2RNRB

Solution structure of the complex between tfiie alpha c-terminal acidic domain and tfiih p62 ph domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
108
structure length
108
Chain Sequence
MATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKISPEGKAKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into the TFIIE-TFIIH interaction: TFIIE and p53 share the binding region on TFIIH
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Transcription initiation factor IIE subunit alpha
total genus 24
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2008-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2rnrB00
5LONB 4CHJA 1EVHA 5JLJB 2VRWB 3FSSA 1FHOA 2YF0A 2ZPYA 3FM8C 2RNRB 3MDBC 5DHAB 2DLWA 3LJUX 3D8DA 3V5WA 3U8ZA 2MDXA 1TJ6A 1UNQA 1XKEA 5D27A 3BINA 2EMSA 5JHGA 1X1FA 1X1GA 5KQ1A 2L2IA 1SHCA 3PVUA 3QBVB 1NU2A 2P0DA 2KGXB 2DHIA 4MT7A 4YL8A 2MWNB 2DKQA 1WVHA 4KHBB 1Y5OA 1ZC3B 2HE7A 2QKMA 2UVMA 1U5GA 4A6HA 5HE1A 2OQBA 2H7DA 2DX1A 2COFA 3DXEA 4GN1A 1GG3A 2K2UA 4HDOA 2EJ8A 3X23A 1FGZA 4HB3B 4KHAA 1EAZA 1U29A 2RSGA 2E2XA 1U2BA 1P6SA 4A6FB 2AEHA 3KSYA 4Z2NA 2D9ZA 2D2QA 1GC7A 1LB1A 3HW2B 2P8VA 4DX90 3ML4A 3KY9A 5J3YA 1WJ1A 1BTKA 3DXDA 3A98B 3FEHA 2L1CA 4HATB 2Z0PA 1DDVA 1K5DB 2Y8GA 4CYEA 1W1DA 1PLSA 2MKRA 1W1GA 2YRYA 1ZVRA 5DI9B 2HTHB 1H10A 2D4QA 4ZRIA 2Z0QA 1DDMA 5HE2A 3TCAA 2COCA 4WVFB 2X18A 2RLOA 4HDQA 3ODWA 3PP2A 2DHKA 1PMSA 1V5MA 4KVGB 1KZ7A 5C16A 1ZSQA 3ZDTA 2KCJA 2DFKA 3PVLA 1AQCA 2J59M 3AJ4A 1DBHA 2UZRA 1UPRA 5HE0A 2YS5A 1PFJA 2BCJA 2YVCA 3AU5A 4IFSA 2CRFA 3A8PA 1MAIA 2VSZA 1FAOA 4A6KA 2D10A 2DX5A 1ZM0A 3PVWA 1GC6A 2QKLA 3HQCA 4K2OA 1XX0A 1XCGA 1P3RA 1QQGA 2DYQA 3SV1A 1X86A 1WJMA 1FHWA 2J0MA 4HAYB 2D9XA 1ISNA 2AL6A 2PZ1A 1MIZB 1UNRA 4YONA 4CHMA 4KAXB 2DTCA 5D3WA 1FHXA 2W2XC 2NMBA 3PG7A 3PZDA 5DHFB 1E5WA 4HHVA 4MK0A 3TW1A 3P6AA 2I1KA 2YS1A 2R0DA 1K5GB 3GYPA 4B6HA 3CXBB 4L6EA 2CY4A 2P0FA 2RUKB 1WGQA 3M1IB 5GOWB 5KCVA 4K81A 1V5PA 3ODXA 1B55A 2CODA 1RJ2A 1BTNA 2NZ8B 3ULBA 5D3YA 2G35A 3D8FA 3VOQA 2ROVA 3QIJA 2Z0OA 3VIAA 2DN6A 4DBBA 5C6RA 1UEFA 2K00A 2UZSA 4HB2B 4HAXB 4P7IA 4GXBA 1MK9B 3U7DA 1V5UA 4A6FA 5L81A 2ROZB 1MIXA 1FOEA 1I7AA 1UNPA 1BWNA 1WGUA 4PQ0A 4NY0A 2YT0A 1LW3A 4K2PA 3CIKA 1KZGA 1MPHA 1OY2A 3WA0A 1QC6A 3AU4A 2GS0A 2FJLA 5JP4A 4F7UP 3O96A 5J3QA 2DKPA 3D8EA 1P5TA 5FI0A 2ELBA 5EFXA 1NTVA 4TYZA 2W2WA 1IRSA 1U5EA 5FI1A 1U5DA 3ZVRA 2M14A 2GCLA 2P0HA 1RRPB 2YSZA 2Y8FA 3GYOA 1X05A 3T06A 3F5RA 5KQ4A 4F7GA 4KHOA 2M38A 3TFMA 3BJIA 1M7RA 4ZRJA 2JP2A 2EMTA 2VKIA 4H8SA 1AWEA 3UZTA 1BAKA 1UPQA 1XD4A 2IYBA 5D3XA 4D0NB 5C79A 1U5FA 2COAA 4GMVA 1NI2A 2J0JA 1N3HA 2DHJA 5J3TA 5HE3A 1SGHA 2XQNM 2K2JA 1EGXA 1H4RA 2LOZA 3MPXA 3IVFA 1KI1B 1ZC4B 1Q67A 1MK7B 1V61A 4Z2MB 5CLQB 4HAWB 1XR0B 2MFQA 1FB8A 3SNHA 4Y94A 1V89A 1NTYA 4NSWA 1U27A 2I5FA 2Q13A 1V88A 2CY5A 3SUZA 4EKUA 3PSCA 4HAZB 4EMOA 2LULA 1EF1A 1WI1A 3SYXA 2EC1A 3QWMA 2ELAA 3RCPA 2LG1A 4MY6A 