2RNRB

Solution structure of the complex between tfiie alpha c-terminal acidic domain and tfiih p62 ph domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
108
structure length
108
Chain Sequence
MATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKISPEGKAKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcription initiation factor IIE subunit alpha
publication title Structural insight into the TFIIE-TFIIH interaction: TFIIE and p53 share the binding region on TFIIH
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2008-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2rnrB00
5HE2A 3CIKA 2PZ1A 3BINA 2LG1A 1EF1A 2G35A 2N23A 3F5RA 2RSGA 1U5GA 4H8SA 1BTKA 2UVMA 5DI9B 1KZ7A 1MK7B 1AWEA 1UNRA 3MPXA 2M38A 1DDMA 5KCVA 3GYPA 2DFKA 2YT1A 5C79A 1P6SA 2LOXA 1FOEA 3U7DA 4GZUA 3TFMA 4HAWB 3BJIA 2J59M 4GMVA 1XR0B 5D27A 1ZVRA 4GXBA 2VSZA 4WVFB 3KZ1A 2I5CA 2D11A 1OMWA 2DX1A 5J3TA 2DA0A 5DHAB 1DROA 2K2UA 4CYEA 1U5DA 4HATB 2GCLA 2J0KA 4HHVA 2J0MA 2Z0PA 4HAUB 3M1IB 4K17A 2RLOA 4WJ7A 1XCGA 2D9WA 2P8VA 4NY0A 3SYXA 2VKIA 4A6FB 3PZDA 2CODA 2MWNB 2V76A 1BAKA 3T06A 1B55A 2I1KA 3SV1A 4HAVB 1FGZA 2COCA 4CHJA 2BCJA 2I1JA 3RCPA 2K2JA 3ZVRA 1AQCA 1J0WA 5EFXA 5JHGA 1DDWA 4MY6A 2D2QA 4BBKA 1MIXA 4IOYX 2W2WA 5HE1A 4IAPA 2P0HA 2D9YA 3PSCA 3ODOA 4A6FA 2Z0OA 1FB8A 1E5WA 1U2BA 4K2PA 4CHMA 3V5WA 4MK0A 2DHJA 2DKQA 3FEHA 2XQNM 3DXEA 2GJYA 4KAXB 3PEGA 4ZRIA 2OTXA 2Y7BA 1ZSQA 2CY4A 4YL8A 2YF0A 2D9ZA 1XKEA 1QQGA 2Z0QA 3PG7A 3WA0A 1UPQA 2ELBA 1FHOA 4EJNA 3MDBC 3FSSA 1U5EA 1W1GA 1Y19B 3VOQA 2Q13A 1U27A 1SGHA 2DHIA 1TJ6A 1Y5OA 3KSYA 4F7GA 1WGQA 4GPTB 3SNHA 5KQ4A 3SUZA 1MPHA 3WYFB 5C5BA 2CY5A 2J0JA 5J3YA 3A8PA 1ZM0A 1V88A 2HTHB 2UZSA 5D3YA 2DYNA 1XD4A 4F7UP 2OQBA 1PFJA 3QIJA 1IRSA 2ROVA 4P7IA 1UEFA 5C16A 1V61A 1I2HA 1FGYA 4Y94A 3ULBA 2W2XC 2CRFA 4A6KA 2MFQA 2JP2A 2R09A 3G9WA 2RUKB 2ROZB 2ADZA 2UZRA 4KHAA 1WGUA 4Z2MB 5FI1A 2P0FA 2RNRB 4Z2NA 2LOZA 1DYNA 2M14A 1ZC4B 2P0DA 2D4QA 2ELAA 5JHHA 2DN6A 2EMTA 2YS5A 2NMBA 5D3VA 1OQNA 4F7HA 2L2IA 4HAYB 1PLSA 3TCAA 2YS1A 2Y8GA 3NSUA 3D8EA 3KRXA 2MKRA 1KI1B 5L81A 2RVBB 4C0AA 4DX8A 2KGXB 2ZPYA 3PP2A 2RGNB 3AU5A 1EAZA 4EKUA 5HE3A 4TYZA 2D9VA 3F0WA 1U5FA 1WI1A 1EVHA 2MDXA 2D9XA 3U8ZA 5DHFB 5CLQB 2YSZA 4DXAB 5C5BB 1XODA 1W1DA 3O96A 1M7EA 4ZRJA 1ISNA 4HB4B 2Y8FA 1EGXA 2EC1A 2EMSA 2DTCA 2GS0A 1I7AA 3SO6A 2COAA 1ZC3B 3ODWA 3P7ZA 2DYQA 5C6RA 4PNKA 1DDVA 5JLJB 4A5KA 1M7RA 2H7EA 2W2XD 4MT7A 2YVCA 1NTYA 1GC6A 1TXDA 2NZ8B 3A98B 4PQ0A 1SHCA 2L1CA 1V5UA 4TKNA 2CAYA 5D3WA 2AEHA 3ULCA 1XX0A 1NI2A 1MAIA 4KHOA 1UPRA 2KCJA 1U29A 1KZGA 1GG3A 5GOWB 5JP4A 4B6HA 1W1HA 1BTNA 1FHXA 5DIFB 1QC6A 1RRPB 2E2XA 1DBHA 3VIAA 3QWMA 4A6HA 2DHKA 3FM8C 3AU4A 1V5PA 5KQ1A 1P3RA 3DXDA 2KUPA 2EJ8A 4KVGB 4HB3B 2VRWB 4HDOA 1X05A 4HAXB 2X18A 5FI0A 3ZDTA 3TO1A 1WJ1A 1TQZA 1H4RA 4GMXB 4YONA 3X23A 4HB2B 2K00A 3KY9A 1UNQA 1X11A 1FAOA 3A8QA 3N7CA 2LKOA 2DX5A 3TVVA 4KHBB 3GYOA 1K5GB 