1UEFA

Crystal structure of dok1 ptb domain complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
105
structure length
105
Chain Sequence
MGSQFWVTSQKTEASERCGLQGSYILRVEAEKLTLLTLGAQSQILEPLLFWPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTSQGNDIFQAVEAAIQQQKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Specific Recognition of RET by the Dok1 Phosphotyrosine Binding Domain
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding/transferase
molecule keywords Docking protein 1
total genus 23
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1uefA00
1SHCA 2KCJA 1AWEA 1ZSQA 1GG3A 2EMSA 3UZTA 2UZSA 1NTVA 1DDWA 2KUPA 2MFQA 1KI1B 2GCJA 2DLWA 1RRPB 4HB0B 2BCJA 3PG7A 3SNHA 2P8VA 2EC1A 2L2IA 3ML4A 2PZ1A 2COFA 1Z87A 2HTHB 1V89A 2Y8FA 3F5RA 1ZC4B 2ROVA 3TO1A 4MK0A 1K5GB 2W2WA 1M7RA 2YS1A 4BBKA 1X1GA 2Z0QA 2GCLA 5C5BA 1BTNA 3DXDA 1PLSA 1X1FA 5EFXA 1NTYA 2RGNB 2H7EA 2CY4A 2VKIA 2KGXB 2Z0OA 1UNQA 4HDQA 4Z2NA 1BTKA 5LONB 4CYEA 5JP4A 2COAA 1U27A 1NU2A 4C0AA 3QWMA 1OMWA 2R09A 1H4RA 2R0DA 5CLQB 4HHVA 2DX5A 2UVMA 3PSCA 5DH9B 3RCPA 1MPHA 4K17A 1U2BA 4HAXB 1XX0A 1MIXA 1V5PA 1Y19B 3AU5A 1P5TA 5D3VA 5C79A 5J3TA 1P3RA 3U7DA 2G35A 4F7HA 4PNKA 4A6HA 4EMOA 4HATB 2M14A 3AU4A 1PMSA 1ZM0A 2I1JA 4HAZB 2RLOA 2EMTA 3HK0A 1X86A 1W1DA 2I1KA 1QQGA 3PVWA 1WI1A 2JP2A 3WA0A 5JHHA 1MIZB 5KQ1A 2J0KA 4HAVB 1AQCA 3VOQA 2Z0PA 2YT1A 1EVHA 2D9YA 4A5KA 4MY6A 2K00A 2OTXA 5FI1A 1U5GA 2MDXA 4KHAA 4GZUA 4GN1A 5JHGA 1K5DB 4TYZA 1IRSA 3KRWA 4HAWB 3KZ1A 1V5MA 3M1IB 5D3WA 3GYOA 3X23A 5D27A 1FGZA 1U29A 2LG1A 2LYDA 3ULBA 5KQ4A 2D2QA 4TKNA 1H10A 1TQZA 3TFMA 3ZDTA 5JLJB 3U8ZA 1DDMA 3SYXA 1DROA 5GOWB 4HAYB 2LOXA 1KZ7A 1FHOA 1WJ1A 2UZRA 4F7GA 1FOEA 4WJ7A 3CXBB 2K2JA 3KSYA 5HE0A 2W2XC 5DHAB 2DN6A 1OQNA 4F7UP 4KHBB 2GS0A 5D3YA 3FEHA 5C16A 3PZDA 1PFJA 2VRWB 4HDOA 1GC7A 2E2XA 1EGXA 4DX90 2DHKA 4B6HA 2RNRB 3BJIA 4ZRIA 2J0MA 1WVHA 4XWXA 5CLLB 3T06A 2Y8GA 2DKQA 3MDBC 5KCVA 1I2HA 2QKLA 4CHJA 4IAPA 3VIAA 1W1GA 2RSGA 2DKPA 2P0DA 3PVUA 1MKEA 2YVCA 4HB2B 4YL8A 2N23A 1W1HA 1P6SA 5HE2A 3GYPA 4DX8A 2DYNA 4EKUA 4YONA 4ZRJA 1BWNA 1EAZA 1QC6A 2ELBA 5D3XA 2I5FA 4MT7A 2RUKB 2D10A 3KY9A 3DXCA 2D9XA 3KRXA 2CODA 1X11A 1B55A 2XQNM 1UPRA 4WVFB 1RJ2A 2CY5A 3QIJA 1FGYA 2V76A 2EJ8A 1UNPA 2YT0A 2Y7BA 1U5DA 4GXBA 3F0WA 4Y94A 1FB8A 2M38A 1I7AA 4GMXB 3SV1A 4A6KA 2DX1A 5LOPB 2L1CA 2MWNB 1E5WA 2J59M 2VSZA 3PVLA 2D9VA 1LB1A 3A8PA 4IOYX 4DBBA 1M7EA 3P7ZA 2YS5A 2HE7A 5L81A 1ISNA 3ODOA 3PP2A 4H8SA 2LOZA 4GMVA 4A6FA 2I5CA 3HQCA 3ULCA 1U5EA 2NZ8B 2YRYA 1U5FA 4WSFA 2Q13A 1KZGA 1J19A 1OY2A 3FM8C 2N0YA 3ODWA 1WGQA 2MKRA 1NI2A 3NSUA 4IFSA 2YF0A 1ZC3B 5C6RA 2CAYA 2LULA 2D9ZA 1N3HA 5HE1A 2D4QA 3P6AA 4HAUB 3OANA 2IYBA 3G9WA 2ZPYA 5C5BB 2AEHA 1SGHA 3CIKA 2ELAA 4KHOA 3WYFB 1V61A 1EF1A 1UNRA 2X18A 3D8FA 2DHIA 2OQBA 1FHWA 2CRFA 1ZVRA 1FAOA 2DYQA 4KAXB 2NMBA 2K2UA 2AL6A 1MK7B 3BINA 4K81A 2DTCA 2FJLA 3SUZA 1DDVA 4HB4B 1MAIA 1MK9B 