q13A 2ROZB 4KHOA 1MPHA 2K2UA 1Z87A 2CRFA 1M7RA 2COAA 1V89A 1TXDA 2QKMA 1I2HA 1MK9B 3HW2B 1UPRA 2K2JA 2W2XD 2MKRA 5D3YA 2H7DA 4HAVB 1GC6A 5D3XA 3U7DA 2ELAA 4Z2NA 4HB3B 1ZC3B 4WSFA 3KRWA 5JP4A 1X11A 3ODOA 2D10A 4A6KA 1OMWA 3CXBB 5EFXA 2MFQA 3PVLA 2P0DA 4YL8A 4DBBA 1DYNA 3F0WA 1UNPA 2YSZA 3PP2A 1V5PA 4HB2B 3TO1A 4HHVA 1V61A 1DDVA 1X86A 3AU5A 1WG7A 5DH9B 5J3QA 2RSGA 1EVHA 1UEFA 4GPTB 4BBKA 2N23A 4MY6A 2EC1A 2UVMA 4HATB 5L81A 1V88A 5LOPB 1EF1A 1QC6A 3PEGA 2DHIA 2RLOA 2EJ8A 4Y94A 2COCA 1P3RA 3T06A 1NU2A 3DXEA 1EGXA 5DHAB 5CLLB 3ULCA 4F7UP 2M14A 5DIFB 5HE3A 2V76A 3QWMA 1ISNA 5GOWB 4DX90
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CAY A;  1XX0 A;  3TFM A;  1QQG A;  3A98 B;  3KZ1 A;  1PFJ A;  5JLJ B;  1U5G A;  4K2O A;  3G9W A;  1TJ6 A;  2OQB A;  2LKO A;  3HK0 A;  3PZD A;  2K00 A;  1FGZ A;  4NY0 A;  1M7E A;  4ZRJ A;  2COD A;  1UNR A;  3KRX A;  2EMS A;  1ZM0 A;  1B55 A;  3A8P A;  1V5M A;  2R0D A;  1AQC A;  4EMO A;  4C0A A;  2DN6 A;  4HB4 B;  4YON A;  4WJ7 A;  1DDM A;  2W2X C;  3DXD A;  2RGN B;  2D9Y A;  2LG1 A;  5D3W A;  1SGH A;  2VKI A;  1U2B A;  4KHB B;  1J19 A;  4KVG B;  4L6E A;  2D9W A;  1PLS A;  2CY5 A;  1WGU A;  3O96 A;  1E5W A;  1GG3 A;  2VSZ A;  1DDW A;  3GYO A;  3VOQ A;  1TQZ A;  1LW3 A;  3SYX A;  1WJ1 A;  3D8E A;  3P6A A;  2D9X A;  4HB0 B;  3DXC A;  1Y19 B;  2I5C A;  4MT7 A;  1U27 A;  3LJU X;  4HAX B;  1N3H A;  2Z0Q A;  4EJN A;  1H4R A;  2AL6 A;  2P8V A;  3MPX A;  2GS0 A;  4CYE A;  1U29 A;  5C5B A;  2DLW A;  2ROV A;  4A5K A;  3D8F A;  2DKP A;  5CLQ B;  4CHJ A;  2GCL A;  3FSS A;  2LOZ A;  2UZR A;  1DBH A;  4TKN A;  4GMX B;  3UZT A;  1GC7 A;  3TVV A;  2YS3 A;  2ELB A;  1MAI A;  2RVB B;  2Y8F A;  3TW1 A;  5C5B B;  1UNQ A;  4XWX A;  1XCG A;  5C6R A;  4GXB A;  4TYZ A;  1J0W A;  2Z0O A;  2J59 M;  2M38 A;  5C79 A;  3BIN A;  4H8S A;  3D8D A;  1P6S A;  2YVC A;  3ODW A;  2LYD A;  5FI0 A;  3P7Z A;  1FOE A;  2RNR B;  1IRS A;  2GCJ A;  3NSU A;  2XQN M;  2D9V A;  4A6F A;  1ZVR A;  2DHJ A;  2OTX A;  1SHC A;  2DX5 A;  2L2I