1UEFA

Crystal structure of dok1 ptb domain complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
105
structure length
105
Chain Sequence
MGSQFWVTSQKTEASERCGLQGSYILRVEAEKLTLLTLGAQSQILEPLLFWPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTSQGNDIFQAVEAAIQQQKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Docking protein 1
publication title Structural Basis for the Specific Recognition of RET by the Dok1 Phosphotyrosine Binding Domain
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding/transferase
total genus 23
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1uefA00
5HE1A 4KHOA 1EF1A 5CLLB 2P8VA 1Z87A 2KCJA 5HE0A 2EMSA 3MPXA 4YONA 3SO6A 2N0YA 4KAXB 5KCVA 2DHIA 3KZ1A 1J19A 2LKOA 3LJUX 2IFSA 1P5TA 2Y7BA 1XODA 2VSZA 2D10A 3O96A 2LULA 2LOXA 1ZM0A 1KZ7A 2RUKB 4A6KA 4HB2B 1NTYA 3N7CA 2VRWB 1X05A 3OANA 1OY2A 2J0MA 2YSZA 4ZRIA 3TFMA 2DHJA 3WA0A 4C0AA 1U5DA 2KGXB 5J3YA 2MWNB 3ML4A 3ODWA 4K2OA 2K2UA 1J0WA 3DXDA 1AQCA 2COAA 2ZPYA 3HW2B 2CY4A 2RSGA 1UNQA 3SV1A 2P0FA 2D4QA 1V5UA 2D11A 5HE3A 3A98B 1W1DA 2M38A 2I1KA 2J0JA 4HAXB 4HDOA 4TYZA 4EKUA 4GMXB 2DLWA 1AWEA 2DX1A 5EFXA 4Z2NA 1P6SA 1H10A 3AU5A 3QBVB 1PMSA 1BTKA 5JHHA 3AU4A 4NY0A 1U5GA 1TQZA 2COCA 3A8QA 2AEHA 2CODA 1RRPB 2M14A 2QKLA 3PVLA 2KUPA 2UVMA 2K00A 3SUZA 5CLQB 1GC6A 3KSYA 2Z0PA 2DFKA 3BJIA 5HE2A 1ZSQA 2ELAA 1TXDA 1M7RA 2FJLA 3KRXA 1V88A 3ULCA 2YVCA 1QQGA 2R0DA 3U8ZA 3PVWA 5KQ1A 2OTXA 3PP2A 1FB8A 4GN1A 4B6HA 2W2XD 2Q13A 1RJ2A 4DXAB 1WGUA 1N3HA 1DBHA 1ZVRA 1MKEA 4K17A 2GCLA 4EMOA 4HAYB 4HDQA 2Z0OA 1QC6A 2N23A 2MDXA 4GZUA 1EGXA 4Y94A 2J0KA 2LOZA 1WI1A 2CAYA 1OMWA 4HHVA 2X18A 2YS3A 1WGQA 3GYOA 3ODXA 4K2PA 5LOPB 2J59M 2Y8GA 2Z0QA 3AJ4A 4DX90 4A6HA 4KHAA 4CYEA 1U29A 2ELBA 4HB4B 2HTHB 2UZRA 4WSFA 2HE7A 1X1FA 3P6AA 3NSUA 3V5WA 2D9ZA 1Y5OA 4GMVA 2LYDA 3VIAA 2AL6A 5DHFB 4PNKA 1E5WA 4ZRKA 1U5EA 5J3TA 2YRYA 2YT0A 4HAZB 4D0NB 1X1GA 1KZGA 2VKIA 3CIKA 1W1GA 2GCJA 2DKQA 1MPHA 1I2HA 2D2QA 3G9WA 3D8FA 5D3VA 3QIJA 2I5CA 1MIZB 1UEFA 4F7UP 2YF0A 3PSCA 2ROVA 1DROA 4EJNA 2RNRB 3GYPA 1M7EA 3FSSA 1X86A 5D27A 2V76A 1Q67A 1UNRA 2L1CA 4PQ0A 3MDBC 4P7IA 4F7HA 4TKNA 1XCGA 2OQBA 5C16A 5KQ4A 3UZTA 1DYNA 1I7AA 2DYQA 1LW3A 1DDWA 2RVBB 1W1HA 4DX8A 2K2JA 3HK0A 1ZC4B 1V5PA 4HAUB 2D9WA 3PEGA 4GPTB 3PG7A 3QWMA 1XKEA 4WVFB 5JHGA 1V61A 4WJ7A 3VOQA 4GXBA 2Y8FA 1DDMA 2DTCA 4HB3B 1V5MA 3ULBA 3DXEA 2L2IA 2RGNB 2DKPA 3ODOA 3TVVA 3ZVRA 2E2XA 2XQNM 3FEHA 5J3QA 2P0DA 3IVFA 1FGZA 4HAVB 2PZ1A 1WJMA 2YS1A 1U2BA 3F5RA 2MFQA 1K5DB 5DHAB 2QKMA 2RLOA 2W2XC 3F0WA 3A8PA 5L81A 3CXBB 1GG3A 5C6RA 1MK7B 2D9YA 4MK0A 5D3XA 1FHXA 2DA0A 4ZRJA 2I1JA 4NSWA 5FI1A 2H7DA 4L6EA 1P3RA 1K5GB 4HATB 3X23A 4H8SA 1U27A 3D8EA 3KY9A 2ADZA 1U5FA 3PVUA 4IFSA 5FI0A 4F7GA 4IAPA 2BCJA 1SGHA 5C5BB 1NI2A 2IYBA 1MIXA 1XR0B 2I5FA 2JP2A 3FM8C 5JLJB 1GC7A 3U7DA 2LG1A 1DDVA 4KHBB 4KVGB 4A6FB 1BTNA 5D3YA 1ZC3B 5JP4A 1H4RA 2YS5A 3PZDA 3P7ZA 3ZDTA 4A5KA 2D9VA 3BINA 