2RNRB

Solution structure of the complex between tfiie alpha c-terminal acidic domain and tfiih p62 ph domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
108
structure length
108
Chain Sequence
MATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKISPEGKAKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription initiation factor IIE subunit alpha
publication title Structural insight into the TFIIE-TFIIH interaction: TFIIE and p53 share the binding region on TFIIH
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 24
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2008-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2rnrB00
1EVHA 1X11A 4Z2MB 3SO6A 2FJLA 1GC7A 2QKMA 3NSUA 3ZVRA 2RGNB 2NMBA 4EKUA 3MPXA 2HTHB 5FI1A 2K2UA 2MFQA 3D8FA 2D9YA 3DXDA 3A98B 1P6SA 1XKEA 1ZM0A 1BWNA 2D4QA 2Z0QA 2CRFA 1SHCA 1U5FA 1XD4A 1LW3A 4KHOA 3TVVA 2BCJA 1MK9B 2W2XD 1MPHA 1W1HA 2UZSA 4B6HA 4A6KA 1ZC4B 1NTYA 4K2OA 2AEHA 4NY0A 2I1JA 3OANA 4DX8A 1DROA 2K00A 2MKRA 1W1DA 2GS0A 4XWXA 5DI9B 5KCVA 2RVBB 4TKNA 1QC6A 1TXDA 4KVGB 1BAKA 4HB4B 1AQCA 3TO1A 5JHHA 1PLSA 3DXCA 5DH9B 2DA0A 3HW2B 2RUKB 2DYNA 1M7RA 2DN6A 5C5BB 4F7HA 4A6FA 2ELBA 2YS1A 4Z2NA 3P7ZA 1V5PA 2Z0OA 5JP4A 1X05A 5J3QA 2P0FA 1UNRA 2EMSA 1EAZA 2DTCA 4IFSA 1UPRA 4MY6A 1MAIA 2GCJA 3D8DA 1UEFA 5CLLB 1V88A 4C0AA 1XODA 2DHKA 1NU2A 4EJNA 2R09A 1WGQA 3AU4A 2EJ8A 2CODA 3KY9A 5J3TA 1PMSA 5D27A 2YVCA 4HAZB 3CIKA 3FSSA 2W2XC 3FM8C 1ZVRA 1Q67A 2RLOA 1DYNA 5D3WA 3HK0A 2H7EA 1OY2A 5HE0A 4WVFB 4PQ0A 2Y8FA 1Z87A 2P0DA 3F5RA 5DIFB 3PVWA 4F7GA 2MWNB 4YONA 2M14A 2CAYA 1WG7A 1H10A 2DYQA 1X1FA 2GCLA 3V5WA 2Y8GA 3QBVB 4GN1A 4HDOA 2DX5A 4DX90 3LJUX 3ODXA 4HB2B 3A8PA 2VKIA 4PNKA 2G35A 3KRWA 2IYBA 2VRWB 5JHGA 1GG3A 3BINA 5D3YA 4CHJA 2YS3A 5CLQB 1BTKA 2KCJA 3P6AA 1FHXA 1IRSA 4A6HA 2RSGA 5KQ1A 1WJMA 3MDBC 5L81A 4GPTB 3N7CA 3TCAA 4BBKA 4KHBB 1OQNA 2YF0A 1U2BA 1U5EA 1FGZA 2N23A 5C16A 3U7DA 2IFSA 1MIZB 3SYXA 1X86A 4GMVA 3SUZA 5HE2A 5HE1A 1UNPA 2D9VA 3PG7A 1B55A 1ISNA 4GZUA 4HB0B 4IAPA 2YRYA 3PP2A 2COAA 3FEHA 4EMOA 2GJYA 1U27A 1MIXA 4DXAB 4K2PA 2LKOA 1P3RA 5LONB 1DDVA 2Z0PA 3D8EA 2YSZA 1FGYA 2D2QA 4MK0A 5GOWB 1E5WA 2ZPYA 5C6RA 1OMWA 3KSYA 2P8VA 3VOQA 1NTVA 2L1CA 2MDXA 3F0WA 3PEGA 4HAWB 3G9WA 4ZRJA 1UNQA 2UZRA 3HQCA 4HAVB 2QKLA 3QWMA 2HE7A 2NZ8B 4H8SA 3AU5A 2J59M 3QIJA 4A6FB 4ZRKA 3T06A 4YL8A 3X23A 1ZSQA 1KZ7A 5EFXA 2DKPA 1U29A 4MT7A 1TJ6A 2DKQA 3IVFA 2LULA 2P0HA 2DLWA 1MKEA 5D3VA 1DDWA 4HAUB 1W1GA 2K2JA 1TQZA 3ULCA 4D0NB 1V61A 1XX0A 4DBBA 3PSCA 3VIAA 2D10A 1M7EA 1WI1A 5FI0A 3PZDA 1MK7B 2W2WA 3DXEA 1SGHA 3ZDTA 3RCPA 4L6EA 2CY5A 1BTNA 3U8ZA 1LB1A 1KI1B 1FHOA 5HE3A 2E2XA 5J3YA 3TFMA 2LOZA 4F7UP 2VSZA 2LYDA 4GMXB 1Y5OA 3ML4A 4HAYB 1FHWA 2I1KA 2DHIA 3WYFB 2KUPA 3BJIA 4HAXB 2I5CA 4K17A 5DHAB 2LOXA 3AJ4A 4TYZA 2KGXB 1WJ1A 3SV1A 3PVLA 2R0DA 2N0YA 1WVHA 1ZC3B 1QQGA 2X18A 1J0WA 1NI2A 4A5KA 2RNRB 2XQNM 1V5MA 4CHMA 5C5BA 2PZ1A 3ODWA 2YS5A 