4HHVA

Crystal structure of ceramide transfer protein pleckstrin homology domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
103
structure length
103
Chain Sequence
FSGPPVERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWIDAIEQHKTESGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid transport
molecule keywords Collagen type IV alpha-3-binding protein
publication title Crystal Structure of the Pleckstrin Homology Domain from the Ceramide Transfer Protein: Implications for Conformational Change upon Ligand Binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4hhvA00
1DDVA 1WI1A 4GMXB 2W2XC 4K17A 4IOYX 1Y5OA 2P0HA 2I1KA 2J0KA 2DKPA 2MKRA 3MPXA 1LB1A 1FOEA 1ZC4B 1V61A 4GXBA 1U5DA 2EMTA 4C0AA 1EAZA 1DYNA 3G9WA 1Z87A 5FI0A 5HE1A 1H10A 2AL6A 5DH9B 4MY6A 1SHCA 1XODA 4HAZB 1DBHA 4F7GA 2XQNM 4HAYB 2VKIA 2DHIA 1MAIA 1XD4A 3ULCA 3WA0A 4TKNA 2J0JA 2W2WA 1QQGA 1V5UA 2L1CA 2PZ1A 1M7RA 4NY0A 2EC1A 4B6HA 1ZSQA 1M7EA 2E2XA 4MK0A 2Q13A 4ZRJA 2UZSA 2G35A 2R09A 4A5KA 5J3TA 3KRXA 4A6FB 4K2OA 2H7DA 2RVBB 4GN1A 1BTKA 2DKQA 2YS5A 3PZDA 2M14A 2VSZA 2MFQA 3TO1A 2D9YA 2ELAA 4A6KA 4WJ7A 2DX5A 2Y7BA 5L81A 2J0MA 4A6HA 2GS0A 5EFXA 4MT7A 2ADZA 2DHJA 5J3QA 2DX1A 2YSZA 1RRPB 4EKUA 4IAPA 2COAA 1MKEA 2YS3A 3ODOA 1OQNA 3DXDA 3BJIA 1Y19B 3U8ZA 3KY9A 2CY5A 1MIXA 1DDWA 5D3WA 4IFSA 3PEGA 3T06A 4DXAB 2BCJA 4K81A 3PVUA 4EJNA 1GC6A 1P6SA 3TW1A 2ZPYA 3U7DA 2Y8GA 1W1HA 3QBVB 1LW3A 3ULBA 5JHHA 4HATB 1EF1A 2OQBA 4Y94A 1WJMA 4CHMA 5KQ4A 2D2QA 2K2UA 2RSGA 2M38A 4DX8A 3A8QA 4A6FA 1UPQA 4HB4B 3HK0A 1XKEA 2L2IA 2EJ8A 2DFKA 2N0YA 2ROZB 2LG1A 4CYEA 1X1FA 1FAOA 1XCGA 3IVFA 4HAWB 2DHKA 3X23A 2K2JA 2NMBA 4ZRIA 5HE0A 5J3YA 3V5WA 4HAXB 1SGHA 3GYOA 3TFMA 2RGNB 1ZVRA 1U2BA 2D11A 4YONA 3ODWA 2K00A 2OTXA 4EMOA 2COFA 5KQ1A 2RNRB 2D4QA 2DLWA 4KHBB 1QC6A 2W2XD 2R0DA 4HB2B 1GC7A 1MK9B 2GJYA 3QWMA 3CXBB 1MIZB 2J59M 2JP2A 1FHXA 4KVGB 3HQCA 3OANA 1NU2A 2D9ZA 2YT0A 5JP4A 4WVFB 4GPTB 4GZUA 1PMSA 3UZTA 1W1DA 2VRWB 1MPHA 2YVCA 3GYPA 4GMVA 2YF0A 1U29A 4L6EA 5DIFB 3D8DA 3A98B 5DHFB 2DTCA 3SUZA 3SV1A 3O96A 3KRWA 1UPRA 2KCJA 3M1IB 4KHAA 2LOXA 2Z0PA 1UEFA 5D3VA 1V89A 2V76A 1FGZA 5DI9B 1RJ2A 1K5GB 1XR0B 1WGQA 3SO6A 2COCA 2LYDA 5D3XA 1B55A 5HE2A 1UNPA 2P8VA 4BBKA 1MK7B 1X1GA 4H8SA 1XX0A 1AWEA 3QIJA 3PG7A 2CAYA 4HB3B 4PNKA 2P0DA 3AU4A 2KUPA 3SNHA 1U27A 5LOPB 3DXCA 5JLJB 5DHAB 2P0FA 1FHWA 4HDQA 2N23A 3D8EA 2I5FA 1NTVA 2HE7A 2Y8FA 1OMWA 4DBBA 1P5TA 2FJLA 2I1JA 1W1GA 5C16A 2RUKB 2IYBA 1WG7A 2EMSA 2CRFA 3BINA 1X86A 3P7ZA 1U5EA 2KGXB 3FSSA 2DYNA 1ZM0A 4CHJA 4F7HA 2YS1A 2HTHB 1BWNA 4Z2NA 1J0WA 2D10A 3P6AA 3N7CA 2DA0A 3WYFB 4Z2MB 1NI2A 3KZ1A 1V5PA 1IRSA 1TXDA 4XWXA 2D9XA 5D3YA 4HB0B 2D9VA 4DX90 1V5MA 4TYZA 1FB8A 1KZGA 1NTYA 3TVVA 1DDMA 1GG3A 3LJUX 4HHVA 3F5RA 4NSWA 1PLSA 1U5GA 2ROVA 1I7AA 3VIAA 3ZDTA 3AJ4A 5C5BB 2QKMA 1BAKA 3NSUA 1WGUA 3PP2A 2AEHA 2DYQA 2LULA 2MWNB 4HAVB 3SYXA 4ZRKA 1KI1B 1UNRA 4K2PA 1FGYA 1EGXA 