2RNRB

Solution structure of the complex between tfiie alpha c-terminal acidic domain and tfiih p62 ph domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
108
structure length
108
Chain Sequence
b'MATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKISPEGKAKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription initiation factor IIE subunit alpha
publication title Structural insight into the TFIIE-TFIIH interaction: TFIIE and p53 share the binding region on TFIIH
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 24
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2008-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2rnrB00
1OQNA 2Y7BA 1X1GA 2DLWA 4HAUB 2Y8GA 4NSWA 4WSFA 2ROZB 3DXEA 1X11A 3PG7A 1J0WA 3U7DA 1E5WA 2UZSA 1U5FA 4MK0A 2AL6A 3TO1A 2DA0A 5JLJB 4KHOA 4K2PA 2YSZA 1FHWA 1AWEA 1BAKA 2YF0A 3FSSA 2KUPA 1XODA 2FJLA 1V5PA 1U5GA 5JHGA 2I5FA 4WJ7A 2ADZA 1M7EA 3X23A 4KHBB 3TFMA 4IAPA 1I2HA 2LG1A 2RLOA 3SUZA 1ZC4B 4CHMA 3QBVB 1NTVA 3HQCA 1X05A 2L2IA 2DX5A 1MIXA 3MPXA 1TQZA 2CY4A 2VRWB 2D9XA 2EMSA 2W2XD 1EVHA 1XD4A 2KGXB 2D11A 1FGZA 4DX90 1KI1B 2RNRB 4HB3B 2YT0A 2W2XC 4NY0A 1ZM0A 4MT7A 1K5DB 1XCGA 3FEHA 5C6RA 2OQBA 5C79A 5DI9B 3FM8C 1RJ2A 4GN1A 3P6AA 1Y19B 2DHJA 4PQ0A 3P7ZA 4PNKA 2KCJA 4K2OA 3DXDA 2COCA 1XR0B 4A6FA 2M14A 1GC6A 2ZPYA 1BWNA 2GJYA 3ODXA 4EJNA 1X1FA 5DHAB 4DBBA 2HE7A 3PVUA 5GOWB 4B6HA 3D8EA 3PVWA 2RUKB 2K00A 2MFQA 3KRWA 2N23A 4A6FB 5KCVA 4DXAB 4KHAA 2DTCA 4EMOA 4P7IA 2N0YA 3LJUX 4K81A 3TVVA 1U5EA 3AU5A 3ML4A 4WVFB 5KQ1A 5J3QA 1FGYA 4D0NB 3F5RA 5CLLB 1LB1A 1ZSQA 2VSZA 2RVBB 3SYXA 4YL8A 2LOZA 2L1CA 2P0DA 2GS0A 4IOYX 4GMXB 3ULCA 1H4RA 2DFKA 5FI0A 4ZRIA 3TCAA 2RGNB 4F7HA 1AQCA 1DYNA 4GPTB 3PEGA 2OTXA 3ULBA 2D9VA 2J59M 2R0DA 2LOXA 5EFXA 3KZ1A 2J0MA 4HHVA 4IFSA 2K2JA 3A8PA 1WVHA 2D4QA 5C5BA 1MPHA 1GG3A 2DHKA 1X86A 3N7CA 3T06A 2CY5A 4L6EA 1XKEA 3CXBB 1XX0A 2QKMA 4K17A 3KY9A 2UVMA 1UPRA 1FHXA 2E2XA 5D3YA 2CAYA 3F0WA 2Y8FA 2GCLA 1H10A 2M38A 4HAWB 5DH9B 3CIKA 5C5BB 1P5TA 5LOPB 1EGXA 3PSCA 1B55A 3D8DA 4CYEA 1V5MA 2Z0PA 1WJ1A 1NU2A 3PZDA 3V5WA 3VIAA 1WG7A 1Y5OA 1K5GB 3RCPA 2YT1A 2D9YA 1ZVRA 5HE3A 4HAYB 4HDOA 2EMTA 3MDBC 3DXCA 1OY2A 1WJMA 3UZTA 4KAXB 4DX8A 2UZRA 1V89A 1DDVA 3ODWA 3OANA 1KZ7A 4MY6A 2BCJA 2EC1A 4HB4B 1DDMA 2LULA 4TYZA 2P0HA 1UNPA 1FOEA 3M1IB 2CODA 2I5CA 2DKQA 2J0KA 2H7DA 1V88A 3D8FA 4HAVB 1J19A 5JHHA 2W2WA 4Z2NA 1MAIA 4XWXA 2YVCA 2MKRA 2LKOA 1OMWA 5L81A 1I7AA 4A6KA 4Y94A 2I1JA 1UEFA 4HAZB 1WGQA 2CRFA 4KVGB 1EF1A 1NI2A 1BTKA 2PZ1A 4GMVA 2XQNM 4CHJA 2X18A 1U27A 2ROVA 5C16A 2YS3A 2Z0QA 1W1GA 3PVLA 2GCJA 5HE2A 1QC6A 5KQ4A 3AJ4A 3HK0A 4HAXB 2QKLA 1FB8A 2DX1A 5D3XA 2YS1A 3SNHA 1V5UA 2ELAA 2K2UA 3AU4A 3KSYA 2P8VA 3QIJA 1KZGA 4A6HA 1ISNA 5JP4A 2Z0OA 4ZRJA 5J3YA 2LYDA 5DIFB 1FAOA 3GYPA 1RRPB 3VOQA 1FHOA 4Z2MB 4F7GA 1UNQA 4C0AA 1LW3A 2MWNB 2G35A 3ZDTA 1SGHA 2IFSA 5D27A 3KRXA 3IVFA 2COAA 1ZC3B 3ODOA 1U5DA 2H7EA 1PMSA 1NTYA 