5C79A 5DIFB 2CRFA 1SHCA 2MKRA 4MY6A 2R09A 1MAIA 1FHOA 2H7EA 2EC1A 1KI1B 1IRSA 1Y19B 3DXCA 1XX0A 5DI9B 4IOYX 2YT1A 1NU2A 3SYXA 2COFA 2NZ8B 4BBKA 1EVHA 1MK9B 2CY5A 1UPRA 1FGYA 1WVHA 1FAOA 2G35A 2DYNA 4CHJA 3TO1A 1V89A 4MT7A 1X11A 5D3WA 2D9XA 3HQCA 4CHMA 5DH9B 3TCAA 1TJ6A 4DBBA 2UZSA 3KRWA 1XD4A 1WJ1A 2P0HA 1B55A 1EAZA 2DN6A 2NMBA 2W2WA 1UNPA 4HAWB 1ISNA 2EMTA 1WG7A 5LONB 4K81A 1PLSA 4Z2MB 2EJ8A 1BWNA 3D8DA 3TW1A 5C5BA 2ROZB 1PFJA 2GJYA 1FOEA 3WYFB 1NTVA 1FHWA 5GOWB 2GS0A 4XWXA 2DHKA 2DX5A 4A6FA 3M1IB 3SNHA 3RCPA 1LB1A 1OQNA 1UPQA 4HB0B 1BAKA 3T06A 4YL8A
chains in the Genus database with same CATH superfamily
5HE1A 4KHOA 1EF1A 5CLLB 2P8VA 3A58A 1Z87A 2KUQA 3NWAA 2KCJA 5HE0A 2EMSA 4GOUA 3MPXA 4YONA 3SO6A 2N0YA 4QJ4B 4KAXB 5KCVA 2DHIA 3KZ1A 1J19A 2LKOA 3LJUX 3NWFA 2IFSA 5M4YB 1P5TA 2Y7BA 1XODA 2VSZA 2D10A 3O96A 2LULA 2LOXA 4QJ5B 1ZM0A 1KZ7A 2RUKB 4A6KA 4HB2B 1NTYA 3N7CA 2VRWB 1X05A 3OANA 1OY2A 4GNKB 4L1RA 2J0MA 2YSZA 4ZRIA 3TFMA 2DHJA 3WA0A 4C0AA 1U5DA 2KGXB 5J3YA 2MWNB 3ML4A 3ODWA 4K2OA 2K2UA 1J0WA 3DXDA 1AQCA 2COAA 2ZPYA 3HW2B 2CY4A 2RSGA 1UNQA 3HIEA 3SV1A 2P0FA 2D4QA 1V5UA 2D11A 5HE3A 3A98B 1W1DA 2M38A 2I1KA 2J0JA 4HAXB 4HDOA 4TYZA 4EKUA 4GMXB 2DLWA 1AWEA 2DX1A 2KIEA 5EFXA 4Z2NA 3U12A 1P6SA 1H10A 3AU5A 3QBVB 1PMSA 1BTKA 5JHHA 3AU4A 4NY0A 2NBVA 1U5GA 1TQZA 2COCA 3A8QA 2AEHA 4HSIA 2CODA 1RRPB 2M14A 2QKLA 3PVLA 2KUPA 2UVMA 2K00A 2ZKMX 3SUZA 5CLQB 1GC6A 3KSYA 2Z0PA 2DFKA 3BJIA 5HE2A 1ZSQA 2ELAA 1TXDA 1M7RA 2FJLA 3KRXA 1V88A 3ULCA 2YVCA 1QQGA 2R0DA 3U8ZA 3PVWA 5KQ1A 2OTXA 3PP2A 1FB8A 4GN1A 4B6HA 2W2XD 2Q13A 1RJ2A 4DXAB 1WGUA 1N3HA 1DBHA 1ZVRA 1MKEA 4K17A 2GCLA 4EMOA 4HAYB 4HDQA 2KR0A 2Z0OA 1QC6A 2N23A 2MDXA 4GZUA 1EGXA 4Y94A 2J0KA 2LOZA 1WI1A 2CAYA 1OMWA 4HHVA 2X18A 2YS3A 2KIGA 1WGQA 3GYOA 3ODXA 4K2PA 5LOPB 2J59M 2Y8GA 2Z0QA 2GUMA 3AJ4A 4DX90 4A6HA 4KHAA 4CYEA 1U29A 2ELBA 4HB4B 2HTHB 2UZRA 4OT1A 2HE7A 1X1FA 3P6AA 4WSFA 3NSUA 3V5WA 2D9ZA 1Y5OA 4GMVA 2LYDA 4QXAB 3VIAA 2AL6A 5DHFB 4QJ3B 1MI1A 2FJUB 4PNKA 1E5WA 4ZRKA 1U5EA 2K49A 2YRYA 3FVCA 5J3TA 2YT0A 4HAZB 4D0NB 1X1GA 1KZGA 2VKIA 3CIKA 1W1GA 2GCJA 2DKQA 1MPHA 1I2HA 2D2QA 3G9WA 3D8FA 5D3VA 3QIJA 2I5CA 1MIZB 1UEFA 4F7UP 2YF0A 3PSCA 2ROVA 1DROA 4EJNA 2RNRB 3B77A 3GYPA 1M7EA 3FSSA 1X86A 5D27A 5IRSA 2V76A 1Q67A 1UNRA 2L1CA 4PQ0A 3MDBC 4P7IA 4F7HA 4TKNA 1XCGA 2OQBA 5C16A 5KQ4A 3UZTA 1DYNA 1I7AA 2DYQA 1LW3A 1DDWA 2RVBB 2Z4DA 3HSAA 1W1HA 4DX8A 2K2JA 3HK0A 1ZC4B 1V5PA 4HAUB 2D9WA 3PEGA 4GPTB 3PG7A 3QWMA 1XKEA 4WVFB 5JHGA 4D6WA 1V61A 4WJ7A 3VOQA 4GXBA 2Y8FA 1T77A 1DDMA 2DTCA 4HB3B 1V5MA 3ULBA 3DXEA 2L2IA 2RGNB 2Z14A 2DKPA 3ODOA 5I2SA 3TVVA 3ZVRA 2E2XA 2XQNM 3FEHA 5J3QA 2P0DA 3IVFA 1FGZA 4HAVB 2Z13A 2PZ1A 1WJMA 2YS1A 1U2BA 3F5RA 2MFQA 1K5DB 5DHAB 2QKMA 2RLOA 2W2XC 3F0WA 2K8EA 3A8PA 5I2MA 5L81A 3CXBB 1GG3A 5C6RA 1MK7B 2D9YA 4MK0A 5D3XA 1FHXA 2DA0A 4ZRJA 2I1JA 4NSWA 5FI1A 2H7DA 4L6EA 1P3RA 1K5GB 4HATB 3X23A 4H8SA 