4K2OA 3PEGA 4NSWA 3D8DA 1WJMA 1V5UA 4HB3B 1BAKA 1Q67A 2DA0A 3FSSA 1UPQA 1TJ6A 2P0HA 2LKOA 2YS3A 4GPTB 1XODA 4L6EA 4KVGB 1WG7A 2D11A 3V5WA 1DYNA 2DFKA 3TCAA 2DHJA 2P0FA 3A8QA 5DI9B 4K2PA 4A6FB 1Y5OA 1TXDA 2RVBB 1FHXA 4P7IA 1XD4A 5DIFB 1X05A 5J3QA 1XCGA 2YSZA 3IVFA 3ZVRA 3TVVA 5J3YA 3N7CA 2QKMA 1XKEA 4DXAB 2IFSA 2COCA 2J0JA 3TW1A 1XR0B 3A98B 2ADZA 1J0WA 4CHMA 3D8EA 3QBVB 3DXEA 1LW3A 3ODXA 1WGUA 3LJUX 2GJYA 2ROZB 4PQ0A 2W2XD 3AJ4A 3MPXA 1UEFA 2D9WA 4NY0A 1GC6A 3SO6A 4ZRKA 4EJNA 2H7DA 4Z2MB 3HW2B 1DBHA 5HE3A 3O96A 5FI0A 4D0NB 5DHFB 1V88A
chains in the Genus database with same CATH superfamily
1SHCA 2KCJA 1AWEA 1ZSQA 2KR0A 1GG3A 2EMSA 3UZTA 2UZSA 1NTVA 1DDWA 2KUPA 2MFQA 1KI1B 2GCJA 2DLWA 5I2SA 1RRPB 4HB0B 2BCJA 3PG7A 3SNHA 2P8VA 2EC1A 2L2IA 3ML4A 2PZ1A 4GNKB 2COFA 1Z87A 2HTHB 1V89A 2NBVA 2Y8FA 3F5RA 1ZC4B 2ROVA 3TO1A 4MK0A 1K5GB 2W2WA 1M7RA 2YS1A 2R2YA 4BBKA 1X1GA 2Z0QA 2GCLA 5C5BA 1BTNA 3DXDA 1PLSA 1X1FA 3B77A 5EFXA 1NTYA 2RGNB 2H7EA 2CY4A 2VKIA 2KGXB 2Z0OA 1UNQA 4HDQA 4Z2NA 1BTKA 5LONB 4CYEA 5JP4A 2COAA 1U27A 1NU2A 4C0AA 3QWMA 1OMWA 2R09A 1H4RA 2R0DA 5CLQB 4HHVA 2DX5A 2UVMA 3PSCA 5DH9B 3RCPA 1MPHA 4K17A 1U2BA 4HAXB 1XX0A 1MIXA 1V5PA 1Y19B 3AU5A 1P5TA 5D3VA 5C79A 3OHMB 5J3TA 1P3RA 3U7DA 2G35A 4F7HA 4PNKA 4A6HA 4EMOA 4HATB 2M14A 3AU4A 1PMSA 1ZM0A 2I1JA 4HAZB 2RLOA 2EMTA 3HK0A 1X86A 1W1DA 2I1KA 1QQGA 3PVWA 1WI1A 2JP2A 3DCXA 2K8EA 2FJUB 3WA0A 5JHHA 1MIZB 5KQ1A 2J0KA 4HAVB 1AQCA 3VOQA 2Z0PA 2YT1A 1EVHA 2K49A 2D9YA 4A5KA 4MY6A 2K00A 2OTXA 5FI1A 1U5GA 2MDXA 4KHAA 4GZUA 4GN1A 5JHGA 1K5DB 4TYZA 1IRSA 3KRWA 4HAWB 3KZ1A 4QJ5B 1V5MA 3A58A 3M1IB 5D3WA 3GYOA 3X23A 5D27A 1FGZA 1U29A 2LG1A 2LYDA 4KHBA 3ULBA 5KQ4A 2D2QA 4TKNA 1H10A 1TQZA 3FVCA 3TFMA 3ZDTA 5JLJB 3U8ZA 1DDMA 3SYXA 1DROA 5GOWB 4HAYB 2LOXA 1KZ7A 1FHOA 1ZYIA 1WJ1A 2UZRA 4F7GA 1FOEA 4WJ7A 4GOUA 4CSQA 3CXBB 2K2JA 3KSYA 5HE0A 2W2XC 5DHAB 2DN6A 2KUQA 1OQNA 2YT2A 1MI1A 4F7UP 3NW8A 4KHBB 2GS0A 5D3YA 3FEHA 5C16A 3PZDA 1PFJA 2VRWB 4HDOA 4QJ4B 1GC7A 2E2XA 1EGXA 4DX90 2DHKA 4B6HA 2RNRB 2KIGA 3BJIA 3NWFA 4ZRIA 2J0MA 1WVHA 4XWXA 5CLLB 3T06A 2Y8GA 2DKQA 3MDBC 5KCVA 1I2HA 3NWAA 2QKLA 4CHJA 4IAPA 3VIAA 1W1GA 4OT1A 2RSGA 2DKPA 2P0DA 3PVUA 1MKEA 4HSIA 2YVCA 4HB2B 4YL8A 2N23A 2RRFA 1W1HA 1P6SA 5HE2A 3GYPA 4DX8A 2DYNA 4EKUA 4YONA 4ZRJA 1BWNA 1EAZA 1QC6A 2ELBA 5D3XA 2I5FA 4MT7A 2RUKB 5I2MA 2D10A 3KY9A 3DXCA 2D9XA 3KRXA 2CODA 1X11A 1B55A 2XQNM 4D6WA 1UPRA 4WVFB 1RJ2A 2CY5A 3QIJA 1FGYA 2V76A 4OSNA 2EJ8A 1UNPA 2YT0A 3NWDA 2Y7BA 1U5DA 4GXBA 3F0WA 4DIXA 4Y94A 1FB8A 2M38A 1I7AA 4GMXB 3SV1A 4A6KA 2DX1A 5LOPB 2L1CA 2MWNB 1E5WA 2J59M 2VSZA 5M4YB 3PVLA 2D9VA 1LB1A 3A8PA 4IOYX 4DBBA 1M7EA 3P7ZA 2YS5A 2HE7A 5L81A 1ISNA 3ODOA 3PP2A 3HSAA 4H8SA 2LOZA 4GMVA 4A6FA 2I5CA 3HQCA 3ULCA 1U5EA 2NZ8B 2YRYA 1U5FA 4WSFA 2Q13A 1KZGA 1J19A 1OY2A 3FM8C 2N0YA 3ODWA 1WGQA 2MKRA 1NI2A 3NSUA 4IFSA 4QXAB 2YF0A 1ZC3B 5C6RA 2CAYA 2LULA 2D9ZA 1N3HA 5HE1A 