2W2XD 3N7CA 5CLLB 2N23A 4WSFA 2D9VA 2H7EA 2I1JA 3KZ1A 3ODOA 2N0YA 1DROA 2D11A 1DDWA 4HB0B 2Y7BA 4WJ7A 1W1HA 5C5BB 4DX8A 3HK0A 3P7ZA 2ADZA 4GMXB 4IAPA 4C0AA 1Z87A 3DXCA 4PNKA 1MKEA 4BBKA 2YT1A 2IFSA 2LOXA 2KUPA 5C5BA 1J0WA 2GCJA 4F7HA 2R09A 2YS3A 1DYNA 4K17A 1TXDA 2CAYA 4IOYX 4HAUB 3KRXA 1M7EA 2RGNB 1OMWA 1J19A 2LYDA 1XODA 3OANA 2GJYA 2V76A 2D9WA 4GZUA 3F0WA 4HB4B 4A5KA 3TO1A 4EJNA 2D9YA 5DH9B 3NSUA 5DIFB 2DYNA 2I5CA 4DXAB 2OTXA 5JHHA 3SO6A 1TQZA 5LOPB 4HAVB 2DA0A 3KRWA 1Y19B 2RVBB 1WG7A 3TVVA 1FGYA 2J0KA 4ZRKA 1X11A 3A8QA 3PEGA 1I2HA 5D3VA 3ULCA 3G9WA 4XWXA 3WYFB 2LKOA 1OQNA 4GPTB 4TKNA
chains in the Genus database with same CATH superfamily
5LONB 4CHJA 1EVHA 5JLJB 2VRWB 3FSSA 1FHOA 2YF0A 2ZPYA 3FM8C 3MDBC 5DHAB 2DLWA 3LJUX 3D8DA 3V5WA 3NWAA 2K8EA 3U8ZA 2MDXA 1TJ6A 1UNQA 1XKEA 5D27A 3BINA 2EMSA 5JHGA 1X1FA 1X1GA 5KQ1A 2L2IA 1SHCA 3PVUA 3QBVB 1NU2A 2P0DA 2KGXB 2DHIA 4MT7A 4YL8A 2MWNB 2DKQA 1WVHA 4KHBB 1Y5OA 2FJUB 2Z14A 1ZC3B 2HE7A 2QKMA 2UVMA 4OT1A 1U5GA 4A6HA 4KHBA 5HE1A 2OQBA 2H7DA 2DX1A 2COFA 3DXEA 4GN1A 1GG3A 2K2UA 4HDOA 2EJ8A 3X23A 1FGZA 4HB3B 4KHAA 1EAZA 1U29A 2RSGA 2E2XA 1U2BA 1P6SA 4A6FB 2AEHA 3KSYA 4Z2NA 2D9ZA 2D2QA 1GC7A 1LB1A 3HW2B 2P8VA 4DX90 3ML4A 2Z13A 3KY9A 5J3YA 1WJ1A 1BTKA 4GNKB 3DXDA 3A98B 2YT2A 3FEHA 2KR0A 4OSNA 2L1CA 4HATB 2Z0PA 1DDVA 1K5DB 2Y8GA 4CYEA 1W1DA 1PLSA 5I2MA 2MKRA 1W1GA 2YRYA 1ZVRA 5DI9B 2HTHB 1H10A 2D4QA 4ZRIA 2Z0QA 1DDMA 5IRSA 5HE2A 3TCAA 2COCA 4WVFB 2X18A 2RLOA 4HDQA 3ODWA 3PP2A 2DHKA 1PMSA 1V5MA 4KVGB 1KZ7A 5C16A 1ZSQA 3ZDTA 2KCJA 2DFKA 3PVLA 1AQCA 2J59M 3AJ4A 1DBHA 2UZRA 1UPRA 5HE0A 2YS5A 1PFJA 2BCJA 2YVCA 3AU5A 4IFSA 2CRFA 3A8PA 1MAIA 2VSZA 1FAOA 4A6KA 2D10A 2DX5A 1ZM0A 3PVWA 1GC6A 4HSIA 2QKLA 3HQCA 4K2OA 1XX0A 4QJ3B 1XCGA 1P3RA 1QQGA 2DYQA 3SV1A 1X86A 1WJMA 1FHWA 2J0MA 4HAYB 2D9XA 1ISNA 2AL6A 2PZ1A 4CSQA 1MIZB 1UNRA 4YONA 3DCXA 4CHMA 4KAXB 2KIEA 2DTCA 5D3WA 1FHXA 2W2XC 2NMBA 3PG7A 3PZDA 5DHFB 1E5WA 4HHVA 3U12A 4MK0A 3TW1A 3P6AA 2I1KA 2YS1A 5LG4B 2R0DA 1MI1A 1K5GB 3GYPA 3HSAA 4B6HA 3CXBB 4L6EA 5M4YB 4D6WA 2CY4A 2P0FA 2RUKB 1WGQA 3M1IB 5GOWB 5KCVA 4K81A 1V5PA 3ODXA 1B55A 2CODA 2R2YA 1RJ2A 1BTNA 2NZ8B 3ULBA 4DIXA 5D3YA 2G35A 3D8FA 2GUMA 3VOQA 2ROVA 3A58A 3QIJA 2Z0OA 3VIAA 3NW8A 2DN6A 4DBBA 5C6RA 1UEFA 2K00A 2UZSA 4HB2B 2Z59A 3NWDA 4HAXB 4P7IA 4GXBA 1MK9B 3U7DA 1V5UA 4A6FA 5L81A 2ROZB 1MIXA 1FOEA 1I7AA 1UNPA 5I2SA 1BWNA 1WGUA 4PQ0A 4NY0A 2YT0A 1LW3A 4QJ5B 4K2PA 3CIKA 1KZGA 1MPHA 1OY2A 3WA0A 1QC6A 3AU4A 2GS0A 2FJLA 5JP4A 4F7UP 3O96A 5J3QA 2DKPA 3D8EA 1P5TA 5FI0A 2ELBA 5EFXA 1NTVA 4TYZA 2W2WA 1IRSA 1U5EA 5FI1A 1U5DA 3ZVRA 2M14A 2GCLA 2P0HA 1RRPB 2YSZA 4L1RA 2Y8FA 3GYOA 1X05A 3T06A 3F5RA 5KQ4A 4F7GA 4KHOA 2M38A 2KUQA 3TFMA 3BJIA 1M7RA 2ZKMX 4ZRJA 2JP2A 2EMTA 2VKIA 4H8SA 1ZYIA 1AWEA 3UZTA 1BAKA 1UPQA 1XD4A 2IYBA 5D3XA 1T77A 4D0NB 5C79A 1U5FA 2COAA 4GMVA 1NI2A 2J0JA 1N3HA 2DHJA 5J3TA 5HE3A 1SGHA 2XQNM 2K2JA 1EGXA 1H4RA 