1UEFA

Crystal structure of dok1 ptb domain complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
105
structure length
105
Chain Sequence
MGSQFWVTSQKTEASERCGLQGSYILRVEAEKLTLLTLGAQSQILEPLLFWPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTSQGNDIFQAVEAAIQQQKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/transferase
molecule keywords Docking protein 1
publication title Structural Basis for the Specific Recognition of RET by the Dok1 Phosphotyrosine Binding Domain
pubmed doi rcsb
source organism Mus musculus
total genus 23
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1uefA00
1FB8A 3QWMA 3TW1A 1V88A 2P0DA 1LW3A 1UEFA 4KHOA 2DHIA 3F5RA 3PVWA 4MK0A 4NSWA 1E5WA 1DYNA 1EF1A 1P5TA 3V5WA 4HHVA 4IOYX 2D9WA 4DX90 2UVMA 2CODA 2YRYA 1N3HA 3WA0A 4CYEA 3DXEA 4YL8A 1NTVA 3LJUX 4HB3B 3TO1A 4HAXB 4B6HA 2Y7BA 3QIJA 1FOEA 2DLWA 4A6KA 1QQGA 5D3XA 1W1DA 2P0HA 5C5BA 5C6RA 3FEHA 3AU4A 4XWXA 2E2XA 4ZRKA 1ISNA 3GYPA 4KAXB 5JHHA 2MKRA 3KZ1A 1J19A 1FHOA 2EMTA 3SNHA 1DBHA 3PG7A 2GCJA 3PEGA 2L1CA 1V89A 1EAZA 1Y19B 5D3VA 1U5FA 4K2PA 4A5KA 2YT0A 2Z0PA 1Y5OA 1M7EA 2P8VA 1XR0B 2DYNA 1H4RA 1M7RA 2R0DA 1PFJA 3QBVB 2W2XC 1I2HA 3FSSA 4P7IA 4GMXB 2DYQA 1XODA 3P7ZA 2YSZA 4HB4B 3PZDA 2Y8GA 3D8DA 4KHAA 1W1GA 1U2BA 2DN6A 2EC1A 2ROVA 4TKNA 1WGUA 2X18A 5DH9B 2RVBB 1PMSA 2COAA 2JP2A 3BJIA 4K17A 1OMWA 4CHJA 3TFMA 1UNRA 1X1FA 2DFKA 1QC6A 2CAYA 2D4QA 4DXAB 4HAUB 2OQBA 4K2OA 1TJ6A 4L6EA 2M14A 2RNRB 2MFQA 2RUKB 3NSUA 2W2XD 2LOXA 4HB0B 2HE7A 4HAZB 5L81A 2N0YA 4HATB 1FGZA 2DKQA 4A6FA 3SUZA 1EVHA 2UZSA 5CLQB 3RCPA 2V76A 1WGQA 2PZ1A 5DI9B 2BCJA 4Z2NA 4BBKA 3ZVRA 4GXBA 3DXCA 3KRXA 1V61A 5JLJB 4GZUA 5HE1A 4HB2B 5FI1A 2YS5A 1KZ7A 1XKEA 2NMBA 5J3QA 2VKIA 2GJYA 2Q13A 5KQ1A 2Y8FA 2ADZA 3A8QA 5HE2A 1MK7B 1MAIA 1IRSA 2YVCA 4YONA 3PVUA 1SGHA 2D2QA 2D9ZA 1TQZA 2J59M 1V5MA 1RJ2A 4HAYB 4EMOA 2EJ8A 2I5FA 3N7CA 5C16A 3G9WA 3AU5A 3A8PA 3T06A 1XX0A 3OANA 5FI0A 2N23A 2QKMA 5JP4A 5KCVA 1MK9B 2LULA 5CLLB 4HDOA 2DHJA 4MY6A 1MIXA 2I5CA 3ODOA 1BWNA 3PVLA 2DX1A 1ZSQA 3ULCA 2KGXB 1AQCA 1V5UA 1WG7A 2LKOA 1V5PA 4HAVB 4H8SA 1RRPB 3O96A 2VSZA 5GOWB 1Q67A 4IFSA 2OTXA 1FGYA 3M1IB 3MPXA 1OQNA 1NI2A 4DBBA 3PSCA 3TCAA 2ELAA 2D9VA 2ROZB 2VRWB 2COCA 2LOZA 1GC6A 4MT7A 1K5DB 2AEHA 4EJNA 2FJLA 1NU2A 1FHXA 2Z0QA 2YF0A 1I7AA 1U5EA 2K2UA 1XD4A 2D9XA 3CXBB 2QKLA 1J0WA 4PNKA 5C5BB 2RSGA 2RGNB 1X1GA 5HE0A 4TYZA 1GG3A 1OY2A 5DIFB 3F0WA 3TVVA 3ODXA 1BAKA 2H7DA 1U5DA 3VOQA 1WJMA 2EMSA 1MPHA 3KSYA 2IYBA 1K5GB 3GYOA 1WJ1A 1MIZB 2AL6A 2D9YA 2DA0A 2DKPA 4A6HA 2RLOA 3CIKA 5D3YA 1P6SA 4WVFB 2YT1A 1WVHA 2KCJA 2YS1A 1ZC4B 3AJ4A 3A98B 1SHCA 1BTKA 1MKEA 2MWNB 1AWEA 3MDBC 2J0KA 5KQ4A 3ULBA 3ODWA 1P3RA 5DHFB 4ZRIA 2XQNM 4Z2MB 1U29A 3X23A 3D8EA 3FM8C 4PQ0A 2M38A 1UPRA 2J0MA 2LYDA 1U5GA 1UNQA 4K81A 2DTCA 1FHWA 3KY9A 4KVGB 2GS0A 4GPTB 2P0FA 1GC7A 2KUPA 2CY5A 1X11A 4NY0A 2D11A 2IFSA 1KI1B 1PLSA 2NZ8B 3SO6A 1UNPA 1ZC3B 2G35A 2CY4A 1XCGA 