1UEFA

Crystal structure of dok1 ptb domain complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
105
structure length
105
Chain Sequence
MGSQFWVTSQKTEASERCGLQGSYILRVEAEKLTLLTLGAQSQILEPLLFWPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTSQGNDIFQAVEAAIQQQKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Specific Recognition of RET by the Dok1 Phosphotyrosine Binding Domain
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding/transferase
molecule keywords Docking protein 1
total genus 23
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1uefA00
2DTCA 3U8ZA 1TQZA 1QC6A 4B6HA 4HAZB 3TCAA 4F7HA 2OQBA 2CODA 1M7RA 4PQ0A 1U27A 1UPQA 3KSYA 1PFJA 3KZ1A 2ROVA 2EMTA 3FM8C 5CLLB 2I1KA 2IFSA 3PP2A 2N23A 1UPRA 2COAA 2CY5A 1DDVA 2DHKA 5HE0A 3ODOA 4HB4B 4KAXB 3P7ZA 1UNQA 1SHCA 2RLOA 2Y8FA 4KHBB 5DHAB 4HHVA 1V88A 2D9XA 2V76A 1W1GA 2D2QA 1SGHA 3WYFB 1WI1A 2N0YA 5JHHA 2UZSA 3GYOA 3ODWA 4HB3B 1FGYA 1GC7A 1XKEA 2J0JA 1MPHA 5C5BB 3ZVRA 1EF1A 3G9WA 2YT0A 1ZSQA 5D3YA 2DFKA 3VOQA 3N7CA 1K5GB 1MK9B 2LYDA 2W2WA 5FI0A 4PNKA 1WJ1A 2Y7BA 2D11A 2VKIA 4GMXB 4KHAA 5HE2A 1ZM0A 4HAUB 2DYNA 1FGZA 2YVCA 4TYZA 4KHOA 4XWXA 2K2JA 1U5DA 2CRFA 1W1DA 1DYNA 2R0DA 3DXEA 2HTHB 1IRSA 4A5KA 4GMVA 2UZRA 1FB8A 4K2PA 2GCJA 2J59M 1DROA 1AWEA 2JP2A 5LOPB 2RSGA 4DX8A 1KZ7A 2J0KA 2RNRB 1X1FA 4HATB 1U5GA 3MDBC 3KY9A 1M7EA 3QBVB 5GOWB 1WVHA 3FEHA 2NZ8B 3PZDA 3A98B 2ADZA 2UVMA 3P6AA 4HAWB 3DXCA 3SO6A 3ODXA 4P7IA 1LB1A 3SNHA 4TKNA 3ML4A 1P5TA 1X05A 3MPXA 1U5FA 3UZTA 5JLJB 2I5CA 1W1HA 2NMBA 1XR0B 4ZRIA 3OANA 5L81A 2H7EA 4H8SA 4IFSA 2GCLA 4IAPA 2I1JA 2KCJA 5J3QA 2M38A 2MKRA 3NSUA 1V61A 4DXAB 5FI1A 1LW3A 1XCGA 2AL6A 5KQ4A 1GG3A 2IYBA 3O96A 3PVUA 1Z87A 2DX1A 3WA0A 1DDWA 2I5FA 1FHOA 3SV1A 2MWNB 1WG7A 1X86A 1I7AA 2DA0A 4WSFA 2BCJA 3T06A 5EFXA 2D9YA 2K2UA 1MIZB 3F0WA 5HE3A 1QQGA 3PSCA 2MFQA 2CY4A 3BJIA 1MKEA 2Z0PA 4BBKA 3AU4A 1V89A 3TW1A 3ULBA 3ZDTA 5DIFB 2CAYA 2ZPYA 5LONB 1NI2A 3PG7A 4KVGB 2YF0A 3F5RA 4NSWA 1V5MA 1ZC4B 2YT1A 1MK7B 1RJ2A 5J3TA 2Y8GA 3TO1A 2J0MA 1Y5OA 1I2HA 2D9WA 4HAVB 1UNPA 2P8VA 2DKPA 3CIKA 4CHMA 2K00A 2COFA 3TVVA 1N3HA 4A6KA 1V5UA 1U2BA 3V5WA 3DXDA 1U29A 2D4QA 2LOZA 3QIJA 1TJ6A 2YRYA 2VRWB 3LJUX 3PVWA 2W2XC 1WGUA 3A8PA 5DH9B 2L2IA 4CYEA 2EC1A 1FAOA 3ULCA 2DKQA 4NY0A 5D3XA 5KCVA 4K81A 2EMSA 2M14A 4F7UP 2P0FA 4ZRKA 2Z0OA 3HK0A 1H4RA 3PVLA 1FHXA 2GJYA 4K17A 2LOXA 2LG1A 2RGNB 1BTNA 4MT7A 4DX90 4HB0B 2DYQA 1V5PA 1XD4A 2G35A 2RVBB 1BTKA 2DN6A 1UNRA 3SUZA 4L6EA 2ROZB 3SYXA 1MAIA 1ZC3B 3BINA 4HAYB 1AQCA 1DBHA 2H7DA 3A8QA 1WJMA 2L1CA 4EMOA 1UEFA 3KRWA 4Z2MB 1PMSA 2P0HA 2PZ1A 1P3RA 2KUPA 5C16A 1EVHA 5JP4A 1ISNA 5C5BA 1X1GA 1U5EA 2LULA 5HE1A 4EKUA 1Q67A 4MK0A 1X11A 2FJLA 1B55A 1OY2A 4A6HA 4F7GA 2YS5A 3GYPA 5JHGA 1ZVRA 2DHIA 2DHJA 1NTVA 1TXDA 2QKLA 1XODA 4GPTB 4A6FA 4YONA 5KQ1A 2YS3A 2LKOA 3D8EA 3D8FA 5CLQB 2W2XD 1OMWA 1FOEA 2AEHA 2YS1A 4YL8A 5D3WA 3RCPA 4MY6A 2COCA 2X18A 