3ULBA 3O96A 2Y7BA 1P5TA 1WGUA 2YT0A 1FAOA 3M1IB 2YT1A 1PFJA 2I5FA 2EMTA 3GYOA 2COCA 1Y19B 2ROZB 1FOEA 5KQ4A 2AL6A 1U5DA 4Y94A 3GYPA 3WA0A 2ELAA 2D9XA 3UZTA 1K5GB 3KRXA 4NSWA 4HDQA 5JLJB 2ROVA 5D3XA 1DDMA 1N3HA 2Q13A 2OQBA 4HB3B 2DHJA 2JP2A 1K5DB 2COFA 3SNHA 5LOPB 2DFKA 2EC1A 2UVMA 2DX1A 3ODOA 2LG1A 1EGXA 2L2IA 5C79A 1UPQA 3A8QA 4P7IA 1H4RA 1X1GA 1I7AA 3PVUA 1J19A 1KZGA 5DHFB 4KHAA 4CYEA 1GC6A 4ZRIA 1AWEA 1EF1A 2D9ZA 1I2HA 2J0MA 2D9WA 4HATB 4HHVA 3TW1A 2H7DA 1RRPB 2ADZA 2V76A 1V5UA 4WSFA 4IOYX 1XCGA 1DBHA 1RJ2A 2OTXA 1FB8A 4KAXB 3CXBB 1V89A 2J0KA 2CY4A 4WJ7A 1U5GA 1XR0B 2M38A 3KZ1A 4K81A 2J0JA 4GXBA 2D11A
chains in the Genus database with same CATH superfamily
1EVHA 1X11A 4Z2MB 4OT1A 2KIEA 3SO6A 2FJLA 1GC7A 2QKMA 3NSUA 3ZVRA 2RGNB 2NMBA 4EKUA 3MPXA 2HTHB 5FI1A 2K2UA 2MFQA 3D8FA 2D9YA 3DXDA 3A98B 1P6SA 1XKEA 1ZM0A 3NWFA 1BWNA 2D4QA 2Z0QA 2CRFA 1SHCA 3A58A 1U5FA 1XD4A 1LW3A 3NWAA 4KHOA 3TVVA 2BCJA 3NWDA 1MK9B 5I2SA 2W2XD 1MPHA 1W1HA 2UZSA 4B6HA 4A6KA 1ZC4B 5I2MA 1NTYA 4K2OA 2KUQA 2AEHA 4NY0A 2I1JA 3OANA 4DX8A 1DROA 2K00A 2MKRA 1W1DA 3U12A 2GS0A 4XWXA 5DI9B 5KCVA 3HIEA 2RVBB 4TKNA 2FJUB 1QC6A 4GOUA 4QJ4B 1TXDA 4KVGB 1BAKA 4HB4B 1AQCA 3TO1A 5JHHA 1PLSA 3DXCA 5DH9B 2DA0A 3HW2B 2RUKB 4CSQA 2DYNA 2R2YA 1M7RA 2DN6A 5C5BB 4F7HA 2GUMA 2ELBA 2YS1A 4A6FA 4Z2NA 3P7ZA 1T77A 1V5PA 2Z0OA 5JP4A 1X05A 2Z14A 5J3QA 2P0FA 1UNRA 2EMSA 1EAZA 2DTCA 4IFSA 1UPRA 4MY6A 1MAIA 2GCJA 3D8DA 1UEFA 5CLLB 1V88A 2ZKMX 4C0AA 5IRSA 1XODA 2DHKA 1NU2A 2Z59A 4EJNA 2R09A 1WGQA 3AU4A 2EJ8A 2CODA 3KY9A 5J3TA 1PMSA 5D27A 2YVCA 4HAZB 3CIKA 3FSSA 2W2XC 3FM8C 1ZVRA 1Q67A 2RLOA 1DYNA 5D3WA 3HK0A 2H7EA 1OY2A 5LG4B 4KHBA 5HE0A 4WVFB 4PQ0A 2Y8FA 1Z87A 2P0DA 3F5RA 5DIFB 3PVWA 4F7GA 2MWNB 4YONA 2M14A 2CAYA 1WG7A 1H10A 2DYQA 1X1FA 2GCLA 3V5WA 2Y8GA 3QBVB 2K49A 4GN1A 4HDOA 2DX5A 4DX90 2YT2A 3LJUX 3ODXA 4HB2B 3A8PA 2VKIA 4PNKA 4QXAB 2G35A 3KRWA 2IYBA 2VRWB 5JHGA 1GG3A 3BINA 5D3YA 4CHJA 2YS3A 5CLQB 1BTKA 3OHMB 2KCJA 3P6AA 1FHXA 1IRSA 4A6HA 2RSGA 5KQ1A 2KIGA 1WJMA 4OSNA 3MDBC 5L81A 4GPTB 3N7CA 3TCAA 4BBKA 4KHBB 1OQNA 2YF0A 1U2BA 3DCXA 1U5EA 1FGZA 2N23A 2Z13A 4GNKB 5C16A 3U7DA 2IFSA 1MIZB 3SYXA 1X86A 4GMVA 3SUZA 5HE2A 5HE1A 1UNPA 2D9VA 3PG7A 1B55A 1ISNA 4GZUA 4HSIA 4HB0B 4IAPA 2YRYA 3PP2A 2COAA 3FEHA 4EMOA 2GJYA 1U27A 1MIXA 4DXAB 4K2PA 2LKOA 1P3RA 5LONB 1DDVA 2Z0PA 3D8EA 2YSZA 1FGYA 2D2QA 4MK0A 5GOWB 1E5WA 2ZPYA 3B77A 5C6RA 1OMWA 3KSYA 2P8VA 3VOQA 1NTVA 2L1CA 2MDXA 3F0WA 3PEGA 4HAWB 3G9WA 4ZRJA 2RRFA 1UNQA 2UZRA 3HQCA 4HAVB 2QKLA 3QWMA 2HE7A 2NZ8B 4H8SA 3AU5A 2J59M 1MI1A 3QIJA 4A6FB 4ZRKA 3T06A 4YL8A 3X23A 1ZSQA 1KZ7A 5EFXA 2DKPA 1U29A 4MT7A 1TJ6A 2DKQA 3IVFA 2LULA 4DIXA 2P0HA 2DLWA 1MKEA 5D3VA 1DDWA 4HAUB 1W1GA 2K2JA 1TQZA 3ULCA 4QJ3B 4D0NB 1V61A 1XX0A 4DBBA 3PSCA 3VIAA 2D10A 1M7EA 1WI1A 5FI0A 3PZDA 1MK7B 2W2WA 3DXEA 3FVCA 1SGHA 3ZDTA 3RCPA 4L6EA 2CY5A 1BTNA 3U8ZA 1LB1A 1KI1B 1FHOA 2KR0A 5HE3A 2E2XA 5J3YA 