3P6AA 2GCLA 5DHAB 3PP2A 2CRFA 3HK0A 3WYFB 3ML4A 1UPQA 5C79A 1Z87A 1DDWA 5JHGA 2I1JA 1NTYA 3ZDTA 4EKUA 5J3TA 2K2JA 2Z0OA 4GMVA 1DDMA 1EGXA 1ZM0A 4WSFA 4GN1A 1TXDA 1W1HA 4A6FB 3SYXA 1DROA 3U7DA 2HTHB 4IAPA 4KHBB 3BINA 2D10A 1U27A 4D0NB 3UZTA 5D27A 2J0JA 4ZRJA 5HE3A 5LONB 4CHMA 2MDXA 5D3WA 4F7GA 2YS3A 4HAWB 1H10A 1ZVRA 3VIAA 3U8ZA 3HW2B 3D8FA 1FAOA 4F7UP 1BTNA 2DHKA 3HQCA 2R09A 4DX8A 2ZPYA 2W2WA 2LG1A 4HDQA 1X05A 4F7HA 2L2IA 2K00A 2ELBA 4WJ7A 1WI1A 1KZGA 3DXDA 4Y94A 3SV1A 2UZRA 1LB1A 3KRWA 5EFXA 2H7EA 2COFA 5LOPB 1B55A 1DDVA 5J3YA 4C0AA 3IVFA 1X86A 2I1KA 2DX5A
chains in the Genus database with same CATH superfamily
1FB8A 3QWMA 3TW1A 1V88A 2P0DA 1LW3A 1UEFA 4KHOA 2DHIA 3F5RA 3PVWA 4MK0A 4NSWA 1E5WA 1DYNA 1EF1A 1P5TA 3V5WA 4HHVA 4IOYX 2D9WA 4DX90 2UVMA 2CODA 2YRYA 1N3HA 3WA0A 4CYEA 3DXEA 3FVCA 4YL8A 1NTVA 3LJUX 4HB3B 3TO1A 4HAXB 1ZYIA 4B6HA 2Y7BA 3QIJA 1FOEA 2DLWA 4A6KA 1QQGA 5D3XA 1W1DA 2P0HA 5C5BA 3A58A 3FEHA 5C6RA 3AU4A 4XWXA 2E2XA 4ZRKA 1ISNA 3GYPA 4KAXB 5JHHA 2GUMA 2MKRA 3KZ1A 2K8EA 1J19A 1FHOA 2EMTA 3SNHA 1DBHA 3NW8A 2KIGA 3PG7A 2GCJA 3PEGA 2L1CA 1V89A 1EAZA 1Y19B 5D3VA 1U5FA 4K2PA 4A5KA 2YT0A 2Z59A 2Z0PA 1Y5OA 1M7EA 2P8VA 1XR0B 2DYNA 1H4RA 1M7RA 2R0DA 1PFJA 3QBVB 2W2XC 1I2HA 3FSSA 4P7IA 4GMXB 2DYQA 1XODA 3P7ZA 2YSZA 2ZKMX 4HB4B 3PZDA 2Y8GA 3D8DA 4KHAA 2Z14A 1W1GA 1U2BA 2DN6A 2EC1A 2ROVA 4TKNA 1WGUA 1T77A 2X18A 5DH9B 2RVBB 1PMSA 4HSIA 2COAA 2JP2A 3BJIA 4D6WA 4K17A 1OMWA 4CHJA 3TFMA 1UNRA 1X1FA 2DFKA 1QC6A 2YT2A 2CAYA 2D4QA 4DXAB 4HAUB 2NBVA 2OQBA 4K2OA 1TJ6A 4L6EA 2M14A 2RNRB 2MFQA 2RUKB 3NSUA 2W2XD 1MI1A 2LOXA 4HB0B 2HE7A 4HAZB 4QXAB 5L81A 2N0YA 4HATB 1FGZA 2DKQA 4A6FA 3SUZA 1EVHA 2UZSA 4KHBA 5CLQB 3RCPA 2V76A 1WGQA 2PZ1A 5DI9B 2BCJA 4Z2NA 4BBKA 3ZVRA 4GXBA 3DXCA 3KRXA 1V61A 5JLJB 4GZUA 5HE1A 4HB2B 5FI1A 2YS5A 1KZ7A 1XKEA 2NMBA 5J3QA 2VKIA 2GJYA 2Q13A 5KQ1A 2Y8FA 2ADZA 4GNKB 3A8QA 5HE2A 3NWFA 1MK7B 1MAIA 1IRSA 2YVCA 4YONA 3PVUA 1SGHA 2D2QA 2D9ZA 1TQZA 2J59M 1V5MA 1RJ2A 4HAYB 4EMOA 2EJ8A 2I5FA 4QJ4B 3N7CA 5C16A 3G9WA 3AU5A 3A8PA 3OHMB 5M4YB 3T06A 1XX0A 3OANA 5FI0A 2N23A 2QKMA 5JP4A 5KCVA 1MK9B 2LULA 3HSAA 5CLLB 4HDOA 2DHJA 4MY6A 1MIXA 2I5CA 3ODOA 1BWNA 3PVLA 2DX1A 1ZSQA 3ULCA 2KGXB 1AQCA 1V5UA 1WG7A 2LKOA 1V5PA 4HAVB 4H8SA 1RRPB 3O96A 2VSZA 5GOWB 1Q67A 4IFSA 2OTXA 1FGYA 3M1IB 3MPXA 1OQNA 1NI2A 4DBBA 3PSCA 3TCAA 2ELAA 2D9VA 2ROZB 2VRWB 2COCA 2LOZA 1GC6A 4MT7A 1K5DB 2AEHA 4EJNA 2FJLA 1NU2A 1FHXA 2Z4DA 2Z0QA 2YF0A 1I7AA 1U5EA 2K2UA 1XD4A 2D9XA 3CXBB 2QKLA 1J0WA 4PNKA 5C5BB 2RSGA 2RGNB 1X1GA 5HE0A 4TYZA 1GG3A 1OY2A 5DIFB 3F0WA 3TVVA 3ODXA 1BAKA 2H7DA 1U5DA 3VOQA 1WJMA 2EMSA 1MPHA 3KSYA 2IYBA 1K5GB 3GYOA 1WJ1A 1MIZB 2AL6A 2D9YA 2DA0A 2DKPA 4A6HA 2RLOA 3CIKA 5D3YA 1P6SA 4WVFB 2YT1A 1WVHA 2KCJA 2YS1A 4OT1A 1ZC4B 3AJ4A 3A98B 1SHCA 1BTKA 1MKEA 2KIEA 2MWNB 1AWEA 3MDBC 2J0KA 5KQ4A 3ULBA 4L1RA 3ODWA 1P3RA 5DHFB 4ZRIA 2XQNM 4Z2MB 1U29A 3X23A 3D8EA 3FM8C 