4HHVA

Crystal structure of ceramide transfer protein pleckstrin homology domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
103
structure length
103
Chain Sequence
FSGPPVERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWIDAIEQHKTESGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Pleckstrin Homology Domain from the Ceramide Transfer Protein: Implications for Conformational Change upon Ligand Binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid transport
molecule keywords Collagen type IV alpha-3-binding protein
total genus 25
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4hhvA00
4CYEA 3SYXA 4GPTB 2DHIA 1I7AA 1FHOA 2NZ8B 1H4RA 1SHCA 3HK0A 1Y19B 1ZVRA 2IYBA 1EGXA 3HW2B 3QWMA 2L2IA 4MK0A 2QKLA 4DXAB 1FHWA 5C16A 1DDMA 2Z0OA 4HAWB 3ODXA 1OY2A 1WGQA 3DXEA 1UPRA 3KZ1A 5HE0A 2COCA 1BTNA 1V5PA 4B6HA 2J0MA 4MT7A 2GJYA 2I1KA 3LJUX 1TXDA 4YONA 1J0WA 2DYNA 3U8ZA 4ZRKA 1B55A 1FGZA 2ADZA 3D8EA 2AEHA 3FEHA 1FOEA 3P6AA 2CRFA 1GG3A 3U7DA 5DH9B 1U5EA 5CLLB 1Q67A 5GOWB 2DX1A 1QC6A 3UZTA 2YT1A 5J3YA 1FGYA 5JHHA 4A6FA 2L1CA 1LB1A 3FM8C 1LW3A 5LOPB 3MPXA 4WSFA 5D3XA 2YS5A 4HB2B 5KCVA 3F0WA 4A6FB 3IVFA 3PP2A 4GN1A 1X1GA 1RRPB 1WJ1A 3V5WA 2D4QA 1NU2A 1N3HA 3P7ZA 4HDQA 3TVVA 2AL6A 1M7RA 2W2XC 2I1JA 1P3RA 2D9ZA 1DDVA 3KRXA 4KHOA 3D8FA 4HAUB 2I5FA 5C79A 1V61A 2OTXA 1OMWA 2KGXB 2D9XA 2DFKA 3PSCA 2OQBA 2D10A 5JP4A 5C5BB 1W1GA 1H10A 2W2XD 3BINA 1XODA 3GYOA 4DBBA 3DXCA 4HDOA 4DX90 2EJ8A 1BAKA 2ZPYA 3VIAA 1NTVA 4EKUA 2RNRB 2QKMA 3AU4A 1U5FA 4H8SA 2MFQA 4TKNA 3ULCA 2DYQA 2M38A 2UZRA 3VOQA 2D9YA 4C0AA 2H7EA 5J3TA 1PLSA 5D3WA 2UZSA 1P5TA 3O96A 3RCPA 5C6RA 1FB8A 1V89A 2D2QA 3QIJA 4L6EA 5JHGA 4EMOA 2Y8GA 1X11A 1GC6A 2M14A 3X23A 2J0JA 2RVBB 3ZDTA 2I5CA 2YT0A 3SUZA 2K2UA 1WG7A 4K2PA 2YS3A 4DX8A 2LKOA 4K2OA 3FSSA 3DXDA 2GS0A 2COFA 2LULA 4Z2MB 5DHAB 1FHXA 2NMBA 4A6KA 2LOZA 1MKEA 1W1DA 2CY4A 4GXBA 3A8QA 5J3QA 5KQ4A 4BBKA 4A5KA 1Y5OA 1MK7B 2N23A 2GCLA 3KY9A 1DBHA 1V5MA 2ELBA 3ULBA 5HE3A 1XKEA 3PVWA 1X86A 3PEGA 4KHAA 4WJ7A 