2D4QA 3P6AA 4HAUB 3OANA 2IYBA 3G9WA 2ZPYA 5C5BB 2AEHA 1SGHA 3CIKA 2ELAA 4KHOA 3WYFB 1V61A 2GUMA 1EF1A 1UNRA 2X18A 3D8FA 2DHIA 2OQBA 1FHWA 2CRFA 1ZVRA 1FAOA 2DYQA 4KAXB 2NMBA 2K2UA 2AL6A 1MK7B 3BINA 5LG4B 3U12A 4K81A 2DTCA 2FJLA 3SUZA 1DDVA 4HB4B 1MAIA 1MK9B 4K2OA 3PEGA 4NSWA 2Z59A 3D8DA 3HIEA 1WJMA 1V5UA 2Z14A 4HB3B 1BAKA 1Q67A 2DA0A 3FSSA 1UPQA 1TJ6A 2P0HA 2LKOA 2YS3A 4GPTB 1XODA 4L6EA 4KVGB 1WG7A 5IRSA 2D11A 3V5WA 2Z13A 1DYNA 2ZKMX 2DFKA 3TCAA 2DHJA 2P0FA 3A8QA 5DI9B 4K2PA 4A6FB 1Y5OA 1TXDA 2Z4DA 1T77A 2RVBB 1FHXA 4P7IA 1XD4A 5DIFB 1X05A 5J3QA 4QJ3B 1XCGA 2YSZA 3IVFA 3ZVRA 3TVVA 5J3YA 3N7CA 2QKMA 1XKEA 4DXAB 2IFSA 2COCA 2J0JA 3TW1A 1XR0B 3A98B 2ADZA 1J0WA 4CHMA 3D8EA 3QBVB 3DXEA 1LW3A 3ODXA 2KIEA 1WGUA 4L1RA 3LJUX 2GJYA 2ROZB 4PQ0A 2W2XD 3AJ4A 3MPXA 1UEFA 2D9WA 4NY0A 1GC6A 3SO6A 4ZRKA 4EJNA 2H7DA 4Z2MB 3HW2B 1DBHA 5HE3A 3O96A 5FI0A 4D0NB 5DHFB 1V88A
chains in the Genus database with same CATH topology
1SHCA 2KCJA 1AWEA 1ZSQA 1GG3A 2EMSA 3UZTA 2UZSA 1NTVA 1DDWA 2KUPA 2MFQA 1KI1B 2GCJA 2DLWA 1RRPB 4HB0B 2BCJA 3PG7A 3SNHA 2P8VA 2EC1A 2L2IA 3ML4A 2PZ1A 2COFA 1Z87A 2HTHB 1V89A 2Y8FA 3F5RA 1ZC4B 2ROVA 3TO1A 4MK0A 1K5GB 2W2WA 1M7RA 2YS1A 4BBKA 1X1GA 2Z0QA 2GCLA 5C5BA 1BTNA 3DXDA 1PLSA 1X1FA 5EFXA 1NTYA 2RGNB 2H7EA 2CY4A 2VKIA 2KGXB 2Z0OA 1UNQA 4HDQA 4Z2NA 1BTKA 5LONB 4CYEA 5JP4A 2COAA 1U27A 1NU2A 4C0AA 3QWMA 1OMWA 2R09A 1H4RA 2R0DA 5CLQB 4HHVA 2DX5A 2UVMA 3PSCA 5DH9B 3RCPA 1MPHA 4K17A 1U2BA 4HAXB 1XX0A 1MIXA 1V5PA 1Y19B 3AU5A 1P5TA 5D3VA 5C79A 5J3TA 1P3RA 3U7DA 2G35A 4F7HA 4PNKA 4A6HA 4EMOA 4HATB 2M14A 3AU4A 1PMSA 1ZM0A 2I1JA 4HAZB 2RLOA 2EMTA 3HK0A 1X86A 1W1DA 2I1KA 1QQGA 3PVWA 1WI1A 2JP2A 3WA0A 5JHHA 1MIZB 5KQ1A 2J0KA 4HAVB 1AQCA 3VOQA 2Z0PA 2YT1A 1EVHA 2D9YA 4A5KA 4MY6A 2K00A 2OTXA 5FI1A 1U5GA 2MDXA 4KHAA 4GZUA 4GN1A 5JHGA 1K5DB 4TYZA 1IRSA 3KRWA 4HAWB 3KZ1A 1V5MA 3M1IB 5D3WA 3GYOA 3X23A 5D27A 1FGZA 1U29A 2LG1A 2LYDA 3ULBA 5KQ4A 2D2QA 4TKNA 1H10A 1TQZA 3TFMA 3ZDTA 5JLJB 3U8ZA 1DDMA 3SYXA 1DROA 5GOWB 4HAYB 2LOXA 1KZ7A 1FHOA 1WJ1A 2UZRA 4F7GA 1FOEA 4WJ7A 3CXBB 2K2JA 3KSYA 5HE0A 2W2XC 5DHAB 2DN6A 1OQNA 4F7UP 4KHBB 2GS0A 5D3YA 3FEHA 5C16A 3PZDA 1PFJA 2VRWB 4HDOA 1GC7A 2E2XA 1EGXA 4DX90 2DHKA 4B6HA 2RNRB 3BJIA 4ZRIA 2J0MA 1WVHA 4XWXA 5CLLB 3T06A 2Y8GA 2DKQA 3MDBC 5KCVA 1I2HA 2QKLA 4CHJA 4IAPA 3VIAA 1W1GA 2RSGA 2DKPA 2P0DA 3PVUA 1MKEA 2YVCA 4HB2B 4YL8A 2N23A 1W1HA 1P6SA 5HE2A 3GYPA 4DX8A 2DYNA 4EKUA 4YONA 4ZRJA 1BWNA 1EAZA 1QC6A 2ELBA 5D3XA 2I5FA 4MT7A 2RUKB 2D10A 3KY9A 3DXCA 2D9XA 3KRXA 2CODA 1X11A 1B55A 2XQNM 1UPRA 4WVFB 1RJ2A 2CY5A 3QIJA 1FGYA 2V76A 2EJ8A 1UNPA 2YT0A 2Y7BA 1U5DA 4GXBA 3F0WA 4Y94A 1FB8A 2M38A 1I7AA 4GMXB 3SV1A 4A6KA 2DX1A 5LOPB 2L1CA 2MWNB 1E5WA 2J59M 2VSZA 3PVLA 2D9VA 1LB1A 3A8PA 4IOYX 4DBBA 1M7EA 3P7ZA 2YS5A 2HE7A 5L81A 1ISNA 3ODOA 3PP2A 4H8SA 2LOZA 4GMVA 4A6FA 2I5CA 3HQCA 3ULCA 1U5EA 2NZ8B 2YRYA 1U5FA 4WSFA 2Q13A 1KZGA 1J19A 