4PQ0A 2M38A 1UPRA 2J0MA 2LYDA 1U5GA 1UNQA 4K81A 2DTCA 1FHWA 3KY9A 4KVGB 2GS0A 4GPTB 2P0FA 1GC7A 4GOUA 2KUPA 2CY5A 1X11A 4NY0A 2D11A 2IFSA 1KI1B 1PLSA 2NZ8B 3SO6A 1UNPA 1ZC3B 2FJUB 5I2SA 4OSNA 2G35A 2CY4A 1XCGA 3P6AA 2GCLA 5DHAB 2R2YA 3PP2A 4QJ5B 2K49A 2CRFA 5LG4B 3HK0A 4QJ3B 3WYFB 3ML4A 1UPQA 2RRFA 5C79A 1Z87A 2KR0A 1DDWA 5JHGA 2I1JA 1NTYA 3ZDTA 4EKUA 5J3TA 2K2JA 2Z0OA 4GMVA 3U12A 5IRSA 1DDMA 1EGXA 4CSQA 1ZM0A 4WSFA 4GN1A 1TXDA 3NWAA 1W1HA 4A6FB 3SYXA 1DROA 2KUQA 3U7DA 2HTHB 4IAPA 4KHBB 3BINA 2D10A 1U27A 3NWDA 4D0NB 3UZTA 5D27A 2J0JA 4ZRJA 2Z13A 5HE3A 5LONB 4CHMA 2MDXA 5D3WA 4F7GA 2YS3A 4HAWB 1H10A 1ZVRA 3VIAA 3U8ZA 3HW2B 3D8FA 1FAOA 4F7UP 5I2MA 1BTNA 2DHKA 3B77A 3HQCA 2R09A 4DX8A 4DIXA 2ZPYA 2W2WA 3HIEA 2LG1A 4HDQA 1X05A 4F7HA 2L2IA 2K00A 2ELBA 3DCXA 4WJ7A 1WI1A 1KZGA 3DXDA 4Y94A 3SV1A 2UZRA 1LB1A 3KRWA 5EFXA 2H7EA 2COFA 5LOPB 1B55A 1DDVA 5J3YA 4C0AA 3IVFA 1X86A 2I1KA 2DX5A
chains in the Genus database with same CATH topology
1FB8A 3QWMA 3TW1A 1V88A 2P0DA 1LW3A 1UEFA 4KHOA 2DHIA 3F5RA 3PVWA 4MK0A 4NSWA 1E5WA 1DYNA 1EF1A 1P5TA 3V5WA 4HHVA 4IOYX 2D9WA 4DX90 2UVMA 2CODA 2YRYA 1N3HA 3WA0A 4CYEA 3DXEA 4YL8A 1NTVA 3LJUX 4HB3B 3TO1A 4HAXB 4B6HA 2Y7BA 3QIJA 1FOEA 2DLWA 4A6KA 1QQGA 5D3XA 1W1DA 2P0HA 5C5BA 5C6RA 3FEHA 3AU4A 4XWXA 2E2XA 4ZRKA 1ISNA 3GYPA 4KAXB 5JHHA 2MKRA 3KZ1A 1J19A 1FHOA 2EMTA 3SNHA 1DBHA 3PG7A 2GCJA 3PEGA 2L1CA 1V89A 1EAZA 1Y19B 5D3VA 1U5FA 4K2PA 4A5KA 2YT0A 2Z0PA 1Y5OA 1M7EA 2P8VA 1XR0B 2DYNA 1H4RA 1M7RA 2R0DA 1PFJA 3QBVB 2W2XC 1I2HA 3FSSA 4P7IA 4GMXB 2DYQA 1XODA 3P7ZA 2YSZA 4HB4B 3PZDA 2Y8GA 3D8DA 4KHAA 1W1GA 1U2BA 2DN6A 2EC1A 2ROVA 4TKNA 1WGUA 2X18A 5DH9B 2RVBB 1PMSA 2COAA 2JP2A 3BJIA 4K17A 1OMWA 4CHJA 3TFMA 1UNRA 1X1FA 2DFKA 1QC6A 2CAYA 2D4QA 4DXAB 4HAUB 2OQBA 4K2OA 1TJ6A 4L6EA 2M14A 2RNRB 2MFQA 2RUKB 3NSUA 2W2XD 2LOXA 4HB0B 2HE7A 4HAZB 5L81A 2N0YA 4HATB 1FGZA 2DKQA 4A6FA 3SUZA 1EVHA 2UZSA 5CLQB 3RCPA 2V76A 1WGQA 2PZ1A 5DI9B 2BCJA 4Z2NA 4BBKA 3ZVRA 4GXBA 3DXCA 3KRXA 1V61A 5JLJB 4GZUA 5HE1A 4HB2B 5FI1A 2YS5A 1KZ7A 1XKEA 2NMBA 5J3QA 2VKIA 2GJYA 2Q13A 5KQ1A 2Y8FA 2ADZA 3A8QA 5HE2A 1MK7B 1MAIA 1IRSA 2YVCA 4YONA 3PVUA 1SGHA 2D2QA 2D9ZA 1TQZA 2J59M 1V5MA 1RJ2A 4HAYB 4EMOA 2EJ8A 2I5FA 3N7CA 5C16A 3G9WA 3AU5A 3A8PA 3T06A 1XX0A 3OANA 5FI0A 2N23A 2QKMA 5JP4A 5KCVA 1MK9B 2LULA 5CLLB 4HDOA 2DHJA 4MY6A 1MIXA 2I5CA 3ODOA 1BWNA 3PVLA 2DX1A 1ZSQA 3ULCA 2KGXB 1AQCA 1V5UA 1WG7A 2LKOA 1V5PA 4HAVB 4H8SA 1RRPB 3O96A 2VSZA 5GOWB 1Q67A 4IFSA 2OTXA 1FGYA 3M1IB 3MPXA 1OQNA 1NI2A 4DBBA 3PSCA 3TCAA 2ELAA 2D9VA 2ROZB 2VRWB 2COCA 2LOZA 1GC6A 4MT7A 1K5DB 2AEHA 4EJNA 2FJLA 1NU2A 1FHXA 2Z0QA 2YF0A 1I7AA 1U5EA 2K2UA 1XD4A 2D9XA 3CXBB 2QKLA 1J0WA 4PNKA 5C5BB 2RSGA 2RGNB 1X1GA 5HE0A 4TYZA 1GG3A 1OY2A 5DIFB 3F0WA 3TVVA 3ODXA 1BAKA 2H7DA 1U5DA 3VOQA 1WJMA 2EMSA 1MPHA 3KSYA 2IYBA 1K5GB 3GYOA 1WJ1A 1MIZB 2AL6A 2D9YA 2DA0A 2DKPA 4A6HA 2RLOA 3CIKA 5D3YA 1P6SA 4WVFB 2YT1A 