5C6RA 3PSCA 2Z0QA 5HE3A 2LOZA 1AQCA 3KSYA 3PVLA 4PQ0A 1V88A 2NZ8B 3TCAA 1WJ1A 5CLQB 3RCPA 2H7EA 2MDXA 1KZ7A 2X18A 2YT1A 4P7IA 3VOQA 2UZRA 2GCJA 2QKLA 4F7UP 5KCVA 1OY2A 1I2HA 2RLOA 1X11A 1X05A 4YL8A 2LKOA 2YRYA 2ELBA 3AU5A 1U5FA 1H4RA 1K5DB 3ODXA 1Q67A 2I5CA 5LONB 1E5WA 3D8FA 2Z0OA 1DROA 3MDBC 5JHGA 1UNQA 5C79A 1WVHA 4KHOA 3F0WA 5D27A 1J19A 1EVHA 1FHOA 3A8PA 5C5BA 1TJ6A 4HAUB 5GOWB 3PVWA 2DN6A 1BTNA 1TQZA 3ZVRA 3ML4A 3FM8C 4WSFA 1ISNA 2UVMA 5FI1A 2CY4A 3FEHA 1P3RA 2D9WA 5CLLB 3HW2B 1ZC3B 3DXEA 2GCLA 1N3HA 2CODA 2IFSA 4HDOA 4KAXB 4D0NB 3CIKA 1PFJA
chains in the Genus database with same CATH superfamily
1DDVA 1WI1A 4GMXB 2W2XC 4K17A 4IOYX 1Y5OA 2P0HA 2I1KA 2J0KA 2DKPA 2MKRA 3MPXA 1LB1A 1FOEA 1ZC4B 1V61A 4GXBA 1U5DA 2EMTA 4C0AA 1EAZA 1DYNA 3G9WA 1Z87A 5FI0A 5HE1A 1H10A 2AL6A 5DH9B 4MY6A 1SHCA 1XODA 4HAZB 1DBHA 4F7GA 2XQNM 4HAYB 2VKIA 2DHIA 1MAIA 1XD4A 3ULCA 2Z14A 3WA0A 4TKNA 2J0JA 2W2WA 1QQGA 1V5UA 2L1CA 2PZ1A 1M7RA 4NY0A 5I2MA 2KIGA 2EC1A 4B6HA 1ZSQA 1M7EA 1T77A 2E2XA 4MK0A 2Q13A 4ZRJA 2UZSA 2G35A 2R09A 4A5KA 5J3TA 3KRXA 4A6FB 4K2OA 2H7DA 2RVBB 4GN1A 1BTKA 2DKQA 2KR0A 2YS5A 3PZDA 2M14A 2VSZA 2MFQA 3TO1A 2D9YA 2ELAA 4A6KA 4WJ7A 2DX5A 2Y7BA 5L81A 2J0MA 4A6HA 2GS0A 5EFXA 4MT7A 2ADZA 2DHJA 5J3QA 2DX1A 2YSZA 1RRPB 4EKUA 4IAPA 2COAA 1MKEA 2YS3A 3ODOA 1OQNA 3DXDA 3BJIA 1Y19B 3U8ZA 3KY9A 2CY5A 1MIXA 1DDWA 5D3WA 4IFSA 3FVCA 3PEGA 3T06A 4DXAB 2BCJA 4K81A 3PVUA 4EJNA 1GC6A 1P6SA 3TW1A 2ZPYA 3U7DA 2Y8GA 1W1HA 3QBVB 1LW3A 3ULBA 5JHHA 4HATB 1EF1A 2OQBA 4Y94A 1WJMA 4CHMA 4OSNA 5KQ4A 2D2QA 2K2UA 3DCXA 2RSGA 2M38A 5I2SA 4DX8A 3A8QA 4A6FA 1UPQA 4HB4B 3HK0A 1XKEA 2L2IA 2EJ8A 2DFKA 2N0YA 2ROZB 2LG1A 4CYEA 1X1FA 1FAOA 1XCGA 3IVFA 4HAWB 2DHKA 3X23A 2K2JA 2NMBA 4ZRIA 5HE0A 5J3YA 3V5WA 4HAXB 1SGHA 3GYOA 4DIXA 3TFMA 2RGNB 1ZVRA 1U2BA 2D11A 4YONA 3ODWA 2K00A 2OTXA 4EMOA 2COFA 5KQ1A 2FJUB 2RNRB 2D4QA 2DLWA 4KHBB 1QC6A 2W2XD 2R0DA 4HB2B 1GC7A 1MK9B 2GJYA 3QWMA 3CXBB 4CSQA 1MIZB 2J59M 2JP2A 1FHXA 4KVGB 2K8EA 3HQCA 3OANA 4L1RA 4QJ5B 1NU2A 2D9ZA 2YT0A 5JP4A 4WVFB 4GPTB 4GZUA 1PMSA 2Z13A 3A58A 3UZTA 1W1DA 2VRWB 1MPHA 2YVCA 3GYPA 4GMVA 2YF0A 1U29A 4L6EA 5DIFB 3D8DA 3A98B 5DHFB 2DTCA 3SUZA 3SV1A 3O96A 3KRWA 1UPRA 2KCJA 3M1IB 4KHAA 2LOXA 2Z0PA 1UEFA 5D3VA 1V89A 2V76A 1FGZA 5DI9B 1RJ2A 1K5GB 1XR0B 1WGQA 3SO6A 2COCA 2LYDA 5D3XA 1B55A 5HE2A 2ZKMX 5M4YB 2KIEA 1UNPA 2P8VA 4BBKA 1MK7B 1X1GA 4H8SA 2RRFA 1XX0A 1AWEA 5IRSA 3QIJA 3PG7A 2CAYA 4HB3B 4PNKA 2P0DA 2R2YA 3AU4A 2KUPA 3SNHA 1U27A 4KHBA 5LOPB 3DXCA 5JLJB 5DHAB 2P0FA 1FHWA 4HDQA 2N23A 3D8EA 3U12A 2I5FA 1NTVA 2HE7A 2Y8FA 3NWDA 1OMWA 4DBBA 1P5TA 2FJLA 2I1JA 1MI1A 2NBVA 1W1GA 5C16A 2RUKB 2IYBA 1WG7A 2EMSA 2CRFA 3BINA 3HIEA 1X86A 3P7ZA 1U5EA 2KGXB 3FSSA 2DYNA 1ZM0A 4CHJA 4F7HA 2YS1A 2HTHB 1BWNA 4Z2NA 1J0WA 2D10A 3P6AA 3N7CA 2DA0A 3WYFB 4Z2MB 1NI2A 3KZ1A 1V5PA 1IRSA 1TXDA 4HSIA 4XWXA 2D9XA 2GUMA 5D3YA 4HB0B 2D9VA 4DX90 1V5MA 4TYZA 3OHMB 