1V5MA 1FHWA 4GN1A 4K2OA 2FJLA 2YS3A 4DX90 1MK9B 1UNPA 1P5TA 2IFSA 3IVFA 2N0YA 4NSWA 1X86A 3ML4A 1MIZB 3OANA 2D10A 2QKLA 1X1FA 1J19A 1K5DB 2YT0A 2GCJA 3CXBB 4ZRKA 5DH9B 3DXCA 1Z87A 2QKMA 4HDQA 1X1GA 4DBBA 4D0NB 3LJUX 3QBVB 1N3HA 3PVUA 1V89A 3P6AA 4K81A 1RJ2A 1WG7A 2R0DA 3UZTA 1H10A 2DKPA 2YRYA 3PVLA 1NU2A 2HE7A 3HQCA 3AJ4A 4XWXA 2COFA 4HAZB 5LONB 4EMOA 3ODXA 3PVWA 2I5FA 1LW3A 3HW2B 4WSFA 4HB0B 1NTVA 1WJMA 5CLLB 3HK0A 1LB1A 5LOPB 1MKEA 2LULA 5HE0A 3D8FA 5D3XA 1WVHA 2LYDA 1GC7A 4IFSA 4L6EA 2IYBA 3KRWA 1BWNA 1OY2A 5J3QA 1PMSA 3D8DA 2AL6A 2DLWA 3TW1A 2H7DA 1Q67A
chains in the Genus database with same CATH superfamily
5HE2A 3CIKA 2PZ1A 3BINA 2KIGA 2LG1A 1EF1A 2G35A 2N23A 3F5RA 2RSGA 3HSAA 1U5GA 4H8SA 1BTKA 2UVMA 5DI9B 1KZ7A 1MK7B 1AWEA 1UNRA 3MPXA 2M38A 1DDMA 5KCVA 3GYPA 2DFKA 1ZYIA 2YT1A 5C79A 1P6SA 2LOXA 1FOEA 3U7DA 4GZUA 3TFMA 4HAWB 3BJIA 2J59M 4GMVA 1XR0B 5D27A 1ZVRA 4GXBA 2VSZA 4WVFB 3KZ1A 2I5CA 2D11A 1OMWA 2DX1A 5J3TA 2DA0A 5DHAB 1DROA 2K2UA 4CYEA 1U5DA 4HATB 4OSNA 2GCLA 2J0KA 4HHVA 2J0MA 2Z0PA 4HAUB 3M1IB 4K17A 2RLOA 4WJ7A 1XCGA 2D9WA 2P8VA 4NY0A 3SYXA 2VKIA 4A6FB 5I2SA 3PZDA 2CODA 2MWNB 2V76A 1BAKA 3T06A 1B55A 2I1KA 3SV1A 4HAVB 1FGZA 2COCA 4GOUA 4CHJA 2BCJA 2RRFA 2I1JA 3RCPA 2K2JA 3ZVRA 1AQCA 1J0WA 5EFXA 5JHGA 1DDWA 3A58A 4MY6A 2D2QA 2Z4DA 4BBKA 1MIXA 4QJ5B 4IOYX 3NWAA 2W2WA 5HE1A 4IAPA 2P0HA 2D9YA 3PSCA 3ODOA 4A6FA 2Z0OA 1FB8A 1E5WA 1U2BA 4K2PA 4CHMA 3V5WA 4MK0A 2DHJA 2DKQA 3FEHA 2XQNM 3DXEA 2GJYA 4KAXB 3PEGA 4ZRIA 2OTXA 2Y7BA 1ZSQA 2CY4A 4YL8A 2YF0A 2D9ZA 1XKEA 1QQGA 2Z0QA 3PG7A 3WA0A 1UPQA 2ELBA 1FHOA 2ZKMX 4EJNA 3MDBC 3FSSA 1U5EA 1W1GA 1Y19B 3VOQA 2Q13A 1U27A 1SGHA 2DHIA 1TJ6A 1Y5OA 3KSYA 4F7GA 1WGQA 4GPTB 3SNHA 5KQ4A 3SUZA 1MPHA 3WYFB 2KUQA 5C5BA 2CY5A 2J0JA 3U12A 5J3YA 3A8PA 1ZM0A 1V88A 2HTHB 2UZSA 5D3YA 2DYNA 1XD4A 4F7UP 2Z13A 2OQBA 1PFJA 3QIJA 1IRSA 2ROVA 4P7IA 1UEFA 5C16A 1V61A 1I2HA 4QXAB 4QJ4B 1FGYA 4Y94A 3ULBA 2W2XC 2CRFA 5LG4B 4A6KA 2K49A 2MFQA 2JP2A 2R09A 3G9WA 2RUKB 2ROZB 2ADZA 2UZRA 4KHAA 1WGUA 4Z2MB 5FI1A 2P0FA 2RNRB 4CSQA 4Z2NA 2LOZA 1DYNA 2M14A 1ZC4B 3OHMB 4D6WA 2P0DA 2D4QA 3HIEA 5I2MA 2ELAA 5JHHA 4GNKB 2DN6A 2EMTA 2YS5A 2NMBA 5D3VA 1OQNA 4F7HA 2L2IA 4HAYB 1PLSA 3TCAA 2YS1A 2Y8GA 3NSUA 3D8EA 3KRXA 2MKRA 2NBVA 1KI1B 5L81A 2RVBB 4C0AA 4DX8A 2KGXB 2ZPYA 1T77A 3PP2A 2RGNB 3AU5A 1EAZA 4EKUA 5HE3A 4TYZA 2D9VA 3F0WA 1U5FA 1WI1A 2FJUB 1EVHA 2MDXA 2D9XA 3U8ZA 5DHFB 5CLQB 2YSZA 4DXAB 5C5BB 1XODA 4KHBA 1W1DA 3O96A 1M7EA 4ZRJA 1ISNA 4HB4B 4DIXA 2Y8FA 1EGXA 2EC1A 4OT1A 2EMSA 2DTCA 2GS0A 1I7AA 3SO6A 2COAA 1ZC3B 3ODWA 3P7ZA 1MI1A 2DYQA 5C6RA 4PNKA 1DDVA 5JLJB 4A5KA 1M7RA 2H7EA 2W2XD 4MT7A 2YVCA 1NTYA 1GC6A 1TXDA 2KIEA 2NZ8B 3A98B 4PQ0A 1SHCA 2L1CA 4QJ3B 1V5UA 4TKNA 2CAYA 5D3WA 2AEHA 3ULCA 4L1RA 1XX0A 1NI2A 2K8EA 1MAIA 4KHOA 1UPRA 2KCJA 1U29A 1KZGA 1GG3A 5GOWB 5JP4A 2YT2A 4B6HA 1W1HA 1BTNA 1FHXA 5DIFB 1QC6A 1RRPB 2E2XA 1DBHA 3NW8A 3DCXA 