1WVHA 2KCJA 2YS1A 1ZC4B 3AJ4A 3A98B 1SHCA 1BTKA 1MKEA 2MWNB 1AWEA 3MDBC 2J0KA 5KQ4A 3ULBA 3ODWA 1P3RA 5DHFB 4ZRIA 2XQNM 4Z2MB 1U29A 3X23A 3D8EA 3FM8C 4PQ0A 2M38A 1UPRA 2J0MA 2LYDA 1U5GA 1UNQA 4K81A 2DTCA 1FHWA 3KY9A 4KVGB 2GS0A 4GPTB 2P0FA 1GC7A 2KUPA 2CY5A 1X11A 4NY0A 2D11A 2IFSA 1KI1B 1PLSA 2NZ8B 3SO6A 1UNPA 1ZC3B 2G35A 2CY4A 1XCGA 3P6AA 2GCLA 5DHAB 3PP2A 2CRFA 3HK0A 3WYFB 3ML4A 1UPQA 5C79A 1Z87A 1DDWA 5JHGA 2I1JA 1NTYA 3ZDTA 4EKUA 5J3TA 2K2JA 2Z0OA 4GMVA 1DDMA 1EGXA 1ZM0A 4WSFA 4GN1A 1TXDA 1W1HA 4A6FB 3SYXA 1DROA 3U7DA 2HTHB 4IAPA 4KHBB 3BINA 2D10A 1U27A 4D0NB 3UZTA 5D27A 2J0JA 4ZRJA 5HE3A 5LONB 4CHMA 2MDXA 5D3WA 4F7GA 2YS3A 4HAWB 1H10A 1ZVRA 3VIAA 3U8ZA 3HW2B 3D8FA 1FAOA 4F7UP 1BTNA 2DHKA 3HQCA 2R09A 4DX8A 2ZPYA 2W2WA 2LG1A 4HDQA 1X05A 4F7HA 2L2IA 2K00A 2ELBA 4WJ7A 1WI1A 1KZGA 3DXDA 4Y94A 3SV1A 2UZRA 1LB1A 3KRWA 5EFXA 2H7EA 2COFA 5LOPB 1B55A 1DDVA 5J3YA 4C0AA 3IVFA 1X86A 2I1KA 2DX5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FB8 A;  3QWM A;  3TW1 A;  1V88 A;  2P0D A;  1LW3 A;  1UEF A;  4KHO A;  2DHI A;  3F5R A;  3PVW A;  4MK0 A;  4NSW A;  1E5W A;  1DYN A;  1EF1 A;  1P5T A;  3V5W A;  4HHV A;  4IOY X;  2D9W A;  4DX9 0;  2UVM A;  2COD A;  2YRY A;  1N3H A;  3WA0 A;  4CYE A;  3DXE A;  4YL8 A;  1NTV A;  3LJU X;  4HB3 B;  3TO1 A;  4HAX B;  4B6H A;  2Y7B A;  3QIJ A;  1FOE A;  2DLW A;  4A6K A;  1QQG A;  5D3X A;  1W1D A;  2P0H A;  5C5B A;  5C6R A;  3FEH A;  3AU4 A;  4XWX A;  2E2X A;  4ZRK A;  1ISN A;  3GYP A;  4KAX B;  5JHH A;  2MKR A;  3KZ1 A;  1J19 A;  1FHO A;  2EMT A;  3SNH A;  1DBH A;  3PG7 A;  2GCJ A;  3PEG A;  2L1C A;  1V89 A;  1EAZ A;  1Y19 B;  5D3V A;  1U5F A;  4K2P A;  4A5K A;  2YT0 A;  2Z0P A;  1Y5O A;  1M7E A;  2P8V A;  1XR0 B;  2DYN A;  1H4R A;  1M7R A;  2R0D A;  1PFJ A;  3QBV B;  2W2X C;  1I2H A;  3FSS A;  4P7I A;  4GMX B;  2DYQ A;  1XOD A;  3P7Z A;  2YSZ A;  4HB4 B;  3PZD A;  2Y8G A;  3D8D A;  4KHA A;  1W1G A;  1U2B A;  2DN6 A;  2EC1 A;  2ROV A;  4TKN A;  1WGU A;  2X18 A;  5DH9 B;  2RVB B;  1PMS A;  2COA A;  2JP2 A;  3BJI A;  4K17 A;  1OMW A;  4CHJ A;  3TFM A;  1UNR A;  1X1F A;  2DFK A;  1QC6 A;  2CAY A;  2D4Q A;  4DXA B;  4HAU B;  2OQB A;  4K2O A;  1TJ6 A;  4L6E A;  2M14 A;  2RNR B;  2MFQ A;  2RUK B;  3NSU A;  2W2X D;  2LOX A;  4HB0 B;  2HE7 A;  4HAZ B;  5L81 A;  2N0Y A;  4HAT B;  1FGZ A;  2DKQ A;  4A6F A;  3SUZ A;  1EVH A;  2UZS A;  5CLQ B;  3RCP A;  2V76 A;  1WGQ A;  2PZ1 A;  5DI9 B;  2BCJ A;  4Z2N A;  4BBK A;  3ZVR A;  4GXB A;  3DXC A;  3KRX A;  1V61 A;  5JLJ B;  4GZU A;  5HE1 A;  4HB2 B;  5FI1 A;  2YS5 A;  1KZ7 A;  1XKE A;  2NMB A;  5J3Q A;  2VKI A;  2GJY A;  2Q13 A;  5KQ1 A;  2Y8F A;  2ADZ A;  3A8Q A;  5HE2 A;  1MK7 B;  1MAI A;  1IRS A;  2YVC A;  4YON A;  3PVU A;  1SGH A;  2D2Q A;  2D9Z A;  1TQZ A;  2J59 M;  1V5M A;  1RJ2 A;  4HAY B;  4EMO A;  2EJ8 A;  2I5F A;  3N7C A;  5C16 A;  3G9W A;  3AU5 A;  3A8P A;  3T06 A;  1XX0 