5DHFB 2D9ZA 3QWMA 2Q13A 1EAZA 2MDXA 3FSSA 1GC6A 2P0DA 2VSZA 1H10A 2DLWA 4GN1A 1MIXA 4CHJA 3HW2B 4DBBA 2YSZA 4HB2B 4A6FB 1J0WA 1DDMA 2QKMA 4HAXB 3KRXA 1P6SA 3AJ4A 3VIAA 2GS0A 4HDQA 5C79A 1Y19B 2KGXB 1K5DB 4Z2NA 1XX0A 2RUKB 1WGQA 1EGXA 3HQCA 3M1IB 3AU5A 1NU2A 4WVFB 4HDOA 3U7DA 5D27A 2OTXA 1OQNA 4C0AA 2ELAA 1J19A 5D3VA 3IVFA 2D10A 4IOYX 2D9VA 2EJ8A 3CXBB 4EJNA 2XQNM 1KI1B 4GXBA 1KZGA 4ZRJA 5J3YA 1E5WA 1FHWA 3TFMA 1PLSA 1RRPB 2DX5A 1BWNA 5DI9B 2HE7A 4Y94A 4K2OA 1NTYA 3PEGA 3D8DA 2Z0QA 2R09A 1BAKA 5C6RA 4D0NB 3X23A 2E2XA 4GZUA 4WJ7A 2ELBA
chains in the Genus database with same CATH superfamily
2DTCA 3U8ZA 2K8EA 1TQZA 1QC6A 3B77A 4B6HA 4HAZB 3TCAA 4QXAB 4F7HA 2OQBA 2CODA 1M7RA 4PQ0A 1U27A 1UPQA 3KSYA 3NWAA 1PFJA 3KZ1A 2ROVA 2EMTA 3FM8C 5CLLB 2I1KA 2IFSA 3PP2A 2N23A 1UPRA 2COAA 2CY5A 1DDVA 2DHKA 5HE0A 3ODOA 4HB4B 4KAXB 3P7ZA 5LG4B 1UNQA 1SHCA 2RLOA 2Y8FA 4KHBB 4D6WA 5DHAB 4HHVA 1V88A 2D9XA 2KIGA 2V76A 1W1GA 2D2QA 1SGHA 3WYFB 1WI1A 2N0YA 5JHHA 2UZSA 3GYOA 3ODWA 3OHMB 4HB3B 1FGYA 1GC7A 1XKEA 2J0JA 1MPHA 5C5BB 3ZVRA 1EF1A 3G9WA 2YT0A 1ZSQA 5D3YA 2DFKA 3VOQA 3N7CA 1K5GB 1MK9B 2Z14A 2LYDA 2W2WA 5FI0A 4PNKA 1WJ1A 2Y7BA 2D11A 2VKIA 4GMXB 4KHAA 5HE2A 1ZM0A 4HAUB 2DYNA 1FGZA 2YVCA 4TYZA 4KHOA 4XWXA 1T77A 2K2JA 1U5DA 2CRFA 1W1DA 1DYNA 2R0DA 3DXEA 2HTHB 1IRSA 4A5KA 4GMVA 2UZRA 1FB8A 4K2PA 2YT2A 2GCJA 3NWFA 2J59M 1DROA 1AWEA 2JP2A 5LOPB 2RSGA 4DX8A 1KZ7A 2J0KA 2RNRB 1X1FA 4HATB 1U5GA 3MDBC 3KY9A 1M7EA 3QBVB 5GOWB 1WVHA 3FEHA 2NZ8B 3PZDA 3A98B 2ADZA 2UVMA 3P6AA 4HAWB 3DXCA 4GOUA 3SO6A 3ODXA 4P7IA 4OT1A 1LB1A 3SNHA 4TKNA 3ML4A 1P5TA 2KIEA 1X05A 3MPXA 1U5FA 3UZTA 5JLJB 2I5CA 1W1HA 2NMBA 1XR0B 4ZRIA 2NBVA 3OANA 5L81A 2H7EA 4H8SA 4IFSA 2GCLA 2Z13A 4IAPA 2I1JA 2KCJA 5J3QA 4DIXA 2M38A 2MKRA 3NSUA 1V61A 4DXAB 5FI1A 1LW3A 1XCGA 2AL6A 5KQ4A 2KR0A 4QJ4B 1GG3A 2IYBA 3O96A 3PVUA 1Z87A 2DX1A 3WA0A 1DDWA 2I5FA 1FHOA 3SV1A 2ZKMX 2MWNB 1WG7A 1X86A 1I7AA 2DA0A 4WSFA 2BCJA 3T06A 5EFXA 2D9YA 2K2UA 1MIZB 3F0WA 5HE3A 1QQGA 3PSCA 2MFQA 2CY4A 3BJIA 1MKEA 4QJ3B 2Z0PA 4BBKA 3AU4A 1V89A 3TW1A 3ULBA 3ZDTA 5DIFB 2CAYA 5M4YB 2ZPYA 5LONB 1NI2A 3PG7A 4KVGB 2YF0A 3F5RA 3NW8A 4NSWA 1V5MA 1ZC4B 2YT1A 1MK7B 1RJ2A 5J3TA 2Y8GA 3TO1A 2J0MA 2KUQA 1Y5OA 1I2HA 2D9WA 4HAVB 4OSNA 1UNPA 2P8VA 2DKPA 3CIKA 4CHMA 2K00A 2COFA 4CSQA 3TVVA 1N3HA 2RRFA 4A6KA 1V5UA 1U2BA 3V5WA 3FVCA 3DXDA 1U29A 2R2YA 2D4QA 2LOZA 3QIJA 1TJ6A 2YRYA 2VRWB 3LJUX 3PVWA 2W2XC 1WGUA 3A8PA 5DH9B 2L2IA 3NWDA 4CYEA 2EC1A 1FAOA 3ULCA 2DKQA 4NY0A 5D3XA 5KCVA 4K81A 2EMSA 5I2SA 2M14A 4F7UP 2P0FA 4ZRKA 2Z0OA 3HK0A 1H4RA 3PVLA 1FHXA 2GJYA 4KHBA 4K17A 2LOXA 2LG1A 2RGNB 1BTNA 2K49A 1MI1A 4MT7A 4DX90 4HB0B 2DYQA 1V5PA 1XD4A 2G35A 2RVBB 1BTKA 2DN6A 1UNRA 3SUZA 4L6EA 2ROZB 3SYXA 1MAIA 1ZC3B 3BINA 4HAYB 1AQCA 1DBHA 4QJ5B 2H7DA 3A8QA 1WJMA 2L1CA 4EMOA 1UEFA 3KRWA 4Z2MB 1PMSA 2P0HA 2PZ1A 1P3RA 4L1RA 2KUPA 5C16A 1EVHA 5JP4A 1ISNA 5C5BA 1X1GA 3A58A 1U5EA 