3TFMA 2LOZA 4F7UP 2VSZA 2LYDA 4GMXB 1Y5OA 3ML4A 5M4YB 4HAYB 1FHWA 2I1KA 2DHIA 3WYFB 2KUPA 3BJIA 4HAXB 2I5CA 4K17A 5DHAB 2LOXA 3AJ4A 2NBVA 4TYZA 2KGXB 1WJ1A 3SV1A 3PVLA 2R0DA 2N0YA 1WVHA 1ZC3B 1QQGA 2X18A 1J0WA 1NI2A 4A5KA 2RNRB 2XQNM 1V5MA 4CHMA 5C5BA 2PZ1A 3ODWA 2YS5A 3ULBA 3O96A 2Y7BA 3HSAA 1P5TA 1WGUA 2YT0A 1FAOA 3M1IB 4L1RA 2YT1A 1PFJA 2I5FA 2EMTA 3GYOA 2COCA 1Y19B 2ROZB 1FOEA 5KQ4A 2AL6A 1U5DA 4Y94A 2K8EA 3GYPA 3WA0A 2ELAA 2D9XA 3UZTA 1K5GB 3KRXA 4NSWA 4HDQA 5JLJB 2ROVA 5D3XA 1DDMA 1N3HA 2Q13A 4QJ5B 2OQBA 3NW8A 4HB3B 2DHJA 2JP2A 1K5DB 2COFA 3SNHA 5LOPB 2DFKA 2EC1A 2UVMA 2DX1A 3ODOA 2LG1A 1EGXA 2L2IA 5C79A 1UPQA 3A8QA 4P7IA 1H4RA 2Z4DA 1X1GA 1I7AA 3PVUA 1J19A 1KZGA 5DHFB 4KHAA 4CYEA 1GC6A 4ZRIA 1AWEA 1EF1A 2D9ZA 1I2HA 2J0MA 2D9WA 4HATB 4HHVA 3TW1A 4D6WA 2H7DA 1RRPB 2ADZA 2V76A 1ZYIA 1V5UA 4WSFA 4IOYX 1XCGA 1DBHA 1RJ2A 2OTXA 1FB8A 4KAXB 3CXBB 1V89A 2J0KA 2CY4A 4WJ7A 1U5GA 1XR0B 2M38A 3KZ1A 4K81A 2J0JA 4GXBA 2D11A
chains in the Genus database with same CATH topology
1EVHA 1X11A 4Z2MB 3SO6A 2FJLA 1GC7A 2QKMA 3NSUA 3ZVRA 2RGNB 2NMBA 4EKUA 3MPXA 2HTHB 5FI1A 2K2UA 2MFQA 3D8FA 2D9YA 3DXDA 3A98B 1P6SA 1XKEA 1ZM0A 1BWNA 2D4QA 2Z0QA 2CRFA 1SHCA 1U5FA 1XD4A 1LW3A 4KHOA 3TVVA 2BCJA 1MK9B 2W2XD 1MPHA 1W1HA 2UZSA 4B6HA 4A6KA 1ZC4B 1NTYA 4K2OA 2AEHA 4NY0A 2I1JA 3OANA 4DX8A 1DROA 2K00A 2MKRA 1W1DA 2GS0A 4XWXA 5DI9B 5KCVA 2RVBB 4TKNA 1QC6A 1TXDA 4KVGB 1BAKA 4HB4B 1AQCA 3TO1A 5JHHA 1PLSA 3DXCA 5DH9B 2DA0A 3HW2B 2RUKB 2DYNA 1M7RA 2DN6A 5C5BB 4F7HA 4A6FA 2ELBA 2YS1A 4Z2NA 3P7ZA 1V5PA 2Z0OA 5JP4A 1X05A 5J3QA 2P0FA 1UNRA 2EMSA 1EAZA 2DTCA 4IFSA 1UPRA 4MY6A 1MAIA 2GCJA 3D8DA 1UEFA 5CLLB 1V88A 4C0AA 1XODA 2DHKA 1NU2A 4EJNA 2R09A 1WGQA 3AU4A 2EJ8A 2CODA 3KY9A 5J3TA 1PMSA 5D27A 2YVCA 4HAZB 3CIKA 3FSSA 2W2XC 3FM8C 1ZVRA 1Q67A 2RLOA 1DYNA 5D3WA 3HK0A 2H7EA 1OY2A 5HE0A 4WVFB 4PQ0A 2Y8FA 1Z87A 2P0DA 3F5RA 5DIFB 3PVWA 4F7GA 2MWNB 4YONA 2M14A 2CAYA 1WG7A 1H10A 2DYQA 1X1FA 2GCLA 3V5WA 2Y8GA 3QBVB 4GN1A 4HDOA 2DX5A 4DX90 3LJUX 3ODXA 4HB2B 3A8PA 2VKIA 4PNKA 2G35A 3KRWA 2IYBA 2VRWB 5JHGA 1GG3A 3BINA 5D3YA 4CHJA 2YS3A 5CLQB 1BTKA 2KCJA 3P6AA 1FHXA 1IRSA 4A6HA 2RSGA 5KQ1A 1WJMA 3MDBC 5L81A 4GPTB 3N7CA 3TCAA 4BBKA 4KHBB 1OQNA 2YF0A 1U2BA 1U5EA 1FGZA 2N23A 5C16A 3U7DA 2IFSA 1MIZB 3SYXA 1X86A 4GMVA 3SUZA 5HE2A 5HE1A 1UNPA 2D9VA 3PG7A 1B55A 1ISNA 4GZUA 4HB0B 4IAPA 2YRYA 3PP2A 2COAA 3FEHA 4EMOA 2GJYA 1U27A 1MIXA 4DXAB 4K2PA 2LKOA 1P3RA 5LONB 1DDVA 2Z0PA 3D8EA 2YSZA 1FGYA 2D2QA 4MK0A 5GOWB 1E5WA 2ZPYA 5C6RA 1OMWA 3KSYA 2P8VA 3VOQA 1NTVA 2L1CA 2MDXA 3F0WA 3PEGA 4HAWB 3G9WA 4ZRJA 1UNQA 2UZRA 3HQCA 4HAVB 2QKLA 3QWMA 2HE7A 2NZ8B 4H8SA 3AU5A 2J59M 3QIJA 4A6FB 4ZRKA 3T06A 4YL8A 3X23A 1ZSQA 1KZ7A 5EFXA 2DKPA 1U29A 4MT7A 1TJ6A 2DKQA 3IVFA 2LULA 2P0HA 2DLWA 1MKEA 5D3VA 1DDWA 4HAUB 1W1GA 2K2JA 1TQZA 3ULCA 4D0NB 1V61A 1XX0A 4DBBA 3PSCA 3VIAA 2D10A 1M7EA 1WI1A 5FI0A 3PZDA 1MK7B 2W2WA 3DXEA 1SGHA 3ZDTA 