1U27A 3D8EA 3KY9A 2ADZA 1U5FA 3OHMB 3PVUA 4IFSA 5FI0A 4F7GA 4IAPA 2BCJA 1SGHA 5C5BB 1NI2A 2IYBA 1MIXA 1XR0B 2I5FA 2JP2A 3FM8C 5JLJB 1GC7A 3U7DA 2LG1A 1DDVA 4KHBB 4KVGB 4A6FB 1BTNA 5D3YA 1ZC3B 5JP4A 1H4RA 2YS5A 3PZDA 3P7ZA 3ZDTA 4A5KA 2D9VA 3BINA 5C79A 5DIFB 2CRFA 1SHCA 2MKRA 4MY6A 2R09A 1MAIA 1FHOA 2H7EA 2EC1A 1KI1B 1IRSA 1Y19B 3DXCA 1XX0A 5DI9B 4IOYX 2YT1A 1NU2A 3SYXA 2COFA 2NZ8B 4BBKA 1EVHA 1MK9B 2CY5A 4OSNA 1UPRA 1FGYA 1WVHA 1FAOA 2Z59A 3NW8A 2G35A 5LG4B 2DYNA 4CHJA 3TO1A 4DIXA 1V89A 4MT7A 1X11A 5D3WA 2D9XA 3HQCA 4CHMA 5DH9B 3DCXA 3TCAA 1TJ6A 4DBBA 2UZSA 2YT2A 3KRWA 1XD4A 1WJ1A 2P0HA 1B55A 1EAZA 2DN6A 2NMBA 2W2WA 1UNPA 4HAWB 1ISNA 2EMTA 1WG7A 5LONB 4K81A 1PLSA 4Z2MB 2EJ8A 1BWNA 2RRFA 2R2YA 3D8DA 3NWDA 3TW1A 5C5BA 2ROZB 1ZYIA 1PFJA 2GJYA 4CSQA 1FOEA 3WYFB 1NTVA 4KHBA 1FHWA 5GOWB 2GS0A 4XWXA 2DHKA 2DX5A 4A6FA 3M1IB 3SNHA 3RCPA 1LB1A 1OQNA 1UPQA 4HB0B 1BAKA 3T06A 4YL8A
chains in the Genus database with same CATH topology
5HE1A 4KHOA 1EF1A 5CLLB 2P8VA 1Z87A 2KCJA 5HE0A 2EMSA 3MPXA 4YONA 3SO6A 2N0YA 4KAXB 5KCVA 2DHIA 3KZ1A 1J19A 2LKOA 3LJUX 2IFSA 1P5TA 2Y7BA 1XODA 2VSZA 2D10A 3O96A 2LULA 2LOXA 1ZM0A 1KZ7A 2RUKB 4A6KA 4HB2B 1NTYA 3N7CA 2VRWB 1X05A 3OANA 1OY2A 2J0MA 2YSZA 4ZRIA 3TFMA 2DHJA 3WA0A 4C0AA 1U5DA 2KGXB 5J3YA 2MWNB 3ML4A 3ODWA 4K2OA 2K2UA 1J0WA 3DXDA 1AQCA 2COAA 2ZPYA 3HW2B 2CY4A 2RSGA 1UNQA 3SV1A 2P0FA 2D4QA 1V5UA 2D11A 5HE3A 3A98B 1W1DA 2M38A 2I1KA 2J0JA 4HAXB 4HDOA 4TYZA 4EKUA 4GMXB 2DLWA 1AWEA 2DX1A 5EFXA 4Z2NA 1P6SA 1H10A 3AU5A 3QBVB 1PMSA 1BTKA 5JHHA 3AU4A 4NY0A 1U5GA 1TQZA 2COCA 3A8QA 2AEHA 2CODA 1RRPB 2M14A 2QKLA 3PVLA 2KUPA 2UVMA 2K00A 3SUZA 5CLQB 1GC6A 3KSYA 2Z0PA 2DFKA 3BJIA 5HE2A 1ZSQA 2ELAA 1TXDA 1M7RA 2FJLA 3KRXA 1V88A 3ULCA 2YVCA 1QQGA 2R0DA 3U8ZA 3PVWA 5KQ1A 2OTXA 3PP2A 1FB8A 4GN1A 4B6HA 2W2XD 2Q13A 1RJ2A 4DXAB 1WGUA 1N3HA 1DBHA 1ZVRA 1MKEA 4K17A 2GCLA 4EMOA 4HAYB 4HDQA 2Z0OA 1QC6A 2N23A 2MDXA 4GZUA 1EGXA 4Y94A 2J0KA 2LOZA 1WI1A 2CAYA 1OMWA 4HHVA 2X18A 2YS3A 1WGQA 3GYOA 3ODXA 4K2PA 5LOPB 2J59M 2Y8GA 2Z0QA 3AJ4A 4DX90 4A6HA 4KHAA 4CYEA 1U29A 2ELBA 4HB4B 2HTHB 2UZRA 4WSFA 2HE7A 1X1FA 3P6AA 3NSUA 3V5WA 2D9ZA 1Y5OA 4GMVA 2LYDA 3VIAA 2AL6A 5DHFB 4PNKA 1E5WA 4ZRKA 1U5EA 5J3TA 2YRYA 2YT0A 4HAZB 4D0NB 1X1GA 1KZGA 2VKIA 3CIKA 1W1GA 2GCJA 2DKQA 1MPHA 1I2HA 2D2QA 3G9WA 3D8FA 5D3VA 3QIJA 2I5CA 1MIZB 1UEFA 4F7UP 2YF0A 3PSCA 2ROVA 1DROA 4EJNA 2RNRB 3GYPA 1M7EA 3FSSA 1X86A 5D27A 2V76A 1Q67A 1UNRA 2L1CA 4PQ0A 3MDBC 4P7IA 4F7HA 4TKNA 1XCGA 2OQBA 5C16A 5KQ4A 3UZTA 1DYNA 1I7AA 2DYQA 1LW3A 1DDWA 2RVBB 1W1HA 4DX8A 2K2JA 3HK0A 1ZC4B 1V5PA 4HAUB 2D9WA 3PEGA 4GPTB 3PG7A 3QWMA 1XKEA 4WVFB 5JHGA 1V61A 4WJ7A 3VOQA 4GXBA 2Y8FA 1DDMA 2DTCA 4HB3B 1V5MA 3ULBA 3DXEA 2L2IA 2RGNB 2DKPA 3ODOA 3TVVA 3ZVRA 2E2XA 2XQNM 3FEHA 5J3QA 2P0DA 3IVFA 1FGZA 4HAVB 2PZ1A 1WJMA 2YS1A 1U2BA 3F5RA 2MFQA 1K5DB 5DHAB 2QKMA 2RLOA 2W2XC 3F0WA 3A8PA 5L81A 3CXBB 1GG3A 5C6RA 1MK7B 2D9YA 4MK0A 5D3XA 1FHXA 2DA0A 4ZRJA 2I1JA 4NSWA 5FI1A 2H7DA 4L6EA 1P3RA 1K5GB 4HATB 3X23A 4H8SA 1U27A 3D8EA 3KY9A 2ADZA 1U5FA 3PVUA 4IFSA 5FI0A 4F7GA 4IAPA 2BCJA 1SGHA 5C5BB 1NI2A 2IYBA 1MIXA 1XR0B 2I5FA 2JP2A 3FM8C 5JLJB 1GC7A 3U7DA 2LG1A 1DDVA 4KHBB 4KVGB 4A6FB 1BTNA 5D3YA 1ZC3B 5JP4A 1H4RA 2YS5A 3PZDA 3P7ZA 3ZDTA 4A5KA 2D9VA 3BINA 5C79A 5DIFB 2CRFA 1SHCA 2MKRA 4MY6A 2R09A 1MAIA 1FHOA 2H7EA 2EC1A 1KI1B 1IRSA 1Y19B 3DXCA 1XX0A 5DI9B 4IOYX 2YT1A 1NU2A 3SYXA 2COFA 2NZ8B 4BBKA 1EVHA 1MK9B 2CY5A 1UPRA 1FGYA 1WVHA 1FAOA 2G35A 2DYNA 4CHJA 3TO1A 1V89A 4MT7A 1X11A 5D3WA 2D9XA 3HQCA 4CHMA 5DH9B 3TCAA 1TJ6A 4DBBA 2UZSA 3KRWA 1XD4A 1WJ1A 2P0HA 1B55A 1EAZA 2DN6A 2NMBA 2W2WA 1UNPA 4HAWB 1ISNA 2EMTA 1WG7A 5LONB 4K81A 1PLSA 4Z2MB 2EJ8A 1BWNA 3D8DA 3TW1A 5C5BA 2ROZB 1PFJA 2GJYA 1FOEA 3WYFB 1NTVA 1FHWA 5GOWB 2GS0A 4XWXA 2DHKA 2DX5A 4A6FA 3M1IB 3SNHA 3RCPA 1LB1A 1OQNA 1UPQA 4HB0B 1BAKA 3T06A 4YL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HE1 A;  4KHO A;  1EF1 A;  5CLL B;  2P8V A;  1Z87 A;  2KCJ A;  5HE0 A;  2EMS A;  3MPX A;  4YON A;  3SO6 A;  2N0Y A;  4KAX B;  5KCV A;  2DHI A;  3KZ1 A;  1J19 A;  2LKO A;  3LJU X;  2IFS A;  1P5T A;  2Y7B A;  1XOD A;  2VSZ A;  2D10 A;  3O96 A;  2LUL A;  2LOX A;  1ZM0 A;  1KZ7 A;  2RUK B;  4A6K A;  4HB2 B;  1NTY A;  3N7C A;  2VRW B;  1X05 A;  3OAN A;  1OY2 A;  2J0M A;  2YSZ A;  4ZRI A;  3TFM A;  2DHJ A;  3WA0 A;  4C0A A;  1U5D A;  2KGX B;  5J3Y A;  2MWN B;  3ML4 A;  3ODW A;  4K2O A;  2K2U A;  1J0W A;  3DXD A;  1AQC A;  2COA A;  2ZPY A;  3HW2 B;  2CY4 A;  2RSG A;  1UNQ A;  3SV1 A;  2P0F A;  2D4Q A;  1V5U A;  2D11 A;  5HE3 A;  3A98 B;  1W1D A;  2M38 A;  2I1K A;  2J0J A;  4HAX B;  4HDO A;  4TYZ A;  4EKU A;  4GMX B;  2DLW A;  1AWE A;  2DX1 A;  5EFX A;  4Z2N A;  1P6S A;  1H10 A;  3AU5 A;  3QBV B;  1PMS A;  1BTK A;  5JHH A;  3AU4 A;  4NY0 A;  1U5G A;  1TQZ A;  2COC A;  3A8Q A;  2AEH A;  2COD A;  1RRP B;  2M14 A;  2QKL A;  3PVL A;  2KUP A;  2UVM A;  2K00 A;  3SUZ A;  5CLQ B;  1GC6 A;  3KSY A;  2Z0P A;  2DFK A;  3BJI A;  5HE2 A;  1ZSQ A;  2ELA A;  1TXD A;  1M7R A;  2FJL A;  3KRX A;  1V88 A;  3ULC A;  2YVC A;  1QQG A;  2R0D A;  3U8Z A;  3PVW A;  5KQ1 A;  2OTX A;  3PP2 A;  1FB8 A;  4GN1 A;  4B6H A;  2W2X D;  2Q13 A;  1RJ2 A;  4DXA B;  1WGU A;  1N3H A;  1DBH A;  1ZVR A;  1MKE A;  4K17 A;  2GCL A;  4EMO A;  4HAY B;  4HDQ A;  2Z0O A;  1QC6 A;  2N23 A;  2MDX A;  4GZU A;  1EGX A;  4Y94 A;  2J0K A;  2LOZ A;  1WI1 A;  2CAY A;  1OMW A;  4HHV A;  2X18 A;  2YS3 A;  1WGQ A;  3GYO A;  3ODX A;  4K2P A;  5LOP B;  2J59 M;  2Y8G A;  2Z0Q A;  3AJ4 A;  4DX9 0;  4A6H A;  4KHA A;  4CYE A;  1U29 A;  2ELB A;  4HB4 B;  2HTH B;  2UZR A;  4WSF A;  2HE7 A;  1X1F A;  3P6A A;  3NSU A;  3V5W A;  2D9Z A;  1Y5O A;  4GMV A;  2LYD A;  3VIA A;  2AL6 A;  5DHF B;  4PNK A;  1E5W A;  4ZRK A;  1U5E A;  5J3T A;  2YRY A;  2YT0 A;  4HAZ B;  4D0N B;  1X1G A;  1KZG A;  