2LULA 5HE1A 4EKUA 1Q67A 4MK0A 1X11A 2FJLA 1B55A 1OY2A 4A6HA 4F7GA 2YS5A 3GYPA 5JHGA 1ZVRA 4HSIA 2DHIA 2GUMA 2DHJA 1NTVA 1TXDA 2QKLA 1XODA 4GPTB 4A6FA 2Z4DA 4YONA 5KQ1A 2YS3A 2LKOA 3D8EA 3D8FA 5CLQB 3U12A 2W2XD 1OMWA 1FOEA 2AEHA 2YS1A 4YL8A 5D3WA 3RCPA 4MY6A 2COCA 2X18A 5DHFB 2D9ZA 3QWMA 5IRSA 2Q13A 1EAZA 3HSAA 2MDXA 3FSSA 1GC6A 2P0DA 2VSZA 1H10A 2DLWA 2Z59A 4GN1A 1MIXA 4CHJA 3HW2B 4DBBA 3HIEA 2YSZA 4HB2B 4A6FB 1ZYIA 1J0WA 1DDMA 2QKMA 4HAXB 3KRXA 1P6SA 3AJ4A 3VIAA 2GS0A 4HDQA 5C79A 1Y19B 2KGXB 1K5DB 4Z2NA 1XX0A 2RUKB 1WGQA 1EGXA 3DCXA 3HQCA 3M1IB 3AU5A 1NU2A 4WVFB 4HDOA 3U7DA 5D27A 2OTXA 1OQNA 4C0AA 2ELAA 1J19A 5D3VA 3IVFA 2D10A 2D9VA 2EJ8A 3CXBB 4IOYX 4EJNA 2XQNM 1KI1B 4GXBA 1KZGA 4ZRJA 5J3YA 1E5WA 1FHWA 3TFMA 1PLSA 1RRPB 4GNKB 2DX5A 1BWNA 5DI9B 2HE7A 4Y94A 4K2OA 1NTYA 3PEGA 3D8DA 2Z0QA 2R09A 1BAKA 5C6RA 4D0NB 3X23A 2E2XA 4GZUA 4WJ7A 5I2MA 2FJUB 2ELBA
chains in the Genus database with same CATH topology
2DTCA 3U8ZA 1TQZA 1QC6A 4B6HA 4HAZB 3TCAA 4F7HA 2OQBA 2CODA 1M7RA 4PQ0A 1U27A 1UPQA 3KSYA 1PFJA 3KZ1A 2ROVA 2EMTA 3FM8C 5CLLB 2I1KA 2IFSA 3PP2A 2N23A 1UPRA 2COAA 2CY5A 1DDVA 2DHKA 5HE0A 3ODOA 4HB4B 4KAXB 3P7ZA 1UNQA 1SHCA 2RLOA 2Y8FA 4KHBB 5DHAB 4HHVA 1V88A 2D9XA 2V76A 1W1GA 2D2QA 1SGHA 3WYFB 1WI1A 2N0YA 5JHHA 2UZSA 3GYOA 3ODWA 4HB3B 1FGYA 1GC7A 1XKEA 2J0JA 1MPHA 5C5BB 3ZVRA 1EF1A 3G9WA 2YT0A 1ZSQA 5D3YA 2DFKA 3VOQA 3N7CA 1K5GB 1MK9B 2LYDA 2W2WA 5FI0A 4PNKA 1WJ1A 2Y7BA 2D11A 2VKIA 4GMXB 4KHAA 5HE2A 1ZM0A 4HAUB 2DYNA 1FGZA 2YVCA 4TYZA 4KHOA 4XWXA 2K2JA 1U5DA 2CRFA 1W1DA 1DYNA 2R0DA 3DXEA 2HTHB 1IRSA 4A5KA 4GMVA 2UZRA 1FB8A 4K2PA 2GCJA 2J59M 1DROA 1AWEA 2JP2A 5LOPB 2RSGA 4DX8A 1KZ7A 2J0KA 2RNRB 1X1FA 4HATB 1U5GA 3MDBC 3KY9A 1M7EA 3QBVB 5GOWB 1WVHA 3FEHA 2NZ8B 3PZDA 3A98B 2ADZA 2UVMA 3P6AA 4HAWB 3DXCA 3SO6A 3ODXA 4P7IA 1LB1A 3SNHA 4TKNA 3ML4A 1P5TA 1X05A 3MPXA 1U5FA 3UZTA 5JLJB 2I5CA 1W1HA 2NMBA 1XR0B 4ZRIA 3OANA 5L81A 2H7EA 4H8SA 4IFSA 2GCLA 4IAPA 2I1JA 2KCJA 5J3QA 2M38A 2MKRA 3NSUA 1V61A 4DXAB 5FI1A 1LW3A 1XCGA 2AL6A 5KQ4A 1GG3A 2IYBA 3O96A 3PVUA 1Z87A 2DX1A 3WA0A 1DDWA 2I5FA 1FHOA 3SV1A 2MWNB 1WG7A 1X86A 1I7AA 2DA0A 4WSFA 2BCJA 3T06A 5EFXA 2D9YA 2K2UA 1MIZB 3F0WA 5HE3A 1QQGA 3PSCA 2MFQA 2CY4A 3BJIA 1MKEA 2Z0PA 4BBKA 3AU4A 1V89A 3TW1A 3ULBA 3ZDTA 5DIFB 2CAYA 2ZPYA 5LONB 1NI2A 3PG7A 4KVGB 2YF0A 3F5RA 4NSWA 1V5MA 1ZC4B 2YT1A 1MK7B 1RJ2A 5J3TA 2Y8GA 3TO1A 2J0MA 1Y5OA 1I2HA 2D9WA 4HAVB 1UNPA 2P8VA 2DKPA 3CIKA 4CHMA 2K00A 2COFA 3TVVA 1N3HA 4A6KA 1V5UA 1U2BA 3V5WA 3DXDA 1U29A 2D4QA 2LOZA 3QIJA 1TJ6A 2YRYA 2VRWB 3LJUX 3PVWA 2W2XC 1WGUA 3A8PA 5DH9B 2L2IA 4CYEA 2EC1A 1FAOA 3ULCA 2DKQA 4NY0A 5D3XA 5KCVA 4K81A 2EMSA 2M14A 4F7UP 2P0FA 4ZRKA 2Z0OA 3HK0A 1H4RA 3PVLA 1FHXA 2GJYA 4K17A 2LOXA 2LG1A 2RGNB 1BTNA 4MT7A 4DX90 4HB0B 2DYQA 1V5PA 1XD4A 2G35A 2RVBB 1BTKA 2DN6A 1UNRA 3SUZA 4L6EA 2ROZB 3SYXA 1MAIA 1ZC3B 3BINA 4HAYB 1AQCA 1DBHA 2H7DA 3A8QA 1WJMA 2L1CA 