5D3WA 1MKEA 4A5KA 1WGUA 2AEHA 2DYQA 3SO6A 4YONA 1GC7A 4F7UP 1P3RA 1QQGA 2COFA 1Z87A 1Q67A 2IYBA 1TXDA 3SV1A 4GZUA 1MIZB 2YRYA 4ZRKA 2R09A 2HTHB 1MK9B 5CLQB 1SHCA 2DKPA 2P0FA 1MK7B 3QWMA 1W1HA 3A98B 3NSUA 1M7RA 5DHFB 1U2BA 2MDXA 1UNRA 5D3VA 2ELBA 3TW1A 2VKIA 2EJ8A 1PLSA 1EAZA 3ZVRA 5HE0A 1BTNA 3GYOA 1WI1A 4GXBA 2V76A 2Q13A 1P6SA 2RSGA 4HATB 3A8QA 1DROA 1UPQA 2DHIA 3BINA 3O96A 1DDWA 3U8ZA 1N3HA 2I1KA 1U29A 2D9WA 4HB2B 3HW2B 5LONB 2DN6A 1IRSA 2DYNA 3G9WA 2YS5A 2D2QA 1DBHA 1PFJA 3WYFB 1V61A 2NZ8B 4EKUA 4TKNA 3BJIA 3PP2A 5FI1A 5J3TA 2NMBA 4HB0B 2D9ZA 1TJ6A 4BBKA 2J0JA 5HE1A 4HDQA 2JP2A 3WA0A 4H8SA 1W1DA 2D10A
chains in the Genus database with same CATH superfamily
3OHMB 1OQNA 2Y7BA 1X1GA 2DLWA 4HAUB 2Y8GA 4NSWA 4WSFA 2ROZB 3DXEA 1X11A 3PG7A 1J0WA 3U7DA 1E5WA 2UZSA 1U5FA 2K49A 4MK0A 2AL6A 3TO1A 4KHBA 2DA0A 5JLJB 4KHOA 3NW8A 4QXAB 4K2PA 2YSZA 1FHWA 1AWEA 1BAKA 2YF0A 3FSSA 2KUPA 1XODA 2FJLA 1V5PA 1U5GA 2KIGA 5JHGA 2I5FA 4WJ7A 2ADZA 2R2YA 1M7EA 3X23A 4KHBB 3TFMA 4IAPA 1I2HA 2LG1A 2RLOA 3SUZA 5LG4B 1ZC4B 4CHMA 4QJ5B 3QBVB 1NTVA 3HQCA 1X05A 2L2IA 2K8EA 2DX5A 1MIXA 3MPXA 1TQZA 2CY4A 2VRWB 3HIEA 2D9XA 2EMSA 2W2XD 1EVHA 1XD4A 2KGXB 2D11A 1FGZA 2Z4DA 4DX90 1KI1B 2RNRB 4HB3B 2YT0A 2W2XC 4NY0A 1ZM0A 4MT7A 1K5DB 1XCGA 3FEHA 5C6RA 2OQBA 5C79A 5DI9B 3FM8C 1RJ2A 2KR0A 4GN1A 3P6AA 1Y19B 2DHJA 4PQ0A 3P7ZA 4PNKA 2KCJA 4K2OA 3DCXA 3DXDA 2COCA 1XR0B 4A6FA 2M14A 1GC6A 5IRSA 2ZKMX 2ZPYA 1BWNA 2GJYA 3ODXA 4EJNA 2RRFA 1X1FA 5DHAB 1T77A 4DBBA 2HE7A 3PVUA 5GOWB 4B6HA 3D8EA 3PVWA 2RUKB 2K00A 2MFQA 3KRWA 2N23A 4A6FB 5KCVA 4DXAB 4KHAA 2DTCA 4EMOA 4P7IA 2N0YA 3LJUX 4K81A 3TVVA 1U5EA 3AU5A 3ML4A 4WVFB 5KQ1A 5J3QA 1FGYA 3B77A 3F5RA 4D0NB 5CLLB 1LB1A 1ZSQA 2VSZA 2RVBB 3SYXA 4YL8A 2LOZA 2L1CA 2P0DA 2GS0A 4IOYX 4GMXB 3ULCA 1H4RA 2DFKA 5FI0A 4ZRIA 3TCAA 2RGNB 4F7HA 1AQCA 1DYNA 2GUMA 4GPTB 3PEGA 2OTXA 3ULBA 2D9VA 2J59M 2R0DA 2LOXA 5EFXA 3KZ1A 2J0MA 4HHVA 4IFSA 2K2JA 3A8PA 1WVHA 2D4QA 5C5BA 1MPHA 1GG3A 2DHKA 1X86A 3N7CA 3T06A 2CY5A 4L6EA 1XKEA 3CXBB 1XX0A 2QKMA 4K17A 3KY9A 2UVMA 1UPRA 4OT1A 1FHXA 2E2XA 5D3YA 2CAYA 3F0WA 3U12A 2Y8FA 2GCLA 1H10A 2M38A 4HAWB 5DH9B 3CIKA 5C5BB 3NWDA 1P5TA 5LOPB 1EGXA 3PSCA 1B55A 3D8DA 2NBVA 4CYEA 1V5MA 2Z0PA 1WJ1A 1NU2A 3PZDA 3A58A 3V5WA 3VIAA 1WG7A 1Y5OA 1K5GB 3RCPA 2YT1A 2D9YA 1ZVRA 5HE3A 4HAYB 4HDOA 2EMTA 3MDBC 3DXCA 1OY2A 1WJMA 3UZTA 3HSAA 4KAXB 4DX8A 2UZRA 4CSQA 1V89A 2Z13A 1DDVA 3ODWA 3OANA 1KZ7A 4MY6A 2BCJA 2EC1A 4HB4B 1DDMA 2LULA 4TYZA 2P0HA 1UNPA 1FOEA 3M1IB 2CODA 2I5CA 4QJ4B 2DKQA 2J0KA 2H7DA 1V88A 3D8FA 4HAVB 1J19A 5JHHA 2W2WA 2KUQA 4Z2NA 1MAIA 4XWXA 2YVCA 2MKRA 2LKOA 1OMWA 5L81A 1I7AA 4A6KA 4Y94A 2I1JA 1UEFA 4HAZB 4DIXA 2Z14A 1WGQA 2CRFA 1ZYIA 4KVGB 1EF1A 1NI2A 1BTKA 2PZ1A 4GMVA 4HSIA 2XQNM 4CHJA 2X18A 1U27A 2ROVA 5C16A 2YS3A 2Z0QA 1W1GA 3PVLA 2GCJA 5HE2A 1QC6A 2Z59A 5KQ4A 3AJ4A 3HK0A 4HAXB 2QKLA 1FB8A 2DX1A 5D3XA 5I2SA 2YS1A 3SNHA 1V5UA 2ELAA 2K2UA 