2VKI A;  3CIK A;  1W1G A;  2GCJ A;  2DKQ A;  1MPH A;  1I2H A;  2D2Q A;  3G9W A;  3D8F A;  5D3V A;  3QIJ A;  2I5C A;  1MIZ B;  1UEF A;  4F7U P;  2YF0 A;  3PSC A;  2ROV A;  1DRO A;  4EJN A;  2RNR B;  3GYP A;  1M7E A;  3FSS A;  1X86 A;  5D27 A;  2V76 A;  1Q67 A;  1UNR A;  2L1C A;  4PQ0 A;  3MDB C;  4P7I A;  4F7H A;  4TKN A;  1XCG A;  2OQB A;  5C16 A;  5KQ4 A;  3UZT A;  1DYN A;  1I7A A;  2DYQ A;  1LW3 A;  1DDW A;  2RVB B;  1W1H A;  4DX8 A;  2K2J A;  3HK0 A;  1ZC4 B;  1V5P A;  4HAU B;  2D9W A;  3PEG A;  4GPT B;  3PG7 A;  3QWM A;  1XKE A;  4WVF B;  5JHG A;  1V61 A;  4WJ7 A;  3VOQ A;  4GXB A;  2Y8F A;  1DDM A;  2DTC A;  4HB3 B;  1V5M A;  3ULB A;  3DXE A;  2L2I A;  2RGN B;  2DKP A;  3ODO A;  3TVV A;  3ZVR A;  2E2X A;  2XQN M;  3FEH A;  5J3Q A;  2P0D A;  3IVF A;  1FGZ A;  4HAV B;  2PZ1 A;  1WJM A;  2YS1 A;  1U2B A;  3F5R A;  2MFQ A;  1K5D B;  5DHA B;  2QKM A;  2RLO A;  2W2X C;  3F0W A;  3A8P A;  5L81 A;  3CXB B;  1GG3 A;  5C6R A;  1MK7 B;  2D9Y A;  4MK0 A;  5D3X A;  1FHX A;  2DA0 A;  4ZRJ A;  2I1J A;  4NSW A;  5FI1 A;  2H7D A;  4L6E A;  1P3R A;  1K5G B;  4HAT B;  3X23 A;  4H8S A;  1U27 A;  3D8E A;  3KY9 A;  2ADZ A;  1U5F A;  3PVU A;  4IFS A;  5FI0 A;  4F7G A;  4IAP A;  2BCJ A;  1SGH A;  5C5B B;  1NI2 A;  2IYB A;  1MIX A;  1XR0 B;  2I5F A;  2JP2 A;  3FM8 C;  5JLJ B;  1GC7 A;  3U7D A;  2LG1 A;  1DDV A;  4KHB B;  4KVG B;  4A6F B;  1BTN A;  5D3Y A;  1ZC3 B;  5JP4 A;  1H4R A;  2YS5 A;  3PZD A;  3P7Z A;  3ZDT A;  4A5K A;  2D9V A;  3BIN A;  5C79 A;  5DIF B;  2CRF A;  1SHC A;  2MKR A;  4MY6 A;  2R09 A;  1MAI A;  1FHO A;  2H7E A;  2EC1 A;  1KI1 B;  1IRS A;  1Y19 B;  3DXC A;  1XX0 A;  5DI9 B;  4IOY X;  2YT1 A;  1NU2 A;  3SYX A;  2COF A;  2NZ8 B;  4BBK A;  1EVH A;  1MK9 B;  2CY5 A;  1UPR A;  1FGY A;  1WVH A;  1FAO A;  2G35 A;  2DYN A;  4CHJ A;  3TO1 A;  1V89 A;  4MT7 A;  1X11 A;  5D3W A;  2D9X A;  3HQC A;  4CHM A;  5DH9 B;  3TCA A;  1TJ6 A;  4DBB A;  2UZS A;  3KRW A;  1XD4 A;  1WJ1 A;  2P0H A;  1B55 A;  1EAZ A;  2DN6 A;  2NMB A;  2W2W A;  1UNP A;  4HAW B;  1ISN A;  2EMT A;  1WG7 A;  5LON B;  4K81 A;  1PLS A;  4Z2M B;  2EJ8 A;  1BWN A;  3D8D A;  3TW1 A;  5C5B A;  2ROZ B;  1PFJ A;  2GJY A;  1FOE A;  3WYF B;  1NTV A;  1FHW A;  5GOW B;  2GS0 A;  4XWX A;  2DHK A;  2DX5 A;  4A6F A;  3M1I B;  3SNH A;  3RCP A;  1LB1 A;  1OQN A;  1UPQ A;  4HB0 B;  1BAK A;  3T06 A;  4YL8 A; 
#chains in the Genus database with same CATH topology
 5HE1 A;  4KHO A;  1EF1 A;  5CLL B;  2P8V A;  3A58 A;  1Z87 A;  2KUQ A;  3NWA A;  2KCJ A;  5HE0 A;  2EMS A;  4GOU A;  3MPX A;  4YON A;  3SO6 A;  2N0Y A;  4QJ4 B;  4KAX B;  5KCV A;  2DHI A;  3KZ1 A;  1J19 A;  2LKO A;  3LJU X;  3NWF A;  2IFS A;  5M4Y B;  1P5T A;  2Y7B A;  1XOD A;  2VSZ A;  2D10 A;  3O96 A;  2LUL A;  2LOX A;  4QJ5 B;  1ZM0 A;  1KZ7 A;  2RUK B;  4A6K A;  4HB2 B;  1NTY A;  3N7C A;  2VRW B;  1X05 A;  3OAN A;  1OY2 A;  4GNK B;  4L1R A;  