1OY2A 3FM8C 2N0YA 3ODWA 1WGQA 2MKRA 1NI2A 3NSUA 4IFSA 2YF0A 1ZC3B 5C6RA 2CAYA 2LULA 2D9ZA 1N3HA 5HE1A 2D4QA 3P6AA 4HAUB 3OANA 2IYBA 3G9WA 2ZPYA 5C5BB 2AEHA 1SGHA 3CIKA 2ELAA 4KHOA 3WYFB 1V61A 1EF1A 1UNRA 2X18A 3D8FA 2DHIA 2OQBA 1FHWA 2CRFA 1ZVRA 1FAOA 2DYQA 4KAXB 2NMBA 2K2UA 2AL6A 1MK7B 3BINA 4K81A 2DTCA 2FJLA 3SUZA 1DDVA 4HB4B 1MAIA 1MK9B 4K2OA 3PEGA 4NSWA 3D8DA 1WJMA 1V5UA 4HB3B 1BAKA 1Q67A 2DA0A 3FSSA 1UPQA 1TJ6A 2P0HA 2LKOA 2YS3A 4GPTB 1XODA 4L6EA 4KVGB 1WG7A 2D11A 3V5WA 1DYNA 2DFKA 3TCAA 2DHJA 2P0FA 3A8QA 5DI9B 4K2PA 4A6FB 1Y5OA 1TXDA 2RVBB 1FHXA 4P7IA 1XD4A 5DIFB 1X05A 5J3QA 1XCGA 2YSZA 3IVFA 3ZVRA 3TVVA 5J3YA 3N7CA 2QKMA 1XKEA 4DXAB 2IFSA 2COCA 2J0JA 3TW1A 1XR0B 3A98B 2ADZA 1J0WA 4CHMA 3D8EA 3QBVB 3DXEA 1LW3A 3ODXA 1WGUA 3LJUX 2GJYA 2ROZB 4PQ0A 2W2XD 3AJ4A 3MPXA 1UEFA 2D9WA 4NY0A 1GC6A 3SO6A 4ZRKA 4EJNA 2H7DA 4Z2MB 3HW2B 1DBHA 5HE3A 3O96A 5FI0A 4D0NB 5DHFB 1V88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SHC A;  2KCJ A;  1AWE A;  1ZSQ A;  1GG3 A;  2EMS A;  3UZT A;  2UZS A;  1NTV A;  1DDW A;  2KUP A;  2MFQ A;  1KI1 B;  2GCJ A;  2DLW A;  1RRP B;  4HB0 B;  2BCJ A;  3PG7 A;  3SNH A;  2P8V A;  2EC1 A;  2L2I A;  3ML4 A;  2PZ1 A;  2COF A;  1Z87 A;  2HTH B;  1V89 A;  2Y8F A;  3F5R A;  1ZC4 B;  2ROV A;  3TO1 A;  4MK0 A;  1K5G B;  2W2W A;  1M7R A;  2YS1 A;  4BBK A;  1X1G A;  2Z0Q A;  2GCL A;  5C5B A;  1BTN A;  3DXD A;  1PLS A;  1X1F A;  5EFX A;  1NTY A;  2RGN B;  2H7E A;  2CY4 A;  2VKI A;  2KGX B;  2Z0O A;  1UNQ A;  4HDQ A;  4Z2N A;  1BTK A;  5LON B;  4CYE A;  5JP4 A;  2COA A;  1U27 A;  1NU2 A;  4C0A A;  3QWM A;  1OMW A;  2R09 A;  1H4R A;  2R0D A;  5CLQ B;  4HHV A;  2DX5 A;  2UVM A;  3PSC A;  5DH9 B;  3RCP A;  1MPH A;  4K17 A;  1U2B A;  4HAX B;  1XX0 A;  1MIX A;  1V5P A;  1Y19 B;  3AU5 A;  1P5T A;  5D3V A;  5C79 A;  5J3T A;  1P3R A;  3U7D A;  2G35 A;  4F7H A;  4PNK A;  4A6H A;  4EMO A;  4HAT B;  2M14 A;  3AU4 A;  1PMS A;  1ZM0 A;  2I1J A;  4HAZ B;  2RLO A;  2EMT A;  3HK0 A;  1X86 A;  1W1D A;  2I1K A;  1QQG A;  3PVW A;  1WI1 A;  2JP2 A;  3WA0 A;  5JHH A;  1MIZ B;  5KQ1 A;  2J0K A;  4HAV B;  1AQC A;  3VOQ A;  2Z0P A;  2YT1 A;  1EVH A;  2D9Y A;  4A5K A;  4MY6 A;  2K00 A;  2OTX A;  5FI1 A;  1U5G A;  2MDX A;  4KHA A;  4GZU A;  4GN1 A;  5JHG A;  1K5D B;  4TYZ A;  1IRS A;  3KRW A;  4HAW B;  3KZ1 A;  1V5M A;  3M1I B;  5D3W A;  3GYO A;  3X23 A;  5D27 A;  1FGZ A;  1U29 A;  2LG1 A;  2LYD A;  3ULB A;  5KQ4 A;  2D2Q A;  4TKN A;  1H10 A;  1TQZ A;  3TFM A;  3ZDT A;  5JLJ B;  3U8Z A;  1DDM A;  3SYX A;  1DRO A;  5GOW B;  4HAY B;  2LOX A;  1KZ7 A;  1FHO A;  1WJ1 A;  2UZR A;  4F7G A;  1FOE A;  4WJ7 A;  3CXB B;  2K2J A;  3KSY A;  5HE0 A;  2W2X C;  5DHA B;  2DN6 A;  1OQN A;  4F7U P;  4KHB B;  2GS0 A;  5D3Y A;  3FEH A;  5C16 A;  3PZD A;  1PFJ A;  2VRW B;  4HDO A;  1GC7 A;  2E2X A;  1EGX A;  4DX9 0;  2DHK A;  4B6H A;  2RNR B;  3BJI A;  4ZRI A;  2J0M A;  