4EMOA 1UEFA 3KRWA 4Z2MB 1PMSA 2P0HA 2PZ1A 1P3RA 2KUPA 5C16A 1EVHA 5JP4A 1ISNA 5C5BA 1X1GA 1U5EA 2LULA 5HE1A 4EKUA 1Q67A 4MK0A 1X11A 2FJLA 1B55A 1OY2A 4A6HA 4F7GA 2YS5A 3GYPA 5JHGA 1ZVRA 2DHIA 2DHJA 1NTVA 1TXDA 2QKLA 1XODA 4GPTB 4A6FA 4YONA 5KQ1A 2YS3A 2LKOA 3D8EA 3D8FA 5CLQB 2W2XD 1OMWA 1FOEA 2AEHA 2YS1A 4YL8A 5D3WA 3RCPA 4MY6A 2COCA 2X18A 5DHFB 2D9ZA 3QWMA 2Q13A 1EAZA 2MDXA 3FSSA 1GC6A 2P0DA 2VSZA 1H10A 2DLWA 4GN1A 1MIXA 4CHJA 3HW2B 4DBBA 2YSZA 4HB2B 4A6FB 1J0WA 1DDMA 2QKMA 4HAXB 3KRXA 1P6SA 3AJ4A 3VIAA 2GS0A 4HDQA 5C79A 1Y19B 2KGXB 1K5DB 4Z2NA 1XX0A 2RUKB 1WGQA 1EGXA 3HQCA 3M1IB 3AU5A 1NU2A 4WVFB 4HDOA 3U7DA 5D27A 2OTXA 1OQNA 4C0AA 2ELAA 1J19A 5D3VA 3IVFA 2D10A 4IOYX 2D9VA 2EJ8A 3CXBB 4EJNA 2XQNM 1KI1B 4GXBA 1KZGA 4ZRJA 5J3YA 1E5WA 1FHWA 3TFMA 1PLSA 1RRPB 2DX5A 1BWNA 5DI9B 2HE7A 4Y94A 4K2OA 1NTYA 3PEGA 3D8DA 2Z0QA 2R09A 1BAKA 5C6RA 4D0NB 3X23A 2E2XA 4GZUA 4WJ7A 2ELBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DTC A;  3U8Z A;  1TQZ A;  1QC6 A;  4B6H A;  4HAZ B;  3TCA A;  4F7H A;  2OQB A;  2COD A;  1M7R A;  4PQ0 A;  1U27 A;  1UPQ A;  3KSY A;  1PFJ A;  3KZ1 A;  2ROV A;  2EMT A;  3FM8 C;  5CLL B;  2I1K A;  2IFS A;  3PP2 A;  2N23 A;  1UPR A;  2COA A;  2CY5 A;  1DDV A;  2DHK A;  5HE0 A;  3ODO A;  4HB4 B;  4KAX B;  3P7Z A;  1UNQ A;  1SHC A;  2RLO A;  2Y8F A;  4KHB B;  5DHA B;  4HHV A;  1V88 A;  2D9X A;  2V76 A;  1W1G A;  2D2Q A;  1SGH A;  3WYF B;  1WI1 A;  2N0Y A;  5JHH A;  2UZS A;  3GYO A;  3ODW A;  4HB3 B;  1FGY A;  1GC7 A;  1XKE A;  2J0J A;  1MPH A;  5C5B B;  3ZVR A;  1EF1 A;  3G9W A;  2YT0 A;  1ZSQ A;  5D3Y A;  2DFK A;  3VOQ A;  3N7C A;  1K5G B;  1MK9 B;  2LYD A;  2W2W A;  5FI0 A;  4PNK A;  1WJ1 A;  2Y7B A;  2D11 A;  2VKI A;  4GMX B;  4KHA A;  5HE2 A;  1ZM0 A;  4HAU B;  2DYN A;  1FGZ A;  2YVC A;  4TYZ A;  4KHO A;  4XWX A;  2K2J A;  1U5D A;  2CRF A;  1W1D A;  1DYN A;  2R0D A;  3DXE A;  2HTH B;  1IRS A;  4A5K A;  4GMV A;  2UZR A;  1FB8 A;  4K2P A;  2GCJ A;  2J59 M;  1DRO A;  1AWE A;  2JP2 A;  5LOP B;  2RSG A;  4DX8 A;  1KZ7 A;  2J0K A;  2RNR B;  1X1F A;  4HAT B;  1U5G A;  3MDB C;  3KY9 A;  1M7E A;  3QBV B;  5GOW B;  1WVH A;  3FEH A;  2NZ8 B;  3PZD A;  3A98 B;  2ADZ A;  2UVM A;  3P6A A;  4HAW B;  3DXC A;  3SO6 A;  3ODX A;  4P7I A;  1LB1 A;  3SNH A;  4TKN A;  3ML4 A;  1P5T A;  1X05 A;  3MPX A;  1U5F A;  3UZT A;  5JLJ B;  2I5C A;  1W1H A;  2NMB A;  1XR0 B;  4ZRI A;  3OAN A;  5L81 A;  2H7E A;  4H8S A;  4IFS A;  2GCL A;  4IAP A;  2I1J A;  2KCJ A;  5J3Q A;  2M38 A;  2MKR A;  3NSU A;  1V61 A;  4DXA B;  5FI1 A;  1LW3 A;  1XCG A;  2AL6 A;  5KQ4 A;  1GG3 A;  2IYB A;  3O96 A;  3PVU A;  1Z87 A;  2DX1 A;  3WA0 A;  1DDW A;  2I5F A;  1FHO A;  3SV1 A;  2MWN B;  1WG7 A;  1X86 A;  1I7A A;  2DA0 A;  4WSF A;  2BCJ A;  3T06 A;  5EFX A;  2D9Y A;  2K2U A;  1MIZ B;  3F0W A;  5HE3 A;  1QQG A;  3PSC A;  2MFQ A;  2CY4 A;  3BJI A;  1MKE A;  2Z0P A;  4BBK A;  3AU4 A;  1V89 A;  3TW1 A;  3ULB A;  3ZDT A;  5DIF B;  2CAY A;  2ZPY A;  5LON B;  1NI2 A;  3PG7 A;  4KVG B;  2YF0 A;  3F5R A;  4NSW A;  1V5M A;  1ZC4 B;  2YT1 A;  1MK7 B;  1RJ2 A;  5J3T A;  2Y8G A;  3TO1 A;  2J0M A;  1Y5O A;  1I2H A;  2D9W A;  4HAV B;  1UNP A;  2P8V A;  2DKP A;  3CIK A;  4CHM A;  2K00 A;  2COF A;  3TVV A;  1N3H A;  4A6K A;  1V5U A;  1U2B A;  3V5W A;  3DXD A;  1U29 A;  2D4Q A;  2LOZ A;  3QIJ A;  1TJ6 A;  2YRY A;  2VRW B;  3LJU X;  3PVW A;  2W2X C;  1WGU A;  3A8P A;  5DH9 B;  2L2I A;  4CYE A;  2EC1 A;  1FAO A;  3ULC A;  2DKQ A;  4NY0 A;  5D3X A;  5KCV A;  4K81 A;  2EMS A;  2M14 A;  4F7U P;  2P0F A;  4ZRK A;  2Z0O A;  3HK0 A;  1H4R A;  3PVL A;  1FHX A;  2GJY A;  4K17 A;  2LOX A;  2LG1 A;  2RGN B;  1BTN A;  4MT7 A;  4DX9 0;  4HB0 B;  2DYQ A;  1V5P A;  1XD4 A;  2G35 A;  2RVB B;  1BTK A;  2DN6 A;  1UNR A;  3SUZ A;  4L6E A;  2ROZ B;  3SYX A;  1MAI A;  1ZC3 B;  3BIN A;  4HAY B;  1AQC A;  1DBH A;  2H7D A;  3A8Q A;  1WJM A;  2L1C A;  4EMO A;  1UEF A;  3KRW A;  4Z2M B;  1PMS A;  2P0H A;  2PZ1 A;  1P3R A;  2KUP A;  5C16 A;  1EVH A;  5JP4 A;  1ISN A;  5C5B A;  1X1G A;  1U5E A;  2LUL A;  5HE1 A;  4EKU A;  1Q67 A;  4MK0 A;  1X11 A;  2FJL A;  1B55 A;  1OY2 A;  4A6H A;  4F7G A;  2YS5 A;  3GYP A;  5JHG A;  1ZVR A;  2DHI A;  2DHJ A;  1NTV A;  1TXD A;  2QKL A;  1XOD A;  4GPT B;  4A6F A;  4YON A;  5KQ1 A;  2YS3 A;  2LKO A;  3D8E A;  3D8F A;  5CLQ B;  2W2X D;  1OMW A;  1FOE A;  2AEH A;  2YS1 A;  4YL8 A;  5D3W A;  3RCP A;  4MY6 A;  2COC A;  2X18 A;  5DHF B;  2D9Z A;  3QWM A;  2Q13 A;  1EAZ A;  2MDX A;  3FSS A;  1GC6 A;  2P0D A;  2VSZ A;  1H10 A;  2DLW A;  4GN1 A;  1MIX A;  4CHJ A;  3HW2 B;  4DBB A;  2YSZ A;  4HB2 B;  4A6F B;  1J0W A;  1DDM A;  2QKM A;  4HAX B;  3KRX A;  1P6S A;  3AJ4 A;  3VIA A;  2GS0 A;  4HDQ A;  5C79 A;  1Y19 B;  2KGX B;  1K5D B;  4Z2N A;  1XX0 A;  2RUK B;  1WGQ A;  1EGX A;  3HQC A;  3M1I B;  3AU5 A;  1NU2 A;  4WVF B;  4HDO A;  3U7D A;  5D27 A;  2OTX A;  1OQN A;  4C0A A;  2ELA A;  1J19 A;  5D3V A;  3IVF A;  2D10 A;  4IOY X;  2D9V A;  2EJ8 A;  3CXB B;  4EJN A;  2XQN M;  1KI1 B;  4GXB A;  1KZG A;  4ZRJ A;  5J3Y A;  1E5W A;  1FHW A;  3TFM A;  1PLS A;  1RRP B;  2DX5 A;  1BWN A;  5DI9 B;  2HE7 A;  4Y94 A;  4K2O A;  1NTY A;  3PEG A;  3D8D A;  2Z0Q A;  2R09 A;  1BAK A;  5C6R A;  4D0N B;  3X23 A;  2E2X A;  4GZU A;  4WJ7 A;  2ELB A; 
#chains in the Genus database with same CATH topology
 2DTC A;  3U8Z A;  2K8E A;  1TQZ A;  1QC6 A;  3B77 A;  4B6H A;  4HAZ B;  3TCA A;  4QXA B;  4F7H A;  2OQB A;  2COD A;  1M7R A;  4PQ0 A;  1U27 A;  1UPQ A;  3KSY A;  3NWA A;  1PFJ A;  3KZ1 A;  2ROV A;  2EMT A;  3FM8 C;  5CLL B;  2I1K A;  2IFS A;  3PP2 A;  2N23 A;  1UPR A;  2COA A;  2CY5 A;  1DDV A;  2DHK A;  5HE0 A;  3ODO A;  4HB4 B;  4KAX B;  3P7Z A;  5LG4 B;  1UNQ A;  1SHC A;  2RLO A;  2Y8F A;  4KHB B;  4D6W A;  5DHA B;  4HHV A;  1V88 A;  2D9X A;  2KIG A;  