3RCPA 4L6EA 2CY5A 1BTNA 3U8ZA 1LB1A 1KI1B 1FHOA 5HE3A 2E2XA 5J3YA 3TFMA 2LOZA 4F7UP 2VSZA 2LYDA 4GMXB 1Y5OA 3ML4A 4HAYB 1FHWA 2I1KA 2DHIA 3WYFB 2KUPA 3BJIA 4HAXB 2I5CA 4K17A 5DHAB 2LOXA 3AJ4A 4TYZA 2KGXB 1WJ1A 3SV1A 3PVLA 2R0DA 2N0YA 1WVHA 1ZC3B 1QQGA 2X18A 1J0WA 1NI2A 4A5KA 2RNRB 2XQNM 1V5MA 4CHMA 5C5BA 2PZ1A 3ODWA 2YS5A 3ULBA 3O96A 2Y7BA 1P5TA 1WGUA 2YT0A 1FAOA 3M1IB 2YT1A 1PFJA 2I5FA 2EMTA 3GYOA 2COCA 1Y19B 2ROZB 1FOEA 5KQ4A 2AL6A 1U5DA 4Y94A 3GYPA 3WA0A 2ELAA 2D9XA 3UZTA 1K5GB 3KRXA 4NSWA 4HDQA 5JLJB 2ROVA 5D3XA 1DDMA 1N3HA 2Q13A 2OQBA 4HB3B 2DHJA 2JP2A 1K5DB 2COFA 3SNHA 5LOPB 2DFKA 2EC1A 2UVMA 2DX1A 3ODOA 2LG1A 1EGXA 2L2IA 5C79A 1UPQA 3A8QA 4P7IA 1H4RA 1X1GA 1I7AA 3PVUA 1J19A 1KZGA 5DHFB 4KHAA 4CYEA 1GC6A 4ZRIA 1AWEA 1EF1A 2D9ZA 1I2HA 2J0MA 2D9WA 4HATB 4HHVA 3TW1A 2H7DA 1RRPB 2ADZA 2V76A 1V5UA 4WSFA 4IOYX 1XCGA 1DBHA 1RJ2A 2OTXA 1FB8A 4KAXB 3CXBB 1V89A 2J0KA 2CY4A 4WJ7A 1U5GA 1XR0B 2M38A 3KZ1A 4K81A 2J0JA 4GXBA 2D11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EVH A;  1X11 A;  4Z2M B;  3SO6 A;  2FJL A;  1GC7 A;  2QKM A;  3NSU A;  3ZVR A;  2RGN B;  2NMB A;  4EKU A;  3MPX A;  2HTH B;  5FI1 A;  2K2U A;  2MFQ A;  3D8F A;  2D9Y A;  3DXD A;  3A98 B;  1P6S A;  1XKE A;  1ZM0 A;  1BWN A;  2D4Q A;  2Z0Q A;  2CRF A;  1SHC A;  1U5F A;  1XD4 A;  1LW3 A;  4KHO A;  3TVV A;  2BCJ A;  1MK9 B;  2W2X D;  1MPH A;  1W1H A;  2UZS A;  4B6H A;  4A6K A;  1ZC4 B;  1NTY A;  4K2O A;  2AEH A;  4NY0 A;  2I1J A;  3OAN A;  4DX8 A;  1DRO A;  2K00 A;  2MKR A;  1W1D A;  2GS0 A;  4XWX A;  5DI9 B;  5KCV A;  2RVB B;  4TKN A;  1QC6 A;  1TXD A;  4KVG B;  1BAK A;  4HB4 B;  1AQC A;  3TO1 A;  5JHH A;  1PLS A;  3DXC A;  5DH9 B;  2DA0 A;  3HW2 B;  2RUK B;  2DYN A;  1M7R A;  2DN6 A;  5C5B B;  4F7H A;  4A6F A;  2ELB A;  2YS1 A;  4Z2N A;  3P7Z A;  1V5P A;  2Z0O A;  5JP4 A;  1X05 A;  5J3Q A;  2P0F A;  1UNR A;  2EMS A;  1EAZ A;  2DTC A;  4IFS A;  1UPR A;  4MY6 A;  1MAI A;  2GCJ A;  3D8D A;  1UEF A;  5CLL B;  1V88 A;  4C0A A;  1XOD A;  2DHK A;  1NU2 A;  4EJN A;  2R09 A;  1WGQ A;  3AU4 A;  2EJ8 A;  2COD A;  3KY9 A;  5J3T A;  1PMS A;  5D27 A;  2YVC A;  4HAZ B;  3CIK A;  3FSS A;  2W2X C;  3FM8 C;  1ZVR A;  1Q67 A;  2RLO A;  1DYN A;  5D3W A;  3HK0 A;  2H7E A;  1OY2 A;  5HE0 A;  4WVF B;  4PQ0 A;  2Y8F A;  1Z87 A;  2P0D A;  3F5R A;  5DIF B;  3PVW A;  4F7G A;  2MWN B;  4YON A;  2M14 A;  2CAY A;  1WG7 A;  1H10 A;  2DYQ A;  1X1F A;  2GCL A;  3V5W A;  2Y8G A;  3QBV B;  4GN1 A;  4HDO A;  2DX5 A;  4DX9 0;  3LJU X;  3ODX A;  4HB2 B;  3A8P A;  2VKI A;  4PNK A;  2G35 A;  3KRW A;  2IYB A;  2VRW B;  5JHG A;  1GG3 A;  3BIN A;  5D3Y A;  4CHJ A;  2YS3 A;  5CLQ B;  1BTK A;  2KCJ A;  3P6A A;  1FHX A;  1IRS A;  4A6H A;  2RSG A;  5KQ1 A;  1WJM A;  3MDB C;  5L81 A;  4GPT B;  3N7C A;  3TCA A;  4BBK A;  4KHB B;  1OQN A;  2YF0 A;  1U2B A;  1U5E A;  1FGZ A;  2N23 A;  5C16 A;  3U7D A;  2IFS A;  1MIZ B;  3SYX A;  1X86 