3MPXA 2LOZA 3IVFA 1KI1B 1ZC4B 1Q67A 1MK7B 1V61A 4Z2MB 5CLQB 4HAWB 1XR0B 2MFQA 1FB8A 3SNHA 3HIEA 4Y94A 2K49A 1V89A 1NTYA 4NSWA 1U27A 2I5FA 2Q13A 1V88A 2KIGA 2CY5A 3SUZA 2RRFA 4EKUA 3PSCA 4HAZB 3NWFA 4EMOA 2LULA 4QXAB 1EF1A 1WI1A 3SYXA 2EC1A 3QWMA 2ELAA 3RCPA 2LG1A 4MY6A 2W2XD 3N7CA 5CLLB 2N23A 4GPTB 4WSFA 2D9VA 2H7EA 2Z4DA 2I1JA 3KZ1A 3ODOA 2N0YA 1DROA 2D11A 1DDWA 4HB0B 2Y7BA 4WJ7A 1W1HA 5C5BB 4DX8A 3HK0A 3P7ZA 2ADZA 4GMXB 4IAPA 4C0AA 1Z87A 3DXCA 4PNKA 1MKEA 4BBKA 2YT1A 2IFSA 2LOXA 2KUPA 5C5BA 1J0WA 2GCJA 4F7HA 2R09A 3B77A 2YS3A 1DYNA 4K17A 1TXDA 2CAYA 4IOYX 4QJ4B 4HAUB 3KRXA 1M7EA 2RGNB 1OMWA 1J19A 2LYDA 1XODA 3OANA 2GJYA 2V76A 2D9WA 4GZUA 2NBVA 3F0WA 4HB4B 4A5KA 3TO1A 4EJNA 2D9YA 5DH9B 3NSUA 5DIFB 2DYNA 2I5CA 4DXAB 2OTXA 5JHHA 3SO6A 1TQZA 5LOPB 4HAVB 2DA0A 3KRWA 1Y19B 2RVBB 1WG7A 3TVVA 1FGYA 3OHMB 2J0KA 3FVCA 4ZRKA 1X11A 3A8QA 3PEGA 1I2HA 5D3VA 3ULCA 3G9WA 4XWXA 3WYFB 4GOUA 2LKOA 1OQNA 2RNRB 4TKNA
chains in the Genus database with same CATH topology
5LONB 4CHJA 1EVHA 5JLJB 2VRWB 3FSSA 1FHOA 2YF0A 2ZPYA 3FM8C 2RNRB 3MDBC 5DHAB 2DLWA 3LJUX 3D8DA 3V5WA 3U8ZA 2MDXA 1TJ6A 1UNQA 1XKEA 5D27A 3BINA 2EMSA 5JHGA 1X1FA 1X1GA 5KQ1A 2L2IA 1SHCA 3PVUA 3QBVB 1NU2A 2P0DA 2KGXB 2DHIA 4MT7A 4YL8A 2MWNB 2DKQA 1WVHA 4KHBB 1Y5OA 1ZC3B 2HE7A 2QKMA 2UVMA 1U5GA 4A6HA 5HE1A 2OQBA 2H7DA 2DX1A 2COFA 3DXEA 4GN1A 1GG3A 2K2UA 4HDOA 2EJ8A 3X23A 1FGZA 4HB3B 4KHAA 1EAZA 1U29A 2RSGA 2E2XA 1U2BA 1P6SA 4A6FB 2AEHA 3KSYA 4Z2NA 2D9ZA 2D2QA 1GC7A 1LB1A 3HW2B 2P8VA 4DX90 3ML4A 3KY9A 5J3YA 1WJ1A 1BTKA 3DXDA 3A98B 3FEHA 2L1CA 4HATB 2Z0PA 1DDVA 1K5DB 2Y8GA 4CYEA 1W1DA 1PLSA 2MKRA 1W1GA 2YRYA 1ZVRA 5DI9B 2HTHB 1H10A 2D4QA 4ZRIA 2Z0QA 1DDMA 5HE2A 3TCAA 2COCA 4WVFB 2X18A 2RLOA 4HDQA 3ODWA 3PP2A 2DHKA 1PMSA 1V5MA 4KVGB 1KZ7A 5C16A 1ZSQA 3ZDTA 2KCJA 2DFKA 3PVLA 1AQCA 2J59M 3AJ4A 1DBHA 2UZRA 1UPRA 5HE0A 2YS5A 1PFJA 2BCJA 2YVCA 3AU5A 4IFSA 2CRFA 3A8PA 1MAIA 2VSZA 1FAOA 4A6KA 2D10A 2DX5A 1ZM0A 3PVWA 1GC6A 2QKLA 3HQCA 4K2OA 1XX0A 1XCGA 1P3RA 1QQGA 2DYQA 3SV1A 1X86A 1WJMA 1FHWA 2J0MA 4HAYB 2D9XA 1ISNA 2AL6A 2PZ1A 1MIZB 1UNRA 4YONA 4CHMA 4KAXB 2DTCA 5D3WA 1FHXA 2W2XC 2NMBA 3PG7A 3PZDA 5DHFB 1E5WA 4HHVA 4MK0A 3TW1A 3P6AA 2I1KA 2YS1A 2R0DA 1K5GB 3GYPA 4B6HA 3CXBB 4L6EA 2CY4A 2P0FA 2RUKB 1WGQA 3M1IB 5GOWB 5KCVA 4K81A 1V5PA 3ODXA 1B55A 2CODA 1RJ2A 1BTNA 2NZ8B 3ULBA 5D3YA 2G35A 3D8FA 3VOQA 2ROVA 3QIJA 2Z0OA 3VIAA 2DN6A 4DBBA 5C6RA 1UEFA 2K00A 2UZSA 4HB2B 4HAXB 4P7IA 4GXBA 1MK9B 3U7DA 1V5UA 4A6FA 5L81A 2ROZB 1MIXA 1FOEA 1I7AA 1UNPA 1BWNA 1WGUA 4PQ0A 4NY0A 2YT0A 1LW3A 4K2PA 3CIKA 1KZGA 1MPHA 1OY2A 3WA0A 1QC6A 3AU4A 2GS0A 2FJLA 5JP4A 4F7UP 3O96A 5J3QA 2DKPA 3D8EA 1P5TA 5FI0A 2ELBA 5EFXA 1NTVA 4TYZA 2W2WA 1IRSA 1U5EA 5FI1A 1U5DA 3ZVRA 2M14A 2GCLA 2P0HA 1RRPB 2YSZA 2Y8FA 3GYOA 1X05A 3T06A 3F5RA 5KQ4A 4F7GA 4KHOA 2M38A 3TFMA 3BJIA 1M7RA 4ZRJA 2JP2A 2EMTA 2VKIA 4H8SA 1AWEA 3UZTA 1BAKA 1UPQA 1XD4A 2IYBA 5D3XA 