1FB8A 1KZGA 1NTYA 3TVVA 1DDMA 1GG3A 3LJUX 4HHVA 3F5RA 4OT1A 4NSWA 4GNKB 1PLSA 2Z4DA 1U5GA 2ROVA 1I7AA 3VIAA 3ZDTA 3AJ4A 5C5BB 2QKMA 1BAKA 3NSUA 1WGUA 3PP2A 3NW8A 2AEHA 2DYQA 2LULA 2MWNB 4HAVB 3SYXA 4ZRKA 1KI1B 4GOUA 1UNRA 4K2PA 1FGYA 1EGXA 5C6RA 3PSCA 2Z0QA 5HE3A 2Z59A 2LOZA 1AQCA 1ZYIA 3KSYA 3PVLA 4PQ0A 1V88A 2NZ8B 3TCAA 1WJ1A 5CLQB 3RCPA 2H7EA 2MDXA 1KZ7A 2X18A 2YT1A 4P7IA 3VOQA 2UZRA 4QJ4B 2GCJA 2QKLA 4F7UP 5KCVA 1OY2A 1I2HA 2RLOA 1X11A 1X05A 4YL8A 2LKOA 3HSAA 3NWFA 2YRYA 2ELBA 3NWAA 3AU5A 4QJ3B 1U5FA 1H4RA 1K5DB 3ODXA 5LG4B 1Q67A 2I5CA 5LONB 1E5WA 3D8FA 2Z0OA 1DROA 2K49A 3MDBC 5JHGA 3B77A 1UNQA 5C79A 1WVHA 4KHOA 3F0WA 5D27A 1J19A 1EVHA 1FHOA 3A8PA 5C5BA 1TJ6A 4HAUB 5GOWB 3PVWA 2DN6A 4D6WA 1BTNA 1TQZA 3ZVRA 3ML4A 3FM8C 4WSFA 1ISNA 2UVMA 5FI1A 2YT2A 2CY4A 3FEHA 1P3RA 2D9WA 5CLLB 3HW2B 1ZC3B 3DXEA 2GCLA 1N3HA 2CODA 2IFSA 4QXAB 4HDOA 2KUQA 4KAXB 4D0NB 3CIKA 1PFJA
chains in the Genus database with same CATH topology
1DDVA 1WI1A 4GMXB 2W2XC 4K17A 4IOYX 1Y5OA 2P0HA 2I1KA 2J0KA 2DKPA 2MKRA 3MPXA 1LB1A 1FOEA 1ZC4B 1V61A 4GXBA 1U5DA 2EMTA 4C0AA 1EAZA 1DYNA 3G9WA 1Z87A 5FI0A 5HE1A 1H10A 2AL6A 5DH9B 4MY6A 1SHCA 1XODA 4HAZB 1DBHA 4F7GA 2XQNM 4HAYB 2VKIA 2DHIA 1MAIA 1XD4A 3ULCA 3WA0A 4TKNA 2J0JA 2W2WA 1QQGA 1V5UA 2L1CA 2PZ1A 1M7RA 4NY0A 2EC1A 4B6HA 1ZSQA 1M7EA 2E2XA 4MK0A 2Q13A 4ZRJA 2UZSA 2G35A 2R09A 4A5KA 5J3TA 3KRXA 4A6FB 4K2OA 2H7DA 2RVBB 4GN1A 1BTKA 2DKQA 2YS5A 3PZDA 2M14A 2VSZA 2MFQA 3TO1A 2D9YA 2ELAA 4A6KA 4WJ7A 2DX5A 2Y7BA 5L81A 2J0MA 4A6HA 2GS0A 5EFXA 4MT7A 2ADZA 2DHJA 5J3QA 2DX1A 2YSZA 1RRPB 4EKUA 4IAPA 2COAA 1MKEA 2YS3A 3ODOA 1OQNA 3DXDA 3BJIA 1Y19B 3U8ZA 3KY9A 2CY5A 1MIXA 1DDWA 5D3WA 4IFSA 3PEGA 3T06A 4DXAB 2BCJA 4K81A 3PVUA 4EJNA 1GC6A 1P6SA 3TW1A 2ZPYA 3U7DA 2Y8GA 1W1HA 3QBVB 1LW3A 3ULBA 5JHHA 4HATB 1EF1A 2OQBA 4Y94A 1WJMA 4CHMA 5KQ4A 2D2QA 2K2UA 2RSGA 2M38A 4DX8A 3A8QA 4A6FA 1UPQA 4HB4B 3HK0A 1XKEA 2L2IA 2EJ8A 2DFKA 2N0YA 2ROZB 2LG1A 4CYEA 1X1FA 1FAOA 1XCGA 3IVFA 4HAWB 2DHKA 3X23A 2K2JA 2NMBA 4ZRIA 5HE0A 5J3YA 3V5WA 4HAXB 1SGHA 3GYOA 3TFMA 2RGNB 1ZVRA 1U2BA 2D11A 4YONA 3ODWA 2K00A 2OTXA 4EMOA 2COFA 5KQ1A 2RNRB 2D4QA 2DLWA 4KHBB 1QC6A 2W2XD 2R0DA 4HB2B 1GC7A 1MK9B 2GJYA 3QWMA 3CXBB 1MIZB 2J59M 2JP2A 1FHXA 4KVGB 3HQCA 3OANA 1NU2A 2D9ZA 2YT0A 5JP4A 4WVFB 4GPTB 4GZUA 1PMSA 3UZTA 1W1DA 2VRWB 1MPHA 2YVCA 3GYPA 4GMVA 2YF0A 1U29A 4L6EA 5DIFB 3D8DA 3A98B 5DHFB 2DTCA 3SUZA 3SV1A 3O96A 3KRWA 1UPRA 2KCJA 3M1IB 4KHAA 2LOXA 2Z0PA 1UEFA 5D3VA 1V89A 2V76A 1FGZA 5DI9B 1RJ2A 1K5GB 1XR0B 1WGQA 3SO6A 2COCA 2LYDA 5D3XA 1B55A 5HE2A 1UNPA 2P8VA 4BBKA 1MK7B 1X1GA 4H8SA 1XX0A 1AWEA 3QIJA 3PG7A 2CAYA 4HB3B 4PNKA 2P0DA 3AU4A 2KUPA 3SNHA 1U27A 5LOPB 3DXCA 5JLJB 5DHAB 2P0FA 1FHWA 4HDQA 2N23A 3D8EA 2I5FA 1NTVA 2HE7A 2Y8FA 1OMWA 4DBBA 1P5TA 2FJLA 2I1JA 1W1GA 5C16A 2RUKB 2IYBA 1WG7A 2EMSA 2CRFA 3BINA 1X86A 3P7ZA 1U5EA 2KGXB 3FSSA 2DYNA 1ZM0A 4CHJA 4F7HA 2YS1A 2HTHB 