1SGHA 2DTCA 2KCJA 4TYZA 1UNRA 2MKRA 4WVFB 5L81A 1UPQA 3A98B 4ZRJA 2RSGA 4YL8A 4Y94A 1U5GA 4NY0A 1RJ2A 2RGNB 2R0DA 4KHBB 2N0YA 5HE1A 4IFSA 1J19A 1WGUA 1U2BA 2Z0PA 2H7DA 2IFSA 5LONB 2D11A 1AQCA 2R09A 2X18A 1WI1A 2VSZA 3AJ4A 2EC1A 2G35A 2COAA 5HE2A 3QBVB 4K17A 1ZM0A 2XQNM 4CHJA 1P6SA 2YS1A 2HE7A 2V76A 4CHMA 2ROZB 1U29A 1DDWA 3PZDA 4K81A 2Z0QA 4PQ0A 2EMSA 4HAZB 2CAYA 4F7HA 5C5BA 1QQGA 1KZGA 2J59M 2K00A 3TFMA 4IAPA 1NTYA 1X05A 1TQZA 1XR0B 5DHFB 3KSYA 5EFXA 5KQ1A 2KUPA 3TO1A 2E2XA 1ZC3B 1I2HA 3ODWA 1ZC4B 2DX5A 4HAYB 2HTHB 1MIZB 2MWNB 3KRWA 3MDBC 2DA0A 4MY6A 4GZUA 3F5RA 4HB4B 1K5GB 2P8VA 4ZRIA 1EF1A 4A6HA 5D27A 1EAZA 2Y8FA 2Y7BA 1MPHA 4KVGB 1UNQA 4HAVB 2PZ1A 3WYFB 1V88A 2ELAA 5D3VA 1FAOA 2P0FA 2J0KA 4KAXB 3CIKA 3PVLA 3AU5A 2UVMA 3D8DA 1IRSA 3PVUA 2YSZA 4HATB 3ZVRA 4IOYX 2RUKB 2DKQA 4NSWA 4GMVA 4GMXB 3NSUA 1OQNA 1UNPA 3BJIA 3SO6A 3N7CA 1XX0A 3HQCA 2LOXA 1MIXA 2DN6A 1X1FA 2DKPA 2P0DA 2VKIA 1ISNA 3G9WA 2W2WA 5FI0A 2BCJA 3M1IB 5DI9B 5DIFB 1UEFA 1M7EA 2LYDA 5CLQB 2K2JA 3ML4A 1BWNA 4F7UP 2DHKA 3T06A 1BTKA 3OANA 1EVHA 2YVCA 3TCAA 1WJMA 1TJ6A 3GYPA 3A8PA 5D3YA 3SNHA 1K5DB 2VRWB 2YRYA 2ROVA 4HB3B 4HHVA 2DHJA 1PFJA 2P0HA 2CODA 1ZSQA 1AWEA 1MAIA 4F7GA 1DYNA 1XD4A 1GC7A 1KZ7A 4PNKA 3PG7A 4HB0B 2CY5A 2DLWA 1PMSA 4HAXB 1MK9B 5FI1A 2RLOA 2Q13A 1V5UA 2YF0A 4D0NB 3ODOA 1WVHA 5JLJB 1E5WA 4XWXA 3SV1A 1KI1B 4Z2NA 1Z87A 1U5DA 1NI2A 1DROA 4P7IA 3TW1A 1W1HA 3WA0A 4EJNA 3CXBB 2GCJA 2JP2A 2FJLA 2MDXA 1XCGA 2LG1A 2EMTA 2D9VA 1U27A 2D9WA
chains in the Genus database with same CATH superfamily
4OSNA 4CYEA 3SYXA 4GPTB 2DHIA 1T77A 1I7AA 2K8EA 1FHOA 2NZ8B 4CSQA 1H4RA 1SHCA 3HK0A 3HIEA 1Y19B 1ZVRA 2IYBA 1EGXA 3HW2B 3QWMA 2YT2A 2L2IA 4MK0A 2QKLA 4DXAB 1FHWA 5C16A 1DDMA 2FJUB 2Z0OA 4HAWB 3ODXA 1OY2A 1WGQA 3DXEA 2Z59A 2R2YA 1UPRA 3KZ1A 5HE0A 2COCA 1BTNA 1V5PA 4B6HA 2J0MA 4MT7A 2GJYA 2I1KA 3LJUX 1TXDA 4YONA 1J0WA 2RRFA 2DYNA 3U8ZA 4ZRKA 1B55A 1FGZA 2ADZA 3B77A 3D8EA 2AEHA 3FEHA 1FOEA 3P6AA 2CRFA 1GG3A 3U7DA 5DH9B 1U5EA 5CLLB 1Q67A 5GOWB 2DX1A 1QC6A 