A;  4GMV A;  3SUZ A;  5HE2 A;  5HE1 A;  1UNP A;  2D9V A;  3PG7 A;  1B55 A;  1ISN A;  4GZU A;  4HB0 B;  4IAP A;  2YRY A;  3PP2 A;  2COA A;  3FEH A;  4EMO A;  2GJY A;  1U27 A;  1MIX A;  4DXA B;  4K2P A;  2LKO A;  1P3R A;  5LON B;  1DDV A;  2Z0P A;  3D8E A;  2YSZ A;  1FGY A;  2D2Q A;  4MK0 A;  5GOW B;  1E5W A;  2ZPY A;  5C6R A;  1OMW A;  3KSY A;  2P8V A;  3VOQ A;  1NTV A;  2L1C A;  2MDX A;  3F0W A;  3PEG A;  4HAW B;  3G9W A;  4ZRJ A;  1UNQ A;  2UZR A;  3HQC A;  4HAV B;  2QKL A;  3QWM A;  2HE7 A;  2NZ8 B;  4H8S A;  3AU5 A;  2J59 M;  3QIJ A;  4A6F B;  4ZRK A;  3T06 A;  4YL8 A;  3X23 A;  1ZSQ A;  1KZ7 A;  5EFX A;  2DKP A;  1U29 A;  4MT7 A;  1TJ6 A;  2DKQ A;  3IVF A;  2LUL A;  2P0H A;  2DLW A;  1MKE A;  5D3V A;  1DDW A;  4HAU B;  1W1G A;  2K2J A;  1TQZ A;  3ULC A;  4D0N B;  1V61 A;  1XX0 A;  4DBB A;  3PSC A;  3VIA A;  2D10 A;  1M7E A;  1WI1 A;  5FI0 A;  3PZD A;  1MK7 B;  2W2W A;  3DXE A;  1SGH A;  3ZDT A;  3RCP A;  4L6E A;  2CY5 A;  1BTN A;  3U8Z A;  1LB1 A;  1KI1 B;  1FHO A;  5HE3 A;  2E2X A;  5J3Y A;  3TFM A;  2LOZ A;  4F7U P;  2VSZ A;  2LYD A;  4GMX B;  1Y5O A;  3ML4 A;  4HAY B;  1FHW A;  2I1K A;  2DHI A;  3WYF B;  2KUP A;  3BJI A;  4HAX B;  2I5C A;  4K17 A;  5DHA B;  2LOX A;  3AJ4 A;  4TYZ A;  2KGX B;  1WJ1 A;  3SV1 A;  3PVL A;  2R0D A;  2N0Y A;  1WVH A;  1ZC3 B;  1QQG A;  2X18 A;  1J0W A;  1NI2 A;  4A5K A;  2RNR B;  2XQN M;  1V5M A;  4CHM A;  5C5B A;  2PZ1 A;  3ODW A;  2YS5 A;  3ULB A;  3O96 A;  2Y7B A;  1P5T A;  1WGU A;  2YT0 A;  1FAO A;  3M1I B;  2YT1 A;  1PFJ A;  2I5F A;  2EMT A;  3GYO A;  2COC A;  1Y19 B;  2ROZ B;  1FOE A;  5KQ4 A;  2AL6 A;  1U5D A;  4Y94 A;  3GYP A;  3WA0 A;  2ELA A;  2D9X A;  3UZT A;  1K5G B;  3KRX A;  4NSW A;  4HDQ A;  5JLJ B;  2ROV A;  5D3X A;  1DDM A;  1N3H A;  2Q13 A;  2OQB A;  4HB3 B;  2DHJ A;  2JP2 A;  1K5D B;  2COF A;  3SNH A;  5LOP B;  2DFK A;  2EC1 A;  2UVM A;  2DX1 A;  3ODO A;  2LG1 A;  1EGX A;  2L2I A;  5C79 A;  1UPQ A;  3A8Q A;  4P7I A;  1H4R A;  1X1G A;  1I7A A;  3PVU A;  1J19 A;  1KZG A;  5DHF B;  4KHA A;  4CYE A;  1GC6 A;  4ZRI A;  1AWE A;  1EF1 A;  2D9Z A;  1I2H A;  2J0M A;  2D9W A;  4HAT B;  4HHV A;  3TW1 A;  2H7D A;  1RRP B;  2ADZ A;  2V76 A;  1V5U A;  4WSF A;  4IOY X;  1XCG A;  1DBH A;  1RJ2 A;  2OTX A;  1FB8 A;  4KAX B;  3CXB B;  1V89 A;  2J0K A;  2CY4 A;  4WJ7 A;  1U5G A;  1XR0 B;  2M38 A;  3KZ1 A;  4K81 A;  2J0J A;  4GXB A;  2D11 A; 
#chains in the Genus database with same CATH topology
 1EVH A;  1X11 A;  4Z2M B;  4OT1 A;  2KIE A;  3SO6 A;  2FJL A;  1GC7 A;  2QKM A;  3NSU A;  3ZVR A;  2RGN B;  2NMB A;  4EKU A;  3MPX A;  2HTH B;  5FI1 A;  2K2U A;  2MFQ A;  3D8F A;  2D9Y A;  3DXD A;  3A98 B;  1P6S A;  1XKE A;  1ZM0 A;  3NWF A;  1BWN A;  2D4Q A;  2Z0Q A;  2CRF A;  1SHC A;  3A58 A;  1U5F A;  1XD4 A;  1LW3 A;  3NWA A;  4KHO A;  3TVV A;  2BCJ A;  3NWD A;  1MK9 B;  5I2S A;  2W2X D;  1MPH A;  1W1H A;  2UZS A;  4B6H