A;  3OAN A;  5FI0 A;  2N23 A;  2QKM A;  5JP4 A;  5KCV A;  1MK9 B;  2LUL A;  5CLL B;  4HDO A;  2DHJ A;  4MY6 A;  1MIX A;  2I5C A;  3ODO A;  1BWN A;  3PVL A;  2DX1 A;  1ZSQ A;  3ULC A;  2KGX B;  1AQC A;  1V5U A;  1WG7 A;  2LKO A;  1V5P A;  4HAV B;  4H8S A;  1RRP B;  3O96 A;  2VSZ A;  5GOW B;  1Q67 A;  4IFS A;  2OTX A;  1FGY A;  3M1I B;  3MPX A;  1OQN A;  1NI2 A;  4DBB A;  3PSC A;  3TCA A;  2ELA A;  2D9V A;  2ROZ B;  2VRW B;  2COC A;  2LOZ A;  1GC6 A;  4MT7 A;  1K5D B;  2AEH A;  4EJN A;  2FJL A;  1NU2 A;  1FHX A;  2Z0Q A;  2YF0 A;  1I7A A;  1U5E A;  2K2U A;  1XD4 A;  2D9X A;  3CXB B;  2QKL A;  1J0W A;  4PNK A;  5C5B B;  2RSG A;  2RGN B;  1X1G A;  5HE0 A;  4TYZ A;  1GG3 A;  1OY2 A;  5DIF B;  3F0W A;  3TVV A;  3ODX A;  1BAK A;  2H7D A;  1U5D A;  3VOQ A;  1WJM A;  2EMS A;  1MPH A;  3KSY A;  2IYB A;  1K5G B;  3GYO A;  1WJ1 A;  1MIZ B;  2AL6 A;  2D9Y A;  2DA0 A;  2DKP A;  4A6H A;  2RLO A;  3CIK A;  5D3Y A;  1P6S A;  4WVF B;  2YT1 A;  1WVH A;  2KCJ A;  2YS1 A;  1ZC4 B;  3AJ4 A;  3A98 B;  1SHC A;  1BTK A;  1MKE A;  2MWN B;  1AWE A;  3MDB C;  2J0K A;  5KQ4 A;  3ULB A;  3ODW A;  1P3R A;  5DHF B;  4ZRI A;  2XQN M;  4Z2M B;  1U29 A;  3X23 A;  3D8E A;  3FM8 C;  4PQ0 A;  2M38 A;  1UPR A;  2J0M A;  2LYD A;  1U5G A;  1UNQ A;  4K81 A;  2DTC A;  1FHW A;  3KY9 A;  4KVG B;  2GS0 A;  4GPT B;  2P0F A;  1GC7 A;  2KUP A;  2CY5 A;  1X11 A;  4NY0 A;  2D11 A;  2IFS A;  1KI1 B;  1PLS A;  2NZ8 B;  3SO6 A;  1UNP A;  1ZC3 B;  2G35 A;  2CY4 A;  1XCG A;  3P6A A;  2GCL A;  5DHA B;  3PP2 A;  2CRF A;  3HK0 A;  3WYF B;  3ML4 A;  1UPQ A;  5C79 A;  1Z87 A;  1DDW A;  5JHG A;  2I1J A;  1NTY A;  3ZDT A;  4EKU A;  5J3T A;  2K2J A;  2Z0O A;  4GMV A;  1DDM A;  1EGX A;  1ZM0 A;  4WSF A;  4GN1 A;  1TXD A;  1W1H A;  4A6F B;  3SYX A;  1DRO A;  3U7D A;  2HTH B;  4IAP A;  4KHB B;  3BIN A;  2D10 A;  1U27 A;  4D0N B;  3UZT A;  5D27 A;  2J0J A;  4ZRJ A;  5HE3 A;  5LON B;  4CHM A;  2MDX A;  5D3W A;  4F7G A;  2YS3 A;  4HAW B;  1H10 A;  1ZVR A;  3VIA A;  3U8Z A;  3HW2 B;  3D8F A;  1FAO A;  4F7U P;  1BTN A;  2DHK A;  3HQC A;  2R09 A;  4DX8 A;  2ZPY A;  2W2W A;  2LG1 A;  4HDQ A;  1X05 A;  4F7H A;  2L2I A;  2K00 A;  2ELB A;  4WJ7 A;  1WI1 A;  1KZG A;  3DXD A;  4Y94 A;  3SV1 A;  2UZR A;  1LB1 A;  3KRW A;  5EFX A;  2H7E A;  2COF A;  5LOP B;  1B55 A;  1DDV A;  5J3Y A;  4C0A A;  3IVF A;  1X86 A;  2I1K A;  2DX5 A; 
#chains in the Genus database with same CATH topology
 1FB8 A;  3QWM A;  3TW1 A;  1V88 A;  2P0D A;  1LW3 A;  1UEF A;  4KHO A;  2DHI A;  3F5R A;  3PVW A;  4MK0 A;  4NSW A;  1E5W A;  1DYN A;  1EF1 A;  1P5T A;  3V5W A;  4HHV A;  4IOY X;  2D9W A;  4DX9 0;  2UVM A;  2COD A;  2YRY A;  1N3H A;  3WA0 A;  4CYE A;  3DXE A;  3FVC A;  4YL8 A;  1NTV A;  3LJU X;  4HB3 B;  3TO1 A;  4HAX B;  1ZYI A;  4B6H A;  2Y7B A;  3QIJ A;  1FOE A;  2DLW A;  4A6K A;  1QQG A;  5D3X A;  1W1D A;  2P0H A;  5C5B A;  3A58 A;  3FEH