4D0NB 5C79A 1U5FA 2COAA 4GMVA 1NI2A 2J0JA 1N3HA 2DHJA 5J3TA 5HE3A 1SGHA 2XQNM 2K2JA 1EGXA 1H4RA 2LOZA 3MPXA 3IVFA 1KI1B 1ZC4B 1Q67A 1MK7B 1V61A 4Z2MB 5CLQB 4HAWB 1XR0B 2MFQA 1FB8A 3SNHA 4Y94A 1V89A 1NTYA 4NSWA 1U27A 2I5FA 2Q13A 1V88A 2CY5A 3SUZA 4EKUA 3PSCA 4HAZB 4EMOA 2LULA 1EF1A 1WI1A 3SYXA 2EC1A 3QWMA 2ELAA 3RCPA 2LG1A 4MY6A 2W2XD 3N7CA 5CLLB 2N23A 4WSFA 2D9VA 2H7EA 2I1JA 3KZ1A 3ODOA 2N0YA 1DROA 2D11A 1DDWA 4HB0B 2Y7BA 4WJ7A 1W1HA 5C5BB 4DX8A 3HK0A 3P7ZA 2ADZA 4GMXB 4IAPA 4C0AA 1Z87A 3DXCA 4PNKA 1MKEA 4BBKA 2YT1A 2IFSA 2LOXA 2KUPA 5C5BA 1J0WA 2GCJA 4F7HA 2R09A 2YS3A 1DYNA 4K17A 1TXDA 2CAYA 4IOYX 4HAUB 3KRXA 1M7EA 2RGNB 1OMWA 1J19A 2LYDA 1XODA 3OANA 2GJYA 2V76A 2D9WA 4GZUA 3F0WA 4HB4B 4A5KA 3TO1A 4EJNA 2D9YA 5DH9B 3NSUA 5DIFB 2DYNA 2I5CA 4DXAB 2OTXA 5JHHA 3SO6A 1TQZA 5LOPB 4HAVB 2DA0A 3KRWA 1Y19B 2RVBB 1WG7A 3TVVA 1FGYA 2J0KA 4ZRKA 1X11A 3A8QA 3PEGA 1I2HA 5D3VA 3ULCA 3G9WA 4XWXA 3WYFB 2LKOA 1OQNA 4GPTB 4TKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LON B;  4CHJ A;  1EVH A;  5JLJ B;  2VRW B;  3FSS A;  1FHO A;  2YF0 A;  2ZPY A;  3FM8 C;  2RNR B;  3MDB C;  5DHA B;  2DLW A;  3LJU X;  3D8D A;  3V5W A;  3U8Z A;  2MDX A;  1TJ6 A;  1UNQ A;  1XKE A;  5D27 A;  3BIN A;  2EMS A;  5JHG A;  1X1F A;  1X1G A;  5KQ1 A;  2L2I A;  1SHC A;  3PVU A;  3QBV B;  1NU2 A;  2P0D A;  2KGX B;  2DHI A;  4MT7 A;  4YL8 A;  2MWN B;  2DKQ A;  1WVH A;  4KHB B;  1Y5O A;  1ZC3 B;  2HE7 A;  2QKM A;  2UVM A;  1U5G A;  4A6H A;  5HE1 A;  2OQB A;  2H7D A;  2DX1 A;  2COF A;  3DXE A;  4GN1 A;  1GG3 A;  2K2U A;  4HDO A;  2EJ8 A;  3X23 A;  1FGZ A;  4HB3 B;  4KHA A;  1EAZ A;  1U29 A;  2RSG A;  2E2X A;  1U2B A;  1P6S A;  4A6F B;  2AEH A;  3KSY A;  4Z2N A;  2D9Z A;  2D2Q A;  1GC7 A;  1LB1 A;  3HW2 B;  2P8V A;  4DX9 0;  3ML4 A;  3KY9 A;  5J3Y A;  1WJ1 A;  1BTK A;  3DXD A;  3A98 B;  3FEH A;  2L1C A;  4HAT B;  2Z0P A;  1DDV A;  1K5D B;  2Y8G A;  4CYE A;  1W1D A;  1PLS A;  2MKR A;  1W1G A;  2YRY A;  1ZVR A;  5DI9 B;  2HTH B;  1H10 A;  2D4Q A;  4ZRI A;  2Z0Q A;  1DDM A;  5HE2 A;  3TCA A;  2COC A;  4WVF B;  2X18 A;  2RLO A;  4HDQ A;  3ODW A;  3PP2 A;  2DHK A;  1PMS A;  1V5M A;  4KVG B;  1KZ7 A;  5C16 A;  1ZSQ A;  3ZDT A;  2KCJ A;  2DFK A;  3PVL A;  1AQC A;  2J59 M;  3AJ4 A;  1DBH A;  2UZR A;  1UPR A;  5HE0 A;  2YS5 A;  1PFJ A;  2BCJ A;  2YVC A;  3AU5 A;  4IFS A;  2CRF A;  3A8P A;  1MAI A;  2VSZ A;  1FAO A;  4A6K A;  2D10 A;  2DX5 A;  1ZM0 A;  3PVW A;  1GC6 A;  2QKL A;  3HQC A;  4K2O A;  1XX0 A;  1XCG A;  1P3R A;  1QQG A;  2DYQ A;  3SV1 A;  1X86 A;  1WJM A;  1FHW A;  2J0M A;  4HAY B;  2D9X A;  1ISN A;  2AL6 A;  2PZ1 A;  1MIZ B;  1UNR A;  4YON A;  4CHM A;  4KAX B;  2DTC A;  5D3W A;  1FHX A;  2W2X C;  2NMB A;  3PG7 A;  3PZD A;  5DHF B;  1E5W A;  4HHV A;  4MK0 A;  3TW1 A;  3P6A A;  2I1K A;  2YS1 A;  2R0D A;  1K5G B;  3GYP A;  4B6H A;  3CXB B;  4L6E A;  2CY4 A;  2P0F A;  2RUK B;  1WGQ A;  3M1I