A;  4A6K A;  1ZC4 B;  5I2M A;  1NTY A;  4K2O A;  2KUQ A;  2AEH A;  4NY0 A;  2I1J A;  3OAN A;  4DX8 A;  1DRO A;  2K00 A;  2MKR A;  1W1D A;  3U12 A;  2GS0 A;  4XWX A;  5DI9 B;  5KCV A;  3HIE A;  2RVB B;  4TKN A;  2FJU B;  1QC6 A;  4GOU A;  4QJ4 B;  1TXD A;  4KVG B;  1BAK A;  4HB4 B;  1AQC A;  3TO1 A;  5JHH A;  1PLS A;  3DXC A;  5DH9 B;  2DA0 A;  3HW2 B;  2RUK B;  4CSQ A;  2DYN A;  2R2Y A;  1M7R A;  2DN6 A;  5C5B B;  4F7H A;  2GUM A;  2ELB A;  2YS1 A;  4A6F A;  4Z2N A;  3P7Z A;  1T77 A;  1V5P A;  2Z0O A;  5JP4 A;  1X05 A;  2Z14 A;  5J3Q A;  2P0F A;  1UNR A;  2EMS A;  1EAZ A;  2DTC A;  4IFS A;  1UPR A;  4MY6 A;  1MAI A;  2GCJ A;  3D8D A;  1UEF A;  5CLL B;  1V88 A;  2ZKM X;  4C0A A;  5IRS A;  1XOD A;  2DHK A;  1NU2 A;  2Z59 A;  4EJN A;  2R09 A;  1WGQ A;  3AU4 A;  2EJ8 A;  2COD A;  3KY9 A;  5J3T A;  1PMS A;  5D27 A;  2YVC A;  4HAZ B;  3CIK A;  3FSS A;  2W2X C;  3FM8 C;  1ZVR A;  1Q67 A;  2RLO A;  1DYN A;  5D3W A;  3HK0 A;  2H7E A;  1OY2 A;  5LG4 B;  4KHB A;  5HE0 A;  4WVF B;  4PQ0 A;  2Y8F A;  1Z87 A;  2P0D A;  3F5R A;  5DIF B;  3PVW A;  4F7G A;  2MWN B;  4YON A;  2M14 A;  2CAY A;  1WG7 A;  1H10 A;  2DYQ A;  1X1F A;  2GCL A;  3V5W A;  2Y8G A;  3QBV B;  2K49 A;  4GN1 A;  4HDO A;  2DX5 A;  4DX9 0;  2YT2 A;  3LJU X;  3ODX A;  4HB2 B;  3A8P A;  2VKI A;  4PNK A;  4QXA B;  2G35 A;  3KRW A;  2IYB A;  2VRW B;  5JHG A;  1GG3 A;  3BIN A;  5D3Y A;  4CHJ A;  2YS3 A;  5CLQ B;  1BTK A;  3OHM B;  2KCJ A;  3P6A A;  1FHX A;  1IRS A;  4A6H A;  2RSG A;  5KQ1 A;  2KIG A;  1WJM A;  4OSN A;  3MDB C;  5L81 A;  4GPT B;  3N7C A;  3TCA A;  4BBK A;  4KHB B;  1OQN A;  2YF0 A;  1U2B A;  3DCX A;  1U5E A;  1FGZ A;  2N23 A;  2Z13 A;  4GNK B;  5C16 A;  3U7D A;  2IFS A;  1MIZ B;  3SYX A;  1X86 A;  4GMV A;  3SUZ A;  5HE2 A;  5HE1 A;  1UNP A;  2D9V A;  3PG7 A;  1B55 A;  1ISN A;  4GZU A;  4HSI A;  4HB0 B;  4IAP A;  2YRY A;  3PP2 A;  2COA A;  3FEH A;  4EMO A;  2GJY A;  1U27 A;  1MIX A;  4DXA B;  4K2P A;  2LKO A;  1P3R A;  5LON B;  1DDV A;  2Z0P A;  3D8E A;  2YSZ A;  1FGY A;  2D2Q A;  4MK0 A;  5GOW B;  1E5W A;  2ZPY A;  3B77 A;  5C6R A;  1OMW A;  3KSY A;  2P8V A;  3VOQ A;  1NTV A;  2L1C A;  2MDX A;  3F0W A;  3PEG A;  4HAW B;  3G9W A;  4ZRJ A;  2RRF A;  1UNQ A;  2UZR A;  3HQC A;  4HAV B;  2QKL A;  3QWM A;  2HE7 A;  2NZ8 B;  4H8S A;  3AU5 A;  2J59 M;  1MI1 A;  3QIJ A;  4A6F B;  4ZRK A;  3T06 A;  4YL8 A;  3X23 A;  1ZSQ A;  1KZ7 A;  5EFX A;  2DKP A;  1U29 A;  4MT7 A;  1TJ6 A;  2DKQ A;  3IVF A;  2LUL A;  4DIX A;  2P0H A;  2DLW A;  1MKE A;  5D3V A;  1DDW A;  4HAU B;  1W1G A;  2K2J A;  1TQZ A;  3ULC A;  4QJ3 B;  4D0N B;  1V61 A;  1XX0 A;  4DBB A;  3PSC A;  3VIA A;  2D10 A;  1M7E A;  1WI1 A;  5FI0 A;  3PZD A;  1MK7 B;  2W2W A;  3DXE A;  3FVC A;  1SGH A;  3ZDT A;  3RCP A;  4L6E A;  2CY5 A;  1BTN A;  3U8Z A;  1LB1 A;  1KI1 B;  1FHO A;  2KR0 A;  5HE3 A;  2E2X A;  5J3Y A;  3TFM A;  2LOZ A;  4F7U P;  2VSZ A;  2LYD A;  4GMX B;  1Y5O A;  3ML4 A;  5M4Y B;  4HAY B;  1FHW A;  2I1K A;  2DHI A;  3WYF B;  2KUP A;  3BJI A;  4HAX B;  2I5C A;  4K17 A;  5DHA B;  2LOX A;  3AJ4 A;  2NBV A;  4TYZ A;  2KGX B;  1WJ1 A;  3SV1 A;  3PVL A;  2R0D A;  2N0Y A;  1WVH A;  1ZC3 B;  1QQG A;  2X18 A;  1J0W A;  1NI2 A;  4A5K A;  2RNR B;  2XQN M;  1V5M A;  4CHM A;  5C5B A;  2PZ1 A;  3ODW A;  2YS5 A;  3ULB A;  3O96 A;  2Y7B A;  3HSA A;  1P5T A;  1WGU A;  2YT0 A;  1FAO A;  3M1I B;  4L1R A;  2YT1 A;  1PFJ A;  2I5F A;  2EMT A;  3GYO A;  2COC A;  1Y19 B;  2ROZ B;  1FOE A;  5KQ4 A;  2AL6 A;  1U5D A;  4Y94 A;  2K8E A;  3GYP A;  3WA0 A;  2ELA A;  2D9X A;  3UZT A;  1K5G B;  3KRX A;  4NSW A;  4HDQ A;  5JLJ B;  2ROV A;  5D3X A;  1DDM A;  1N3H A;  2Q13 A;  4QJ5 B;  2OQB A;  3NW8 A;  4HB3 B;  2DHJ A;  2JP2 A;  1K5D B;  2COF A;  3SNH A;  5LOP B;  2DFK A;  2EC1 A;  2UVM A;  2DX1 A;  3ODO A;  2LG1 A;  1EGX A;  2L2I A;  5C79 A;  1UPQ A;  3A8Q A;  4P7I A;  1H4R A;  2Z4D A;  1X1G A;  1I7A A;  3PVU A;  1J19 A;  1KZG A;  5DHF B;  4KHA A;  4CYE A;  1GC6 A;  4ZRI A;  1AWE A;  1EF1 A;  2D9Z A;  1I2H A;  2J0M A;  2D9W A;  4HAT B;  4HHV A;  3TW1 A;  4D6W A;  2H7D A;  1RRP B;  2ADZ A;  2V76 A;  1ZYI A;  1V5U A;  4WSF A;  4IOY X;  1XCG A;  1DBH A;  1RJ2 A;  2OTX A;  1FB8 A;  4KAX B;  3CXB B;  1V89 A;  2J0K A;  2CY4 A;  4WJ7 A;  1U5G A;  1XR0 B;  2M38 A;  3KZ1 A;  4K81 A;  2J0J A;  4GXB A;  2D11 A; 
#chains in the Genus database with same CATH homology
 1EVH A;  1X11 A;  4Z2M B;  3SO6 A;  2FJL A;  1GC7 A;  2QKM A;  3NSU A;  3ZVR A;  2RGN B;  2NMB A;  4EKU A;  3MPX A;  2HTH B;  5FI1 A;  2K2U A;  2MFQ A;  3D8F A;  2D9Y A;  3DXD A;  3A98 B;  1P6S A;  1XKE A;  1ZM0 A;  1BWN A;  2D4Q A;  2Z0Q A;  2CRF A;  1SHC A;  1U5F A;  1XD4 A;  1LW3 A;  4KHO A;  3TVV A;  2BCJ A;  1MK9 B;  2W2X D;  1MPH A;  1W1H A;  2UZS A;  4B6H A;  4A6K A;  1ZC4 B;  1NTY A;  4K2O A;  2AEH A;  4NY0 A;  2I1J A;  3OAN A;  4DX8 A;  1DRO A;  2K00 A;  2MKR A;  1W1D A;  2GS0 A;  4XWX A;  5DI9 B;  5KCV A;  2RVB B;  4TKN A;  1QC6 A;  1TXD A;  4KVG B;  1BAK A;  4HB4 B;  1AQC A;  3TO1 A;  5JHH A;  1PLS A;  3DXC A;  5DH9 B;  2DA0 A;  3HW2 B;  2RUK B;  2DYN A;  1M7R A;  2DN6 A;  5C5B B;  4F7H A;  4A6F A;  2ELB A;  2YS1 A;  4Z2N A;  3P7Z A;  1V5P A;  2Z0O A;  5JP4 A;  1X05 A;  5J3Q A;  2P0F A;  1UNR A;  2EMS A;  1EAZ A;  2DTC A;  4IFS A;  1UPR A;  4MY6 A;  1MAI A;  2GCJ A;  3D8D A;  1UEF A;  5CLL B;  1V88 A;  4C0A A;  1XOD A;  2DHK A;  1NU2 A;  4EJN A;  2R09 A;  1WGQ A;  3AU4 A;  2EJ8 A;  2COD A;  3KY9 A;  5J3T A;  1PMS A;  5D27 A;  2YVC A;  4HAZ B;  3CIK A;  3FSS A;  2W2X C;  3FM8 C;  1ZVR A;  1Q67 A;  2RLO A;  1DYN A;  5D3W A;  3HK0 A;  2H7E A;  1OY2 A;  5HE0 A;  4WVF B;  4PQ0 A;  2Y8F A;  1Z87 A;  2P0D A;  3F5R A;  5DIF B;  3PVW A;  4F7G A;  2MWN B;  4YON A;  2M14 A;  2CAY A;  1WG7 A;  1H10 A;  2DYQ A;  1X1F A;  2GCL A;  3V5W A;  2Y8G A;  3QBV B;  4GN1 