1WVH A;  4XWX A;  5CLL B;  3T06 A;  2Y8G A;  2DKQ A;  3MDB C;  5KCV A;  1I2H A;  2QKL A;  4CHJ A;  4IAP A;  3VIA A;  1W1G A;  2RSG A;  2DKP A;  2P0D A;  3PVU A;  1MKE A;  2YVC A;  4HB2 B;  4YL8 A;  2N23 A;  1W1H A;  1P6S A;  5HE2 A;  3GYP A;  4DX8 A;  2DYN A;  4EKU A;  4YON A;  4ZRJ A;  1BWN A;  1EAZ A;  1QC6 A;  2ELB A;  5D3X A;  2I5F A;  4MT7 A;  2RUK B;  2D10 A;  3KY9 A;  3DXC A;  2D9X A;  3KRX A;  2COD A;  1X11 A;  1B55 A;  2XQN M;  1UPR A;  4WVF B;  1RJ2 A;  2CY5 A;  3QIJ A;  1FGY A;  2V76 A;  2EJ8 A;  1UNP A;  2YT0 A;  2Y7B A;  1U5D A;  4GXB A;  3F0W A;  4Y94 A;  1FB8 A;  2M38 A;  1I7A A;  4GMX B;  3SV1 A;  4A6K A;  2DX1 A;  5LOP B;  2L1C A;  2MWN B;  1E5W A;  2J59 M;  2VSZ A;  3PVL A;  2D9V A;  1LB1 A;  3A8P A;  4IOY X;  4DBB A;  1M7E A;  3P7Z A;  2YS5 A;  2HE7 A;  5L81 A;  1ISN A;  3ODO A;  3PP2 A;  4H8S A;  2LOZ A;  4GMV A;  4A6F A;  2I5C A;  3HQC A;  3ULC A;  1U5E A;  2NZ8 B;  2YRY A;  1U5F A;  4WSF A;  2Q13 A;  1KZG A;  1J19 A;  1OY2 A;  3FM8 C;  2N0Y A;  3ODW A;  1WGQ A;  2MKR A;  1NI2 A;  3NSU A;  4IFS A;  2YF0 A;  1ZC3 B;  5C6R A;  2CAY A;  2LUL A;  2D9Z A;  1N3H A;  5HE1 A;  2D4Q A;  3P6A A;  4HAU B;  3OAN A;  2IYB A;  3G9W A;  2ZPY A;  5C5B B;  2AEH A;  1SGH A;  3CIK A;  2ELA A;  4KHO A;  3WYF B;  1V61 A;  1EF1 A;  1UNR A;  2X18 A;  3D8F A;  2DHI A;  2OQB A;  1FHW A;  2CRF A;  1ZVR A;  1FAO A;  2DYQ A;  4KAX B;  2NMB A;  2K2U A;  2AL6 A;  1MK7 B;  3BIN A;  4K81 A;  2DTC A;  2FJL A;  3SUZ A;  1DDV A;  4HB4 B;  1MAI A;  1MK9 B;  4K2O A;  3PEG A;  4NSW A;  3D8D A;  1WJM A;  1V5U A;  4HB3 B;  1BAK A;  1Q67 A;  2DA0 A;  3FSS A;  1UPQ A;  1TJ6 A;  2P0H A;  2LKO A;  2YS3 A;  4GPT B;  1XOD A;  4L6E A;  4KVG B;  1WG7 A;  2D11 A;  3V5W A;  1DYN A;  2DFK A;  3TCA A;  2DHJ A;  2P0F A;  3A8Q A;  5DI9 B;  4K2P A;  4A6F B;  1Y5O A;  1TXD A;  2RVB B;  1FHX A;  4P7I A;  1XD4 A;  5DIF B;  1X05 A;  5J3Q A;  1XCG A;  2YSZ A;  3IVF A;  3ZVR A;  3TVV A;  5J3Y A;  3N7C A;  2QKM A;  1XKE A;  4DXA B;  2IFS A;  2COC A;  2J0J A;  3TW1 A;  1XR0 B;  3A98 B;  2ADZ A;  1J0W A;  4CHM A;  3D8E A;  3QBV B;  3DXE A;  1LW3 A;  3ODX A;  1WGU A;  3LJU X;  2GJY A;  2ROZ B;  4PQ0 A;  2W2X D;  3AJ4 A;  3MPX A;  1UEF A;  2D9W A;  4NY0 A;  1GC6 A;  3SO6 A;  4ZRK A;  4EJN A;  2H7D A;  4Z2M B;  3HW2 B;  1DBH A;  5HE3 A;  3O96 A;  5FI0 A;  4D0N B;  5DHF B;  1V88 A; 
#chains in the Genus database with same CATH topology
 1SHC A;  2KCJ A;  1AWE A;  1ZSQ A;  2KR0 A;  1GG3 A;  2EMS A;  3UZT A;  2UZS A;  1NTV A;  1DDW A;  2KUP A;  2MFQ A;  1KI1 B;  2GCJ A;  2DLW A;  5I2S A;  1RRP B;  4HB0 B;  2BCJ A;  3PG7 A;  3SNH A;  2P8V A;  2EC1 A;  2L2I A;  3ML4 A;  2PZ1 A;  4GNK B;  2COF A;  1Z87 A;  2HTH B;  1V89 A;  2NBV A;  2Y8F A;  3F5R A;  1ZC4 B;  2ROV A;  3TO1 A;  4MK0 A;  1K5G B;  2W2W A;  1M7R A;  2YS1 A;  2R2Y A;  4BBK A;  1X1G A;  2Z0Q A;  2GCL A;  5C5B A;  1BTN A;  3DXD A;  