1BWNA 4Z2NA 1J0WA 2D10A 3P6AA 3N7CA 2DA0A 3WYFB 4Z2MB 1NI2A 3KZ1A 1V5PA 1IRSA 1TXDA 4XWXA 2D9XA 5D3YA 4HB0B 2D9VA 4DX90 1V5MA 4TYZA 1FB8A 1KZGA 1NTYA 3TVVA 1DDMA 1GG3A 3LJUX 4HHVA 3F5RA 4NSWA 1PLSA 1U5GA 2ROVA 1I7AA 3VIAA 3ZDTA 3AJ4A 5C5BB 2QKMA 1BAKA 3NSUA 1WGUA 3PP2A 2AEHA 2DYQA 2LULA 2MWNB 4HAVB 3SYXA 4ZRKA 1KI1B 1UNRA 4K2PA 1FGYA 1EGXA 5C6RA 3PSCA 2Z0QA 5HE3A 2LOZA 1AQCA 3KSYA 3PVLA 4PQ0A 1V88A 2NZ8B 3TCAA 1WJ1A 5CLQB 3RCPA 2H7EA 2MDXA 1KZ7A 2X18A 2YT1A 4P7IA 3VOQA 2UZRA 2GCJA 2QKLA 4F7UP 5KCVA 1OY2A 1I2HA 2RLOA 1X11A 1X05A 4YL8A 2LKOA 2YRYA 2ELBA 3AU5A 1U5FA 1H4RA 1K5DB 3ODXA 1Q67A 2I5CA 5LONB 1E5WA 3D8FA 2Z0OA 1DROA 3MDBC 5JHGA 1UNQA 5C79A 1WVHA 4KHOA 3F0WA 5D27A 1J19A 1EVHA 1FHOA 3A8PA 5C5BA 1TJ6A 4HAUB 5GOWB 3PVWA 2DN6A 1BTNA 1TQZA 3ZVRA 3ML4A 3FM8C 4WSFA 1ISNA 2UVMA 5FI1A 2CY4A 3FEHA 1P3RA 2D9WA 5CLLB 3HW2B 1ZC3B 3DXEA 2GCLA 1N3HA 2CODA 2IFSA 4HDOA 4KAXB 4D0NB 3CIKA 1PFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DDV A;  1WI1 A;  4GMX B;  2W2X C;  4K17 A;  4IOY X;  1Y5O A;  2P0H A;  2I1K A;  2J0K A;  2DKP A;  2MKR A;  3MPX A;  1LB1 A;  1FOE A;  1ZC4 B;  1V61 A;  4GXB A;  1U5D A;  2EMT A;  4C0A A;  1EAZ A;  1DYN A;  3G9W A;  1Z87 A;  5FI0 A;  5HE1 A;  1H10 A;  2AL6 A;  5DH9 B;  4MY6 A;  1SHC A;  1XOD A;  4HAZ B;  1DBH A;  4F7G A;  2XQN M;  4HAY B;  2VKI A;  2DHI A;  1MAI A;  1XD4 A;  3ULC A;  3WA0 A;  4TKN A;  2J0J A;  2W2W A;  1QQG A;  1V5U A;  2L1C A;  2PZ1 A;  1M7R A;  4NY0 A;  2EC1 A;  4B6H A;  1ZSQ A;  1M7E A;  2E2X A;  4MK0 A;  2Q13 A;  4ZRJ A;  2UZS A;  2G35 A;  2R09 A;  4A5K A;  5J3T A;  3KRX A;  4A6F B;  4K2O A;  2H7D A;  2RVB B;  4GN1 A;  1BTK A;  2DKQ A;  2YS5 A;  3PZD A;  2M14 A;  2VSZ A;  2MFQ A;  3TO1 A;  2D9Y A;  2ELA A;  4A6K A;  4WJ7 A;  2DX5 A;  2Y7B A;  5L81 A;  2J0M A;  4A6H A;  2GS0 A;  5EFX A;  4MT7 A;  2ADZ A;  2DHJ A;  5J3Q A;  2DX1 A;  2YSZ A;  1RRP B;  4EKU A;  4IAP A;  2COA A;  1MKE A;  2YS3 A;  3ODO A;  1OQN A;  3DXD A;  3BJI A;  1Y19 B;  3U8Z A;  3KY9 A;  2CY5 A;  1MIX A;  1DDW A;  5D3W A;  4IFS A;  3PEG A;  3T06 A;  4DXA B;  2BCJ A;  4K81 A;  3PVU A;  4EJN A;  1GC6 A;  1P6S A;  3TW1 A;  2ZPY A;  3U7D A;  2Y8G A;  1W1H A;  3QBV B;  1LW3 A;  3ULB A;  5JHH A;  4HAT B;  1EF1 A;  2OQB A;  4Y94 A;  1WJM A;  4CHM A;  5KQ4 A;  2D2Q A;  2K2U A;  2RSG A;  2M38 A;  4DX8 A;  3A8Q A;  4A6F A;  1UPQ A;  4HB4 B;  3HK0 A;  1XKE A;  2L2I A;  2EJ8 A;  2DFK A;  2N0Y A;  2ROZ B;  2LG1 A;  4CYE A;  1X1F A;  1FAO A;  1XCG A;  3IVF A;  4HAW B;  2DHK A;  3X23 A;  2K2J A;  2NMB A;  4ZRI A;  5HE0 A;  5J3Y A;  3V5W A;  4HAX B;  1SGH A;  3GYO A;  3TFM A;  2RGN B;  1ZVR A;  1U2B A;  2D11 A;  4YON A;  3ODW A;  2K00 A;  2OTX A;  4EMO A;  2COF A;  5KQ1 A;  2RNR B;  2D4Q A;  2DLW A;  4KHB B;  1QC6 A;  2W2X D;  2R0D A;  4HB2 B;  1GC7 A;  1MK9 B;  2GJY A;  3QWM A;  3CXB B;  1MIZ B;  2J59 M;  2JP2 A;  1FHX A;  4KVG B;  3HQC A;  