3AU4A 3KSYA 2P8VA 3QIJA 1KZGA 4A6HA 1ISNA 5JP4A 2Z0OA 4ZRJA 4GOUA 5J3YA 2LYDA 5DIFB 1FAOA 3GYPA 1RRPB 3FVCA 3VOQA 1FHOA 4Z2MB 4F7GA 1UNQA 4C0AA 1LW3A 2MWNB 2G35A 3ZDTA 1SGHA 2IFSA 5D27A 4D6WA 3KRXA 1MI1A 3IVFA 3NWAA 2COAA 1ZC3B 3ODOA 1U5DA 2H7EA 1PMSA 1NTYA 5D3WA 1MKEA 4OSNA 4A5KA 1WGUA 2AEHA 2DYQA 3SO6A 4YONA 1GC7A 4F7UP 1P3RA 1QQGA 2KIEA 2COFA 1Z87A 1Q67A 2IYBA 1TXDA 3SV1A 3NWFA 4GZUA 1MIZB 2YRYA 4ZRKA 2R09A 2HTHB 1MK9B 5CLQB 1SHCA 2DKPA 2P0FA 4QJ3B 1MK7B 3QWMA 1W1HA 3A98B 3NSUA 1M7RA 5DHFB 1U2BA 2MDXA 1UNRA 5D3VA 2ELBA 3TW1A 2VKIA 2EJ8A 1PLSA 2FJUB 1EAZA 3ZVRA 5HE0A 1BTNA 3GYOA 1WI1A 4GXBA 2V76A 2Q13A 1P6SA 2RSGA 4HATB 3A8QA 1DROA 1UPQA 2DHIA 3BINA 3O96A 4GNKB 1DDWA 3U8ZA 5I2MA 1N3HA 2I1KA 1U29A 2D9WA 4HB2B 3HW2B 5LONB 4L1RA 5M4YB 2DN6A 1IRSA 2DYNA 3G9WA 2YS5A 2D2QA 1DBHA 1PFJA 3WYFB 1V61A 2NZ8B 4EKUA 4TKNA 3BJIA 3PP2A 5FI1A 5J3TA 2NMBA 4HB0B 2D9ZA 1TJ6A 4BBKA 2J0JA 5HE1A 4HDQA 2JP2A 3WA0A 4H8SA 1W1DA 2D10A 2YT2A
chains in the Genus database with same CATH topology
1OQNA 2Y7BA 1X1GA 2DLWA 4HAUB 2Y8GA 4NSWA 4WSFA 2ROZB 3DXEA 1X11A 3PG7A 1J0WA 3U7DA 1E5WA 2UZSA 1U5FA 4MK0A 2AL6A 3TO1A 2DA0A 5JLJB 4KHOA 4K2PA 2YSZA 1FHWA 1AWEA 1BAKA 2YF0A 3FSSA 2KUPA 1XODA 2FJLA 1V5PA 1U5GA 5JHGA 2I5FA 4WJ7A 2ADZA 1M7EA 3X23A 4KHBB 3TFMA 4IAPA 1I2HA 2LG1A 2RLOA 3SUZA 1ZC4B 4CHMA 3QBVB 1NTVA 3HQCA 1X05A 2L2IA 2DX5A 1MIXA 3MPXA 1TQZA 2CY4A 2VRWB 2D9XA 2EMSA 2W2XD 1EVHA 1XD4A 2KGXB 2D11A 1FGZA 4DX90 1KI1B 2RNRB 4HB3B 2YT0A 2W2XC 4NY0A 1ZM0A 4MT7A 1K5DB 1XCGA 3FEHA 5C6RA 2OQBA 5C79A 5DI9B 3FM8C 1RJ2A 4GN1A 3P6AA 1Y19B 2DHJA 4PQ0A 3P7ZA 4PNKA 2KCJA 4K2OA 3DXDA 2COCA 1XR0B 4A6FA 2M14A 1GC6A 2ZPYA 1BWNA 2GJYA 3ODXA 4EJNA 1X1FA 5DHAB 4DBBA 2HE7A 3PVUA 5GOWB 4B6HA 3D8EA 3PVWA 2RUKB 2K00A 2MFQA 3KRWA 2N23A 4A6FB 5KCVA 4DXAB 4KHAA 2DTCA 4EMOA 4P7IA 2N0YA 3LJUX 4K81A 3TVVA 1U5EA 3AU5A 3ML4A 4WVFB 5KQ1A 5J3QA 1FGYA 4D0NB 3F5RA 5CLLB 1LB1A 1ZSQA 2VSZA 2RVBB 3SYXA 4YL8A 2LOZA 2L1CA 2P0DA 2GS0A 4IOYX 4GMXB 3ULCA 1H4RA 2DFKA 5FI0A 4ZRIA 3TCAA 2RGNB 4F7HA 1AQCA 1DYNA 4GPTB 3PEGA 2OTXA 3ULBA 2D9VA 2J59M 2R0DA 2LOXA 5EFXA 3KZ1A 2J0MA 4HHVA 4IFSA 2K2JA 3A8PA 1WVHA 2D4QA 5C5BA 1MPHA 1GG3A 2DHKA 1X86A 3N7CA 3T06A 2CY5A 4L6EA 1XKEA 3CXBB 1XX0A 2QKMA 4K17A 3KY9A 2UVMA 1UPRA 1FHXA 2E2XA 5D3YA 2CAYA 3F0WA 2Y8FA 2GCLA 1H10A 2M38A 4HAWB 5DH9B 3CIKA 5C5BB 1P5TA 5LOPB 1EGXA 3PSCA 1B55A 3D8DA 4CYEA 1V5MA 2Z0PA 1WJ1A 1NU2A 3PZDA 3V5WA 3VIAA 1WG7A 1Y5OA 1K5GB 3RCPA 2YT1A 2D9YA 1ZVRA 5HE3A 4HAYB 4HDOA 2EMTA 3MDBC 3DXCA 1OY2A 1WJMA 3UZTA 4KAXB 4DX8A 2UZRA 1V89A 1DDVA 3ODWA 3OANA 1KZ7A 4MY6A 2BCJA 2EC1A 4HB4B 1DDMA 2LULA 4TYZA 2P0HA 1UNPA 1FOEA 3M1IB 2CODA 2I5CA 2DKQA 2J0KA 2H7DA 1V88A 3D8FA 4HAVB 1J19A 5JHHA 2W2WA 4Z2NA 1MAIA 4XWXA 2YVCA 2MKRA 2LKOA 1OMWA 5L81A 1I7AA 4A6KA 4Y94A 2I1JA 1UEFA 4HAZB 1WGQA 2CRFA 4KVGB 1EF1A 1NI2A 1BTKA 2PZ1A 4GMVA 2XQNM 4CHJA 2X18A 1U27A 2ROVA 5C16A 2YS3A 2Z0QA 1W1GA 3PVLA 