2V76 A;  1W1G A;  2D2Q A;  1SGH A;  3WYF B;  1WI1 A;  2N0Y A;  5JHH A;  2UZS A;  3GYO A;  3ODW A;  3OHM B;  4HB3 B;  1FGY A;  1GC7 A;  1XKE A;  2J0J A;  1MPH A;  5C5B B;  3ZVR A;  1EF1 A;  3G9W A;  2YT0 A;  1ZSQ A;  5D3Y A;  2DFK A;  3VOQ A;  3N7C A;  1K5G B;  1MK9 B;  2Z14 A;  2LYD A;  2W2W A;  5FI0 A;  4PNK A;  1WJ1 A;  2Y7B A;  2D11 A;  2VKI A;  4GMX B;  4KHA A;  5HE2 A;  1ZM0 A;  4HAU B;  2DYN A;  1FGZ A;  2YVC A;  4TYZ A;  4KHO A;  4XWX A;  1T77 A;  2K2J A;  1U5D A;  2CRF A;  1W1D A;  1DYN A;  2R0D A;  3DXE A;  2HTH B;  1IRS A;  4A5K A;  4GMV A;  2UZR A;  1FB8 A;  4K2P A;  2YT2 A;  2GCJ A;  3NWF A;  2J59 M;  1DRO A;  1AWE A;  2JP2 A;  5LOP B;  2RSG A;  4DX8 A;  1KZ7 A;  2J0K A;  2RNR B;  1X1F A;  4HAT B;  1U5G A;  3MDB C;  3KY9 A;  1M7E A;  3QBV B;  5GOW B;  1WVH A;  3FEH A;  2NZ8 B;  3PZD A;  3A98 B;  2ADZ A;  2UVM A;  3P6A A;  4HAW B;  3DXC A;  4GOU A;  3SO6 A;  3ODX A;  4P7I A;  4OT1 A;  1LB1 A;  3SNH A;  4TKN A;  3ML4 A;  1P5T A;  2KIE A;  1X05 A;  3MPX A;  1U5F A;  3UZT A;  5JLJ B;  2I5C A;  1W1H A;  2NMB A;  1XR0 B;  4ZRI A;  2NBV A;  3OAN A;  5L81 A;  2H7E A;  4H8S A;  4IFS A;  2GCL A;  2Z13 A;  4IAP A;  2I1J A;  2KCJ A;  5J3Q A;  4DIX A;  2M38 A;  2MKR A;  3NSU A;  1V61 A;  4DXA B;  5FI1 A;  1LW3 A;  1XCG A;  2AL6 A;  5KQ4 A;  2KR0 A;  4QJ4 B;  1GG3 A;  2IYB A;  3O96 A;  3PVU A;  1Z87 A;  2DX1 A;  3WA0 A;  1DDW A;  2I5F A;  1FHO A;  3SV1 A;  2ZKM X;  2MWN B;  1WG7 A;  1X86 A;  1I7A A;  2DA0 A;  4WSF A;  2BCJ A;  3T06 A;  5EFX A;  2D9Y A;  2K2U A;  1MIZ B;  3F0W A;  5HE3 A;  1QQG A;  3PSC A;  2MFQ A;  2CY4 A;  3BJI A;  1MKE A;  4QJ3 B;  2Z0P A;  4BBK A;  3AU4 A;  1V89 A;  3TW1 A;  3ULB A;  3ZDT A;  5DIF B;  2CAY A;  5M4Y B;  2ZPY A;  5LON B;  1NI2 A;  3PG7 A;  4KVG B;  2YF0 A;  3F5R A;  3NW8 A;  4NSW A;  1V5M A;  1ZC4 B;  2YT1 A;  1MK7 B;  1RJ2 A;  5J3T A;  2Y8G A;  3TO1 A;  2J0M A;  2KUQ A;  1Y5O A;  1I2H A;  2D9W A;  4HAV B;  4OSN A;  1UNP A;  2P8V A;  2DKP A;  3CIK A;  4CHM A;  2K00 A;  2COF A;  4CSQ A;  3TVV A;  1N3H A;  2RRF A;  4A6K A;  1V5U A;  1U2B A;  3V5W A;  3FVC A;  3DXD A;  1U29 A;  2R2Y A;  2D4Q A;  2LOZ A;  3QIJ A;  1TJ6 A;  2YRY A;  2VRW B;  3LJU X;  3PVW A;  2W2X C;  1WGU A;  3A8P A;  5DH9 B;  2L2I A;  3NWD A;  4CYE A;  2EC1 A;  1FAO A;  3ULC A;  2DKQ A;  4NY0 A;  5D3X A;  5KCV A;  4K81 A;  2EMS A;  5I2S A;  2M14 A;  4F7U P;  2P0F A;  4ZRK A;  2Z0O A;  3HK0 A;  1H4R A;  3PVL A;  1FHX A;  2GJY A;  4KHB A;  4K17 A;  2LOX A;  2LG1 A;  2RGN B;  1BTN A;  2K49 A;  1MI1 A;  4MT7 A;  4DX9 0;  4HB0 B;  2DYQ A;  1V5P A;  1XD4 A;  2G35 A;  2RVB B;  1BTK A;  2DN6 A;  1UNR A;  3SUZ A;  4L6E A;  2ROZ B;  3SYX A;  1MAI A;  1ZC3 B;  3BIN A;  4HAY B;  1AQC A;  1DBH A;  4QJ5 B;  2H7D A;  3A8Q A;  1WJM A;  2L1C A;  4EMO A;  1UEF A;  3KRW A;  4Z2M B;  1PMS A;  2P0H A;  2PZ1 A;  1P3R A;  4L1R A;  2KUP A;  5C16 A;  1EVH A;  5JP4 A;  1ISN A;  5C5B A;  1X1G A;  3A58 A;  1U5E A;  2LUL A;  5HE1 A;  4EKU A;  1Q67 A;  4MK0 A;  1X11 A;  2FJL A;  1B55 A;  1OY2 A;  4A6H A;  4F7G A;  2YS5 A;  3GYP A;  5JHG A;  1ZVR A;  4HSI A;  2DHI A;  2GUM A;  2DHJ A;  1NTV A;  1TXD A;  2QKL A;  1XOD A;  4GPT B;  4A6F A;  2Z4D A;  4YON A;  5KQ1 A;  2YS3 A;  2LKO A;  3D8E A;  3D8F A;  5CLQ B;  3U12 A;  2W2X D;  1OMW A;  1FOE A;  2AEH A;  2YS1 A;  4YL8 A;  5D3W A;  3RCP A;  4MY6 A;  2COC A;  2X18 A;  5DHF B;  2D9Z A;  3QWM A;  5IRS A;  2Q13 A;  1EAZ A;  3HSA A;  2MDX A;  3FSS A;  1GC6 A;  2P0D A;  2VSZ A;  1H10 A;  2DLW A;  2Z59 A;  4GN1 A;  1MIX A;  4CHJ A;  3HW2 B;  4DBB A;  3HIE A;  2YSZ A;  4HB2 B;  4A6F B;  1ZYI A;  1J0W A;  1DDM A;  2QKM A;  4HAX B;  3KRX A;  1P6S A;  3AJ4 A;  3VIA A;  2GS0 A;  4HDQ A;  5C79 A;  1Y19 B;  2KGX B;  1K5D B;  4Z2N A;  1XX0 A;  2RUK B;  1WGQ A;  1EGX A;  3DCX A;  3HQC A;  3M1I B;  3AU5 A;  1NU2 A;  4WVF B;  4HDO A;  3U7D A;  5D27 A;  2OTX A;  1OQN A;  4C0A A;  2ELA A;  1J19 A;  5D3V A;  3IVF A;  2D10 A;  2D9V A;  2EJ8 A;  3CXB B;  4IOY X;  4EJN A;  2XQN M;  1KI1 B;  4GXB A;  1KZG A;  4ZRJ A;  5J3Y A;  1E5W A;  1FHW A;  3TFM A;  1PLS A;  1RRP B;  4GNK B;  2DX5 A;  1BWN A;  5DI9 B;  2HE7 A;  4Y94 A;  4K2O A;  1NTY A;  3PEG A;  3D8D A;  2Z0Q A;  2R09 A;  1BAK A;  5C6R A;  4D0N B;  3X23 A;  2E2X A;  4GZU A;  4WJ7 A;  5I2M A;  2FJU B;  2ELB A; 
#chains in the Genus database with same CATH homology
 2DTC A;  3U8Z A;  1TQZ A;  1QC6 A;  4B6H A;  4HAZ B;  3TCA A;  4F7H A;  2OQB A;  2COD A;  1M7R A;  4PQ0 A;  1U27 A;  1UPQ A;  3KSY A;  1PFJ A;  3KZ1 A;  2ROV A;  2EMT A;  3FM8 C;  5CLL B;  2I1K A;  2IFS A;  3PP2 A;  2N23 A;  1UPR A;  2COA A;  2CY5 A;  1DDV A;  2DHK A;  5HE0 A;  3ODO A;  4HB4 B;  4KAX B;  3P7Z A;  1UNQ A;  1SHC A;  2RLO A;  2Y8F A;  4KHB B;  5DHA B;  4HHV A;  1V88 A;  2D9X A;  2V76 A;  1W1G A;  2D2Q A;  1SGH A;  3WYF B;  1WI1 A;  2N0Y A;  5JHH A;  2UZS A;  3GYO A;  3ODW A;  4HB3 B;  1FGY A;  1GC7 A;  1XKE A;  2J0J A;  1MPH A;  5C5B B;  3ZVR A;  1EF1 A;  3G9W A;  2YT0 A;  1ZSQ A;  5D3Y A;  2DFK A;  3VOQ A;  3N7C A;  1K5G B;  1MK9 B;  2LYD A;  2W2W A;  5FI0 A;  4PNK A;  1WJ1 A;  2Y7B A;  2D11 A;  2VKI A;  4GMX B;  4KHA A;  5HE2 A;  1ZM0 A;  4HAU B;  2DYN A;  1FGZ A;  2YVC A;  4TYZ A;  4KHO A;  4XWX A;  2K2J A;  1U5D A;  2CRF A;  1W1D A;  1DYN A;  2R0D A;  3DXE A;  2HTH B;  1IRS A;  4A5K A;  4GMV A;  2UZR A;  1FB8 A;  4K2P A;  2GCJ A;  2J59 M;  1DRO A;  1AWE A;  2JP2 A;  5LOP B;  2RSG A;  4DX8 A;  1KZ7 A;  2J0K A;  2RNR B;  1X1F A;  4HAT B;  1U5G A;  3MDB C;  3KY9 A;  1M7E A;  3QBV B;  5GOW B;  1WVH A;  3FEH A;  2NZ8 B;  3PZD A;  3A98 B;  2ADZ A;  2UVM A;  3P6A A;  4HAW B;  3DXC A;  3SO6 A;  3ODX A;  4P7I A;  1LB1 A;  3SNH A;  4TKN A;  3ML4 A;  1P5T A;  1X05 A;  3MPX A;  1U5F A;  3UZT A;  5JLJ B;  2I5C A;  1W1H A;  2NMB A;  1XR0 B;  4ZRI A;  3OAN A;  5L81 