3OAN A;  1NU2 A;  2D9Z A;  2YT0 A;  5JP4 A;  4WVF B;  4GPT B;  4GZU A;  1PMS A;  3UZT A;  1W1D A;  2VRW B;  1MPH A;  2YVC A;  3GYP A;  4GMV A;  2YF0 A;  1U29 A;  4L6E A;  5DIF B;  3D8D A;  3A98 B;  5DHF B;  2DTC A;  3SUZ A;  3SV1 A;  3O96 A;  3KRW A;  1UPR A;  2KCJ A;  3M1I B;  4KHA A;  2LOX A;  2Z0P A;  1UEF A;  5D3V A;  1V89 A;  2V76 A;  1FGZ A;  5DI9 B;  1RJ2 A;  1K5G B;  1XR0 B;  1WGQ A;  3SO6 A;  2COC A;  2LYD A;  5D3X A;  1B55 A;  5HE2 A;  1UNP A;  2P8V A;  4BBK A;  1MK7 B;  1X1G A;  4H8S A;  1XX0 A;  1AWE A;  3QIJ A;  3PG7 A;  2CAY A;  4HB3 B;  4PNK A;  2P0D A;  3AU4 A;  2KUP A;  3SNH A;  1U27 A;  5LOP B;  3DXC A;  5JLJ B;  5DHA B;  2P0F A;  1FHW A;  4HDQ A;  2N23 A;  3D8E A;  2I5F A;  1NTV A;  2HE7 A;  2Y8F A;  1OMW A;  4DBB A;  1P5T A;  2FJL A;  2I1J A;  1W1G A;  5C16 A;  2RUK B;  2IYB A;  1WG7 A;  2EMS A;  2CRF A;  3BIN A;  1X86 A;  3P7Z A;  1U5E A;  2KGX B;  3FSS A;  2DYN A;  1ZM0 A;  4CHJ A;  4F7H A;  2YS1 A;  2HTH B;  1BWN A;  4Z2N A;  1J0W A;  2D10 A;  3P6A A;  3N7C A;  2DA0 A;  3WYF B;  4Z2M B;  1NI2 A;  3KZ1 A;  1V5P A;  1IRS A;  1TXD A;  4XWX A;  2D9X A;  5D3Y A;  4HB0 B;  2D9V A;  4DX9 0;  1V5M A;  4TYZ A;  1FB8 A;  1KZG A;  1NTY A;  3TVV A;  1DDM A;  1GG3 A;  3LJU X;  4HHV A;  3F5R A;  4NSW A;  1PLS A;  1U5G A;  2ROV A;  1I7A A;  3VIA A;  3ZDT A;  3AJ4 A;  5C5B B;  2QKM A;  1BAK A;  3NSU A;  1WGU A;  3PP2 A;  2AEH A;  2DYQ A;  2LUL A;  2MWN B;  4HAV B;  3SYX A;  4ZRK A;  1KI1 B;  1UNR A;  4K2P A;  1FGY A;  1EGX A;  5C6R A;  3PSC A;  2Z0Q A;  5HE3 A;  2LOZ A;  1AQC A;  3KSY A;  3PVL A;  4PQ0 A;  1V88 A;  2NZ8 B;  3TCA A;  1WJ1 A;  5CLQ B;  3RCP A;  2H7E A;  2MDX A;  1KZ7 A;  2X18 A;  2YT1 A;  4P7I A;  3VOQ A;  2UZR A;  2GCJ A;  2QKL A;  4F7U P;  5KCV A;  1OY2 A;  1I2H A;  2RLO A;  1X11 A;  1X05 A;  4YL8 A;  2LKO A;  2YRY A;  2ELB A;  3AU5 A;  1U5F A;  1H4R A;  1K5D B;  3ODX A;  1Q67 A;  2I5C A;  5LON B;  1E5W A;  3D8F A;  2Z0O A;  1DRO A;  3MDB C;  5JHG A;  1UNQ A;  5C79 A;  1WVH A;  4KHO A;  3F0W A;  5D27 A;  1J19 A;  1EVH A;  1FHO A;  3A8P A;  5C5B A;  1TJ6 A;  4HAU B;  5GOW B;  3PVW A;  2DN6 A;  1BTN A;  1TQZ A;  3ZVR A;  3ML4 A;  3FM8 C;  4WSF A;  1ISN A;  2UVM A;  5FI1 A;  2CY4 A;  3FEH A;  1P3R A;  2D9W A;  5CLL B;  3HW2 B;  1ZC3 B;  3DXE A;  2GCL A;  1N3H A;  2COD A;  2IFS A;  4HDO A;  4KAX B;  4D0N B;  3CIK A;  1PFJ A; 
#chains in the Genus database with same CATH topology
 1DDV A;  1WI1 A;  4GMX B;  2W2X C;  4K17 A;  4IOY X;  1Y5O A;  2P0H A;  2I1K A;  2J0K A;  2DKP A;  2MKR A;  3MPX A;  1LB1 A;  1FOE A;  1ZC4 B;  1V61 A;  4GXB A;  1U5D A;  2EMT A;  4C0A A;  1EAZ A;  1DYN A;  3G9W A;  1Z87 A;  5FI0 A;  5HE1 A;  1H10 A;  2AL6 A;  5DH9 B;  4MY6 A;  1SHC A;  1XOD A;  4HAZ B;  1DBH A;  4F7G A;  2XQN M;  4HAY B;  2VKI A;  2DHI A;  1MAI A;  1XD4 A;  3ULC A;  2Z14 A;  3WA0 A;  4TKN A;  2J0J A;  2W2W A;  1QQG A;  1V5U A;  2L1C