2GCJA 5HE2A 1QC6A 5KQ4A 3AJ4A 3HK0A 4HAXB 2QKLA 1FB8A 2DX1A 5D3XA 2YS1A 3SNHA 1V5UA 2ELAA 2K2UA 3AU4A 3KSYA 2P8VA 3QIJA 1KZGA 4A6HA 1ISNA 5JP4A 2Z0OA 4ZRJA 5J3YA 2LYDA 5DIFB 1FAOA 3GYPA 1RRPB 3VOQA 1FHOA 4Z2MB 4F7GA 1UNQA 4C0AA 1LW3A 2MWNB 2G35A 3ZDTA 1SGHA 2IFSA 5D27A 3KRXA 3IVFA 2COAA 1ZC3B 3ODOA 1U5DA 2H7EA 1PMSA 1NTYA 5D3WA 1MKEA 4A5KA 1WGUA 2AEHA 2DYQA 3SO6A 4YONA 1GC7A 4F7UP 1P3RA 1QQGA 2COFA 1Z87A 1Q67A 2IYBA 1TXDA 3SV1A 4GZUA 1MIZB 2YRYA 4ZRKA 2R09A 2HTHB 1MK9B 5CLQB 1SHCA 2DKPA 2P0FA 1MK7B 3QWMA 1W1HA 3A98B 3NSUA 1M7RA 5DHFB 1U2BA 2MDXA 1UNRA 5D3VA 2ELBA 3TW1A 2VKIA 2EJ8A 1PLSA 1EAZA 3ZVRA 5HE0A 1BTNA 3GYOA 1WI1A 4GXBA 2V76A 2Q13A 1P6SA 2RSGA 4HATB 3A8QA 1DROA 1UPQA 2DHIA 3BINA 3O96A 1DDWA 3U8ZA 1N3HA 2I1KA 1U29A 2D9WA 4HB2B 3HW2B 5LONB 2DN6A 1IRSA 2DYNA 3G9WA 2YS5A 2D2QA 1DBHA 1PFJA 3WYFB 1V61A 2NZ8B 4EKUA 4TKNA 3BJIA 3PP2A 5FI1A 5J3TA 2NMBA 4HB0B 2D9ZA 1TJ6A 4BBKA 2J0JA 5HE1A 4HDQA 2JP2A 3WA0A 4H8SA 1W1DA 2D10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OQN A;  2Y7B A;  1X1G A;  2DLW A;  4HAU B;  2Y8G A;  4NSW A;  4WSF A;  2ROZ B;  3DXE A;  1X11 A;  3PG7 A;  1J0W A;  3U7D A;  1E5W A;  2UZS A;  1U5F A;  4MK0 A;  2AL6 A;  3TO1 A;  2DA0 A;  5JLJ B;  4KHO A;  4K2P A;  2YSZ A;  1FHW A;  1AWE A;  1BAK A;  2YF0 A;  3FSS A;  2KUP A;  1XOD A;  2FJL A;  1V5P A;  1U5G A;  5JHG A;  2I5F A;  4WJ7 A;  2ADZ A;  1M7E A;  3X23 A;  4KHB B;  3TFM A;  4IAP A;  1I2H A;  2LG1 A;  2RLO A;  3SUZ A;  1ZC4 B;  4CHM A;  3QBV B;  1NTV A;  3HQC A;  1X05 A;  2L2I A;  2DX5 A;  1MIX A;  3MPX A;  1TQZ A;  2CY4 A;  2VRW B;  2D9X A;  2EMS A;  2W2X D;  1EVH A;  1XD4 A;  2KGX B;  2D11 A;  1FGZ A;  4DX9 0;  1KI1 B;  2RNR B;  4HB3 B;  2YT0 A;  2W2X C;  4NY0 A;  1ZM0 A;  4MT7 A;  1K5D B;  1XCG A;  3FEH A;  5C6R A;  2OQB A;  5C79 A;  5DI9 B;  3FM8 C;  1RJ2 A;  4GN1 A;  3P6A A;  1Y19 B;  2DHJ A;  4PQ0 A;  3P7Z A;  4PNK A;  2KCJ A;  4K2O A;  3DXD A;  2COC A;  1XR0 B;  4A6F A;  2M14 A;  1GC6 A;  2ZPY A;  1BWN A;  2GJY A;  3ODX A;  4EJN A;  1X1F A;  5DHA B;  4DBB A;  2HE7 A;  3PVU A;  5GOW B;  4B6H A;  3D8E A;  3PVW A;  2RUK B;  2K00 A;  2MFQ A;  3KRW A;  2N23 A;  4A6F B;  5KCV A;  4DXA B;  4KHA A;  2DTC A;  4EMO A;  4P7I A;  2N0Y A;  3LJU X;  4K81 A;  3TVV A;  1U5E A;  3AU5 A;  3ML4 A;  4WVF B;  5KQ1 A;  5J3Q A;  1FGY A;  4D0N B;  3F5R A;  5CLL B;  1LB1 A;  1ZSQ A;  2VSZ A;  2RVB B;  3SYX A;  4YL8 A;  2LOZ A;  2L1C A;  2P0D A;  2GS0 A;  4IOY X;  4GMX B;  3ULC A;  1H4R A;  2DFK A;  5FI0 A;  4ZRI A;  3TCA A;  2RGN B;  4F7H A;  1AQC A;  1DYN A;  4GPT B;  3PEG A;  2OTX A;  3ULB A;  2D9V A;  2J59 M;  2R0D A;  2LOX A;  5EFX A;  3KZ1 A;  2J0M A;  4HHV A;  4IFS A;  2K2J A;  3A8P A;  1WVH A;  2D4Q A;  5C5B A;  1MPH A;  1GG3 A;  2DHK A;  1X86 A;  3N7C A;  3T06 A;  2CY5 A;  4L6E A;  1XKE A;  3CXB B;  1XX0 A;  2QKM A;  4K17 A;  3KY9 A;  2UVM A;  1UPR A;  1FHX A;  2E2X A;  5D3Y A;  2CAY