A;  3TCA A;  4D0N B;  5J3Y A;  3QBV B;  2NMB A;  4P7I A;  5C16 A;  4PQ0 A;  1BTN A;  4HDQ A;  3KSY A;  1V5U A;  2YT0 A;  1H10 A;  2KCJ A;  2MDX A;  3A8Q A;  2DFK A;  3OAN A;  1FHO A;  1WJM A;  2DHK A;  2Z0P A;  4HDO A;  2I5F A;  3MDB C;  3PG7 A;  2DTC A;  3WYF B;  1MIZ B;  2AEH A;  4HAY B;  2CY4 A;  1RRP B;  1KZ7 A;  1PMS A;  1UPQ A;  1FB8 A;  2ADZ A;  5JHH A;  1U5D A;  2BCJ A;  1FHW A;  4KAX B;  1WVH A;  2KUP A;  4GZU A;  1U5F A;  2GJY A;  1NTV A;  1XR0 B;  2DYQ A;  2RUK B;  2DYN A;  4DX8 A;  3ODX A;  2QKL A;  1NTY A;  5J3T A;  1XKE A;  3N7C A;  5KQ4 A;  2KGX B;  2EMT A;  5D3V A;  3IVF A;  2UZS A;  2YS5 A;  4EKU A;  1BWN A;  1X1G A;  1FHX A;  3V5W A;  4Z2M B;  3F5R A;  2ZPY A;  1WI1 A;  2I1J A;  3KY9 A;  2D11 A;  4ZRK A;  4WVF B;  2HE7 A;  2LUL A;  3SNH A;  1LB1 A;  4HAW B;  4CHM A;  2LOX A;  2J0M A;  3SO6 A;  2PZ1 A;  4NSW A;  1KZG A;  1K5G B;  1XOD A;  2E2X A;  2P0F A;  3GYP A;  1W1H A;  3PVW A;  5LON B;  1P5T A;  4A6H A;  2JP2 A;  4DXA B;  4K2P A;  3ULB A;  2L1C A;  2DKQ A;  3ML4 A;  5HE1 A;  2YRY A;  3PSC A;  2Y8G A;  2YT1 A;  5FI1 A;  2YF0 A;  2D2Q A;  4GN1 A;  1I7A A;  3FM8 C;  2NZ8 B;  2W2W A;  5DI9 B;  1OQN A;  1X1F A;  3PVU A;  3SUZ A;  4B6H A;  1Y5O A;  4IFS A;  3QIJ A;  4KHA A;  1OY2 A;  4IOY X;  1BAK A;  5KCV A;  2D9Z A;  1U5E A;  2Y7B A;  3CIK A;  2P0H A;  3RCP A;  3FEH A;  2J0J A;  2IFS A;  3BJI A;  1Q67 A;  1ZC4 B;  2N0Y A;  2YS1 A;  1X05 A;  1XD4 A;  1WGQ A;  2H7E A;  2IYB A;  4F7G A;  3ZVR A;  1FGY A;  1KI1 B;  2VRW B;  5D27 A;  1MIX A;  1RJ2 A;  1MK7 B;  1AWE A;  1FAO A;  2R09 A;  4K17 A;  4A6F B;  1NI2 A;  1K5D B;  2J0K A;  3U8Z A;  4K81 A;  3WA0 A;  4GMV A;  4ZRI A;  2MWN B;  1W1D A;  5KQ1 A;  1DRO A;  2G35 A;  3AU4 A;  2X18 A;  2HTH B;  5HE0 A;  5JHG A;  2I1K A;  5HE2 A;  3HQC A;  3X23 A;  2DA0 A;  2FJL A;  4HAZ B;  1EAZ A;  4HAU B;  2COF A;  3M1I B;  1W1G A;  3SV1 A;  1ZSQ A;  4PNK A;  3AJ4 A;  4IAP A;  4MK0 A;  2DX1 A;  2D4Q A;  4F7H A;  3VIA A;  3ZDT A;  5DHF B;  1MKE A;  1BTK A;  2Q13 A;  2ROZ B;  4KHO A;  1MPH A;  2K2U A;  1Z87 A;  2CRF A;  1M7R A;  2COA A;  1V89 A;  1TXD A;  2QKM A;  1I2H A;  1MK9 B;  3HW2 B;  1UPR A;  2K2J A;  2W2X D;  2MKR A;  5D3Y A;  2H7D A;  4HAV B;  1GC6 A;  5D3X A;  3U7D A;  2ELA A;  4Z2N A;  4HB3 B;  1ZC3 B;  4WSF A;  3KRW A;  5JP4 A;  1X11 A;  3ODO A;  2D10 A;  4A6K A;  1OMW A;  3CXB B;  5EFX A;  2MFQ A;  3PVL A;  2P0D A;  4YL8 A;  4DBB A;  1DYN A;  3F0W A;  1UNP A;  2YSZ A;  3PP2 A;  1V5P A;  4HB2 B;  3TO1 A;  4HHV A;  1V61 A;  1DDV A;  1X86 A;  3AU5 A;  1WG7 A;  5DH9 B;  5J3Q A;  2RSG A;  1EVH A;  1UEF A;  4GPT B;  4BBK A;  2N23 A;  4MY6 A;  2EC1 A;  2UVM A;  4HAT B;  5L81 A;  1V88 A;  5LOP B;  1EF1 A;  1QC6 A;  3PEG A;  2DHI A;  2RLO A;  2EJ8 A;  4Y94 A;  2COC A;  1P3R A;  3T06 A;  1NU2 A;  3DXE A;  1EGX A;  5DHA B;  5CLL B;  3ULC A;  4F7U P;  2M14 A;  5DIF B;  5HE3 A;  2V76 A;  3QWM A;  1ISN A;  5GOW B;  4DX9 0; 
#chains in the Genus database with same CATH topology
 2CAY A;  4L1R A;  1XX0 A;  3TFM A;  1QQG A;  3A98 B;  3KZ1 A;  1PFJ A;  5JLJ B;  1U5G A;  4K2O A;  3G9W A;  5I2M A;  1TJ6 A;  2OQB A;  2LKO A;  3HK0 A;  3PZD A;  2K00 A;  1FGZ A;  1T77 A;  4NY0 A;  1M7E A;  4ZRJ A;  2COD A;  4KHB A;  1UNR A;  3KRX A;  2EMS A;  1ZM0 A;  1B55 A;  3A8P A;  1V5M A;  2R0D A;  1AQC A;  4EMO A;  4C0A A;  2DN6 A;  4HB4 B;  4YON A;  4WJ7 A;  1DDM A;  2W2X C;  3DXD A;  2RGN B;  2K8E A;  4QXA B;  2D9Y A;  2LG1 A;  5D3W A;  1SGH A;  2VKI A;  1U2B A;  4KHB B;  1J19 A;  3DCX A;  4KVG B;  5M4Y B;  4L6E A;  2D9W A;  1PLS A;  2CY5 A;  1WGU A;  3O96 A;  1E5W A;  1GG3 A;  2VSZ A;  1DDW A;  3GYO A;  3VOQ A;  1TQZ A;  1LW3 A;  2KR0 A;  3SYX A;  3A58 A;  1WJ1 A;  3D8E A;  3P6A A;  2D9X A;  4HB0 B;  3DXC A;  1Y19 B;  2I5C A;  4MT7 A;  1U27 A;  3LJU X;  4HAX B;  1N3H A;  2Z0Q A;  4EJN A;  1H4R A;  2AL6 A;  2KIE A;  2P8V A;  3MPX A;  3HIE A;  2GS0 A;  4CYE A;  1U29 A;  5C5B A;  2DLW A;  2ROV A;  4A5K A;  3D8F A;  2DKP A;  5CLQ B;  4CHJ A;  2GCL A;  5LG4 B;  3FSS A;  2LOZ A;  4OT1 A;  2UZR A;  1DBH A;  