1PLS A;  1X1F A;  3B77 A;  5EFX A;  1NTY A;  2RGN B;  2H7E A;  2CY4 A;  2VKI A;  2KGX B;  2Z0O A;  1UNQ A;  4HDQ A;  4Z2N A;  1BTK A;  5LON B;  4CYE A;  5JP4 A;  2COA A;  1U27 A;  1NU2 A;  4C0A A;  3QWM A;  1OMW A;  2R09 A;  1H4R A;  2R0D A;  5CLQ B;  4HHV A;  2DX5 A;  2UVM A;  3PSC A;  5DH9 B;  3RCP A;  1MPH A;  4K17 A;  1U2B A;  4HAX B;  1XX0 A;  1MIX A;  1V5P A;  1Y19 B;  3AU5 A;  1P5T A;  5D3V A;  5C79 A;  3OHM B;  5J3T A;  1P3R A;  3U7D A;  2G35 A;  4F7H A;  4PNK A;  4A6H A;  4EMO A;  4HAT B;  2M14 A;  3AU4 A;  1PMS A;  1ZM0 A;  2I1J A;  4HAZ B;  2RLO A;  2EMT A;  3HK0 A;  1X86 A;  1W1D A;  2I1K A;  1QQG A;  3PVW A;  1WI1 A;  2JP2 A;  3DCX A;  2K8E A;  2FJU B;  3WA0 A;  5JHH A;  1MIZ B;  5KQ1 A;  2J0K A;  4HAV B;  1AQC A;  3VOQ A;  2Z0P A;  2YT1 A;  1EVH A;  2K49 A;  2D9Y A;  4A5K A;  4MY6 A;  2K00 A;  2OTX A;  5FI1 A;  1U5G A;  2MDX A;  4KHA A;  4GZU A;  4GN1 A;  5JHG A;  1K5D B;  4TYZ A;  1IRS A;  3KRW A;  4HAW B;  3KZ1 A;  4QJ5 B;  1V5M A;  3A58 A;  3M1I B;  5D3W A;  3GYO A;  3X23 A;  5D27 A;  1FGZ A;  1U29 A;  2LG1 A;  2LYD A;  4KHB A;  3ULB A;  5KQ4 A;  2D2Q A;  4TKN A;  1H10 A;  1TQZ A;  3FVC A;  3TFM A;  3ZDT A;  5JLJ B;  3U8Z A;  1DDM A;  3SYX A;  1DRO A;  5GOW B;  4HAY B;  2LOX A;  1KZ7 A;  1FHO A;  1ZYI A;  1WJ1 A;  2UZR A;  4F7G A;  1FOE A;  4WJ7 A;  4GOU A;  4CSQ A;  3CXB B;  2K2J A;  3KSY A;  5HE0 A;  2W2X C;  5DHA B;  2DN6 A;  2KUQ A;  1OQN A;  2YT2 A;  1MI1 A;  4F7U P;  3NW8 A;  4KHB B;  2GS0 A;  5D3Y A;  3FEH A;  5C16 A;  3PZD A;  1PFJ A;  2VRW B;  4HDO A;  4QJ4 B;  1GC7 A;  2E2X A;  1EGX A;  4DX9 0;  2DHK A;  4B6H A;  2RNR B;  2KIG A;  3BJI A;  3NWF A;  4ZRI A;  2J0M A;  1WVH A;  4XWX A;  5CLL B;  3T06 A;  2Y8G A;  2DKQ A;  3MDB C;  5KCV A;  1I2H A;  3NWA A;  2QKL A;  4CHJ A;  4IAP A;  3VIA A;  1W1G A;  4OT1 A;  2RSG A;  2DKP A;  2P0D A;  3PVU A;  1MKE A;  4HSI A;  2YVC A;  4HB2 B;  4YL8 A;  2N23 A;  2RRF A;  1W1H A;  1P6S A;  5HE2 A;  3GYP A;  4DX8 A;  2DYN A;  4EKU A;  4YON A;  4ZRJ A;  1BWN A;  1EAZ A;  1QC6 A;  2ELB A;  5D3X A;  2I5F A;  4MT7 A;  2RUK B;  5I2M A;  2D10 A;  3KY9 A;  3DXC A;  2D9X A;  3KRX A;  2COD A;  1X11 A;  1B55 A;  2XQN M;  4D6W A;  1UPR A;  4WVF B;  1RJ2 A;  2CY5 A;  3QIJ A;  1FGY A;  2V76 A;  4OSN A;  2EJ8 A;  1UNP A;  2YT0 A;  3NWD A;  2Y7B A;  1U5D A;  4GXB A;  3F0W A;  4DIX A;  4Y94 A;  1FB8 A;  2M38 A;  1I7A A;  4GMX B;  3SV1 A;  4A6K A;  2DX1 A;  5LOP B;  2L1C A;  2MWN B;  1E5W A;  2J59 M;  2VSZ A;  5M4Y B;  3PVL A;  2D9V A;  1LB1 A;  3A8P A;  4IOY X;  4DBB A;  1M7E A;  3P7Z A;  2YS5 A;  2HE7 A;  5L81 A;  1ISN A;  3ODO A;  3PP2 A;  3HSA A;  4H8S A;  2LOZ A;  4GMV A;  4A6F A;  2I5C A;  3HQC A;  3ULC A;  1U5E A;  2NZ8 B;  2YRY A;  1U5F A;  4WSF A;  2Q13 A;  1KZG A;  1J19 A;  1OY2 A;  3FM8 C;  2N0Y A;  3ODW A;  1WGQ A;  2MKR A;  1NI2 A;  3NSU A;  4IFS A;  4QXA B;  2YF0 A;  1ZC3 B;  5C6R A;  