3VIAA 3QWMA 4A6HA 2DHKA 3FM8C 3AU4A 1V5PA 5KQ1A 1P3RA 3DXDA 2KUPA 2EJ8A 4KVGB 4HB3B 2VRWB 4HDOA 1X05A 4HAXB 2X18A 5FI0A 3ZDTA 3TO1A 1WJ1A 1TQZA 1H4RA 4GMXB 4YONA 3X23A 4HB2B 2K00A 3KY9A 3FVCA 3NWDA 1UNQA 1X11A 1FAOA 3A8QA 3N7CA 2LKOA 3B77A 2DX5A 3TVVA 4KHBB 3GYOA 1K5GB 1V5MA 1FHWA 4GN1A 4K2OA 2FJLA 2YS3A 4DX90 1MK9B 2KR0A 1UNPA 1P5TA 2IFSA 3IVFA 2N0YA 4NSWA 1X86A 3ML4A 1MIZB 3OANA 2GUMA 3NWFA 2D10A 2Z14A 2QKLA 1X1FA 1J19A 1K5DB 2YT0A 3CXBB 2GCJA 4HSIA 4ZRKA 5DH9B 3DXCA 1Z87A 2R2YA 2QKMA 4HDQA 1X1GA 4DBBA 4D0NB 3LJUX 3QBVB 1N3HA 3PVUA 1V89A 3P6AA 4K81A 1RJ2A 1WG7A 2R0DA 3UZTA 1H10A 2DKPA 2YRYA 3PVLA 1NU2A 2HE7A 3HQCA 3AJ4A 4XWXA 2COFA 4HAZB 5LONB 4EMOA 3ODXA 3PVWA 2I5FA 1LW3A 2Z59A 3HW2B 4WSFA 4HB0B 1NTVA 1WJMA 5CLLB 3HK0A 1LB1A 5LOPB 1MKEA 5M4YB 2LULA 5HE0A 5IRSA 3D8FA 5D3XA 1WVHA 2LYDA 1GC7A 4IFSA 4L6EA 2IYBA 3KRWA 1BWNA 1OY2A 5J3QA 1PMSA 3D8DA 2AL6A 2DLWA 3TW1A 2H7DA 1Q67A
chains in the Genus database with same CATH topology
5HE2A 3CIKA 2PZ1A 3BINA 2LG1A 1EF1A 2G35A 2N23A 3F5RA 2RSGA 1U5GA 4H8SA 1BTKA 2UVMA 5DI9B 1KZ7A 1MK7B 1AWEA 1UNRA 3MPXA 2M38A 1DDMA 5KCVA 3GYPA 2DFKA 2YT1A 5C79A 1P6SA 2LOXA 1FOEA 3U7DA 4GZUA 3TFMA 4HAWB 3BJIA 2J59M 4GMVA 1XR0B 5D27A 1ZVRA 4GXBA 2VSZA 4WVFB 3KZ1A 2I5CA 2D11A 1OMWA 2DX1A 5J3TA 2DA0A 5DHAB 1DROA 2K2UA 4CYEA 1U5DA 4HATB 2GCLA 2J0KA 4HHVA 2J0MA 2Z0PA 4HAUB 3M1IB 4K17A 2RLOA 4WJ7A 1XCGA 2D9WA 2P8VA 4NY0A 3SYXA 2VKIA 4A6FB 3PZDA 2CODA 2MWNB 2V76A 1BAKA 3T06A 1B55A 2I1KA 3SV1A 4HAVB 1FGZA 2COCA 4CHJA 2BCJA 2I1JA 3RCPA 2K2JA 3ZVRA 1AQCA 1J0WA 5EFXA 5JHGA 1DDWA 4MY6A 2D2QA 4BBKA 1MIXA 4IOYX 2W2WA 5HE1A 4IAPA 2P0HA 2D9YA 3PSCA 3ODOA 4A6FA 2Z0OA 1FB8A 1E5WA 1U2BA 4K2PA 4CHMA 3V5WA 4MK0A 2DHJA 2DKQA 3FEHA 2XQNM 3DXEA 2GJYA 4KAXB 3PEGA 4ZRIA 2OTXA 2Y7BA 1ZSQA 2CY4A 4YL8A 2YF0A 2D9ZA 1XKEA 1QQGA 2Z0QA 3PG7A 3WA0A 1UPQA 2ELBA 1FHOA 4EJNA 3MDBC 3FSSA 1U5EA 1W1GA 1Y19B 3VOQA 2Q13A 1U27A 1SGHA 2DHIA 1TJ6A 1Y5OA 3KSYA 4F7GA 1WGQA 4GPTB 3SNHA 5KQ4A 3SUZA 1MPHA 3WYFB 5C5BA 2CY5A 2J0JA 5J3YA 3A8PA 1ZM0A 1V88A 2HTHB 2UZSA 5D3YA 2DYNA 1XD4A 4F7UP 2OQBA 1PFJA 3QIJA 1IRSA 2ROVA 4P7IA 1UEFA 5C16A 1V61A 1I2HA 1FGYA 4Y94A 3ULBA 2W2XC 2CRFA 4A6KA 2MFQA 2JP2A 2R09A 3G9WA 2RUKB 2ROZB 2ADZA 2UZRA 4KHAA 1WGUA 4Z2MB 5FI1A 2P0FA 2RNRB 4Z2NA 2LOZA 1DYNA 2M14A 1ZC4B 2P0DA 2D4QA 2ELAA 5JHHA 2DN6A 2EMTA 2YS5A 2NMBA 5D3VA 1OQNA 4F7HA 2L2IA 4HAYB 1PLSA 3TCAA 2YS1A 2Y8GA 3NSUA 3D8EA 3KRXA 2MKRA 1KI1B 5L81A 2RVBB 4C0AA 4DX8A 2KGXB 2ZPYA 3PP2A 2RGNB 3AU5A 1EAZA 4EKUA 5HE3A 4TYZA 2D9VA 3F0WA 1U5FA 1WI1A 1EVHA 2MDXA 2D9XA 3U8ZA 5DHFB 5CLQB 2YSZA 4DXAB 5C5BB 1XODA 1W1DA 3O96A 1M7EA 4ZRJA 1ISNA 4HB4B 2Y8FA 1EGXA 2EC1A 2EMSA 2DTCA 2GS0A 1I7AA 3SO6A 2COAA 1ZC3B 3ODWA 3P7ZA 2DYQA 5C6RA 4PNKA 1DDVA 5JLJB 4A5KA 1M7RA 2H7EA 2W2XD 4MT7A 2YVCA 1NTYA 1GC6A 1TXDA 2NZ8B 3A98B 4PQ0A 1SHCA 2L1CA 1V5UA 4TKNA 2CAYA 5D3WA 2AEHA 3ULCA 1XX0A 1NI2A 1MAIA 4KHOA 1UPRA 2KCJA 