4TKN A;  4GMX B;  3UZT A;  1GC7 A;  3TVV A;  2YS3 A;  2ELB A;  2YT2 A;  4CSQ A;  1MAI A;  2RVB B;  2Y8F A;  3TW1 A;  5C5B B;  1UNQ A;  4XWX A;  1XCG A;  5C6R A;  2K49 A;  4GXB A;  4TYZ A;  1J0W A;  2NBV A;  2Z0O A;  2J59 M;  2M38 A;  5C79 A;  3BIN A;  4H8S A;  3D8D A;  1P6S A;  2GUM A;  2YVC A;  2R2Y A;  3ODW A;  2LYD A;  5FI0 A;  3P7Z A;  1FOE A;  2RNR B;  3B77 A;  1IRS A;  2GCJ A;  3NSU A;  2XQN M;  2ZKM X;  2D9V A;  4A6F A;  1ZVR A;  2DHJ A;  3HSA A;  4QJ3 B;  4QJ4 B;  2OTX A;  1SHC A;  2DX5 A;  2L2I A;  3TCA A;  4D0N B;  5J3Y A;  3QBV B;  2NMB A;  4P7I A;  5C16 A;  4PQ0 A;  1BTN A;  4HDQ A;  3KSY A;  1V5U A;  2YT0 A;  1H10 A;  2KCJ A;  2MDX A;  3A8Q A;  2DFK A;  3OAN A;  3NWF A;  1FHO A;  1WJM A;  2DHK A;  2Z0P A;  4HDO A;  2I5F A;  3MDB C;  3PG7 A;  2DTC A;  3WYF B;  1MIZ B;  2AEH A;  4HAY B;  2CY4 A;  1RRP B;  1KZ7 A;  1PMS A;  1UPQ A;  1FB8 A;  2ADZ A;  5JHH A;  1U5D A;  2BCJ A;  1FHW A;  4KAX B;  1WVH A;  2KUP A;  4GZU A;  1U5F A;  2GJY A;  1NTV A;  1XR0 B;  2DYQ A;  2RUK B;  2DYN A;  2Z4D A;  4DX8 A;  3ODX A;  2QKL A;  1NTY A;  5J3T A;  1XKE A;  3N7C A;  5KQ4 A;  2KGX B;  1MI1 A;  2EMT A;  5D3V A;  3IVF A;  2Z13 A;  2UZS A;  2YS5 A;  5IRS A;  4EKU A;  1BWN A;  1X1G A;  1FHX A;  3V5W A;  4Z2M B;  3F5R A;  2ZPY A;  3U12 A;  4HSI A;  1WI1 A;  2I1J A;  3KY9 A;  2D11 A;  3NWD A;  4ZRK A;  4WVF B;  2HE7 A;  2LUL A;  3SNH A;  1LB1 A;  4HAW B;  4CHM A;  2LOX A;  2J0M A;  3SO6 A;  2PZ1 A;  4NSW A;  1KZG A;  1K5G B;  1XOD A;  2E2X A;  2P0F A;  3GYP A;  1W1H A;  3PVW A;  5LON B;  1P5T A;  4A6H A;  2JP2 A;  4DXA B;  4K2P A;  3ULB A;  2L1C A;  4GNK B;  2DKQ A;  3ML4 A;  5HE1 A;  2YRY A;  3PSC A;  2Y8G A;  2YT1 A;  5FI1 A;  2YF0 A;  2D2Q A;  4GN1 A;  1I7A A;  3FM8 C;  2NZ8 B;  2W2W A;  5DI9 B;  1OQN A;  1X1F A;  3PVU A;  3SUZ A;  4B6H A;  1Y5O A;  4IFS A;  3QIJ A;  4KHA A;  4D6W A;  1OY2 A;  4IOY X;  1BAK A;  5KCV A;  2D9Z A;  1U5E A;  2Y7B A;  3CIK A;  2P0H A;  3RCP A;  3FEH A;  2J0J A;  2IFS A;  3BJI A;  1Q67 A;  1ZC4 B;  