2CAY A;  2LUL A;  2D9Z A;  1N3H A;  5HE1 A;  2D4Q A;  3P6A A;  4HAU B;  3OAN A;  2IYB A;  3G9W A;  2ZPY A;  5C5B B;  2AEH A;  1SGH A;  3CIK A;  2ELA A;  4KHO A;  3WYF B;  1V61 A;  2GUM A;  1EF1 A;  1UNR A;  2X18 A;  3D8F A;  2DHI A;  2OQB A;  1FHW A;  2CRF A;  1ZVR A;  1FAO A;  2DYQ A;  4KAX B;  2NMB A;  2K2U A;  2AL6 A;  1MK7 B;  3BIN A;  5LG4 B;  3U12 A;  4K81 A;  2DTC A;  2FJL A;  3SUZ A;  1DDV A;  4HB4 B;  1MAI A;  1MK9 B;  4K2O A;  3PEG A;  4NSW A;  2Z59 A;  3D8D A;  3HIE A;  1WJM A;  1V5U A;  2Z14 A;  4HB3 B;  1BAK A;  1Q67 A;  2DA0 A;  3FSS A;  1UPQ A;  1TJ6 A;  2P0H A;  2LKO A;  2YS3 A;  4GPT B;  1XOD A;  4L6E A;  4KVG B;  1WG7 A;  5IRS A;  2D11 A;  3V5W A;  2Z13 A;  1DYN A;  2ZKM X;  2DFK A;  3TCA A;  2DHJ A;  2P0F A;  3A8Q A;  5DI9 B;  4K2P A;  4A6F B;  1Y5O A;  1TXD A;  2Z4D A;  1T77 A;  2RVB B;  1FHX A;  4P7I A;  1XD4 A;  5DIF B;  1X05 A;  5J3Q A;  4QJ3 B;  1XCG A;  2YSZ A;  3IVF A;  3ZVR A;  3TVV A;  5J3Y A;  3N7C A;  2QKM A;  1XKE A;  4DXA B;  2IFS A;  2COC A;  2J0J A;  3TW1 A;  1XR0 B;  3A98 B;  2ADZ A;  1J0W A;  4CHM A;  3D8E A;  3QBV B;  3DXE A;  1LW3 A;  3ODX A;  2KIE A;  1WGU A;  4L1R A;  3LJU X;  2GJY A;  2ROZ B;  4PQ0 A;  2W2X D;  3AJ4 A;  3MPX A;  1UEF A;  2D9W A;  4NY0 A;  1GC6 A;  3SO6 A;  4ZRK A;  4EJN A;  2H7D A;  4Z2M B;  3HW2 B;  1DBH A;  5HE3 A;  3O96 A;  5FI0 A;  4D0N B;  5DHF B;  1V88 A; 
#chains in the Genus database with same CATH homology
 1SHC A;  2KCJ A;  1AWE A;  1ZSQ A;  1GG3 A;  2EMS A;  3UZT A;  2UZS A;  1NTV A;  1DDW A;  2KUP A;  2MFQ A;  1KI1 B;  2GCJ A;  2DLW A;  1RRP B;  4HB0 B;  2BCJ A;  3PG7 A;  3SNH A;  2P8V A;  2EC1 A;  2L2I A;  3ML4 A;  2PZ1 A;  2COF A;  1Z87 A;  2HTH B;  1V89 A;  2Y8F A;  3F5R A;  1ZC4 B;  2ROV A;  3TO1 A;  4MK0 A;  1K5G B;  2W2W A;  1M7R A;  2YS1 A;  4BBK A;  1X1G A;  2Z0Q A;  2GCL A;  5C5B A;  1BTN A;  3DXD A;  1PLS A;  1X1F A;  5EFX A;  1NTY A;  2RGN B;  2H7E A;  2CY4 A;  2VKI A;  2KGX B;  2Z0O A;  1UNQ A;  4HDQ A;  4Z2N A;  1BTK A;  5LON B;  4CYE A;  5JP4 A;  2COA A;  1U27 A;  1NU2 A;  4C0A A;  3QWM A;  1OMW A;  2R09 A;  1H4R A;  2R0D A;  5CLQ B;  4HHV A;  2DX5 A;  2UVM A;  3PSC A;  5DH9 B;  3RCP A;  1MPH A;  4K17 A;  1U2B A;  4HAX B;  1XX0 A;  1MIX A;  1V5P A;  1Y19 B;  3AU5 A;  1P5T A;  5D3V A;  5C79 A;  5J3T A;  1P3R A;  3U7D A;  2G35 A;  4F7H A;  4PNK A;  4A6H A;  4EMO A;  4HAT B;  2M14 A;  3AU4 A;  1PMS A;  1ZM0 A;  2I1J A;  4HAZ B;  2RLO A;  2EMT A;  3HK0 A;  1X86 A;  1W1D A;  2I1K A;  1QQG A;  3PVW A;  1WI1 A;  2JP2 A;  3WA0 A;  5JHH A;  1MIZ B;  5KQ1 A;  2J0K A;  4HAV B;  1AQC A;  3VOQ A;  2Z0P A;  2YT1 A;  1EVH A;  2D9Y A;  4A5K A;  4MY6 A;  2K00 A;  2OTX A;  5FI1 A;  1U5G A;  2MDX A;  4KHA A;  4GZU A;  4GN1 A;  5JHG A;  1K5D B;  4TYZ A;  1IRS A;  3KRW A;  4HAW B;  3KZ1 A;  1V5M A;  3M1I B;  5D3W A;  3GYO A;  3X23 A;  5D27 A;  1FGZ A;  1U29 A;  2LG1 A;  2LYD