3UZTA 2YT1A 5J3YA 1FGYA 5JHHA 4A6FA 2L1CA 1LB1A 4L1RA 3FM8C 1LW3A 5LOPB 3MPXA 4WSFA 5D3XA 2YS5A 3HSAA 4HB2B 5KCVA 3F0WA 4A6FB 3IVFA 2KIGA 3PP2A 4GN1A 1X1GA 1RRPB 1WJ1A 3V5WA 2D4QA 4QJ5B 3FVCA 1NU2A 1ZYIA 1N3HA 3P7ZA 4HDQA 3TVVA 2AL6A 1M7RA 2W2XC 2I1JA 1P3RA 2D9ZA 1DDVA 3KRXA 4KHOA 3D8FA 4QJ3B 4HAUB 2I5FA 5C79A 1V61A 2GUMA 2K49A 2OTXA 1OMWA 2KGXB 2D9XA 2DFKA 3PSCA 2OQBA 2D10A 5JP4A 5C5BB 1W1GA 1H10A 2W2XD 3BINA 1XODA 3GYOA 4DBBA 3DXCA 4HDOA 2KR0A 2Z4DA 4DX90 2EJ8A 1BAKA 2ZPYA 3VIAA 1NTVA 4EKUA 2RNRB 5IRSA 2QKMA 3AU4A 1U5FA 4H8SA 2MFQA 4TKNA 3ULCA 2DYQA 2M38A 2UZRA 3VOQA 2D9YA 4C0AA 1MI1A 2H7EA 5J3TA 1PLSA 5D3WA 2UZSA 1P5TA 2Z13A 3O96A 3RCPA 5C6RA 1FB8A 1V89A 2D2QA 3QIJA 4L6EA 5JHGA 2NBVA 4EMOA 2Y8GA 3U12A 1X11A 1GC6A 2M14A 3X23A 2J0JA 2RVBB 3ZDTA 2I5CA 2YT0A 3SUZA 2K2UA 1WG7A 4K2PA 2YS3A 4DX8A 2LKOA 4K2OA 3FSSA 3DXDA 2GS0A 2COFA 2LULA 4Z2MB 5DHAB 1FHXA 2NMBA 4A6KA 2LOZA 1MKEA 1W1DA 2CY4A 4GXBA 3A8QA 5J3QA 5KQ4A 4BBKA 4A5KA 1Y5OA 2KUQA 1MK7B 2N23A 2GCLA 3DCXA 3KY9A 3NWAA 1DBHA 1V5MA 2ELBA 5I2SA 3ULBA 5HE3A 1XKEA 3PVWA 1X86A 3PEGA 4KHAA 4WJ7A 1SGHA 2DTCA 2KCJA 4TYZA 1UNRA 2MKRA 4WVFB 5L81A 1UPQA 3A98B 3OHMB 4ZRJA 2RSGA 4YL8A 4Y94A 1U5GA 4NY0A 1RJ2A 2RGNB 2R0DA 4KHBB 2N0YA 5HE1A 3NWDA 4IFSA 1J19A 1WGUA 1U2BA 3NWFA 2Z0PA 2H7DA 2IFSA 5LONB 2D11A 1AQCA 2R09A 2X18A 1WI1A 2VSZA 3AJ4A 2EC1A 2G35A 2COAA 5HE2A 3QBVB 4K17A 1ZM0A 2XQNM 4CHJA 4QJ4B 1P6SA 2YS1A 2HE7A 2V76A 4CHMA 2ROZB 1U29A 1DDWA 3PZDA 4K81A 2Z0QA 3NW8A 4PQ0A 2EMSA 4HAZB 2CAYA 4F7HA 5C5BA 1QQGA 1KZGA 2J59M 2K00A 3TFMA 4IAPA 1NTYA 1X05A 1TQZA 1XR0B 5DHFB 3KSYA 5EFXA 5KQ1A 2KUPA 3TO1A 2E2XA 1ZC3B 1I2HA 3ODWA 1ZC4B 2DX5A 4HAYB 2HTHB 1MIZB 3A58A 2MWNB 3KRWA 3MDBC 2DA0A 4MY6A 4GZUA 3F5RA 4HB4B 1K5GB 2P8VA 4ZRIA 1EF1A 4A6HA 5D27A 1EAZA 2Y8FA 2Y7BA 1MPHA 4KVGB 1UNQA 4HAVB 2PZ1A 4QXAB 3WYFB 1V88A 2ELAA 5D3VA 1FAOA 2P0FA 2J0KA 4OT1A 4KAXB 3CIKA 3PVLA 3AU5A 2UVMA 3D8DA 1IRSA 3PVUA 2YSZA 4HATB 3ZVRA 4IOYX 2RUKB 2DKQA 4NSWA 2Z14A 4GMVA 4GMXB 3NSUA 1OQNA 1UNPA 4GNKB 