A;  2PZ1 A;  1M7R A;  4NY0 A;  5I2M A;  2KIG A;  2EC1 A;  4B6H A;  1ZSQ A;  1M7E A;  1T77 A;  2E2X A;  4MK0 A;  2Q13 A;  4ZRJ A;  2UZS A;  2G35 A;  2R09 A;  4A5K A;  5J3T A;  3KRX A;  4A6F B;  4K2O A;  2H7D A;  2RVB B;  4GN1 A;  1BTK A;  2DKQ A;  2KR0 A;  2YS5 A;  3PZD A;  2M14 A;  2VSZ A;  2MFQ A;  3TO1 A;  2D9Y A;  2ELA A;  4A6K A;  4WJ7 A;  2DX5 A;  2Y7B A;  5L81 A;  2J0M A;  4A6H A;  2GS0 A;  5EFX A;  4MT7 A;  2ADZ A;  2DHJ A;  5J3Q A;  2DX1 A;  2YSZ A;  1RRP B;  4EKU A;  4IAP A;  2COA A;  1MKE A;  2YS3 A;  3ODO A;  1OQN A;  3DXD A;  3BJI A;  1Y19 B;  3U8Z A;  3KY9 A;  2CY5 A;  1MIX A;  1DDW A;  5D3W A;  4IFS A;  3FVC A;  3PEG A;  3T06 A;  4DXA B;  2BCJ A;  4K81 A;  3PVU A;  4EJN A;  1GC6 A;  1P6S A;  3TW1 A;  2ZPY A;  3U7D A;  2Y8G A;  1W1H A;  3QBV B;  1LW3 A;  3ULB A;  5JHH A;  4HAT B;  1EF1 A;  2OQB A;  4Y94 A;  1WJM A;  4CHM A;  4OSN A;  5KQ4 A;  2D2Q A;  2K2U A;  3DCX A;  2RSG A;  2M38 A;  5I2S A;  4DX8 A;  3A8Q A;  4A6F A;  1UPQ A;  4HB4 B;  3HK0 A;  1XKE A;  2L2I A;  2EJ8 A;  2DFK A;  2N0Y A;  2ROZ B;  2LG1 A;  4CYE A;  1X1F A;  1FAO A;  1XCG A;  3IVF A;  4HAW B;  2DHK A;  3X23 A;  2K2J A;  2NMB A;  4ZRI A;  5HE0 A;  5J3Y A;  3V5W A;  4HAX B;  1SGH A;  3GYO A;  4DIX A;  3TFM A;  2RGN B;  1ZVR A;  1U2B A;  2D11 A;  4YON A;  3ODW A;  2K00 A;  2OTX A;  4EMO A;  2COF A;  5KQ1 A;  2FJU B;  2RNR B;  2D4Q A;  2DLW A;  4KHB B;  1QC6 A;  2W2X D;  2R0D A;  4HB2 B;  1GC7 A;  1MK9 B;  2GJY A;  3QWM A;  3CXB B;  4CSQ A;  1MIZ B;  2J59 M;  2JP2 A;  1FHX A;  4KVG B;  2K8E A;  3HQC A;  3OAN A;  4L1R A;  4QJ5 B;  1NU2 A;  2D9Z A;  2YT0 A;  5JP4 A;  4WVF B;  4GPT B;  4GZU A;  1PMS A;  2Z13 A;  3A58 A;  3UZT A;  1W1D A;  2VRW B;  1MPH A;  2YVC A;  3GYP A;  4GMV A;  2YF0 A;  1U29 A;  4L6E A;  5DIF B;  3D8D A;  3A98 B;  5DHF B;  2DTC A;  3SUZ A;  3SV1 A;  3O96 A;  3KRW A;  1UPR A;  2KCJ A;  3M1I B;  4KHA A;  2LOX A;  2Z0P A;  1UEF A;  5D3V A;  1V89 A;  2V76 A;  1FGZ A;  5DI9 B;  1RJ2 A;  1K5G B;  1XR0 B;  1WGQ A;  3SO6 A;  2COC A;  2LYD A;  5D3X A;  1B55 A;  5HE2 A;  2ZKM X;  5M4Y B;  2KIE A;  1UNP A;  2P8V A;  4BBK A;  1MK7 B;  1X1G A;  4H8S A;  2RRF A;  1XX0 A;  1AWE A;  5IRS A;  3QIJ A;  3PG7 A;  2CAY A;  4HB3 B;  4PNK A;  2P0D A;  2R2Y A;  3AU4 A;  2KUP A;  3SNH A;  1U27 A;  4KHB A;  5LOP B;  3DXC A;  5JLJ B;  5DHA B;  2P0F A;  1FHW A;  4HDQ A;  2N23 A;  3D8E A;  3U12 A;  2I5F A;  1NTV A;  2HE7 A;  2Y8F A;  3NWD A;  1OMW A;  4DBB A;  1P5T A;  2FJL A;  2I1J A;  1MI1 A;  2NBV A;  1W1G A;  5C16 A;  2RUK B;  2IYB A;  1WG7 A;  2EMS A;  2CRF A;  3BIN A;  3HIE A;  1X86 A;  3P7Z A;  1U5E A;  2KGX B;  3FSS A;  2DYN A;  1ZM0 A;  4CHJ A;  4F7H A;  2YS1 A;  2HTH B;  1BWN A;  4Z2N A;  1J0W A;  2D10 A;  3P6A A;  3N7C A;  2DA0 A;  3WYF B;  4Z2M B;  1NI2 A;  3KZ1 A;  1V5P A;  1IRS A;  1TXD A;  4HSI A;  4XWX A;  2D9X A;  2GUM A;  5D3Y A;  4HB0 B;  2D9V A;  4DX9 