A;  3ULB A;  5KQ4 A;  2D2Q A;  4TKN A;  1H10 A;  1TQZ A;  3TFM A;  3ZDT A;  5JLJ B;  3U8Z A;  1DDM A;  3SYX A;  1DRO A;  5GOW B;  4HAY B;  2LOX A;  1KZ7 A;  1FHO A;  1WJ1 A;  2UZR A;  4F7G A;  1FOE A;  4WJ7 A;  3CXB B;  2K2J A;  3KSY A;  5HE0 A;  2W2X C;  5DHA B;  2DN6 A;  1OQN A;  4F7U P;  4KHB B;  2GS0 A;  5D3Y A;  3FEH A;  5C16 A;  3PZD A;  1PFJ A;  2VRW B;  4HDO A;  1GC7 A;  2E2X A;  1EGX A;  4DX9 0;  2DHK A;  4B6H A;  2RNR B;  3BJI A;  4ZRI A;  2J0M A;  1WVH A;  4XWX A;  5CLL B;  3T06 A;  2Y8G A;  2DKQ A;  3MDB C;  5KCV A;  1I2H A;  2QKL A;  4CHJ A;  4IAP A;  3VIA A;  1W1G A;  2RSG A;  2DKP A;  2P0D A;  3PVU A;  1MKE A;  2YVC A;  4HB2 B;  4YL8 A;  2N23 A;  1W1H A;  1P6S A;  5HE2 A;  3GYP A;  4DX8 A;  2DYN A;  4EKU A;  4YON A;  4ZRJ A;  1BWN A;  1EAZ A;  1QC6 A;  2ELB A;  5D3X A;  2I5F A;  4MT7 A;  2RUK B;  2D10 A;  3KY9 A;  3DXC A;  2D9X A;  3KRX A;  2COD A;  1X11 A;  1B55 A;  2XQN M;  1UPR A;  4WVF B;  1RJ2 A;  2CY5 A;  3QIJ A;  1FGY A;  2V76 A;  2EJ8 A;  1UNP A;  2YT0 A;  2Y7B A;  1U5D A;  4GXB A;  3F0W A;  4Y94 A;  1FB8 A;  2M38 A;  1I7A A;  4GMX B;  3SV1 A;  4A6K A;  2DX1 A;  5LOP B;  2L1C A;  2MWN B;  1E5W A;  2J59 M;  2VSZ A;  3PVL A;  2D9V A;  1LB1 A;  3A8P A;  4IOY X;  4DBB A;  1M7E A;  3P7Z A;  2YS5 A;  2HE7 A;  5L81 A;  1ISN A;  3ODO A;  3PP2 A;  4H8S A;  2LOZ A;  4GMV A;  4A6F A;  2I5C A;  3HQC A;  3ULC A;  1U5E A;  2NZ8 B;  2YRY A;  1U5F A;  4WSF A;  2Q13 A;  1KZG A;  1J19 A;  1OY2 A;  3FM8 C;  2N0Y A;  3ODW A;  1WGQ A;  2MKR A;  1NI2 A;  3NSU A;  4IFS A;  2YF0 A;  1ZC3 B;  5C6R A;  2CAY A;  2LUL A;  2D9Z A;  1N3H A;  5HE1 A;  2D4Q A;  3P6A A;  4HAU B;  3OAN A;  2IYB A;  3G9W A;  2ZPY A;  5C5B B;  2AEH A;  1SGH A;  3CIK A;  2ELA A;  4KHO A;  3WYF B;  1V61 A;  1EF1 A;  1UNR A;  2X18 A;  3D8F A;  2DHI A;  2OQB A;  1FHW A;  2CRF A;  1ZVR A;  1FAO A;  2DYQ A;  4KAX B;  2NMB A;  2K2U A;  2AL6 A;  1MK7 B;  3BIN A;  4K81 A;  2DTC A;  2FJL A;  3SUZ A;  1DDV A;  4HB4 B;  1MAI A;  1MK9 B;  4K2O A;  3PEG A;  4NSW A;  3D8D A;  1WJM A;  1V5U A;  4HB3 B;  1BAK A;  1Q67 A;  2DA0 A;  3FSS A;  1UPQ A;  1TJ6 A;  2P0H A;  2LKO A;  2YS3 A;  4GPT B;  1XOD A;  4L6E A;  4KVG B;  1WG7 A;  2D11 A;  3V5W A;  1DYN A;  2DFK A;  3TCA A;  2DHJ A;  2P0F A;  3A8Q A;  5DI9 B;  4K2P A;  4A6F B;  1Y5O A;  1TXD A;  2RVB B;  1FHX A;  4P7I A;  1XD4 A;  5DIF B;  1X05 A;  5J3Q A;  1XCG A;  2YSZ A;  3IVF A;  3ZVR A;  3TVV A;  5J3Y A;  3N7C A;  2QKM A;  1XKE A;  4DXA B;  2IFS A;  2COC A;  2J0J A;  3TW1 A;  1XR0 B;  3A98 B;  2ADZ A;  1J0W A;  4CHM A;  3D8E A;  3QBV B;  3DXE A;  1LW3 A;  3ODX A;  1WGU A;  3LJU X;  2GJY A;  2ROZ B;  4PQ0 A;  2W2X D;  3AJ4 A;  3MPX A;  1UEF A;  2D9W A;  4NY0 A;  1GC6 A;  3SO6 A;  4ZRK A;  4EJN A;  2H7D A;  4Z2M B;  3HW2 B;  1DBH A;  5HE3 A;  3O96 A;  5FI0 A;  4D0N B;  5DHF B;  1V88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...