3BJIA 3SO6A 2KIEA 3N7CA 1XX0A 3HQCA 2LOXA 1MIXA 2DN6A 1X1FA 2DKPA 2P0DA 2VKIA 1ISNA 3G9WA 2W2WA 5FI0A 2BCJA 3M1IB 5DI9B 5DIFB 1UEFA 1M7EA 2LYDA 4D6WA 5CLQB 2K2JA 3ML4A 1BWNA 4F7UP 2DHKA 3T06A 1BTKA 3OANA 1EVHA 2YVCA 3TCAA 1WJMA 1TJ6A 3GYPA 3A8PA 5D3YA 3SNHA 1K5DB 2VRWB 2YRYA 2ROVA 4HB3B 4HHVA 2DHJA 1PFJA 2P0HA 2CODA 1ZSQA 1AWEA 1MAIA 4F7GA 1DYNA 1XD4A 1GC7A 1KZ7A 4PNKA 3PG7A 4HB0B 2CY5A 2DLWA 1PMSA 4HSIA 4HAXB 1MK9B 5FI1A 2RLOA 2Q13A 1V5UA 2YF0A 4D0NB 3ODOA 4DIXA 1WVHA 5JLJB 1E5WA 2ZKMX 4XWXA 3SV1A 1KI1B 4Z2NA 1Z87A 5LG4B 1U5DA 1NI2A 1DROA 4P7IA 3TW1A 1W1HA 3WA0A 5I2MA 4EJNA 3CXBB 4GOUA 2GCJA 2JP2A 5M4YB 2FJLA 2MDXA 1XCGA 2LG1A 2EMTA 2D9VA 4KHBA 1U27A 2D9WA
chains in the Genus database with same CATH topology
4CYEA 3SYXA 4GPTB 2DHIA 1I7AA 1FHOA 2NZ8B 1H4RA 1SHCA 3HK0A 1Y19B 1ZVRA 2IYBA 1EGXA 3HW2B 3QWMA 2L2IA 4MK0A 2QKLA 4DXAB 1FHWA 5C16A 1DDMA 2Z0OA 4HAWB 3ODXA 1OY2A 1WGQA 3DXEA 1UPRA 3KZ1A 5HE0A 2COCA 1BTNA 1V5PA 4B6HA 2J0MA 4MT7A 2GJYA 2I1KA 3LJUX 1TXDA 4YONA 1J0WA 2DYNA 3U8ZA 4ZRKA 1B55A 1FGZA 2ADZA 3D8EA 2AEHA 3FEHA 1FOEA 3P6AA 2CRFA 1GG3A 3U7DA 5DH9B 1U5EA 5CLLB 1Q67A 5GOWB 2DX1A 1QC6A 3UZTA 2YT1A 5J3YA 1FGYA 5JHHA 4A6FA 2L1CA 1LB1A 3FM8C 1LW3A 5LOPB 3MPXA 4WSFA 5D3XA 2YS5A 4HB2B 5KCVA 3F0WA 4A6FB 3IVFA 3PP2A 4GN1A 1X1GA 1RRPB 1WJ1A 3V5WA 2D4QA 1NU2A 1N3HA 3P7ZA 4HDQA 3TVVA 2AL6A 1M7RA 2W2XC 2I1JA 1P3RA 2D9ZA 1DDVA 3KRXA 4KHOA 3D8FA 4HAUB 2I5FA 5C79A 1V61A 2OTXA 1OMWA 2KGXB 2D9XA 2DFKA 3PSCA 2OQBA 2D10A 5JP4A 5C5BB 1W1GA 1H10A 2W2XD 3BINA 1XODA 3GYOA 4DBBA 3DXCA 4HDOA 4DX90 2EJ8A 1BAKA 2ZPYA 3VIAA 1NTVA 4EKUA 2RNRB 2QKMA 3AU4A 1U5FA 4H8SA 2MFQA 4TKNA 3ULCA 2DYQA 2M38A 2UZRA 3VOQA 2D9YA 4C0AA 2H7EA 5J3TA 1PLSA 5D3WA 2UZSA 1P5TA 3O96A 3RCPA 5C6RA 1FB8A 1V89A 2D2QA 3QIJA 4L6EA 5JHGA 4EMOA 2Y8GA 1X11A 1GC6A 2M14A 3X23A 2J0JA 2RVBB 3ZDTA 2I5CA 2YT0A 3SUZA 2K2UA 1WG7A 4K2PA 2YS3A 4DX8A 2LKOA 4K2OA 3FSSA 3DXDA 2GS0A 2COFA 2LULA 4Z2MB 5DHAB 1FHXA 2NMBA 4A6KA 2LOZA 1MKEA 1W1DA 2CY4A 4GXBA 3A8QA 5J3QA 5KQ4A 