A;  2H7E A;  4H8S A;  4IFS A;  2GCL A;  4IAP A;  2I1J A;  2KCJ A;  5J3Q A;  2M38 A;  2MKR A;  3NSU A;  1V61 A;  4DXA B;  5FI1 A;  1LW3 A;  1XCG A;  2AL6 A;  5KQ4 A;  1GG3 A;  2IYB A;  3O96 A;  3PVU A;  1Z87 A;  2DX1 A;  3WA0 A;  1DDW A;  2I5F A;  1FHO A;  3SV1 A;  2MWN B;  1WG7 A;  1X86 A;  1I7A A;  2DA0 A;  4WSF A;  2BCJ A;  3T06 A;  5EFX A;  2D9Y A;  2K2U A;  1MIZ B;  3F0W A;  5HE3 A;  1QQG A;  3PSC A;  2MFQ A;  2CY4 A;  3BJI A;  1MKE A;  2Z0P A;  4BBK A;  3AU4 A;  1V89 A;  3TW1 A;  3ULB A;  3ZDT A;  5DIF B;  2CAY A;  2ZPY A;  5LON B;  1NI2 A;  3PG7 A;  4KVG B;  2YF0 A;  3F5R A;  4NSW A;  1V5M A;  1ZC4 B;  2YT1 A;  1MK7 B;  1RJ2 A;  5J3T A;  2Y8G A;  3TO1 A;  2J0M A;  1Y5O A;  1I2H A;  2D9W A;  4HAV B;  1UNP A;  2P8V A;  2DKP A;  3CIK A;  4CHM A;  2K00 A;  2COF A;  3TVV A;  1N3H A;  4A6K A;  1V5U A;  1U2B A;  3V5W A;  3DXD A;  1U29 A;  2D4Q A;  2LOZ A;  3QIJ A;  1TJ6 A;  2YRY A;  2VRW B;  3LJU X;  3PVW A;  2W2X C;  1WGU A;  3A8P A;  5DH9 B;  2L2I A;  4CYE A;  2EC1 A;  1FAO A;  3ULC A;  2DKQ A;  4NY0 A;  5D3X A;  5KCV A;  4K81 A;  2EMS A;  2M14 A;  4F7U P;  2P0F A;  4ZRK A;  2Z0O A;  3HK0 A;  1H4R A;  3PVL A;  1FHX A;  2GJY A;  4K17 A;  2LOX A;  2LG1 A;  2RGN B;  1BTN A;  4MT7 A;  4DX9 0;  4HB0 B;  2DYQ A;  1V5P A;  1XD4 A;  2G35 A;  2RVB B;  1BTK A;  2DN6 A;  1UNR A;  3SUZ A;  4L6E A;  2ROZ B;  3SYX A;  1MAI A;  1ZC3 B;  3BIN A;  4HAY B;  1AQC A;  1DBH A;  2H7D A;  3A8Q A;  1WJM A;  2L1C A;  4EMO A;  1UEF A;  3KRW A;  4Z2M B;  1PMS A;  2P0H A;  2PZ1 A;  1P3R A;  2KUP A;  5C16 A;  1EVH A;  5JP4 A;  1ISN A;  5C5B A;  1X1G A;  1U5E A;  2LUL A;  5HE1 A;  4EKU A;  1Q67 A;  4MK0 A;  1X11 A;  2FJL A;  1B55 A;  1OY2 A;  4A6H A;  4F7G A;  2YS5 A;  3GYP A;  5JHG A;  1ZVR A;  2DHI A;  2DHJ A;  1NTV A;  1TXD A;  2QKL A;  1XOD A;  4GPT B;  4A6F A;  4YON A;  5KQ1 A;  2YS3 A;  2LKO A;  3D8E A;  3D8F A;  5CLQ B;  2W2X D;  1OMW A;  1FOE A;  2AEH A;  2YS1 A;  4YL8 A;  5D3W A;  3RCP A;  4MY6 A;  2COC A;  2X18 A;  5DHF B;  2D9Z A;  3QWM A;  2Q13 A;  1EAZ A;  2MDX A;  3FSS A;  1GC6 A;  2P0D A;  2VSZ A;  1H10 A;  2DLW A;  4GN1 A;  1MIX A;  4CHJ A;  3HW2 B;  4DBB A;  2YSZ A;  4HB2 B;  4A6F B;  1J0W A;  1DDM A;  2QKM A;  4HAX B;  3KRX A;  1P6S A;  3AJ4 A;  3VIA A;  2GS0 A;  4HDQ A;  5C79 A;  1Y19 B;  2KGX B;  1K5D B;  4Z2N A;  1XX0 A;  2RUK B;  1WGQ A;  1EGX A;  3HQC A;  3M1I B;  3AU5 A;  1NU2 A;  4WVF B;  4HDO A;  3U7D A;  5D27 A;  2OTX A;  1OQN A;  4C0A A;  2ELA A;  1J19 A;  5D3V A;  3IVF A;  2D10 A;  4IOY X;  2D9V A;  2EJ8 A;  3CXB B;  4EJN A;  2XQN M;  1KI1 B;  4GXB A;  1KZG A;  4ZRJ A;  5J3Y A;  1E5W A;  1FHW A;  3TFM A;  1PLS A;  1RRP B;  2DX5 A;  1BWN A;  5DI9 B;  2HE7 A;  4Y94 A;  4K2O A;  1NTY A;  3PEG A;  3D8D A;  2Z0Q A;  2R09 A;  1BAK A;  5C6R A;  4D0N B;  3X23 A;  2E2X A;  4GZU A;  4WJ7 A;  2ELB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...