1U29A 1KZGA 1GG3A 5GOWB 5JP4A 4B6HA 1W1HA 1BTNA 1FHXA 5DIFB 1QC6A 1RRPB 2E2XA 1DBHA 3VIAA 3QWMA 4A6HA 2DHKA 3FM8C 3AU4A 1V5PA 5KQ1A 1P3RA 3DXDA 2KUPA 2EJ8A 4KVGB 4HB3B 2VRWB 4HDOA 1X05A 4HAXB 2X18A 5FI0A 3ZDTA 3TO1A 1WJ1A 1TQZA 1H4RA 4GMXB 4YONA 3X23A 4HB2B 2K00A 3KY9A 1UNQA 1X11A 1FAOA 3A8QA 3N7CA 2LKOA 2DX5A 3TVVA 4KHBB 3GYOA 1K5GB 1V5MA 1FHWA 4GN1A 4K2OA 2FJLA 2YS3A 4DX90 1MK9B 1UNPA 1P5TA 2IFSA 3IVFA 2N0YA 4NSWA 1X86A 3ML4A 1MIZB 3OANA 2D10A 2QKLA 1X1FA 1J19A 1K5DB 2YT0A 2GCJA 3CXBB 4ZRKA 5DH9B 3DXCA 1Z87A 2QKMA 4HDQA 1X1GA 4DBBA 4D0NB 3LJUX 3QBVB 1N3HA 3PVUA 1V89A 3P6AA 4K81A 1RJ2A 1WG7A 2R0DA 3UZTA 1H10A 2DKPA 2YRYA 3PVLA 1NU2A 2HE7A 3HQCA 3AJ4A 4XWXA 2COFA 4HAZB 5LONB 4EMOA 3ODXA 3PVWA 2I5FA 1LW3A 3HW2B 4WSFA 4HB0B 1NTVA 1WJMA 5CLLB 3HK0A 1LB1A 5LOPB 1MKEA 2LULA 5HE0A 3D8FA 5D3XA 1WVHA 2LYDA 1GC7A 4IFSA 4L6EA 2IYBA 3KRWA 1BWNA 1OY2A 5J3QA 1PMSA 3D8DA 2AL6A 2DLWA 3TW1A 2H7DA 1Q67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HE2 A;  3CIK A;  2PZ1 A;  3BIN A;  2LG1 A;  1EF1 A;  2G35 A;  2N23 A;  3F5R A;  2RSG A;  1U5G A;  4H8S A;  1BTK A;  2UVM A;  5DI9 B;  1KZ7 A;  1MK7 B;  1AWE A;  1UNR A;  3MPX A;  2M38 A;  1DDM A;  5KCV A;  3GYP A;  2DFK A;  2YT1 A;  5C79 A;  1P6S A;  2LOX A;  1FOE A;  3U7D A;  4GZU A;  3TFM A;  4HAW B;  3BJI A;  2J59 M;  4GMV A;  1XR0 B;  5D27 A;  1ZVR A;  4GXB A;  2VSZ A;  4WVF B;  3KZ1 A;  2I5C A;  2D11 A;  1OMW A;  2DX1 A;  5J3T A;  2DA0 A;  5DHA B;  1DRO A;  2K2U A;  4CYE A;  1U5D A;  4HAT B;  2GCL A;  2J0K A;  4HHV A;  2J0M A;  2Z0P A;  4HAU B;  3M1I B;  4K17 A;  2RLO A;  4WJ7 A;  1XCG A;  2D9W A;  2P8V A;  4NY0 A;  3SYX A;  2VKI A;  4A6F B;  3PZD A;  2COD A;  2MWN B;  2V76 A;  1BAK A;  3T06 A;  1B55 A;  2I1K A;  3SV1 A;  4HAV B;  1FGZ A;  2COC A;  4CHJ A;  2BCJ A;  2I1J A;  3RCP A;  2K2J A;  3ZVR A;  1AQC A;  1J0W A;  5EFX A;  5JHG A;  1DDW A;  4MY6 A;  2D2Q A;  4BBK A;  1MIX A;  4IOY X;  2W2W A;  5HE1 A;  4IAP A;  2P0H A;  2D9Y A;  3PSC A;  3ODO A;  4A6F A;  2Z0O A;  1FB8 A;  1E5W A;  1U2B A;  4K2P A;  4CHM A;  3V5W A;  4MK0 A;  2DHJ A;  2DKQ A;  3FEH A;  2XQN M;  3DXE A;  2GJY A;  4KAX B;  3PEG A;  4ZRI A;  2OTX A;  2Y7B A;  1ZSQ A;  2CY4 A;  4YL8 A;  2YF0 A;  2D9Z A;  1XKE A;  1QQG A;  2Z0Q A;  3PG7 A;  3WA0 A;  1UPQ A;  2ELB A;  1FHO A;  4EJN A;  3MDB C;  3FSS A;  1U5E A;  1W1G A;  1Y19 B;  3VOQ A;  2Q13 A;  1U27 A;  1SGH A;  2DHI A;  1TJ6 A;  1Y5O A;  3KSY A;  4F7G A;  1WGQ A;  4GPT B;  3SNH A;  5KQ4 A;  3SUZ A;  1MPH A;  3WYF B;  5C5B A;  2CY5 A;  2J0J A;  5J3Y A;  3A8P A;  1ZM0 A;  1V88 A;  2HTH B;  2UZS A;  5D3Y A;  2DYN A;  1XD4 A;  4F7U P;  2OQB A;  1PFJ A;  3QIJ A;  1IRS A;  2ROV A;  4P7I A;  1UEF A;  5C16 A;  1V61 A;  1I2H A;  1FGY A;  4Y94 A;  3ULB A;  2W2X C;  2CRF A;  4A6K A;  2MFQ A;  2JP2 A;  2R09 A;  3G9W A;  2RUK B;  2ROZ B;  2ADZ A;  2UZR A;  4KHA A;  1WGU A;  4Z2M B;  5FI1 A;  2P0F