A;  5C6R A;  3AU4 A;  4XWX A;  2E2X A;  4ZRK A;  1ISN A;  3GYP A;  4KAX B;  5JHH A;  2GUM A;  2MKR A;  3KZ1 A;  2K8E A;  1J19 A;  1FHO A;  2EMT A;  3SNH A;  1DBH A;  3NW8 A;  2KIG A;  3PG7 A;  2GCJ A;  3PEG A;  2L1C A;  1V89 A;  1EAZ A;  1Y19 B;  5D3V A;  1U5F A;  4K2P A;  4A5K A;  2YT0 A;  2Z59 A;  2Z0P A;  1Y5O A;  1M7E A;  2P8V A;  1XR0 B;  2DYN A;  1H4R A;  1M7R A;  2R0D A;  1PFJ A;  3QBV B;  2W2X C;  1I2H A;  3FSS A;  4P7I A;  4GMX B;  2DYQ A;  1XOD A;  3P7Z A;  2YSZ A;  2ZKM X;  4HB4 B;  3PZD A;  2Y8G A;  3D8D A;  4KHA A;  2Z14 A;  1W1G A;  1U2B A;  2DN6 A;  2EC1 A;  2ROV A;  4TKN A;  1WGU A;  1T77 A;  2X18 A;  5DH9 B;  2RVB B;  1PMS A;  4HSI A;  2COA A;  2JP2 A;  3BJI A;  4D6W A;  4K17 A;  1OMW A;  4CHJ A;  3TFM A;  1UNR A;  1X1F A;  2DFK A;  1QC6 A;  2YT2 A;  2CAY A;  2D4Q A;  4DXA B;  4HAU B;  2NBV A;  2OQB A;  4K2O A;  1TJ6 A;  4L6E A;  2M14 A;  2RNR B;  2MFQ A;  2RUK B;  3NSU A;  2W2X D;  1MI1 A;  2LOX A;  4HB0 B;  2HE7 A;  4HAZ B;  4QXA B;  5L81 A;  2N0Y A;  4HAT B;  1FGZ A;  2DKQ A;  4A6F A;  3SUZ A;  1EVH A;  2UZS A;  4KHB A;  5CLQ B;  3RCP A;  2V76 A;  1WGQ A;  2PZ1 A;  5DI9 B;  2BCJ A;  4Z2N A;  4BBK A;  3ZVR A;  4GXB A;  3DXC A;  3KRX A;  1V61 A;  5JLJ B;  4GZU A;  5HE1 A;  4HB2 B;  5FI1 A;  2YS5 A;  1KZ7 A;  1XKE A;  2NMB A;  5J3Q A;  2VKI A;  2GJY A;  2Q13 A;  5KQ1 A;  2Y8F A;  2ADZ A;  4GNK B;  3A8Q A;  5HE2 A;  3NWF A;  1MK7 B;  1MAI A;  1IRS A;  2YVC A;  4YON A;  3PVU A;  1SGH A;  2D2Q A;  2D9Z A;  1TQZ A;  2J59 M;  1V5M A;  1RJ2 A;  4HAY B;  4EMO A;  2EJ8 A;  2I5F A;  4QJ4 B;  3N7C A;  5C16 A;  3G9W A;  3AU5 A;  3A8P A;  3OHM B;  5M4Y B;  3T06 A;  1XX0 A;  3OAN A;  5FI0 A;  2N23 A;  2QKM A;  5JP4 A;  5KCV A;  1MK9 B;  2LUL A;  3HSA A;  5CLL B;  4HDO A;  2DHJ A;  4MY6 A;  1MIX A;  2I5C A;  3ODO A;  1BWN A;  3PVL A;  2DX1 A;  1ZSQ A;  3ULC A;  2KGX B;  1AQC A;  1V5U A;  1WG7 A;  2LKO A;  1V5P A;  4HAV B;  4H8S A;  1RRP B;  3O96 A;  2VSZ A;  5GOW B;  1Q67 A;  4IFS A;  2OTX A;  1FGY A;  3M1I B;  3MPX A;  1OQN A;  1NI2 A;  4DBB A;  3PSC A;  3TCA A;  2ELA A;  2D9V A;  2ROZ B;  2VRW B;  2COC A;  2LOZ A;  1GC6 A;  4MT7 A;  1K5D B;  2AEH A;  4EJN A;  2FJL A;  1NU2 A;  1FHX A;  2Z4D A;  2Z0Q A;  2YF0 A;  1I7A A;  1U5E A;  2K2U A;  1XD4 A;  2D9X A;  3CXB B;  2QKL A;  1J0W A;  4PNK A;  5C5B B;  2RSG A;  2RGN B;  1X1G A;  5HE0 A;  4TYZ A;  1GG3 A;  1OY2 A;  5DIF B;  3F0W A;  3TVV A;  3ODX A;  1BAK A;  2H7D A;  1U5D A;  3VOQ A;  1WJM A;  2EMS A;  1MPH A;  3KSY A;  2IYB A;  1K5G B;  3GYO A;  1WJ1 A;  1MIZ B;  2AL6 A;  2D9Y A;  2DA0 A;  2DKP A;  4A6H A;  2RLO A;  3CIK A;  5D3Y A;  1P6S A;  4WVF B;  2YT1 A;  1WVH A;  2KCJ A;  2YS1 A;  4OT1 A;  1ZC4 B;  3AJ4 A;  3A98 B;  1SHC A;  1BTK A;  1MKE A;  2KIE A;  2MWN B;  1AWE A;  3MDB C;  2J0K A;  5KQ4 A;  3ULB A;  4L1R A;  3ODW A;  1P3R A;  5DHF B;  4ZRI A;  2XQN M;  4Z2M B;  1U29 A;  3X23 A;  