A;  4HDO A;  2DX5 A;  4DX9 0;  3LJU X;  3ODX A;  4HB2 B;  3A8P A;  2VKI A;  4PNK A;  2G35 A;  3KRW A;  2IYB A;  2VRW B;  5JHG A;  1GG3 A;  3BIN A;  5D3Y A;  4CHJ A;  2YS3 A;  5CLQ B;  1BTK A;  2KCJ A;  3P6A A;  1FHX A;  1IRS A;  4A6H A;  2RSG A;  5KQ1 A;  1WJM A;  3MDB C;  5L81 A;  4GPT B;  3N7C A;  3TCA A;  4BBK A;  4KHB B;  1OQN A;  2YF0 A;  1U2B A;  1U5E A;  1FGZ A;  2N23 A;  5C16 A;  3U7D A;  2IFS A;  1MIZ B;  3SYX A;  1X86 A;  4GMV A;  3SUZ A;  5HE2 A;  5HE1 A;  1UNP A;  2D9V A;  3PG7 A;  1B55 A;  1ISN A;  4GZU A;  4HB0 B;  4IAP A;  2YRY A;  3PP2 A;  2COA A;  3FEH A;  4EMO A;  2GJY A;  1U27 A;  1MIX A;  4DXA B;  4K2P A;  2LKO A;  1P3R A;  5LON B;  1DDV A;  2Z0P A;  3D8E A;  2YSZ A;  1FGY A;  2D2Q A;  4MK0 A;  5GOW B;  1E5W A;  2ZPY A;  5C6R A;  1OMW A;  3KSY A;  2P8V A;  3VOQ A;  1NTV A;  2L1C A;  2MDX A;  3F0W A;  3PEG A;  4HAW B;  3G9W A;  4ZRJ A;  1UNQ A;  2UZR A;  3HQC A;  4HAV B;  2QKL A;  3QWM A;  2HE7 A;  2NZ8 B;  4H8S A;  3AU5 A;  2J59 M;  3QIJ A;  4A6F B;  4ZRK A;  3T06 A;  4YL8 A;  3X23 A;  1ZSQ A;  1KZ7 A;  5EFX A;  2DKP A;  1U29 A;  4MT7 A;  1TJ6 A;  2DKQ A;  3IVF A;  2LUL A;  2P0H A;  2DLW A;  1MKE A;  5D3V A;  1DDW A;  4HAU B;  1W1G A;  2K2J A;  1TQZ A;  3ULC A;  4D0N B;  1V61 A;  1XX0 A;  4DBB A;  3PSC A;  3VIA A;  2D10 A;  1M7E A;  1WI1 A;  5FI0 A;  3PZD A;  1MK7 B;  2W2W A;  3DXE A;  1SGH A;  3ZDT A;  3RCP A;  4L6E A;  2CY5 A;  1BTN A;  3U8Z A;  1LB1 A;  1KI1 B;  1FHO A;  5HE3 A;  2E2X A;  5J3Y A;  3TFM A;  2LOZ A;  4F7U P;  2VSZ A;  2LYD A;  4GMX B;  1Y5O A;  3ML4 A;  4HAY B;  1FHW A;  2I1K A;  2DHI A;  3WYF B;  2KUP A;  3BJI A;  4HAX B;  2I5C A;  4K17 A;  5DHA B;  2LOX A;  3AJ4 A;  4TYZ A;  2KGX B;  1WJ1 A;  3SV1 A;  3PVL A;  2R0D A;  2N0Y A;  1WVH A;  1ZC3 B;  1QQG A;  2X18 A;  1J0W A;  1NI2 A;  4A5K A;  2RNR B;  2XQN M;  1V5M A;  4CHM A;  5C5B A;  2PZ1 A;  3ODW A;  2YS5 A;  3ULB A;  3O96 A;  2Y7B A;  1P5T A;  1WGU A;  2YT0 A;  1FAO A;  3M1I B;  2YT1 A;  1PFJ A;  2I5F A;  2EMT A;  3GYO A;  2COC A;  1Y19 B;  2ROZ B;  1FOE A;  5KQ4 A;  2AL6 A;  1U5D A;  4Y94 A;  3GYP A;  3WA0 A;  2ELA A;  2D9X A;  3UZT A;  1K5G B;  3KRX A;  4NSW A;  4HDQ A;  5JLJ B;  2ROV A;  5D3X A;  1DDM A;  1N3H A;  2Q13 A;  2OQB A;  4HB3 B;  2DHJ A;  2JP2 A;  1K5D B;  2COF A;  3SNH A;  5LOP B;  2DFK A;  2EC1 A;  2UVM A;  2DX1 A;  3ODO A;  2LG1 A;  1EGX A;  2L2I A;  5C79 A;  1UPQ A;  3A8Q A;  4P7I A;  1H4R A;  1X1G A;  1I7A A;  3PVU A;  1J19 A;  1KZG A;  5DHF B;  4KHA A;  4CYE A;  1GC6 A;  4ZRI A;  1AWE A;  1EF1 A;  2D9Z A;  1I2H A;  2J0M A;  2D9W A;  4HAT B;  4HHV A;  3TW1 A;  2H7D A;  1RRP B;  2ADZ A;  2V76 A;  1V5U A;  4WSF A;  4IOY X;  1XCG A;  1DBH A;  1RJ2 A;  2OTX A;  1FB8 A;  4KAX B;  3CXB B;  1V89 A;  2J0K A;  2CY4 A;  4WJ7 A;  1U5G A;  1XR0 B;  2M38 A;  3KZ1 A;  4K81 A;  2J0J A;  4GXB A;  2D11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...