A;  2RNR B;  4Z2N A;  2LOZ A;  1DYN A;  2M14 A;  1ZC4 B;  2P0D A;  2D4Q A;  2ELA A;  5JHH A;  2DN6 A;  2EMT A;  2YS5 A;  2NMB A;  5D3V A;  1OQN A;  4F7H A;  2L2I A;  4HAY B;  1PLS A;  3TCA A;  2YS1 A;  2Y8G A;  3NSU A;  3D8E A;  3KRX A;  2MKR A;  1KI1 B;  5L81 A;  2RVB B;  4C0A A;  4DX8 A;  2KGX B;  2ZPY A;  3PP2 A;  2RGN B;  3AU5 A;  1EAZ A;  4EKU A;  5HE3 A;  4TYZ A;  2D9V A;  3F0W A;  1U5F A;  1WI1 A;  1EVH A;  2MDX A;  2D9X A;  3U8Z A;  5DHF B;  5CLQ B;  2YSZ A;  4DXA B;  5C5B B;  1XOD A;  1W1D A;  3O96 A;  1M7E A;  4ZRJ A;  1ISN A;  4HB4 B;  2Y8F A;  1EGX A;  2EC1 A;  2EMS A;  2DTC A;  2GS0 A;  1I7A A;  3SO6 A;  2COA A;  1ZC3 B;  3ODW A;  3P7Z A;  2DYQ A;  5C6R A;  4PNK A;  1DDV A;  5JLJ B;  4A5K A;  1M7R A;  2H7E A;  2W2X D;  4MT7 A;  2YVC A;  1NTY A;  1GC6 A;  1TXD A;  2NZ8 B;  3A98 B;  4PQ0 A;  1SHC A;  2L1C A;  1V5U A;  4TKN A;  2CAY A;  5D3W A;  2AEH A;  3ULC A;  1XX0 A;  1NI2 A;  1MAI A;  4KHO A;  1UPR A;  2KCJ A;  1U29 A;  1KZG A;  1GG3 A;  5GOW B;  5JP4 A;  4B6H A;  1W1H A;  1BTN A;  1FHX A;  5DIF B;  1QC6 A;  1RRP B;  2E2X A;  1DBH A;  3VIA A;  3QWM A;  4A6H A;  2DHK A;  3FM8 C;  3AU4 A;  1V5P A;  5KQ1 A;  1P3R A;  3DXD A;  2KUP A;  2EJ8 A;  4KVG B;  4HB3 B;  2VRW B;  4HDO A;  1X05 A;  4HAX B;  2X18 A;  5FI0 A;  3ZDT A;  3TO1 A;  1WJ1 A;  1TQZ A;  1H4R A;  4GMX B;  4YON A;  3X23 A;  4HB2 B;  2K00 A;  3KY9 A;  1UNQ A;  1X11 A;  1FAO A;  3A8Q A;  3N7C A;  2LKO A;  2DX5 A;  3TVV A;  4KHB B;  3GYO A;  1K5G B;  1V5M A;  1FHW A;  4GN1 A;  4K2O A;  2FJL A;  2YS3 A;  4DX9 0;  1MK9 B;  1UNP A;  1P5T A;  2IFS A;  3IVF A;  2N0Y A;  4NSW A;  1X86 A;  3ML4 A;  1MIZ B;  3OAN A;  2D10 A;  2QKL A;  1X1F A;  1J19 A;  1K5D B;  2YT0 A;  2GCJ A;  3CXB B;  4ZRK A;  5DH9 B;  3DXC A;  1Z87 A;  2QKM A;  4HDQ A;  1X1G A;  4DBB A;  4D0N B;  3LJU X;  3QBV B;  1N3H A;  3PVU A;  1V89 A;  3P6A A;  4K81 A;  1RJ2 A;  1WG7 A;  2R0D A;  3UZT A;  1H10 A;  2DKP A;  2YRY A;  3PVL A;  1NU2 A;  2HE7 A;  3HQC A;  3AJ4 A;  4XWX A;  2COF A;  4HAZ B;  5LON B;  4EMO A;  3ODX A;  3PVW A;  2I5F A;  1LW3 A;  3HW2 B;  4WSF A;  4HB0 B;  1NTV A;  1WJM A;  5CLL B;  3HK0 A;  1LB1 A;  5LOP B;  1MKE A;  2LUL A;  5HE0 A;  3D8F A;  5D3X A;  1WVH A;  2LYD A;  1GC7 A;  4IFS A;  4L6E A;  2IYB A;  3KRW A;  1BWN A;  1OY2 A;  5J3Q A;  1PMS A;  3D8D A;  2AL6 A;  2DLW A;  3TW1 A;  2H7D A;  1Q67 A; 
#chains in the Genus database with same CATH topology
 5HE2 A;  3CIK A;  2PZ1 A;  3BIN A;  2KIG A;  2LG1 A;  1EF1 A;  2G35 A;  2N23 A;  3F5R A;  2RSG A;  3HSA A;  1U5G A;  4H8S A;  1BTK A;  2UVM A;  5DI9 B;  1KZ7 A;  1MK7 B;  1AWE A;  1UNR A;  3MPX A;  2M38 A;  1DDM A;  5KCV A;  3GYP A;  2DFK A;  1ZYI A;  2YT1 A;  5C79 A;  1P6S A;  2LOX A;  1FOE A;  3U7D A;  4GZU A;  3TFM A;  4HAW B;  3BJI A;  2J59 M;  4GMV A;  1XR0 B;  5D27 A;  1ZVR A;  4GXB A;  2VSZ A;  4WVF B;  3KZ1 A;  2I5C A;  2D11 A;  1OMW A;  