0;  1V5M A;  4TYZ A;  3OHM B;  1FB8 A;  1KZG A;  1NTY A;  3TVV A;  1DDM A;  1GG3 A;  3LJU X;  4HHV A;  3F5R A;  4OT1 A;  4NSW A;  4GNK B;  1PLS A;  2Z4D A;  1U5G A;  2ROV A;  1I7A A;  3VIA A;  3ZDT A;  3AJ4 A;  5C5B B;  2QKM A;  1BAK A;  3NSU A;  1WGU A;  3PP2 A;  3NW8 A;  2AEH A;  2DYQ A;  2LUL A;  2MWN B;  4HAV B;  3SYX A;  4ZRK A;  1KI1 B;  4GOU A;  1UNR A;  4K2P A;  1FGY A;  1EGX A;  5C6R A;  3PSC A;  2Z0Q A;  5HE3 A;  2Z59 A;  2LOZ A;  1AQC A;  1ZYI A;  3KSY A;  3PVL A;  4PQ0 A;  1V88 A;  2NZ8 B;  3TCA A;  1WJ1 A;  5CLQ B;  3RCP A;  2H7E A;  2MDX A;  1KZ7 A;  2X18 A;  2YT1 A;  4P7I A;  3VOQ A;  2UZR A;  4QJ4 B;  2GCJ A;  2QKL A;  4F7U P;  5KCV A;  1OY2 A;  1I2H A;  2RLO A;  1X11 A;  1X05 A;  4YL8 A;  2LKO A;  3HSA A;  3NWF A;  2YRY A;  2ELB A;  3NWA A;  3AU5 A;  4QJ3 B;  1U5F A;  1H4R A;  1K5D B;  3ODX A;  5LG4 B;  1Q67 A;  2I5C A;  5LON B;  1E5W A;  3D8F A;  2Z0O A;  1DRO A;  2K49 A;  3MDB C;  5JHG A;  3B77 A;  1UNQ A;  5C79 A;  1WVH A;  4KHO A;  3F0W A;  5D27 A;  1J19 A;  1EVH A;  1FHO A;  3A8P A;  5C5B A;  1TJ6 A;  4HAU B;  5GOW B;  3PVW A;  2DN6 A;  4D6W A;  1BTN A;  1TQZ A;  3ZVR A;  3ML4 A;  3FM8 C;  4WSF A;  1ISN A;  2UVM A;  5FI1 A;  2YT2 A;  2CY4 A;  3FEH A;  1P3R A;  2D9W A;  5CLL B;  3HW2 B;  1ZC3 B;  3DXE A;  2GCL A;  1N3H A;  2COD A;  2IFS A;  4QXA B;  4HDO A;  2KUQ A;  4KAX B;  4D0N B;  3CIK A;  1PFJ A; 
#chains in the Genus database with same CATH homology
 1DDV A;  1WI1 A;  4GMX B;  2W2X C;  4K17 A;  4IOY X;  1Y5O A;  2P0H A;  2I1K A;  2J0K A;  2DKP A;  2MKR A;  3MPX A;  1LB1 A;  1FOE A;  1ZC4 B;  1V61 A;  4GXB A;  1U5D A;  2EMT A;  4C0A A;  1EAZ A;  1DYN A;  3G9W A;  1Z87 A;  5FI0 A;  5HE1 A;  1H10 A;  2AL6 A;  5DH9 B;  4MY6 A;  1SHC A;  1XOD A;  4HAZ B;  1DBH A;  4F7G A;  2XQN M;  4HAY B;  2VKI A;  2DHI A;  1MAI A;  1XD4 A;  3ULC A;  3WA0 A;  4TKN A;  2J0J A;  2W2W A;  1QQG A;  1V5U A;  2L1C A;  2PZ1 A;  1M7R A;  4NY0 A;  2EC1 A;  4B6H A;  1ZSQ A;  1M7E A;  2E2X A;  4MK0 A;  2Q13 A;  4ZRJ A;  2UZS A;  2G35 A;  2R09 A;  4A5K A;  5J3T A;  3KRX A;  4A6F B;  4K2O A;  2H7D A;  2RVB B;  4GN1 A;  1BTK A;  2DKQ A;  2YS5 A;  3PZD A;  2M14 A;  2VSZ A;  2MFQ A;  3TO1 A;  2D9Y A;  2ELA A;  4A6K A;  4WJ7 A;  2DX5 A;  2Y7B A;  5L81 A;  2J0M A;  4A6H A;  2GS0 A;  5EFX A;  4MT7 A;  2ADZ A;  2DHJ A;  5J3Q A;  2DX1 A;  2YSZ A;  1RRP B;  4EKU A;  4IAP A;  2COA A;  1MKE A;  2YS3 A;  3ODO A;  1OQN A;  3DXD A;  3BJI A;  1Y19 B;  3U8Z A;  3KY9 A;  2CY5 A;  1MIX A;  1DDW A;  5D3W A;  4IFS A;  3PEG A;  3T06 A;  4DXA B;  2BCJ A;  4K81 A;  3PVU A;  4EJN A;  1GC6 A;  1P6S A;  3TW1 A;  2ZPY A;  3U7D A;  2Y8G A;  1W1H A;  3QBV B;  1LW3 A;  3ULB A;  5JHH A;  4HAT B;  1EF1 A;  2OQB A;  4Y94 A;  1WJM A;  4CHM A;  5KQ4 A;  2D2Q A;  2K2U A;  2RSG A;  2M38 A;  4DX8 A;  3A8Q A;  4A6F A;  1UPQ A;  4HB4 B;  3HK0 A;  1XKE A;  2L2I A;  2EJ8 A;  2DFK A;  2N0Y