B;  5GOW B;  5KCV A;  4K81 A;  1V5P A;  3ODX A;  1B55 A;  2COD A;  1RJ2 A;  1BTN A;  2NZ8 B;  3ULB A;  5D3Y A;  2G35 A;  3D8F A;  3VOQ A;  2ROV A;  3QIJ A;  2Z0O A;  3VIA A;  2DN6 A;  4DBB A;  5C6R A;  1UEF A;  2K00 A;  2UZS A;  4HB2 B;  4HAX B;  4P7I A;  4GXB A;  1MK9 B;  3U7D A;  1V5U A;  4A6F A;  5L81 A;  2ROZ B;  1MIX A;  1FOE A;  1I7A A;  1UNP A;  1BWN A;  1WGU A;  4PQ0 A;  4NY0 A;  2YT0 A;  1LW3 A;  4K2P A;  3CIK A;  1KZG A;  1MPH A;  1OY2 A;  3WA0 A;  1QC6 A;  3AU4 A;  2GS0 A;  2FJL A;  5JP4 A;  4F7U P;  3O96 A;  5J3Q A;  2DKP A;  3D8E A;  1P5T A;  5FI0 A;  2ELB A;  5EFX A;  1NTV A;  4TYZ A;  2W2W A;  1IRS A;  1U5E A;  5FI1 A;  1U5D A;  3ZVR A;  2M14 A;  2GCL A;  2P0H A;  1RRP B;  2YSZ A;  2Y8F A;  3GYO A;  1X05 A;  3T06 A;  3F5R A;  5KQ4 A;  4F7G A;  4KHO A;  2M38 A;  3TFM A;  3BJI A;  1M7R A;  4ZRJ A;  2JP2 A;  2EMT A;  2VKI A;  4H8S A;  1AWE A;  3UZT A;  1BAK A;  1UPQ A;  1XD4 A;  2IYB A;  5D3X A;  4D0N B;  5C79 A;  1U5F A;  2COA A;  4GMV A;  1NI2 A;  2J0J A;  1N3H A;  2DHJ A;  5J3T A;  5HE3 A;  1SGH A;  2XQN M;  2K2J A;  1EGX A;  1H4R A;  2LOZ A;  3MPX A;  3IVF A;  1KI1 B;  1ZC4 B;  1Q67 A;  1MK7 B;  1V61 A;  4Z2M B;  5CLQ B;  4HAW B;  1XR0 B;  2MFQ A;  1FB8 A;  3SNH A;  4Y94 A;  1V89 A;  1NTY A;  4NSW A;  1U27 A;  2I5F A;  2Q13 A;  1V88 A;  2CY5 A;  3SUZ A;  4EKU A;  3PSC A;  4HAZ B;  4EMO A;  2LUL A;  1EF1 A;  1WI1 A;  3SYX A;  2EC1 A;  3QWM A;  2ELA A;  3RCP A;  2LG1 A;  4MY6 A;  2W2X D;  3N7C A;  5CLL B;  2N23 A;  4WSF A;  2D9V A;  2H7E A;  2I1J A;  3KZ1 A;  3ODO A;  2N0Y A;  1DRO A;  2D11 A;  1DDW A;  4HB0 B;  2Y7B A;  4WJ7 A;  1W1H A;  5C5B B;  4DX8 A;  3HK0 A;  3P7Z A;  2ADZ A;  4GMX B;  4IAP A;  4C0A A;  1Z87 A;  3DXC A;  4PNK A;  1MKE A;  4BBK A;  2YT1 A;  2IFS A;  2LOX A;  2KUP A;  5C5B A;  1J0W A;  2GCJ A;  4F7H A;  2R09 A;  2YS3 A;  1DYN A;  4K17 A;  1TXD A;  2CAY A;  4IOY X;  4HAU B;  3KRX A;  1M7E A;  2RGN B;  1OMW A;  1J19 A;  2LYD A;  1XOD A;  3OAN A;  2GJY A;  2V76 A;  2D9W A;  4GZU A;  3F0W A;  4HB4 B;  4A5K A;  3TO1 A;  4EJN A;  2D9Y A;  5DH9 B;  3NSU A;  5DIF B;  2DYN A;  2I5C A;  4DXA B;  2OTX A;  5JHH A;  3SO6 A;  1TQZ A;  5LOP B;  4HAV B;  2DA0 A;  3KRW A;  1Y19 B;  2RVB B;  1WG7 A;  3TVV A;  1FGY A;  2J0K A;  4ZRK A;  1X11 A;  3A8Q A;  3PEG A;  1I2H A;  5D3V A;  3ULC A;  3G9W A;  4XWX A;  3WYF B;  2LKO A;  1OQN A;  4GPT B;  4TKN A; 
#chains in the Genus database with same CATH topology
 5LON B;  4CHJ A;  1EVH A;  5JLJ B;  2VRW B;  3FSS A;  1FHO A;  2YF0 A;  2ZPY A;  3FM8 C;  3MDB C;  5DHA B;  2DLW A;  3LJU X;  3D8D A;  3V5W A;  3NWA A;  2K8E A;  3U8Z A;  2MDX A;  1TJ6 A;  1UNQ A;  1XKE A;  5D27 A;  3BIN A;  2EMS A;  5JHG A;  1X1F A;  1X1G A;  5KQ1 A;  2L2I A;  1SHC A;  3PVU A;  3QBV B;  1NU2 A;  2P0D A;  2KGX B;  2DHI A;  4MT7 A;  4YL8 A;  2MWN B;  2DKQ A;  1WVH A;  4KHB B;  1Y5O A;  2FJU B;  2Z14 A;  1ZC3 B;  2HE7 