A;  3F0W A;  2Y8F A;  2GCL A;  1H10 A;  2M38 A;  4HAW B;  5DH9 B;  3CIK A;  5C5B B;  1P5T A;  5LOP B;  1EGX A;  3PSC A;  1B55 A;  3D8D A;  4CYE A;  1V5M A;  2Z0P A;  1WJ1 A;  1NU2 A;  3PZD A;  3V5W A;  3VIA A;  1WG7 A;  1Y5O A;  1K5G B;  3RCP A;  2YT1 A;  2D9Y A;  1ZVR A;  5HE3 A;  4HAY B;  4HDO A;  2EMT A;  3MDB C;  3DXC A;  1OY2 A;  1WJM A;  3UZT A;  4KAX B;  4DX8 A;  2UZR A;  1V89 A;  1DDV A;  3ODW A;  3OAN A;  1KZ7 A;  4MY6 A;  2BCJ A;  2EC1 A;  4HB4 B;  1DDM A;  2LUL A;  4TYZ A;  2P0H A;  1UNP A;  1FOE A;  3M1I B;  2COD A;  2I5C A;  2DKQ A;  2J0K A;  2H7D A;  1V88 A;  3D8F A;  4HAV B;  1J19 A;  5JHH A;  2W2W A;  4Z2N A;  1MAI A;  4XWX A;  2YVC A;  2MKR A;  2LKO A;  1OMW A;  5L81 A;  1I7A A;  4A6K A;  4Y94 A;  2I1J A;  1UEF A;  4HAZ B;  1WGQ A;  2CRF A;  4KVG B;  1EF1 A;  1NI2 A;  1BTK A;  2PZ1 A;  4GMV A;  2XQN M;  4CHJ A;  2X18 A;  1U27 A;  2ROV A;  5C16 A;  2YS3 A;  2Z0Q A;  1W1G A;  3PVL A;  2GCJ A;  5HE2 A;  1QC6 A;  5KQ4 A;  3AJ4 A;  3HK0 A;  4HAX B;  2QKL A;  1FB8 A;  2DX1 A;  5D3X A;  2YS1 A;  3SNH A;  1V5U A;  2ELA A;  2K2U A;  3AU4 A;  3KSY A;  2P8V A;  3QIJ A;  1KZG A;  4A6H A;  1ISN A;  5JP4 A;  2Z0O A;  4ZRJ A;  5J3Y A;  2LYD A;  5DIF B;  1FAO A;  3GYP A;  1RRP B;  3VOQ A;  1FHO A;  4Z2M B;  4F7G A;  1UNQ A;  4C0A A;  1LW3 A;  2MWN B;  2G35 A;  3ZDT A;  1SGH A;  2IFS A;  5D27 A;  3KRX A;  3IVF A;  2COA A;  1ZC3 B;  3ODO A;  1U5D A;  2H7E A;  1PMS A;  1NTY A;  5D3W A;  1MKE A;  4A5K A;  1WGU A;  2AEH A;  2DYQ A;  3SO6 A;  4YON A;  1GC7 A;  4F7U P;  1P3R A;  1QQG A;  2COF A;  1Z87 A;  1Q67 A;  2IYB A;  1TXD A;  3SV1 A;  4GZU A;  1MIZ B;  2YRY A;  4ZRK A;  2R09 A;  2HTH B;  1MK9 B;  5CLQ B;  1SHC A;  2DKP A;  2P0F A;  1MK7 B;  3QWM A;  1W1H A;  3A98 B;  3NSU A;  1M7R A;  5DHF B;  1U2B A;  2MDX A;  1UNR A;  5D3V A;  2ELB A;  3TW1 A;  2VKI A;  2EJ8 A;  1PLS A;  1EAZ A;  3ZVR A;  5HE0 A;  1BTN A;  3GYO A;  1WI1 A;  4GXB A;  2V76 A;  2Q13 A;  1P6S A;  2RSG A;  4HAT B;  3A8Q A;  1DRO A;  1UPQ A;  2DHI A;  3BIN A;  3O96 A;  1DDW A;  3U8Z A;  1N3H A;  2I1K A;  1U29 A;  2D9W A;  4HB2 B;  3HW2 B;  5LON B;  2DN6 A;  1IRS A;  2DYN A;  3G9W A;  2YS5 A;  2D2Q A;  1DBH A;  1PFJ A;  3WYF B;  1V61 A;  2NZ8 B;  4EKU A;  4TKN A;  3BJI A;  3PP2 A;  5FI1 A;  5J3T A;  2NMB A;  4HB0 B;  2D9Z A;  1TJ6 A;  4BBK A;  2J0J A;  5HE1 A;  4HDQ A;  2JP2 A;  3WA0 A;  4H8S A;  1W1D A;  2D10 A; 
#chains in the Genus database with same CATH topology
 3OHM B;  1OQN A;  2Y7B A;  1X1G A;  2DLW A;  4HAU B;  2Y8G A;  4NSW A;  4WSF A;  2ROZ B;  3DXE A;  1X11 A;  3PG7 A;  1J0W A;  3U7D A;  1E5W A;  2UZS A;  1U5F A;  2K49 A;  4MK0 A;  2AL6 A;  3TO1 A;  4KHB A;  2DA0 A;  5JLJ B;  4KHO A;  3NW8 A;  4QXA B;  4K2P A;  2YSZ A;  1FHW A;  1AWE A;  1BAK A;  2YF0 A;  3FSS A;  2KUP A;  1XOD A;  2FJL A;  1V5P A;  1U5G A;  2KIG A;  5JHG A;  2I5F A;  4WJ7 A;  2ADZ A;  2R2Y A;  1M7E A;  3X23 