3D8E A;  3FM8 C;  4PQ0 A;  2M38 A;  1UPR A;  2J0M A;  2LYD A;  1U5G A;  1UNQ A;  4K81 A;  2DTC A;  1FHW A;  3KY9 A;  4KVG B;  2GS0 A;  4GPT B;  2P0F A;  1GC7 A;  4GOU A;  2KUP A;  2CY5 A;  1X11 A;  4NY0 A;  2D11 A;  2IFS A;  1KI1 B;  1PLS A;  2NZ8 B;  3SO6 A;  1UNP A;  1ZC3 B;  2FJU B;  5I2S A;  4OSN A;  2G35 A;  2CY4 A;  1XCG A;  3P6A A;  2GCL A;  5DHA B;  2R2Y A;  3PP2 A;  4QJ5 B;  2K49 A;  2CRF A;  5LG4 B;  3HK0 A;  4QJ3 B;  3WYF B;  3ML4 A;  1UPQ A;  2RRF A;  5C79 A;  1Z87 A;  2KR0 A;  1DDW A;  5JHG A;  2I1J A;  1NTY A;  3ZDT A;  4EKU A;  5J3T A;  2K2J A;  2Z0O A;  4GMV A;  3U12 A;  5IRS A;  1DDM A;  1EGX A;  4CSQ A;  1ZM0 A;  4WSF A;  4GN1 A;  1TXD A;  3NWA A;  1W1H A;  4A6F B;  3SYX A;  1DRO A;  2KUQ A;  3U7D A;  2HTH B;  4IAP A;  4KHB B;  3BIN A;  2D10 A;  1U27 A;  3NWD A;  4D0N B;  3UZT A;  5D27 A;  2J0J A;  4ZRJ A;  2Z13 A;  5HE3 A;  5LON B;  4CHM A;  2MDX A;  5D3W A;  4F7G A;  2YS3 A;  4HAW B;  1H10 A;  1ZVR A;  3VIA A;  3U8Z A;  3HW2 B;  3D8F A;  1FAO A;  4F7U P;  5I2M A;  1BTN A;  2DHK A;  3B77 A;  3HQC A;  2R09 A;  4DX8 A;  4DIX A;  2ZPY A;  2W2W A;  3HIE A;  2LG1 A;  4HDQ A;  1X05 A;  4F7H A;  2L2I A;  2K00 A;  2ELB A;  3DCX A;  4WJ7 A;  1WI1 A;  1KZG A;  3DXD A;  4Y94 A;  3SV1 A;  2UZR A;  1LB1 A;  3KRW A;  5EFX A;  2H7E A;  2COF A;  5LOP B;  1B55 A;  1DDV A;  5J3Y A;  4C0A A;  3IVF A;  1X86 A;  2I1K A;  2DX5 A; 
#chains in the Genus database with same CATH homology
 1FB8 A;  3QWM A;  3TW1 A;  1V88 A;  2P0D A;  1LW3 A;  1UEF A;  4KHO A;  2DHI A;  3F5R A;  3PVW A;  4MK0 A;  4NSW A;  1E5W A;  1DYN A;  1EF1 A;  1P5T A;  3V5W A;  4HHV A;  4IOY X;  2D9W A;  4DX9 0;  2UVM A;  2COD A;  2YRY A;  1N3H A;  3WA0 A;  4CYE A;  3DXE A;  4YL8 A;  1NTV A;  3LJU X;  4HB3 B;  3TO1 A;  4HAX B;  4B6H A;  2Y7B A;  3QIJ A;  1FOE A;  2DLW A;  4A6K A;  1QQG A;  5D3X A;  1W1D A;  2P0H A;  5C5B A;  5C6R A;  3FEH A;  3AU4 A;  4XWX A;  2E2X A;  4ZRK A;  1ISN A;  3GYP A;  4KAX B;  5JHH A;  2MKR A;  3KZ1 A;  1J19 A;  1FHO A;  2EMT A;  3SNH A;  1DBH A;  3PG7 A;  2GCJ A;  3PEG A;  2L1C A;  1V89 A;  1EAZ A;  1Y19 B;  5D3V A;  1U5F A;  4K2P A;  4A5K A;  2YT0 A;  2Z0P A;  1Y5O A;  1M7E A;  2P8V A;  1XR0 B;  2DYN A;  1H4R A;  1M7R A;  2R0D A;  1PFJ A;  3QBV B;  2W2X C;  1I2H A;  3FSS A;  4P7I A;  4GMX B;  2DYQ A;  1XOD A;  3P7Z A;  2YSZ A;  4HB4 B;  3PZD A;  2Y8G A;  3D8D A;  4KHA A;  1W1G A;  1U2B A;  2DN6 A;  2EC1 A;  2ROV A;  4TKN A;  1WGU A;  2X18 A;  5DH9 B;  2RVB B;  1PMS A;  2COA A;  2JP2 A;  3BJI A;  4K17 A;  1OMW A;  4CHJ A;  3TFM A;  1UNR A;  1X1F A;  2DFK A;  1QC6 A;  2CAY A;  2D4Q A;  4DXA B;  4HAU B;  2OQB A;  4K2O A;  1TJ6 A;  4L6E A;  2M14 A;  2RNR B;  2MFQ A;  2RUK B;  3NSU A;  2W2X D;  2LOX A;  4HB0 B;  2HE7 A;  4HAZ B;  5L81 A;  2N0Y A;  4HAT B;  1FGZ A;  2DKQ A;  4A6F A;  3SUZ A;  1EVH A;  2UZS A;  5CLQ B;  3RCP A;  2V76 A;  1WGQ A;  2PZ1 A;  5DI9 