A;  2QKM A;  2UVM A;  4OT1 A;  1U5G A;  4A6H A;  4KHB A;  5HE1 A;  2OQB A;  2H7D A;  2DX1 A;  2COF A;  3DXE A;  4GN1 A;  1GG3 A;  2K2U A;  4HDO A;  2EJ8 A;  3X23 A;  1FGZ A;  4HB3 B;  4KHA A;  1EAZ A;  1U29 A;  2RSG A;  2E2X A;  1U2B A;  1P6S A;  4A6F B;  2AEH A;  3KSY A;  4Z2N A;  2D9Z A;  2D2Q A;  1GC7 A;  1LB1 A;  3HW2 B;  2P8V A;  4DX9 0;  3ML4 A;  2Z13 A;  3KY9 A;  5J3Y A;  1WJ1 A;  1BTK A;  4GNK B;  3DXD A;  3A98 B;  2YT2 A;  3FEH A;  2KR0 A;  4OSN A;  2L1C A;  4HAT B;  2Z0P A;  1DDV A;  1K5D B;  2Y8G A;  4CYE A;  1W1D A;  1PLS A;  5I2M A;  2MKR A;  1W1G A;  2YRY A;  1ZVR A;  5DI9 B;  2HTH B;  1H10 A;  2D4Q A;  4ZRI A;  2Z0Q A;  1DDM A;  5IRS A;  5HE2 A;  3TCA A;  2COC A;  4WVF B;  2X18 A;  2RLO A;  4HDQ A;  3ODW A;  3PP2 A;  2DHK A;  1PMS A;  1V5M A;  4KVG B;  1KZ7 A;  5C16 A;  1ZSQ A;  3ZDT A;  2KCJ A;  2DFK A;  3PVL A;  1AQC A;  2J59 M;  3AJ4 A;  1DBH A;  2UZR A;  1UPR A;  5HE0 A;  2YS5 A;  1PFJ A;  2BCJ A;  2YVC A;  3AU5 A;  4IFS A;  2CRF A;  3A8P A;  1MAI A;  2VSZ A;  1FAO A;  4A6K A;  2D10 A;  2DX5 A;  1ZM0 A;  3PVW A;  1GC6 A;  4HSI A;  2QKL A;  3HQC A;  4K2O A;  1XX0 A;  4QJ3 B;  1XCG A;  1P3R A;  1QQG A;  2DYQ A;  3SV1 A;  1X86 A;  1WJM A;  1FHW A;  2J0M A;  4HAY B;  2D9X A;  1ISN A;  2AL6 A;  2PZ1 A;  4CSQ A;  1MIZ B;  1UNR A;  4YON A;  3DCX A;  4CHM A;  4KAX B;  2KIE A;  2DTC A;  5D3W A;  1FHX A;  2W2X C;  2NMB A;  3PG7 A;  3PZD A;  5DHF B;  1E5W A;  4HHV A;  3U12 A;  4MK0 A;  3TW1 A;  3P6A A;  2I1K A;  2YS1 A;  5LG4 B;  2R0D A;  1MI1 A;  1K5G B;  3GYP A;  3HSA A;  4B6H A;  3CXB B;  4L6E A;  5M4Y B;  4D6W A;  2CY4 A;  2P0F A;  2RUK B;  1WGQ A;  3M1I B;  5GOW B;  5KCV A;  4K81 A;  1V5P A;  3ODX A;  1B55 A;  2COD A;  2R2Y A;  1RJ2 A;  1BTN A;  2NZ8 B;  3ULB A;  4DIX A;  5D3Y A;  2G35 A;  3D8F A;  2GUM A;  3VOQ A;  2ROV A;  3A58 A;  3QIJ A;  2Z0O A;  3VIA A;  3NW8 A;  2DN6 A;  4DBB A;  5C6R A;  1UEF A;  2K00 A;  2UZS A;  4HB2 B;  2Z59 A;  3NWD A;  4HAX B;  4P7I A;  4GXB A;  1MK9 B;  3U7D A;  1V5U A;  4A6F A;  5L81 A;  2ROZ B;  1MIX A;  1FOE A;  1I7A A;  1UNP A;  5I2S A;  1BWN A;  1WGU A;  4PQ0 A;  4NY0 A;  2YT0 A;  1LW3 A;  4QJ5 B;  4K2P A;  3CIK A;  1KZG A;  1MPH A;  1OY2 A;  3WA0 A;  1QC6 A;  3AU4 A;  2GS0 A;  2FJL A;  5JP4 A;  4F7U P;  3O96 A;  5J3Q A;  2DKP A;  3D8E A;  1P5T A;  5FI0 A;  2ELB A;  5EFX A;  1NTV A;  4TYZ A;  2W2W A;  1IRS A;  1U5E A;  5FI1 A;  1U5D A;  3ZVR A;  2M14 A;  2GCL A;  2P0H A;  1RRP B;  2YSZ A;  4L1R A;  2Y8F A;  3GYO A;  1X05 A;  3T06 A;  3F5R A;  5KQ4 A;  4F7G A;  4KHO A;  2M38 A;  2KUQ A;  3TFM A;  3BJI A;  1M7R A;  2ZKM X;  4ZRJ A;  2JP2 A;  2EMT A;  2VKI A;  4H8S A;  1ZYI A;  1AWE A;  3UZT A;  1BAK A;  1UPQ A;  1XD4 A;  2IYB A;  5D3X A;  1T77 A;  4D0N B;  5C79 A;  1U5F A;  2COA A;  4GMV A;  1NI2 A;  2J0J A;  1N3H A;  2DHJ A;  5J3T A;  5HE3 A;  1SGH A;  2XQN M;  2K2J A;  1EGX A;  1H4R A;  3MPX A;  