2N0Y A;  2YS1 A;  1X05 A;  1XD4 A;  1WGQ A;  2H7E A;  2IYB A;  4F7G A;  3ZVR A;  1FGY A;  1KI1 B;  2VRW B;  5D27 A;  1MIX A;  1RJ2 A;  1MK7 B;  1AWE A;  1FAO A;  4OSN A;  2R09 A;  4K17 A;  4A6F B;  1NI2 A;  1K5D B;  2J0K A;  3U8Z A;  4K81 A;  3WA0 A;  4GMV A;  4ZRI A;  2MWN B;  1W1D A;  5KQ1 A;  1DRO A;  2G35 A;  3AU4 A;  2X18 A;  2HTH B;  5HE0 A;  5JHG A;  2I1K A;  5HE2 A;  3HQC A;  3X23 A;  2DA0 A;  2FJL A;  5I2S A;  4HAZ B;  1EAZ A;  4HAU B;  2COF A;  3M1I B;  1W1G A;  4GOU A;  3SV1 A;  1ZSQ A;  4PNK A;  3AJ4 A;  4IAP A;  3FVC A;  4MK0 A;  2DX1 A;  2D4Q A;  4F7H A;  3VIA A;  3ZDT A;  3NWA A;  5DHF B;  1MKE A;  1BTK A;  2Q13 A;  2ROZ B;  2Z14 A;  4KHO A;  1MPH A;  2K2U A;  1Z87 A;  2CRF A;  2RRF A;  1M7R A;  2COA A;  2Z59 A;  1V89 A;  1TXD A;  2QKM A;  1I2H A;  1MK9 B;  4QJ5 B;  3HW2 B;  1UPR A;  2K2J A;  2W2X D;  2MKR A;  5D3Y A;  2H7D A;  4HAV B;  1GC6 A;  5D3X A;  3U7D A;  2ELA A;  2KUQ A;  4Z2N A;  4HB3 B;  1ZC3 B;  4WSF A;  3KRW A;  5JP4 A;  1X11 A;  3ODO A;  2D10 A;  4A6K A;  1OMW A;  3CXB B;  5EFX A;  2MFQ A;  1ZYI A;  3OHM B;  3PVL A;  2P0D A;  4YL8 A;  4DBB A;  1DYN A;  3F0W A;  1UNP A;  2YSZ A;  3PP2 A;  1V5P A;  4HB2 B;  3TO1 A;  4HHV A;  1V61 A;  4DIX A;  2KIG A;  1DDV A;  1X86 A;  3AU5 A;  1WG7 A;  5DH9 B;  5J3Q A;  3NW8 A;  2RSG A;  1EVH A;  1UEF A;  4GPT B;  4BBK A;  2N23 A;  4MY6 A;  2EC1 A;  2UVM A;  4HAT B;  5L81 A;  1V88 A;  5LOP B;  1EF1 A;  1QC6 A;  3PEG A;  2DHI A;  2RLO A;  2EJ8 A;  4Y94 A;  2COC A;  1P3R A;  2FJU B;  3T06 A;  1NU2 A;  3DXE A;  1EGX A;  5DHA B;  5CLL B;  3ULC A;  4F7U P;  2M14 A;  5DIF B;  5HE3 A;  2V76 A;  3QWM A;  1ISN A;  5GOW B;  4DX9 0; 
#chains in the Genus database with same CATH homology