A;  4KHB B;  3TFM A;  4IAP A;  1I2H A;  2LG1 A;  2RLO A;  3SUZ A;  5LG4 B;  1ZC4 B;  4CHM A;  4QJ5 B;  3QBV B;  1NTV A;  3HQC A;  1X05 A;  2L2I A;  2K8E A;  2DX5 A;  1MIX A;  3MPX A;  1TQZ A;  2CY4 A;  2VRW B;  3HIE A;  2D9X A;  2EMS A;  2W2X D;  1EVH A;  1XD4 A;  2KGX B;  2D11 A;  1FGZ A;  2Z4D A;  4DX9 0;  1KI1 B;  2RNR B;  4HB3 B;  2YT0 A;  2W2X C;  4NY0 A;  1ZM0 A;  4MT7 A;  1K5D B;  1XCG A;  3FEH A;  5C6R A;  2OQB A;  5C79 A;  5DI9 B;  3FM8 C;  1RJ2 A;  2KR0 A;  4GN1 A;  3P6A A;  1Y19 B;  2DHJ A;  4PQ0 A;  3P7Z A;  4PNK A;  2KCJ A;  4K2O A;  3DCX A;  3DXD A;  2COC A;  1XR0 B;  4A6F A;  2M14 A;  1GC6 A;  5IRS A;  2ZKM X;  2ZPY A;  1BWN A;  2GJY A;  3ODX A;  4EJN A;  2RRF A;  1X1F A;  5DHA B;  1T77 A;  4DBB A;  2HE7 A;  3PVU A;  5GOW B;  4B6H A;  3D8E A;  3PVW A;  2RUK B;  2K00 A;  2MFQ A;  3KRW A;  2N23 A;  4A6F B;  5KCV A;  4DXA B;  4KHA A;  2DTC A;  4EMO A;  4P7I A;  2N0Y A;  3LJU X;  4K81 A;  3TVV A;  1U5E A;  3AU5 A;  3ML4 A;  4WVF B;  5KQ1 A;  5J3Q A;  1FGY A;  3B77 A;  3F5R A;  4D0N B;  5CLL B;  1LB1 A;  1ZSQ A;  2VSZ A;  2RVB B;  3SYX A;  4YL8 A;  2LOZ A;  2L1C A;  2P0D A;  2GS0 A;  4IOY X;  4GMX B;  3ULC A;  1H4R A;  2DFK A;  5FI0 A;  4ZRI A;  3TCA A;  2RGN B;  4F7H A;  1AQC A;  1DYN A;  2GUM A;  4GPT B;  3PEG A;  2OTX A;  3ULB A;  2D9V A;  2J59 M;  2R0D A;  2LOX A;  5EFX A;  3KZ1 A;  2J0M A;  4HHV A;  4IFS A;  2K2J A;  3A8P A;  1WVH A;  2D4Q A;  5C5B A;  1MPH A;  1GG3 A;  2DHK A;  1X86 A;  3N7C A;  3T06 A;  2CY5 A;  4L6E A;  1XKE A;  3CXB B;  1XX0 A;  2QKM A;  4K17 A;  3KY9 A;  2UVM A;  1UPR A;  4OT1 A;  1FHX A;  2E2X A;  5D3Y A;  2CAY A;  3F0W A;  3U12 A;  2Y8F A;  2GCL A;  1H10 A;  2M38 A;  4HAW B;  5DH9 B;  3CIK A;  5C5B B;  3NWD A;  1P5T A;  5LOP B;  1EGX A;  3PSC A;  1B55 A;  3D8D A;  2NBV A;  4CYE A;  1V5M A;  2Z0P A;  1WJ1 A;  1NU2 A;  3PZD A;  3A58 A;  3V5W A;  3VIA A;  1WG7 A;  1Y5O A;  1K5G B;  3RCP A;  2YT1 A;  2D9Y A;  1ZVR A;  5HE3 A;  4HAY B;  4HDO A;  2EMT A;  3MDB C;  3DXC A;  1OY2 A;  1WJM A;  3UZT A;  3HSA A;  4KAX B;  4DX8 A;  2UZR A;  4CSQ A;  1V89 A;  2Z13 A;  1DDV A;  3ODW A;  3OAN A;  1KZ7 A;  4MY6 A;  2BCJ A;  2EC1 A;  4HB4 B;  1DDM A;  2LUL A;  4TYZ A;  2P0H A;  1UNP A;  1FOE A;  3M1I B;  2COD A;  2I5C A;  4QJ4 B;  2DKQ A;  2J0K A;  2H7D A;  1V88 A;  3D8F A;  4HAV B;  1J19 A;  5JHH A;  2W2W A;  2KUQ A;  4Z2N A;  1MAI A;  4XWX A;  2YVC A;  2MKR A;  2LKO A;  1OMW A;  5L81 A;  1I7A A;  4A6K A;  4Y94 A;  2I1J A;  1UEF A;  4HAZ B;  4DIX A;  2Z14 A;  1WGQ A;  2CRF A;  1ZYI A;  4KVG B;  1EF1 A;  1NI2 A;  1BTK A;  2PZ1 A;  4GMV A;  4HSI A;  2XQN M;  4CHJ A;  2X18 A;  1U27 A;  2ROV A;  5C16 A;  2YS3 A;  2Z0Q A;  1W1G A;  3PVL A;  2GCJ A;  5HE2 A;  1QC6 A;  2Z59 A;  5KQ4 A;  3AJ4 A;  3HK0 A;  4HAX B;  2QKL A;  1FB8 A;  2DX1 A;  5D3X A;  5I2S A;  2YS1 A;  3SNH A;  1V5U A;  2ELA A;  2K2U A;  3AU4 A;  3KSY A;  2P8V A;  3QIJ A;  1KZG A;  4A6H A;  1ISN A;  5JP4 A;  2Z0O A;  4ZRJ A;  4GOU A;  5J3Y A;  2LYD A;  5DIF B;  1FAO A;  3GYP A;  1RRP B;  3FVC A;  3VOQ A;  1FHO A;  4Z2M B;  4F7G A;  1UNQ A;  4C0A A;  1LW3 A;  2MWN B;  2G35 A;  3ZDT A;  1SGH A;  2IFS A;  5D27 A;  4D6W A;  3KRX A;  1MI1 A;  3IVF A;  3NWA A;  2COA A;  1ZC3 B;  3ODO A;  1U5D A;  2H7E A;  1PMS A;  1NTY A;  5D3W A;  1MKE A;  4OSN A;  4A5K A;  1WGU A;  2AEH A;  2DYQ A;  3SO6 A;  4YON A;  1GC7 A;  4F7U P;  1P3R A;  1QQG A;  2KIE A;  2COF A;  1Z87 A;  1Q67 A;  2IYB A;  1TXD A;  3SV1 A;  3NWF A;  4GZU A;  1MIZ B;  2YRY A;  4ZRK A;  2R09 A;  2HTH B;  1MK9 B;  5CLQ B;  1SHC A;  2DKP A;  2P0F A;  4QJ3 B;  1MK7 B;  3QWM A;  1W1H A;  3A98 B;  3NSU A;  1M7R A;  5DHF B;  1U2B A;  2MDX A;  1UNR A;  5D3V A;  2ELB A;  3TW1 A;  2VKI A;  2EJ8 A;  1PLS A;  2FJU B;  1EAZ A;  3ZVR A;  5HE0 A;  1BTN A;  3GYO A;  1WI1 A;  4GXB A;  2V76 A;  2Q13 A;  1P6S A;  2RSG A;  4HAT B;  3A8Q A;  1DRO A;  1UPQ A;  2DHI A;  3BIN A;  3O96 A;  4GNK B;  1DDW A;  3U8Z A;  5I2M A;  1N3H A;  2I1K A;  1U29 A;  2D9W A;  4HB2 B;  3HW2 B;  5LON B;  4L1R A;  5M4Y B;  2DN6 A;  1IRS A;  2DYN A;  3G9W A;  2YS5 A;  2D2Q A;  1DBH A;  1PFJ A;  3WYF B;  1V61 A;  2NZ8 B;  4EKU A;  4TKN A;  3BJI A;  3PP2 A;  5FI1 A;  5J3T A;  2NMB A;  4HB0 B;  2D9Z A;  1TJ6 A;  4BBK A;  2J0J A;  5HE1 A;  4HDQ A;  2JP2 A;  3WA0 A;  4H8S A;  1W1D A;  2D10 A;  2YT2 A; 
#chains in the Genus database with same CATH homology
 1OQN A;  2Y7B A;  1X1G A;  2DLW A;  4HAU B;  2Y8G A;  4NSW A;  4WSF A;  2ROZ B;  3DXE A;  1X11 A;  3PG7 A;  1J0W A;  3U7D A;  1E5W A;  2UZS A;  1U5F A;  4MK0 A;  2AL6 A;  3TO1 A;  2DA0 A;  5JLJ B;  4KHO A;  4K2P A;  2YSZ A;  1FHW A;  1AWE A;  1BAK A;  2YF0 A;  3FSS A;  2KUP A;  1XOD A;  2FJL A;  1V5P A;  1U5G A;  5JHG A;  2I5F A;  4WJ7 A;  2ADZ A;  1M7E A;  3X23 A;  4KHB B;  3TFM A;  4IAP A;  1I2H A;  2LG1 A;  2RLO A;  3SUZ A;  1ZC4 B;  4CHM A;  3QBV B;  1NTV A;  3HQC A;  1X05 A;  2L2I A;  2DX5 A;  1MIX A;  3MPX A;  1TQZ A;  2CY4 A;  2VRW B;  2D9X A;  2EMS A;  2W2X D;  1EVH A;  1XD4 A;  2KGX B;  2D11 A;  1FGZ A;  4DX9 0;  1KI1 B;  2RNR B;  4HB3 B;  2YT0 A;  2W2X C;  4NY0 A;  1ZM0 A;  4MT7 A;  1K5D B;  1XCG A;  3FEH A;  5C6R A;  2OQB A;  5C79 A;  5DI9 B;  3FM8 C;  1RJ2 A;  4GN1 A;  3P6A A;  1Y19 B;  2DHJ A;  4PQ0 A;  3P7Z A;  4PNK A;  2KCJ A;  4K2O A;  3DXD A;  2COC A;  1XR0 B;  4A6F A;  2M14 A;  1GC6 A;  2ZPY A;  1BWN A;  2GJY A;  3ODX A;  4EJN A;  1X1F A;  5DHA B;  4DBB A;  2HE7 A;  3PVU A;  5GOW B;  4B6H A;  3D8E A;  3PVW A;  2RUK B;  2K00 A;  2MFQ A;  3KRW A;  2N23 A;  4A6F B;  5KCV A;  4DXA B;  4KHA A;  2DTC A;  4EMO A;  4P7I A;  2N0Y A;  3LJU X;  4K81 A;  3TVV A;  1U5E A;  3AU5 A;  3ML4 A;  4WVF B;  5KQ1 A;  5J3Q A;  1FGY A;  4D0N B;  3F5R A;  5CLL B;  1LB1 A;  1ZSQ A;  2VSZ A;  2RVB B;  3SYX A;  4YL8 A;  2LOZ A;  2L1C A;  2P0D A;  2GS0 A;  4IOY X;  4GMX