2J0M A;  2YSZ A;  4ZRI A;  3TFM A;  2DHJ A;  3WA0 A;  4C0A A;  1U5D A;  2KGX B;  5J3Y A;  2MWN B;  3ML4 A;  3ODW A;  4K2O A;  2K2U A;  1J0W A;  3DXD A;  1AQC A;  2COA A;  2ZPY A;  3HW2 B;  2CY4 A;  2RSG A;  1UNQ A;  3HIE A;  3SV1 A;  2P0F A;  2D4Q A;  1V5U A;  2D11 A;  5HE3 A;  3A98 B;  1W1D A;  2M38 A;  2I1K A;  2J0J A;  4HAX B;  4HDO A;  4TYZ A;  4EKU A;  4GMX B;  2DLW A;  1AWE A;  2DX1 A;  2KIE A;  5EFX A;  4Z2N A;  3U12 A;  1P6S A;  1H10 A;  3AU5 A;  3QBV B;  1PMS A;  1BTK A;  5JHH A;  3AU4 A;  4NY0 A;  2NBV A;  1U5G A;  1TQZ A;  2COC A;  3A8Q A;  2AEH A;  4HSI A;  2COD A;  1RRP B;  2M14 A;  2QKL A;  3PVL A;  2KUP A;  2UVM A;  2K00 A;  2ZKM X;  3SUZ A;  5CLQ B;  1GC6 A;  3KSY A;  2Z0P A;  2DFK A;  3BJI A;  5HE2 A;  1ZSQ A;  2ELA A;  1TXD A;  1M7R A;  2FJL A;  3KRX A;  1V88 A;  3ULC A;  2YVC A;  1QQG A;  2R0D A;  3U8Z A;  3PVW A;  5KQ1 A;  2OTX A;  3PP2 A;  1FB8 A;  4GN1 A;  4B6H A;  2W2X D;  2Q13 A;  1RJ2 A;  4DXA B;  1WGU A;  1N3H A;  1DBH A;  1ZVR A;  1MKE A;  4K17 A;  2GCL A;  4EMO A;  4HAY B;  4HDQ A;  2KR0 A;  2Z0O A;  1QC6 A;  2N23 A;  2MDX A;  4GZU A;  1EGX A;  4Y94 A;  2J0K A;  2LOZ A;  1WI1 A;  2CAY A;  1OMW A;  4HHV A;  2X18 A;  2YS3 A;  2KIG A;  1WGQ A;  3GYO A;  3ODX A;  4K2P A;  5LOP B;  2J59 M;  2Y8G A;  2Z0Q A;  2GUM A;  3AJ4 A;  4DX9 0;  4A6H A;  4KHA A;  4CYE A;  1U29 A;  2ELB A;  4HB4 B;  2HTH B;  2UZR A;  4OT1 A;  2HE7 A;  1X1F A;  3P6A A;  4WSF A;  3NSU A;  3V5W A;  2D9Z A;  1Y5O A;  4GMV A;  2LYD A;  4QXA B;  3VIA A;  2AL6 A;  5DHF B;  4QJ3 B;  1MI1 A;  2FJU B;  4PNK A;  1E5W A;  4ZRK A;  1U5E A;  2K49 A;  2YRY A;  3FVC A;  5J3T A;  2YT0 A;  4HAZ B;  4D0N B;  1X1G A;  1KZG A;  2VKI A;  3CIK A;  1W1G A;  2GCJ A;  2DKQ A;  1MPH A;  1I2H A;  2D2Q A;  3G9W A;  3D8F A;  5D3V A;  3QIJ A;  2I5C A;  1MIZ B;  1UEF A;  4F7U P;  2YF0 A;  3PSC A;  2ROV A;  1DRO A;  4EJN A;  2RNR B;  3B77 A;  3GYP A;  1M7E A;  3FSS A;  1X86 A;  5D27 A;  5IRS A;  2V76 A;  1Q67 A;  1UNR A;  2L1C A;  4PQ0 A;  3MDB C;  4P7I A;  4F7H A;  4TKN A;  1XCG A;  2OQB A;  5C16 A;  5KQ4 A;  3UZT A;  1DYN A;  1I7A A;  2DYQ A;  1LW3 A;  1DDW A;  2RVB B;  2Z4D A;  3HSA A;  1W1H A;  4DX8 A;  2K2J A;  3HK0 A;  1ZC4 B;  1V5P A;  4HAU B;  2D9W A;  3PEG A;  4GPT B;  3PG7 A;  3QWM A;  1XKE A;  4WVF B;  5JHG A;  4D6W A;  1V61 A;  4WJ7 A;  3VOQ A;  4GXB A;  2Y8F A;  1T77 A;  1DDM A;  2DTC A;  4HB3 B;  1V5M A;  3ULB A;  3DXE A;  2L2I A;  2RGN B;  2Z14 A;  2DKP A;  3ODO A;  5I2S A;  3TVV A;  3ZVR A;  2E2X A;  2XQN M;  3FEH A;  5J3Q A;  2P0D A;  3IVF A;  1FGZ A;  4HAV B;  2Z13 A;  2PZ1 A;  1WJM A;  2YS1 A;  1U2B A;  3F5R A;  2MFQ A;  1K5D B;  5DHA B;  2QKM A;  2RLO A;  2W2X C;  3F0W A;  2K8E A;  3A8P A;  5I2M A;  5L81 A;  3CXB B;  1GG3 A;  5C6R A;  1MK7 B;  2D9Y A;  4MK0 A;  5D3X A;  1FHX A;  2DA0 A;  4ZRJ A;  2I1J A;  4NSW A;  5FI1 A;  2H7D A;  4L6E A;  1P3R A;  1K5G B;  