2DX1 A;  5J3T A;  2DA0 A;  5DHA B;  1DRO A;  2K2U A;  4CYE A;  1U5D A;  4HAT B;  4OSN A;  2GCL A;  2J0K A;  4HHV A;  2J0M A;  2Z0P A;  4HAU B;  3M1I B;  4K17 A;  2RLO A;  4WJ7 A;  1XCG A;  2D9W A;  2P8V A;  4NY0 A;  3SYX A;  2VKI A;  4A6F B;  5I2S A;  3PZD A;  2COD A;  2MWN B;  2V76 A;  1BAK A;  3T06 A;  1B55 A;  2I1K A;  3SV1 A;  4HAV B;  1FGZ A;  2COC A;  4GOU A;  4CHJ A;  2BCJ A;  2RRF A;  2I1J A;  3RCP A;  2K2J A;  3ZVR A;  1AQC A;  1J0W A;  5EFX A;  5JHG A;  1DDW A;  3A58 A;  4MY6 A;  2D2Q A;  2Z4D A;  4BBK A;  1MIX A;  4QJ5 B;  4IOY X;  3NWA A;  2W2W A;  5HE1 A;  4IAP A;  2P0H A;  2D9Y A;  3PSC A;  3ODO A;  4A6F A;  2Z0O A;  1FB8 A;  1E5W A;  1U2B A;  4K2P A;  4CHM A;  3V5W A;  4MK0 A;  2DHJ A;  2DKQ A;  3FEH A;  2XQN M;  3DXE A;  2GJY A;  4KAX B;  3PEG A;  4ZRI A;  2OTX A;  2Y7B A;  1ZSQ A;  2CY4 A;  4YL8 A;  2YF0 A;  2D9Z A;  1XKE A;  1QQG A;  2Z0Q A;  3PG7 A;  3WA0 A;  1UPQ A;  2ELB A;  1FHO A;  2ZKM X;  4EJN A;  3MDB C;  3FSS A;  1U5E A;  1W1G A;  1Y19 B;  3VOQ A;  2Q13 A;  1U27 A;  1SGH A;  2DHI A;  1TJ6 A;  1Y5O A;  3KSY A;  4F7G A;  1WGQ A;  4GPT B;  3SNH A;  5KQ4 A;  3SUZ A;  1MPH A;  3WYF B;  2KUQ A;  5C5B A;  2CY5 A;  2J0J A;  3U12 A;  5J3Y A;  3A8P A;  1ZM0 A;  1V88 A;  2HTH B;  2UZS A;  5D3Y A;  2DYN A;  1XD4 A;  4F7U P;  2Z13 A;  2OQB A;  1PFJ A;  3QIJ A;  1IRS A;  2ROV A;  4P7I A;  1UEF A;  5C16 A;  1V61 A;  1I2H A;  4QXA B;  4QJ4 B;  1FGY A;  4Y94 A;  3ULB A;  2W2X C;  2CRF A;  5LG4 B;  4A6K A;  2K49 A;  2MFQ A;  2JP2 A;  2R09 A;  3G9W A;  2RUK B;  2ROZ B;  2ADZ A;  2UZR A;  4KHA A;  1WGU A;  4Z2M B;  5FI1 A;  2P0F A;  2RNR B;  4CSQ A;  4Z2N A;  2LOZ A;  1DYN A;  2M14 A;  1ZC4 B;  3OHM B;  4D6W A;  2P0D A;  2D4Q A;  3HIE A;  5I2M A;  2ELA A;  5JHH A;  4GNK B;  2DN6 A;  2EMT A;  2YS5 A;  2NMB A;  5D3V A;  1OQN A;  4F7H A;  2L2I A;  4HAY B;  1PLS A;  3TCA A;  2YS1 A;  2Y8G A;  3NSU A;  3D8E A;  3KRX A;  2MKR A;  2NBV A;  1KI1 B;  5L81 A;  2RVB B;  4C0A A;  4DX8 A;  2KGX B;  2ZPY A;  1T77 A;  3PP2 A;  2RGN B;  3AU5 A;  1EAZ A;  4EKU A;  5HE3 A;  4TYZ A;  2D9V A;  3F0W A;  1U5F A;  1WI1 A;  2FJU B;  1EVH A;  2MDX A;  2D9X A;  3U8Z A;  5DHF B;  5CLQ B;  2YSZ A;  4DXA B;  5C5B B;  1XOD A;  4KHB A;  1W1D A;  3O96 A;  1M7E A;  4ZRJ A;  1ISN A;  4HB4 B;  4DIX A;  2Y8F A;  1EGX A;  2EC1 A;  4OT1 A;  2EMS A;  2DTC A;  2GS0 A;  1I7A A;  3SO6 A;  2COA A;  1ZC3 B;  3ODW A;  3P7Z A;  1MI1 A;  2DYQ A;  5C6R A;  4PNK A;  1DDV A;  5JLJ B;  4A5K A;  1M7R A;  2H7E A;  2W2X D;  4MT7 A;  2YVC A;  1NTY A;  1GC6 A;  1TXD A;  2KIE A;  2NZ8 B;  3A98 B;  4PQ0 A;  1SHC A;  2L1C A;  4QJ3 B;  1V5U A;  4TKN A;  2CAY A;  5D3W A;  2AEH A;  3ULC A;  4L1R A;  1XX0 A;  1NI2 A;  2K8E A;  1MAI A;  4KHO A;  1UPR A;  2KCJ A;  1U29 A;  1KZG A;  1GG3 A;  5GOW B;  5JP4 A;  2YT2 A;  4B6H A;  1W1H A;  1BTN A;  1FHX A;  5DIF B;  1QC6 A;  1RRP B;  2E2X A;  1DBH A;  