B;  2BCJ A;  4Z2N A;  4BBK A;  3ZVR A;  4GXB A;  3DXC A;  3KRX A;  1V61 A;  5JLJ B;  4GZU A;  5HE1 A;  4HB2 B;  5FI1 A;  2YS5 A;  1KZ7 A;  1XKE A;  2NMB A;  5J3Q A;  2VKI A;  2GJY A;  2Q13 A;  5KQ1 A;  2Y8F A;  2ADZ A;  3A8Q A;  5HE2 A;  1MK7 B;  1MAI A;  1IRS A;  2YVC A;  4YON A;  3PVU A;  1SGH A;  2D2Q A;  2D9Z A;  1TQZ A;  2J59 M;  1V5M A;  1RJ2 A;  4HAY B;  4EMO A;  2EJ8 A;  2I5F A;  3N7C A;  5C16 A;  3G9W A;  3AU5 A;  3A8P A;  3T06 A;  1XX0 A;  3OAN A;  5FI0 A;  2N23 A;  2QKM A;  5JP4 A;  5KCV A;  1MK9 B;  2LUL A;  5CLL B;  4HDO A;  2DHJ A;  4MY6 A;  1MIX A;  2I5C A;  3ODO A;  1BWN A;  3PVL A;  2DX1 A;  1ZSQ A;  3ULC A;  2KGX B;  1AQC A;  1V5U A;  1WG7 A;  2LKO A;  1V5P A;  4HAV B;  4H8S A;  1RRP B;  3O96 A;  2VSZ A;  5GOW B;  1Q67 A;  4IFS A;  2OTX A;  1FGY A;  3M1I B;  3MPX A;  1OQN A;  1NI2 A;  4DBB A;  3PSC A;  3TCA A;  2ELA A;  2D9V A;  2ROZ B;  2VRW B;  2COC A;  2LOZ A;  1GC6 A;  4MT7 A;  1K5D B;  2AEH A;  4EJN A;  2FJL A;  1NU2 A;  1FHX A;  2Z0Q A;  2YF0 A;  1I7A A;  1U5E A;  2K2U A;  1XD4 A;  2D9X A;  3CXB B;  2QKL A;  1J0W A;  4PNK A;  5C5B B;  2RSG A;  2RGN B;  1X1G A;  5HE0 A;  4TYZ A;  1GG3 A;  1OY2 A;  5DIF B;  3F0W A;  3TVV A;  3ODX A;  1BAK A;  2H7D A;  1U5D A;  3VOQ A;  1WJM A;  2EMS A;  1MPH A;  3KSY A;  2IYB A;  1K5G B;  3GYO A;  1WJ1 A;  1MIZ B;  2AL6 A;  2D9Y A;  2DA0 A;  2DKP A;  4A6H A;  2RLO A;  3CIK A;  5D3Y A;  1P6S A;  4WVF B;  2YT1 A;  1WVH A;  2KCJ A;  2YS1 A;  1ZC4 B;  3AJ4 A;  3A98 B;  1SHC A;  1BTK A;  1MKE A;  2MWN B;  1AWE A;  3MDB C;  2J0K A;  5KQ4 A;  3ULB A;  3ODW A;  1P3R A;  5DHF B;  4ZRI A;  2XQN M;  4Z2M B;  1U29 A;  3X23 A;  3D8E A;  3FM8 C;  4PQ0 A;  2M38 A;  1UPR A;  2J0M A;  2LYD A;  1U5G A;  1UNQ A;  4K81 A;  2DTC A;  1FHW A;  3KY9 A;  4KVG B;  2GS0 A;  4GPT B;  2P0F A;  1GC7 A;  2KUP A;  2CY5 A;  1X11 A;  4NY0 A;  2D11 A;  2IFS A;  1KI1 B;  1PLS A;  2NZ8 B;  3SO6 A;  1UNP A;  1ZC3 B;  2G35 A;  2CY4 A;  1XCG A;  3P6A A;  2GCL A;  5DHA B;  3PP2 A;  2CRF A;  3HK0 A;  3WYF B;  3ML4 A;  1UPQ A;  5C79 A;  1Z87 A;  1DDW A;  5JHG A;  2I1J A;  1NTY A;  3ZDT A;  4EKU A;  5J3T A;  2K2J A;  2Z0O A;  4GMV A;  1DDM A;  1EGX A;  1ZM0 A;  4WSF A;  4GN1 A;  1TXD A;  1W1H A;  4A6F B;  3SYX A;  1DRO A;  3U7D A;  2HTH B;  4IAP A;  4KHB B;  3BIN A;  2D10 A;  1U27 A;  4D0N B;  3UZT A;  5D27 A;  2J0J A;  4ZRJ A;  5HE3 A;  5LON B;  4CHM A;  2MDX A;  5D3W A;  4F7G A;  2YS3 A;  4HAW B;  1H10 A;  1ZVR A;  3VIA A;  3U8Z A;  3HW2 B;  3D8F A;  1FAO A;  4F7U P;  1BTN A;  2DHK A;  3HQC A;  2R09 A;  4DX8 A;  2ZPY A;  2W2W A;  2LG1 A;  4HDQ A;  1X05 A;  4F7H A;  2L2I A;  2K00 A;  2ELB A;  4WJ7 A;  1WI1 A;  1KZG A;  3DXD A;  4Y94 A;  3SV1 A;  2UZR A;  1LB1 A;  3KRW A;  5EFX A;  2H7E A;  2COF A;  5LOP B;  1B55 A;  1DDV A;  5J3Y A;  4C0A A;  3IVF A;  1X86 A;  2I1K A;  2DX5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...