2LOZ A;  3IVF A;  1KI1 B;  1ZC4 B;  1Q67 A;  1MK7 B;  1V61 A;  4Z2M B;  5CLQ B;  4HAW B;  1XR0 B;  2MFQ A;  1FB8 A;  3SNH A;  3HIE A;  4Y94 A;  2K49 A;  1V89 A;  1NTY A;  4NSW A;  1U27 A;  2I5F A;  2Q13 A;  1V88 A;  2KIG A;  2CY5 A;  3SUZ A;  2RRF A;  4EKU A;  3PSC A;  4HAZ B;  3NWF A;  4EMO A;  2LUL A;  4QXA B;  1EF1 A;  1WI1 A;  3SYX A;  2EC1 A;  3QWM A;  2ELA A;  3RCP A;  2LG1 A;  4MY6 A;  2W2X D;  3N7C A;  5CLL B;  2N23 A;  4GPT B;  4WSF A;  2D9V A;  2H7E A;  2Z4D A;  2I1J A;  3KZ1 A;  3ODO A;  2N0Y A;  1DRO A;  2D11 A;  1DDW A;  4HB0 B;  2Y7B A;  4WJ7 A;  1W1H A;  5C5B B;  4DX8 A;  3HK0 A;  3P7Z A;  2ADZ A;  4GMX B;  4IAP A;  4C0A A;  1Z87 A;  3DXC A;  4PNK A;  1MKE A;  4BBK A;  2YT1 A;  2IFS A;  2LOX A;  2KUP A;  5C5B A;  1J0W A;  2GCJ A;  4F7H A;  2R09 A;  3B77 A;  2YS3 A;  1DYN A;  4K17 A;  1TXD A;  2CAY A;  4IOY X;  4QJ4 B;  4HAU B;  3KRX A;  1M7E A;  2RGN B;  1OMW A;  1J19 A;  2LYD A;  1XOD A;  3OAN A;  2GJY A;  2V76 A;  2D9W A;  4GZU A;  2NBV A;  3F0W A;  4HB4 B;  4A5K A;  3TO1 A;  4EJN A;  2D9Y A;  5DH9 B;  3NSU A;  5DIF B;  2DYN A;  2I5C A;  4DXA B;  2OTX A;  5JHH A;  3SO6 A;  1TQZ A;  5LOP B;  4HAV B;  2DA0 A;  3KRW A;  1Y19 B;  2RVB B;  1WG7 A;  3TVV A;  1FGY A;  3OHM B;  2J0K A;  3FVC A;  4ZRK A;  1X11 A;  3A8Q A;  3PEG A;  1I2H A;  5D3V A;  3ULC A;  3G9W A;  4XWX A;  3WYF B;  4GOU A;  2LKO A;  1OQN A;  2RNR B;  4TKN A; 
#chains in the Genus database with same CATH homology
 5LON B;  4CHJ A;  1EVH A;  5JLJ B;  2VRW B;  3FSS A;  1FHO A;  2YF0 A;  2ZPY A;  3FM8 C;  2RNR B;  3MDB C;  5DHA B;  2DLW A;  3LJU X;  3D8D A;  3V5W A;  3U8Z A;  2MDX A;  1TJ6 A;  1UNQ A;  1XKE A;  5D27 A;  3BIN A;  2EMS A;  5JHG A;  1X1F A;  1X1G A;  5KQ1 A;  2L2I A;  1SHC A;  3PVU A;  3QBV B;  1NU2 A;  2P0D A;  2KGX B;  2DHI A;  4MT7 A;  4YL8 A;  2MWN B;  2DKQ A;  1WVH A;  4KHB B;  1Y5O A;  1ZC3 B;  2HE7 A;  2QKM A;  2UVM A;  1U5G A;  4A6H A;  5HE1 A;  2OQB A;  2H7D A;  2DX1 A;  2COF A;  3DXE A;  4GN1 A;  1GG3 A;  2K2U A;  4HDO A;  2EJ8 A;  3X23 A;  1FGZ A;  4HB3 B;  4KHA A;  1EAZ A;  1U29 A;  2RSG A;  2E2X A;  1U2B A;  1P6S A;  4A6F B;  2AEH A;  3KSY A;  4Z2N A;  2D9Z A;  2D2Q A;  1GC7 A;  1LB1 A;  3HW2 B;  2P8V A;  4DX9 0;  3ML4 A;  3KY9 A;  5J3Y A;  1WJ1 A;  1BTK A;  3DXD A;  3A98 B;  3FEH A;  2L1C A;  4HAT B;  2Z0P A;  1DDV A;  1K5D B;  2Y8G A;  4CYE A;  1W1D A;  1PLS A;  2MKR A;  1W1G A;  2YRY A;  1ZVR A;  5DI9 B;  2HTH B;  1H10 A;  2D4Q A;  4ZRI A;  2Z0Q A;  1DDM A;  5HE2 A;  3TCA A;  2COC A;  4WVF B;  2X18 A;  2RLO A;  4HDQ A;  3ODW A;  3PP2 A;  2DHK A;  1PMS A;  1V5M A;  4KVG B;  1KZ7 A;  5C16 A;  1ZSQ A;  3ZDT A;  2KCJ A;  2DFK A;  3PVL A;  1AQC A;  2J59 M;  3AJ4 A;  1DBH A;  2UZR A;  1UPR A;  5HE0 A;  2YS5 A;  1PFJ A;  2BCJ A;  2YVC A;  3AU5 A;  4IFS A;  2CRF A;  3A8P A;  1MAI A;  2VSZ A;  1FAO A;  4A6K A;  2D10 A;  2DX5 A;  1ZM0 A;  3PVW A;  1GC6 A;  