4BBKA 4A5KA 1Y5OA 1MK7B 2N23A 2GCLA 3KY9A 1DBHA 1V5MA 2ELBA 3ULBA 5HE3A 1XKEA 3PVWA 1X86A 3PEGA 4KHAA 4WJ7A 1SGHA 2DTCA 2KCJA 4TYZA 1UNRA 2MKRA 4WVFB 5L81A 1UPQA 3A98B 4ZRJA 2RSGA 4YL8A 4Y94A 1U5GA 4NY0A 1RJ2A 2RGNB 2R0DA 4KHBB 2N0YA 5HE1A 4IFSA 1J19A 1WGUA 1U2BA 2Z0PA 2H7DA 2IFSA 5LONB 2D11A 1AQCA 2R09A 2X18A 1WI1A 2VSZA 3AJ4A 2EC1A 2G35A 2COAA 5HE2A 3QBVB 4K17A 1ZM0A 2XQNM 4CHJA 1P6SA 2YS1A 2HE7A 2V76A 4CHMA 2ROZB 1U29A 1DDWA 3PZDA 4K81A 2Z0QA 4PQ0A 2EMSA 4HAZB 2CAYA 4F7HA 5C5BA 1QQGA 1KZGA 2J59M 2K00A 3TFMA 4IAPA 1NTYA 1X05A 1TQZA 1XR0B 5DHFB 3KSYA 5EFXA 5KQ1A 2KUPA 3TO1A 2E2XA 1ZC3B 1I2HA 3ODWA 1ZC4B 2DX5A 4HAYB 2HTHB 1MIZB 2MWNB 3KRWA 3MDBC 2DA0A 4MY6A 4GZUA 3F5RA 4HB4B 1K5GB 2P8VA 4ZRIA 1EF1A 4A6HA 5D27A 1EAZA 2Y8FA 2Y7BA 1MPHA 4KVGB 1UNQA 4HAVB 2PZ1A 3WYFB 1V88A 2ELAA 5D3VA 1FAOA 2P0FA 2J0KA 4KAXB 3CIKA 3PVLA 3AU5A 2UVMA 3D8DA 1IRSA 3PVUA 2YSZA 4HATB 3ZVRA 4IOYX 2RUKB 2DKQA 4NSWA 4GMVA 4GMXB 3NSUA 1OQNA 1UNPA 3BJIA 3SO6A 3N7CA 1XX0A 3HQCA 2LOXA 1MIXA 2DN6A 1X1FA 2DKPA 2P0DA 2VKIA 1ISNA 3G9WA 2W2WA 5FI0A 2BCJA 3M1IB 5DI9B 5DIFB 1UEFA 1M7EA 2LYDA 5CLQB 2K2JA 3ML4A 1BWNA 4F7UP 2DHKA 3T06A 1BTKA 3OANA 1EVHA 2YVCA 3TCAA 1WJMA 1TJ6A 3GYPA 3A8PA 5D3YA 3SNHA 1K5DB 2VRWB 2YRYA 2ROVA 4HB3B 4HHVA 2DHJA 1PFJA 2P0HA 2CODA 1ZSQA 1AWEA 1MAIA 4F7GA 1DYNA 1XD4A 1GC7A 1KZ7A 4PNKA 3PG7A 4HB0B 2CY5A 2DLWA 1PMSA 4HAXB 1MK9B 5FI1A 2RLOA 2Q13A 1V5UA 2YF0A 4D0NB 3ODOA 1WVHA 5JLJB 1E5WA 4XWXA 3SV1A 1KI1B 4Z2NA 1Z87A 1U5DA 1NI2A 1DROA 4P7IA 3TW1A 1W1HA 3WA0A 4EJNA 3CXBB 2GCJA 2JP2A 2FJLA 2MDXA 1XCGA 2LG1A 2EMTA 2D9VA 1U27A 2D9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CYE A;  3SYX A;  4GPT B;  2DHI A;  1I7A A;  1FHO A;  2NZ8 B;  1H4R A;  1SHC A;  3HK0 A;  1Y19 B;  1ZVR A;  2IYB A;  1EGX A;  3HW2 B;  3QWM A;  2L2I A;  4MK0 A;  2QKL A;  4DXA B;  1FHW A;  5C16 A;  1DDM A;  2Z0O A;  4HAW B;  3ODX A;  1OY2 A;  1WGQ A;  3DXE A;  1UPR A;  3KZ1 A;  5HE0 A;  2COC A;  1BTN A;  1V5P A;  4B6H A;  2J0M A;  4MT7 A;  2GJY A;  2I1K