3NW8 A;  3DCX A;  3VIA A;  3QWM A;  4A6H A;  2DHK A;  3FM8 C;  3AU4 A;  1V5P A;  5KQ1 A;  1P3R A;  3DXD A;  2KUP A;  2EJ8 A;  4KVG B;  4HB3 B;  2VRW B;  4HDO A;  1X05 A;  4HAX B;  2X18 A;  5FI0 A;  3ZDT A;  3TO1 A;  1WJ1 A;  1TQZ A;  1H4R A;  4GMX B;  4YON A;  3X23 A;  4HB2 B;  2K00 A;  3KY9 A;  3FVC A;  3NWD A;  1UNQ A;  1X11 A;  1FAO A;  3A8Q A;  3N7C A;  2LKO A;  3B77 A;  2DX5 A;  3TVV A;  4KHB B;  3GYO A;  1K5G B;  1V5M A;  1FHW A;  4GN1 A;  4K2O A;  2FJL A;  2YS3 A;  4DX9 0;  1MK9 B;  2KR0 A;  1UNP A;  1P5T A;  2IFS A;  3IVF A;  2N0Y A;  4NSW A;  1X86 A;  3ML4 A;  1MIZ B;  3OAN A;  2GUM A;  3NWF A;  2D10 A;  2Z14 A;  2QKL A;  1X1F A;  1J19 A;  1K5D B;  2YT0 A;  3CXB B;  2GCJ A;  4HSI A;  4ZRK A;  5DH9 B;  3DXC A;  1Z87 A;  2R2Y A;  2QKM A;  4HDQ A;  1X1G A;  4DBB A;  4D0N B;  3LJU X;  3QBV B;  1N3H A;  3PVU A;  1V89 A;  3P6A A;  4K81 A;  1RJ2 A;  1WG7 A;  2R0D A;  3UZT A;  1H10 A;  2DKP A;  2YRY A;  3PVL A;  1NU2 A;  2HE7 A;  3HQC A;  3AJ4 A;  4XWX A;  2COF A;  4HAZ B;  5LON B;  4EMO A;  3ODX A;  3PVW A;  2I5F A;  1LW3 A;  2Z59 A;  3HW2 B;  4WSF A;  4HB0 B;  1NTV A;  1WJM A;  5CLL B;  3HK0 A;  1LB1 A;  5LOP B;  1MKE A;  5M4Y B;  2LUL A;  5HE0 A;  5IRS A;  3D8F A;  5D3X A;  1WVH A;  2LYD A;  1GC7 A;  4IFS A;  4L6E A;  2IYB A;  3KRW A;  1BWN A;  1OY2 A;  5J3Q A;  1PMS A;  3D8D A;  2AL6 A;  2DLW A;  3TW1 A;  2H7D A;  1Q67 A; 
#chains in the Genus database with same CATH homology
 5HE2 A;  3CIK A;  2PZ1 A;  3BIN A;  2LG1 A;  1EF1 A;  2G35 A;  2N23 A;  3F5R A;  2RSG A;  1U5G A;  4H8S A;  1BTK A;  2UVM A;  5DI9 B;  1KZ7 A;  1MK7 B;  1AWE A;  1UNR A;  3MPX A;  2M38 A;  1DDM A;  5KCV A;  3GYP A;  2DFK A;  2YT1 A;  5C79 A;  1P6S A;  2LOX A;  1FOE A;  3U7D A;  4GZU A;  3TFM A;  4HAW B;  3BJI A;  2J59 M;  4GMV A;  1XR0 B;  5D27 A;  1ZVR A;  4GXB A;  2VSZ A;  4WVF B;  3KZ1 A;  2I5C A;  2D11 A;  1OMW A;  2DX1 A;  5J3T A;  2DA0 A;  5DHA B;  1DRO A;  2K2U A;  4CYE A;  1U5D A;  4HAT B;  2GCL A;  2J0K A;  4HHV A;  2J0M A;  2Z0P A;  4HAU B;  3M1I B;  4K17 A;  2RLO A;  4WJ7 A;  1XCG A;  2D9W A;  2P8V A;  4NY0 A;  3SYX A;  2VKI A;  4A6F B;  3PZD A;  2COD A;  2MWN B;  2V76 A;  1BAK A;  3T06 A;  1B55 A;  2I1K A;  3SV1 A;  4HAV B;  1FGZ A;  2COC A;  4CHJ A;  2BCJ A;  2I1J A;  3RCP A;  2K2J A;  3ZVR A;  1AQC A;  1J0W A;  5EFX A;  5JHG A;  1DDW A;  4MY6 A;  2D2Q A;  4BBK A;  1MIX A;  4IOY X;  2W2W A;  5HE1 A;  4IAP A;  2P0H A;  2D9Y A;  3PSC A;  3ODO A;  4A6F A;  2Z0O A;  1FB8 A;  1E5W A;  1U2B A;  4K2P A;  4CHM A;  3V5W A;  4MK0 A;  2DHJ A;  2DKQ A;  3FEH A;  2XQN M;  3DXE A;  2GJY A;  4KAX B;  3PEG A;  4ZRI A;  2OTX A;  2Y7B A;  1ZSQ A;  2CY4 A;  4YL8 A;  2YF0 A;  2D9Z A;  1XKE A;  1QQG A;  2Z0Q A;  3PG7 A;  3WA0 A;  1UPQ A;  2ELB A;  1FHO A;  4EJN A;  3MDB C;  3FSS A;  1U5E A;  1W1G A;  1Y19 B;  3VOQ A;  2Q13 A;  1U27 A;  1SGH A;  2DHI A;  1TJ6 A;  1Y5O A;  3KSY