B;  3ULC A;  1H4R A;  2DFK A;  5FI0 A;  4ZRI A;  3TCA A;  2RGN B;  4F7H A;  1AQC A;  1DYN A;  4GPT B;  3PEG A;  2OTX A;  3ULB A;  2D9V A;  2J59 M;  2R0D A;  2LOX A;  5EFX A;  3KZ1 A;  2J0M A;  4HHV A;  4IFS A;  2K2J A;  3A8P A;  1WVH A;  2D4Q A;  5C5B A;  1MPH A;  1GG3 A;  2DHK A;  1X86 A;  3N7C A;  3T06 A;  2CY5 A;  4L6E A;  1XKE A;  3CXB B;  1XX0 A;  2QKM A;  4K17 A;  3KY9 A;  2UVM A;  1UPR A;  1FHX A;  2E2X A;  5D3Y A;  2CAY A;  3F0W A;  2Y8F A;  2GCL A;  1H10 A;  2M38 A;  4HAW B;  5DH9 B;  3CIK A;  5C5B B;  1P5T A;  5LOP B;  1EGX A;  3PSC A;  1B55 A;  3D8D A;  4CYE A;  1V5M A;  2Z0P A;  1WJ1 A;  1NU2 A;  3PZD A;  3V5W A;  3VIA A;  1WG7 A;  1Y5O A;  1K5G B;  3RCP A;  2YT1 A;  2D9Y A;  1ZVR A;  5HE3 A;  4HAY B;  4HDO A;  2EMT A;  3MDB C;  3DXC A;  1OY2 A;  1WJM A;  3UZT A;  4KAX B;  4DX8 A;  2UZR A;  1V89 A;  1DDV A;  3ODW A;  3OAN A;  1KZ7 A;  4MY6 A;  2BCJ A;  2EC1 A;  4HB4 B;  1DDM A;  2LUL A;  4TYZ A;  2P0H A;  1UNP A;  1FOE A;  3M1I B;  2COD A;  2I5C A;  2DKQ A;  2J0K A;  2H7D A;  1V88 A;  3D8F A;  4HAV B;  1J19 A;  5JHH A;  2W2W A;  4Z2N A;  1MAI A;  4XWX A;  2YVC A;  2MKR A;  2LKO A;  1OMW A;  5L81 A;  1I7A A;  4A6K A;  4Y94 A;  2I1J A;  1UEF A;  4HAZ B;  1WGQ A;  2CRF A;  4KVG B;  1EF1 A;  1NI2 A;  1BTK A;  2PZ1 A;  4GMV A;  2XQN M;  4CHJ A;  2X18 A;  1U27 A;  2ROV A;  5C16 A;  2YS3 A;  2Z0Q A;  1W1G A;  3PVL A;  2GCJ A;  5HE2 A;  1QC6 A;  5KQ4 A;  3AJ4 A;  3HK0 A;  4HAX B;  2QKL A;  1FB8 A;  2DX1 A;  5D3X A;  2YS1 A;  3SNH A;  1V5U A;  2ELA A;  2K2U A;  3AU4 A;  3KSY A;  2P8V A;  3QIJ A;  1KZG A;  4A6H A;  1ISN A;  5JP4 A;  2Z0O A;  4ZRJ A;  5J3Y A;  2LYD A;  5DIF B;  1FAO A;  3GYP A;  1RRP B;  3VOQ A;  1FHO A;  4Z2M B;  4F7G A;  1UNQ A;  4C0A A;  1LW3 A;  2MWN B;  2G35 A;  3ZDT A;  1SGH A;  2IFS A;  5D27 A;  3KRX A;  3IVF A;  2COA A;  1ZC3 B;  3ODO A;  1U5D A;  2H7E A;  1PMS A;  1NTY A;  5D3W A;  1MKE A;  4A5K A;  1WGU A;  2AEH A;  2DYQ A;  3SO6 A;  4YON A;  1GC7 A;  4F7U P;  1P3R A;  1QQG A;  2COF A;  1Z87 A;  1Q67 A;  2IYB A;  1TXD A;  3SV1 A;  4GZU A;  1MIZ B;  2YRY A;  4ZRK A;  2R09 A;  2HTH B;  1MK9 B;  5CLQ B;  1SHC A;  2DKP A;  2P0F A;  1MK7 B;  3QWM A;  1W1H A;  3A98 B;  3NSU A;  1M7R A;  5DHF B;  1U2B A;  2MDX A;  1UNR A;  5D3V A;  2ELB A;  3TW1 A;  2VKI A;  2EJ8 A;  1PLS A;  1EAZ A;  3ZVR A;  5HE0 A;  1BTN A;  3GYO A;  1WI1 A;  4GXB A;  2V76 A;  2Q13 A;  1P6S A;  2RSG A;  4HAT B;  3A8Q A;  1DRO A;  1UPQ A;  2DHI A;  3BIN A;  3O96 A;  1DDW A;  3U8Z A;  1N3H A;  2I1K A;  1U29 A;  2D9W A;  4HB2 B;  3HW2 B;  5LON B;  2DN6 A;  1IRS A;  2DYN A;  3G9W A;  2YS5 A;  2D2Q A;  1DBH A;  1PFJ A;  3WYF B;  1V61 A;  2NZ8 B;  4EKU A;  4TKN A;  3BJI A;  3PP2 A;  5FI1 A;  5J3T A;  2NMB A;  4HB0 B;  2D9Z A;  1TJ6 A;  4BBK A;  2J0J A;  5HE1 A;  4HDQ A;  2JP2 A;  3WA0 A;  4H8S A;  1W1D A;  2D10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...