A;  2ROZ B;  2LG1 A;  4CYE A;  1X1F A;  1FAO A;  1XCG A;  3IVF A;  4HAW B;  2DHK A;  3X23 A;  2K2J A;  2NMB A;  4ZRI A;  5HE0 A;  5J3Y A;  3V5W A;  4HAX B;  1SGH A;  3GYO A;  3TFM A;  2RGN B;  1ZVR A;  1U2B A;  2D11 A;  4YON A;  3ODW A;  2K00 A;  2OTX A;  4EMO A;  2COF A;  5KQ1 A;  2RNR B;  2D4Q A;  2DLW A;  4KHB B;  1QC6 A;  2W2X D;  2R0D A;  4HB2 B;  1GC7 A;  1MK9 B;  2GJY A;  3QWM A;  3CXB B;  1MIZ B;  2J59 M;  2JP2 A;  1FHX A;  4KVG B;  3HQC A;  3OAN A;  1NU2 A;  2D9Z A;  2YT0 A;  5JP4 A;  4WVF B;  4GPT B;  4GZU A;  1PMS A;  3UZT A;  1W1D A;  2VRW B;  1MPH A;  2YVC A;  3GYP A;  4GMV A;  2YF0 A;  1U29 A;  4L6E A;  5DIF B;  3D8D A;  3A98 B;  5DHF B;  2DTC A;  3SUZ A;  3SV1 A;  3O96 A;  3KRW A;  1UPR A;  2KCJ A;  3M1I B;  4KHA A;  2LOX A;  2Z0P A;  1UEF A;  5D3V A;  1V89 A;  2V76 A;  1FGZ A;  5DI9 B;  1RJ2 A;  1K5G B;  1XR0 B;  1WGQ A;  3SO6 A;  2COC A;  2LYD A;  5D3X A;  1B55 A;  5HE2 A;  1UNP A;  2P8V A;  4BBK A;  1MK7 B;  1X1G A;  4H8S A;  1XX0 A;  1AWE A;  3QIJ A;  3PG7 A;  2CAY A;  4HB3 B;  4PNK A;  2P0D A;  3AU4 A;  2KUP A;  3SNH A;  1U27 A;  5LOP B;  3DXC A;  5JLJ B;  5DHA B;  2P0F A;  1FHW A;  4HDQ A;  2N23 A;  3D8E A;  2I5F A;  1NTV A;  2HE7 A;  2Y8F A;  1OMW A;  4DBB A;  1P5T A;  2FJL A;  2I1J A;  1W1G A;  5C16 A;  2RUK B;  2IYB A;  1WG7 A;  2EMS A;  2CRF A;  3BIN A;  1X86 A;  3P7Z A;  1U5E A;  2KGX B;  3FSS A;  2DYN A;  1ZM0 A;  4CHJ A;  4F7H A;  2YS1 A;  2HTH B;  1BWN A;  4Z2N A;  1J0W A;  2D10 A;  3P6A A;  3N7C A;  2DA0 A;  3WYF B;  4Z2M B;  1NI2 A;  3KZ1 A;  1V5P A;  1IRS A;  1TXD A;  4XWX A;  2D9X A;  5D3Y A;  4HB0 B;  2D9V A;  4DX9 0;  1V5M A;  4TYZ A;  1FB8 A;  1KZG A;  1NTY A;  3TVV A;  1DDM A;  1GG3 A;  3LJU X;  4HHV A;  3F5R A;  4NSW A;  1PLS A;  1U5G A;  2ROV A;  1I7A A;  3VIA A;  3ZDT A;  3AJ4 A;  5C5B B;  2QKM A;  1BAK A;  3NSU A;  1WGU A;  3PP2 A;  2AEH A;  2DYQ A;  2LUL A;  2MWN B;  4HAV B;  3SYX A;  4ZRK A;  1KI1 B;  1UNR A;  4K2P A;  1FGY A;  1EGX A;  5C6R A;  3PSC A;  2Z0Q A;  5HE3 A;  2LOZ A;  1AQC A;  3KSY A;  3PVL A;  4PQ0 A;  1V88 A;  2NZ8 B;  3TCA A;  1WJ1 A;  5CLQ B;  3RCP A;  2H7E A;  2MDX A;  1KZ7 A;  2X18 A;  2YT1 A;  4P7I A;  3VOQ A;  2UZR A;  2GCJ A;  2QKL A;  4F7U P;  5KCV A;  1OY2 A;  1I2H A;  2RLO A;  1X11 A;  1X05 A;  4YL8 A;  2LKO A;  2YRY A;  2ELB A;  3AU5 A;  1U5F A;  1H4R A;  1K5D B;  3ODX A;  1Q67 A;  2I5C A;  5LON B;  1E5W A;  3D8F A;  2Z0O A;  1DRO A;  3MDB C;  5JHG A;  1UNQ A;  5C79 A;  1WVH A;  4KHO A;  3F0W A;  5D27 A;  1J19 A;  1EVH A;  1FHO A;  3A8P A;  5C5B A;  1TJ6 A;  4HAU B;  5GOW B;  3PVW A;  2DN6 A;  1BTN A;  1TQZ A;  3ZVR A;  3ML4 A;  3FM8 C;  4WSF A;  1ISN A;  2UVM A;  5FI1 A;  2CY4 A;  3FEH A;  1P3R A;  2D9W A;  5CLL B;  3HW2 B;  1ZC3 B;  3DXE A;  2GCL A;  1N3H A;  2COD A;  2IFS A;  4HDO A;  4KAX B;  4D0N B;  3CIK A;  1PFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...