 2CAY A;  1XX0 A;  3TFM A;  1QQG A;  3A98 B;  3KZ1 A;  1PFJ A;  5JLJ B;  1U5G A;  4K2O A;  3G9W A;  1TJ6 A;  2OQB A;  2LKO A;  3HK0 A;  3PZD A;  2K00 A;  1FGZ A;  4NY0 A;  1M7E A;  4ZRJ A;  2COD A;  1UNR A;  3KRX A;  2EMS A;  1ZM0 A;  1B55 A;  3A8P A;  1V5M A;  2R0D A;  1AQC A;  4EMO A;  4C0A A;  2DN6 A;  4HB4 B;  4YON A;  4WJ7 A;  1DDM A;  2W2X C;  3DXD A;  2RGN B;  2D9Y A;  2LG1 A;  5D3W A;  1SGH A;  2VKI A;  1U2B A;  4KHB B;  1J19 A;  4KVG B;  4L6E A;  2D9W A;  1PLS A;  2CY5 A;  1WGU A;  3O96 A;  1E5W A;  1GG3 A;  2VSZ A;  1DDW A;  3GYO A;  3VOQ A;  1TQZ A;  1LW3 A;  3SYX A;  1WJ1 A;  3D8E A;  3P6A A;  2D9X A;  4HB0 B;  3DXC A;  1Y19 B;  2I5C A;  4MT7 A;  1U27 A;  3LJU X;  4HAX B;  1N3H A;  2Z0Q A;  4EJN A;  1H4R A;  2AL6 A;  2P8V A;  3MPX A;  2GS0 A;  4CYE A;  1U29 A;  5C5B A;  2DLW A;  2ROV A;  4A5K A;  3D8F A;  2DKP A;  5CLQ B;  4CHJ A;  2GCL A;  3FSS A;  2LOZ A;  2UZR A;  1DBH A;  4TKN A;  4GMX B;  3UZT A;  1GC7 A;  3TVV A;  2YS3 A;  2ELB A;  1MAI A;  2RVB B;  2Y8F A;  3TW1 A;  5C5B B;  1UNQ A;  4XWX A;  1XCG A;  5C6R A;  4GXB A;  4TYZ A;  1J0W A;  2Z0O A;  2J59 M;  2M38 A;  5C79 A;  3BIN A;  4H8S A;  3D8D A;  1P6S A;  2YVC A;  3ODW A;  2LYD A;  5FI0 A;  3P7Z A;  1FOE A;  2RNR B;  1IRS A;  2GCJ A;  3NSU A;  2XQN M;  2D9V A;  4A6F A;  1ZVR A;  2DHJ A;  2OTX A;  1SHC A;  2DX5 A;  2L2I A;  3TCA A;  4D0N B;  5J3Y A;  3QBV B;  2NMB A;  4P7I A;  5C16 A;  4PQ0 A;  1BTN A;  4HDQ A;  3KSY A;  1V5U A;  2YT0 A;  1H10 A;  2KCJ A;  2MDX A;  3A8Q A;  2DFK A;  3OAN A;  1FHO A;  1WJM A;  2DHK A;  2Z0P A;  4HDO A;  2I5F A;  3MDB C;  3PG7 A;  2DTC A;  3WYF B;  1MIZ B;  2AEH A;  4HAY B;  2CY4 A;  1RRP B;  1KZ7 A;  1PMS A;  1UPQ A;  1FB8 A;  2ADZ A;  5JHH A;  1U5D A;  2BCJ A;  1FHW A;  4KAX B;  1WVH A;  2KUP A;  4GZU A;  1U5F A;  2GJY A;  1NTV A;  1XR0 B;  2DYQ A;  2RUK B;  2DYN A;  4DX8 A;  3ODX A;  2QKL A;  1NTY A;  5J3T A;  1XKE A;  3N7C A;  5KQ4 A;  2KGX B;  2EMT A;  5D3V A;  3IVF A;  2UZS A;  2YS5 A;  4EKU A;  1BWN A;  1X1G A;  1FHX A;  3V5W A;  4Z2M B;  3F5R A;  2ZPY A;  1WI1 A;  2I1J A;  3KY9 A;  2D11 A;  4ZRK A;  4WVF B;  2HE7 A;  2LUL A;  3SNH A;  1LB1 A;  4HAW B;  4CHM A;  2LOX A;  2J0M A;  3SO6 A;  2PZ1 A;  4NSW A;  1KZG A;  1K5G B;  1XOD A;  2E2X A;  2P0F A;  3GYP A;  1W1H A;  3PVW A;  5LON B;  