A;  4F7G A;  1WGQ A;  4GPT B;  3SNH A;  5KQ4 A;  3SUZ A;  1MPH A;  3WYF B;  5C5B A;  2CY5 A;  2J0J A;  5J3Y A;  3A8P A;  1ZM0 A;  1V88 A;  2HTH B;  2UZS A;  5D3Y A;  2DYN A;  1XD4 A;  4F7U P;  2OQB A;  1PFJ A;  3QIJ A;  1IRS A;  2ROV A;  4P7I A;  1UEF A;  5C16 A;  1V61 A;  1I2H A;  1FGY A;  4Y94 A;  3ULB A;  2W2X C;  2CRF A;  4A6K A;  2MFQ A;  2JP2 A;  2R09 A;  3G9W A;  2RUK B;  2ROZ B;  2ADZ A;  2UZR A;  4KHA A;  1WGU A;  4Z2M B;  5FI1 A;  2P0F A;  2RNR B;  4Z2N A;  2LOZ A;  1DYN A;  2M14 A;  1ZC4 B;  2P0D A;  2D4Q A;  2ELA A;  5JHH A;  2DN6 A;  2EMT A;  2YS5 A;  2NMB A;  5D3V A;  1OQN A;  4F7H A;  2L2I A;  4HAY B;  1PLS A;  3TCA A;  2YS1 A;  2Y8G A;  3NSU A;  3D8E A;  3KRX A;  2MKR A;  1KI1 B;  5L81 A;  2RVB B;  4C0A A;  4DX8 A;  2KGX B;  2ZPY A;  3PP2 A;  2RGN B;  3AU5 A;  1EAZ A;  4EKU A;  5HE3 A;  4TYZ A;  2D9V A;  3F0W A;  1U5F A;  1WI1 A;  1EVH A;  2MDX A;  2D9X A;  3U8Z A;  5DHF B;  5CLQ B;  2YSZ A;  4DXA B;  5C5B B;  1XOD A;  1W1D A;  3O96 A;  1M7E A;  4ZRJ A;  1ISN A;  4HB4 B;  2Y8F A;  1EGX A;  2EC1 A;  2EMS A;  2DTC A;  2GS0 A;  1I7A A;  3SO6 A;  2COA A;  1ZC3 B;  3ODW A;  3P7Z A;  2DYQ A;  5C6R A;  4PNK A;  1DDV A;  5JLJ B;  4A5K A;  1M7R A;  2H7E A;  2W2X D;  4MT7 A;  2YVC A;  1NTY A;  1GC6 A;  1TXD A;  2NZ8 B;  3A98 B;  4PQ0 A;  1SHC A;  2L1C A;  1V5U A;  4TKN A;  2CAY A;  5D3W A;  2AEH A;  3ULC A;  1XX0 A;  1NI2 A;  1MAI A;  4KHO A;  1UPR A;  2KCJ A;  1U29 A;  1KZG A;  1GG3 A;  5GOW B;  5JP4 A;  4B6H A;  1W1H A;  1BTN A;  1FHX A;  5DIF B;  1QC6 A;  1RRP B;  2E2X A;  1DBH A;  3VIA A;  3QWM A;  4A6H A;  2DHK A;  3FM8 C;  3AU4 A;  1V5P A;  5KQ1 A;  1P3R A;  3DXD A;  2KUP A;  2EJ8 A;  4KVG B;  4HB3 B;  2VRW B;  4HDO A;  1X05 A;  4HAX B;  2X18 A;  5FI0 A;  3ZDT A;  3TO1 A;  1WJ1 A;  1TQZ A;  1H4R A;  4GMX B;  4YON A;  3X23 A;  4HB2 B;  2K00 A;  3KY9 A;  1UNQ A;  1X11 A;  1FAO A;  3A8Q A;  3N7C A;  2LKO A;  2DX5 A;  3TVV A;  4KHB B;  3GYO A;  1K5G B;  1V5M A;  1FHW A;  4GN1 A;  4K2O A;  2FJL A;  2YS3 A;  4DX9 0;  1MK9 B;  1UNP A;  1P5T A;  2IFS A;  3IVF A;  2N0Y A;  4NSW A;  1X86 A;  3ML4 A;  1MIZ B;  3OAN A;  2D10 A;  2QKL A;  1X1F A;  1J19 A;  1K5D B;  2YT0 A;  2GCJ A;  3CXB B;  4ZRK A;  5DH9 B;  3DXC A;  1Z87 A;  2QKM A;  4HDQ A;  1X1G A;  4DBB A;  4D0N B;  3LJU X;  3QBV B;  1N3H A;  3PVU A;  1V89 A;  3P6A A;  4K81 A;  1RJ2 A;  1WG7 A;  2R0D A;  3UZT A;  1H10 A;  2DKP A;  2YRY A;  3PVL A;  1NU2 A;  2HE7 A;  3HQC A;  3AJ4 A;  4XWX A;  2COF A;  4HAZ B;  5LON B;  4EMO A;  3ODX A;  3PVW A;  2I5F A;  1LW3 A;  3HW2 B;  4WSF A;  4HB0 B;  1NTV A;  1WJM A;  5CLL B;  3HK0 A;  1LB1 A;  5LOP B;  1MKE A;  2LUL A;  5HE0 A;  3D8F A;  5D3X A;  1WVH A;  2LYD A;  1GC7 A;  4IFS A;  4L6E A;  2IYB A;  3KRW A;  1BWN A;  1OY2 A;  5J3Q A;  1PMS A;  3D8D A;  2AL6 A;  2DLW A;  3TW1 A;  2H7D A;  1Q67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...