4HAT B;  3X23 A;  4H8S A;  1U27 A;  3D8E A;  3KY9 A;  2ADZ A;  1U5F A;  3OHM B;  3PVU A;  4IFS A;  5FI0 A;  4F7G A;  4IAP A;  2BCJ A;  1SGH A;  5C5B B;  1NI2 A;  2IYB A;  1MIX A;  1XR0 B;  2I5F A;  2JP2 A;  3FM8 C;  5JLJ B;  1GC7 A;  3U7D A;  2LG1 A;  1DDV A;  4KHB B;  4KVG B;  4A6F B;  1BTN A;  5D3Y A;  1ZC3 B;  5JP4 A;  1H4R A;  2YS5 A;  3PZD A;  3P7Z A;  3ZDT A;  4A5K A;  2D9V A;  3BIN A;  5C79 A;  5DIF B;  2CRF A;  1SHC A;  2MKR A;  4MY6 A;  2R09 A;  1MAI A;  1FHO A;  2H7E A;  2EC1 A;  1KI1 B;  1IRS A;  1Y19 B;  3DXC A;  1XX0 A;  5DI9 B;  4IOY X;  2YT1 A;  1NU2 A;  3SYX A;  2COF A;  2NZ8 B;  4BBK A;  1EVH A;  1MK9 B;  2CY5 A;  4OSN A;  1UPR A;  1FGY A;  1WVH A;  1FAO A;  2Z59 A;  3NW8 A;  2G35 A;  5LG4 B;  2DYN A;  4CHJ A;  3TO1 A;  4DIX A;  1V89 A;  4MT7 A;  1X11 A;  5D3W A;  2D9X A;  3HQC A;  4CHM A;  5DH9 B;  3DCX A;  3TCA A;  1TJ6 A;  4DBB A;  2UZS A;  2YT2 A;  3KRW A;  1XD4 A;  1WJ1 A;  2P0H A;  1B55 A;  1EAZ A;  2DN6 A;  2NMB A;  2W2W A;  1UNP A;  4HAW B;  1ISN A;  2EMT A;  1WG7 A;  5LON B;  4K81 A;  1PLS A;  4Z2M B;  2EJ8 A;  1BWN A;  2RRF A;  2R2Y A;  3D8D A;  3NWD A;  3TW1 A;  5C5B A;  2ROZ B;  1ZYI A;  1PFJ A;  2GJY A;  4CSQ A;  1FOE A;  3WYF B;  1NTV A;  4KHB A;  1FHW A;  5GOW B;  2GS0 A;  4XWX A;  2DHK A;  2DX5 A;  4A6F A;  3M1I B;  3SNH A;  3RCP A;  1LB1 A;  1OQN A;  1UPQ A;  4HB0 B;  1BAK A;  3T06 A;  4YL8 A; 
#chains in the Genus database with same CATH homology
 5HE1 A;  4KHO A;  1EF1 A;  5CLL B;  2P8V A;  1Z87 A;  2KCJ A;  5HE0 A;  2EMS A;  3MPX A;  4YON A;  3SO6 A;  2N0Y A;  4KAX B;  5KCV A;  2DHI A;  3KZ1 A;  1J19 A;  2LKO A;  3LJU X;  2IFS A;  1P5T A;  2Y7B A;  1XOD A;  2VSZ A;  2D10 A;  3O96 A;  2LUL A;  2LOX A;  1ZM0 A;  1KZ7 A;  2RUK B;  4A6K A;  4HB2 B;  1NTY A;  3N7C A;  2VRW B;  1X05 A;  3OAN A;  1OY2 A;  2J0M A;  2YSZ A;  4ZRI A;  3TFM A;  2DHJ A;  3WA0 A;  4C0A A;  1U5D A;  2KGX B;  5J3Y A;  2MWN B;  3ML4 A;  3ODW A;  4K2O A;  2K2U A;  1J0W A;  3DXD A;  1AQC A;  2COA A;  2ZPY A;  3HW2 B;  2CY4 A;  2RSG A;  1UNQ A;  3SV1 A;  2P0F A;  2D4Q A;  1V5U A;  2D11 A;  5HE3 A;  3A98 B;  1W1D A;  2M38 A;  2I1K A;  2J0J A;  4HAX B;  4HDO A;  4TYZ A;  4EKU A;  4GMX B;  2DLW A;  1AWE A;  2DX1 A;  5EFX A;  4Z2N A;  1P6S A;  1H10 A;  3AU5 A;  3QBV B;  1PMS A;  1BTK A;  5JHH A;  3AU4 A;  4NY0 A;  1U5G A;  1TQZ A;  2COC A;  3A8Q A;  2AEH A;  2COD A;  1RRP B;  2M14 A;  2QKL A;  3PVL A;  2KUP A;  2UVM A;  2K00 A;  3SUZ A;  5CLQ B;  1GC6 A;  3KSY A;  2Z0P A;  2DFK A;  3BJI A;  5HE2 A;  1ZSQ A;  2ELA A;  1TXD A;  1M7R A;  2FJL A;  3KRX A;  1V88 A;  3ULC A;  2YVC A;  1QQG A;  2R0D A;  3U8Z A;  3PVW A;  5KQ1 A;  2OTX A;  3PP2 A;  1FB8 A;  4GN1 A;  4B6H A;  2W2X D;  2Q13 A;  1RJ2 A;  4DXA B;  1WGU A;  1N3H A;  1DBH A;  1ZVR A;  1MKE A;  4K17 A;  2GCL A;  4EMO A;  4HAY B;  4HDQ A;  2Z0O A;  1QC6 A;  2N23 A;  2MDX A;  4GZU A;  1EGX A;  4Y94 