1P5T A;  4A6H A;  2JP2 A;  4DXA B;  4K2P A;  3ULB A;  2L1C A;  2DKQ A;  3ML4 A;  5HE1 A;  2YRY A;  3PSC A;  2Y8G A;  2YT1 A;  5FI1 A;  2YF0 A;  2D2Q A;  4GN1 A;  1I7A A;  3FM8 C;  2NZ8 B;  2W2W A;  5DI9 B;  1OQN A;  1X1F A;  3PVU A;  3SUZ A;  4B6H A;  1Y5O A;  4IFS A;  3QIJ A;  4KHA A;  1OY2 A;  4IOY X;  1BAK A;  5KCV A;  2D9Z A;  1U5E A;  2Y7B A;  3CIK A;  2P0H A;  3RCP A;  3FEH A;  2J0J A;  2IFS A;  3BJI A;  1Q67 A;  1ZC4 B;  2N0Y A;  2YS1 A;  1X05 A;  1XD4 A;  1WGQ A;  2H7E A;  2IYB A;  4F7G A;  3ZVR A;  1FGY A;  1KI1 B;  2VRW B;  5D27 A;  1MIX A;  1RJ2 A;  1MK7 B;  1AWE A;  1FAO A;  2R09 A;  4K17 A;  4A6F B;  1NI2 A;  1K5D B;  2J0K A;  3U8Z A;  4K81 A;  3WA0 A;  4GMV A;  4ZRI A;  2MWN B;  1W1D A;  5KQ1 A;  1DRO A;  2G35 A;  3AU4 A;  2X18 A;  2HTH B;  5HE0 A;  5JHG A;  2I1K A;  5HE2 A;  3HQC A;  3X23 A;  2DA0 A;  2FJL A;  4HAZ B;  1EAZ A;  4HAU B;  2COF A;  3M1I B;  1W1G A;  3SV1 A;  1ZSQ A;  4PNK A;  3AJ4 A;  4IAP A;  4MK0 A;  2DX1 A;  2D4Q A;  4F7H A;  3VIA A;  3ZDT A;  5DHF B;  1MKE A;  1BTK A;  2Q13 A;  2ROZ B;  4KHO A;  1MPH A;  2K2U A;  1Z87 A;  2CRF A;  1M7R A;  2COA A;  1V89 A;  1TXD A;  2QKM A;  1I2H A;  1MK9 B;  3HW2 B;  1UPR A;  2K2J A;  2W2X D;  2MKR A;  5D3Y A;  2H7D A;  4HAV B;  1GC6 A;  5D3X A;  3U7D A;  2ELA A;  4Z2N A;  4HB3 B;  1ZC3 B;  4WSF A;  3KRW A;  5JP4 A;  1X11 A;  3ODO A;  2D10 A;  4A6K A;  1OMW A;  3CXB B;  5EFX A;  2MFQ A;  3PVL A;  2P0D A;  4YL8 A;  4DBB A;  1DYN A;  3F0W A;  1UNP A;  2YSZ A;  3PP2 A;  1V5P A;  4HB2 B;  3TO1 A;  4HHV A;  1V61 A;  1DDV A;  1X86 A;  3AU5 A;  1WG7 A;  5DH9 B;  5J3Q A;  2RSG A;  1EVH A;  1UEF A;  4GPT B;  4BBK A;  2N23 A;  4MY6 A;  2EC1 A;  2UVM A;  4HAT B;  5L81 A;  1V88 A;  5LOP B;  1EF1 A;  1QC6 A;  3PEG A;  2DHI A;  2RLO A;  2EJ8 A;  4Y94 A;  2COC A;  1P3R A;  3T06 A;  1NU2 A;  3DXE A;  1EGX A;  5DHA B;  5CLL B;  3ULC A;  4F7U P;  2M14 A;  5DIF B;  5HE3 A;  2V76 A;  3QWM A;  1ISN A;  5GOW B;  4DX9 0; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...