2QKL A;  3HQC A;  4K2O A;  1XX0 A;  1XCG A;  1P3R A;  1QQG A;  2DYQ A;  3SV1 A;  1X86 A;  1WJM A;  1FHW A;  2J0M A;  4HAY B;  2D9X A;  1ISN A;  2AL6 A;  2PZ1 A;  1MIZ B;  1UNR A;  4YON A;  4CHM A;  4KAX B;  2DTC A;  5D3W A;  1FHX A;  2W2X C;  2NMB A;  3PG7 A;  3PZD A;  5DHF B;  1E5W A;  4HHV A;  4MK0 A;  3TW1 A;  3P6A A;  2I1K A;  2YS1 A;  2R0D A;  1K5G B;  3GYP A;  4B6H A;  3CXB B;  4L6E A;  2CY4 A;  2P0F A;  2RUK B;  1WGQ A;  3M1I B;  5GOW B;  5KCV A;  4K81 A;  1V5P A;  3ODX A;  1B55 A;  2COD A;  1RJ2 A;  1BTN A;  2NZ8 B;  3ULB A;  5D3Y A;  2G35 A;  3D8F A;  3VOQ A;  2ROV A;  3QIJ A;  2Z0O A;  3VIA A;  2DN6 A;  4DBB A;  5C6R A;  1UEF A;  2K00 A;  2UZS A;  4HB2 B;  4HAX B;  4P7I A;  4GXB A;  1MK9 B;  3U7D A;  1V5U A;  4A6F A;  5L81 A;  2ROZ B;  1MIX A;  1FOE A;  1I7A A;  1UNP A;  1BWN A;  1WGU A;  4PQ0 A;  4NY0 A;  2YT0 A;  1LW3 A;  4K2P A;  3CIK A;  1KZG A;  1MPH A;  1OY2 A;  3WA0 A;  1QC6 A;  3AU4 A;  2GS0 A;  2FJL A;  5JP4 A;  4F7U P;  3O96 A;  5J3Q A;  2DKP A;  3D8E A;  1P5T A;  5FI0 A;  2ELB A;  5EFX A;  1NTV A;  4TYZ A;  2W2W A;  1IRS A;  1U5E A;  5FI1 A;  1U5D A;  3ZVR A;  2M14 A;  2GCL A;  2P0H A;  1RRP B;  2YSZ A;  2Y8F A;  3GYO A;  1X05 A;  3T06 A;  3F5R A;  5KQ4 A;  4F7G A;  4KHO A;  2M38 A;  3TFM A;  3BJI A;  1M7R A;  4ZRJ A;  2JP2 A;  2EMT A;  2VKI A;  4H8S A;  1AWE A;  3UZT A;  1BAK A;  1UPQ A;  1XD4 A;  2IYB A;  5D3X A;  4D0N B;  5C79 A;  1U5F A;  2COA A;  4GMV A;  1NI2 A;  2J0J A;  1N3H A;  2DHJ A;  5J3T A;  5HE3 A;  1SGH A;  2XQN M;  2K2J A;  1EGX A;  1H4R A;  2LOZ A;  3MPX A;  3IVF A;  1KI1 B;  1ZC4 B;  1Q67 A;  1MK7 B;  1V61 A;  4Z2M B;  5CLQ B;  4HAW B;  1XR0 B;  2MFQ A;  1FB8 A;  3SNH A;  4Y94 A;  1V89 A;  1NTY A;  4NSW A;  1U27 A;  2I5F A;  2Q13 A;  1V88 A;  2CY5 A;  3SUZ A;  4EKU A;  3PSC A;  4HAZ B;  4EMO A;  2LUL A;  1EF1 A;  1WI1 A;  3SYX A;  2EC1 A;  3QWM A;  2ELA A;  3RCP A;  2LG1 A;  4MY6 A;  2W2X D;  3N7C A;  5CLL B;  2N23 A;  4WSF A;  2D9V A;  2H7E A;  2I1J A;  3KZ1 A;  3ODO A;  2N0Y A;  1DRO A;  2D11 A;  1DDW A;  4HB0 B;  2Y7B A;  4WJ7 A;  1W1H A;  5C5B B;  4DX8 A;  3HK0 A;  3P7Z A;  2ADZ A;  4GMX B;  4IAP A;  4C0A A;  1Z87 A;  3DXC A;  4PNK A;  1MKE A;  4BBK A;  2YT1 A;  2IFS A;  2LOX A;  2KUP A;  5C5B A;  1J0W A;  2GCJ A;  4F7H A;  2R09 A;  2YS3 A;  1DYN A;  4K17 A;  1TXD A;  2CAY A;  4IOY X;  4HAU B;  3KRX A;  1M7E A;  2RGN B;  1OMW A;  1J19 A;  2LYD A;  1XOD A;  3OAN A;  2GJY A;  2V76 A;  2D9W A;  4GZU A;  3F0W A;  4HB4 B;  4A5K A;  3TO1 A;  4EJN A;  2D9Y A;  5DH9 B;  3NSU A;  5DIF B;  2DYN A;  2I5C A;  4DXA B;  2OTX A;  5JHH A;  3SO6 A;  1TQZ A;  5LOP B;  4HAV B;  2DA0 A;  3KRW A;  1Y19 B;  2RVB B;  1WG7 A;  3TVV A;  1FGY A;  2J0K A;  4ZRK A;  1X11 A;  3A8Q A;  3PEG A;  1I2H A;  5D3V A;  3ULC A;  3G9W A;  4XWX A;  3WYF B;  2LKO A;  1OQN A;  4GPT B;  4TKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...