A;  2J0K A;  2LOZ A;  1WI1 A;  2CAY A;  1OMW A;  4HHV A;  2X18 A;  2YS3 A;  1WGQ A;  3GYO A;  3ODX A;  4K2P A;  5LOP B;  2J59 M;  2Y8G A;  2Z0Q A;  3AJ4 A;  4DX9 0;  4A6H A;  4KHA A;  4CYE A;  1U29 A;  2ELB A;  4HB4 B;  2HTH B;  2UZR A;  4WSF A;  2HE7 A;  1X1F A;  3P6A A;  3NSU A;  3V5W A;  2D9Z A;  1Y5O A;  4GMV A;  2LYD A;  3VIA A;  2AL6 A;  5DHF B;  4PNK A;  1E5W A;  4ZRK A;  1U5E A;  5J3T A;  2YRY A;  2YT0 A;  4HAZ B;  4D0N B;  1X1G A;  1KZG A;  2VKI A;  3CIK A;  1W1G A;  2GCJ A;  2DKQ A;  1MPH A;  1I2H A;  2D2Q A;  3G9W A;  3D8F A;  5D3V A;  3QIJ A;  2I5C A;  1MIZ B;  1UEF A;  4F7U P;  2YF0 A;  3PSC A;  2ROV A;  1DRO A;  4EJN A;  2RNR B;  3GYP A;  1M7E A;  3FSS A;  1X86 A;  5D27 A;  2V76 A;  1Q67 A;  1UNR A;  2L1C A;  4PQ0 A;  3MDB C;  4P7I A;  4F7H A;  4TKN A;  1XCG A;  2OQB A;  5C16 A;  5KQ4 A;  3UZT A;  1DYN A;  1I7A A;  2DYQ A;  1LW3 A;  1DDW A;  2RVB B;  1W1H A;  4DX8 A;  2K2J A;  3HK0 A;  1ZC4 B;  1V5P A;  4HAU B;  2D9W A;  3PEG A;  4GPT B;  3PG7 A;  3QWM A;  1XKE A;  4WVF B;  5JHG A;  1V61 A;  4WJ7 A;  3VOQ A;  4GXB A;  2Y8F A;  1DDM A;  2DTC A;  4HB3 B;  1V5M A;  3ULB A;  3DXE A;  2L2I A;  2RGN B;  2DKP A;  3ODO A;  3TVV A;  3ZVR A;  2E2X A;  2XQN M;  3FEH A;  5J3Q A;  2P0D A;  3IVF A;  1FGZ A;  4HAV B;  2PZ1 A;  1WJM A;  2YS1 A;  1U2B A;  3F5R A;  2MFQ A;  1K5D B;  5DHA B;  2QKM A;  2RLO A;  2W2X C;  3F0W A;  3A8P A;  5L81 A;  3CXB B;  1GG3 A;  5C6R A;  1MK7 B;  2D9Y A;  4MK0 A;  5D3X A;  1FHX A;  2DA0 A;  4ZRJ A;  2I1J A;  4NSW A;  5FI1 A;  2H7D A;  4L6E A;  1P3R A;  1K5G B;  4HAT B;  3X23 A;  4H8S A;  1U27 A;  3D8E A;  3KY9 A;  2ADZ A;  1U5F A;  3PVU A;  4IFS A;  5FI0 A;  4F7G A;  4IAP A;  2BCJ A;  1SGH A;  5C5B B;  1NI2 A;  2IYB A;  1MIX A;  1XR0 B;  2I5F A;  2JP2 A;  3FM8 C;  5JLJ B;  1GC7 A;  3U7D A;  2LG1 A;  1DDV A;  4KHB B;  4KVG B;  4A6F B;  1BTN A;  5D3Y A;  1ZC3 B;  5JP4 A;  1H4R A;  2YS5 A;  3PZD A;  3P7Z A;  3ZDT A;  4A5K A;  2D9V A;  3BIN A;  5C79 A;  5DIF B;  2CRF A;  1SHC A;  2MKR A;  4MY6 A;  2R09 A;  1MAI A;  1FHO A;  2H7E A;  2EC1 A;  1KI1 B;  1IRS A;  1Y19 B;  3DXC A;  1XX0 A;  5DI9 B;  4IOY X;  2YT1 A;  1NU2 A;  3SYX A;  2COF A;  2NZ8 B;  4BBK A;  1EVH A;  1MK9 B;  2CY5 A;  1UPR A;  1FGY A;  1WVH A;  1FAO A;  2G35 A;  2DYN A;  4CHJ A;  3TO1 A;  1V89 A;  4MT7 A;  1X11 A;  5D3W A;  2D9X A;  3HQC A;  4CHM A;  5DH9 B;  3TCA A;  1TJ6 A;  4DBB A;  2UZS A;  3KRW A;  1XD4 A;  1WJ1 A;  2P0H A;  1B55 A;  1EAZ A;  2DN6 A;  2NMB A;  2W2W A;  1UNP A;  4HAW B;  1ISN A;  2EMT A;  1WG7 A;  5LON B;  4K81 A;  1PLS A;  4Z2M B;  2EJ8 A;  1BWN A;  3D8D A;  3TW1 A;  5C5B A;  2ROZ B;  1PFJ A;  2GJY A;  1FOE A;  3WYF B;  1NTV A;  1FHW A;  5GOW B;  2GS0 A;  4XWX A;  2DHK A;  2DX5 A;  4A6F A;  3M1I B;  3SNH A;  3RCP A;  1LB1 A;  1OQN A;  1UPQ A;  4HB0 B;  1BAK A;  3T06 A;  4YL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...