A;  3LJU X;  1TXD A;  4YON A;  1J0W A;  2DYN A;  3U8Z A;  4ZRK A;  1B55 A;  1FGZ A;  2ADZ A;  3D8E A;  2AEH A;  3FEH A;  1FOE A;  3P6A A;  2CRF A;  1GG3 A;  3U7D A;  5DH9 B;  1U5E A;  5CLL B;  1Q67 A;  5GOW B;  2DX1 A;  1QC6 A;  3UZT A;  2YT1 A;  5J3Y A;  1FGY A;  5JHH A;  4A6F A;  2L1C A;  1LB1 A;  3FM8 C;  1LW3 A;  5LOP B;  3MPX A;  4WSF A;  5D3X A;  2YS5 A;  4HB2 B;  5KCV A;  3F0W A;  4A6F B;  3IVF A;  3PP2 A;  4GN1 A;  1X1G A;  1RRP B;  1WJ1 A;  3V5W A;  2D4Q A;  1NU2 A;  1N3H A;  3P7Z A;  4HDQ A;  3TVV A;  2AL6 A;  1M7R A;  2W2X C;  2I1J A;  1P3R A;  2D9Z A;  1DDV A;  3KRX A;  4KHO A;  3D8F A;  4HAU B;  2I5F A;  5C79 A;  1V61 A;  2OTX A;  1OMW A;  2KGX B;  2D9X A;  2DFK A;  3PSC A;  2OQB A;  2D10 A;  5JP4 A;  5C5B B;  1W1G A;  1H10 A;  2W2X D;  3BIN A;  1XOD A;  3GYO A;  4DBB A;  3DXC A;  4HDO A;  4DX9 0;  2EJ8 A;  1BAK A;  2ZPY A;  3VIA A;  1NTV A;  4EKU A;  2RNR B;  2QKM A;  3AU4 A;  1U5F A;  4H8S A;  2MFQ A;  4TKN A;  3ULC A;  2DYQ A;  2M38 A;  2UZR A;  3VOQ A;  2D9Y A;  4C0A A;  2H7E A;  5J3T A;  1PLS A;  5D3W A;  2UZS A;  1P5T A;  3O96 A;  3RCP A;  5C6R A;  1FB8 A;  1V89 A;  2D2Q A;  3QIJ A;  4L6E A;  5JHG A;  4EMO A;  2Y8G A;  1X11 A;  1GC6 A;  2M14 A;  3X23 A;  2J0J A;  2RVB B;  3ZDT A;  2I5C A;  2YT0 A;  3SUZ A;  2K2U A;  1WG7 A;  4K2P A;  2YS3 A;  4DX8 A;  2LKO A;  4K2O A;  3FSS A;  3DXD A;  2GS0 A;  2COF A;  2LUL A;  4Z2M B;  5DHA B;  1FHX A;  2NMB A;  4A6K A;  2LOZ A;  1MKE A;  1W1D A;  2CY4 A;  4GXB A;  3A8Q A;  5J3Q A;  5KQ4 A;  4BBK A;  4A5K A;  1Y5O A;  1MK7 B;  2N23 A;  2GCL A;  3KY9 A;  1DBH A;  1V5M A;  2ELB A;  3ULB A;  5HE3 A;  1XKE A;  3PVW A;  1X86 A;  3PEG A;  4KHA A;  4WJ7 A;  1SGH A;  2DTC A;  2KCJ A;  4TYZ A;  1UNR A;  2MKR A;  4WVF B;  5L81 A;  1UPQ A;  3A98 B;  4ZRJ A;  2RSG A;  4YL8 A;  4Y94 A;  1U5G A;  4NY0 A;  1RJ2 A;  2RGN B;  2R0D A;  4KHB B;  2N0Y A;  5HE1 A;  4IFS A;  1J19 A;  1WGU A;  1U2B A;  2Z0P A;  2H7D A;  2IFS A;  5LON B;  2D11 A;  1AQC A;  2R09 A;  2X18 A;  1WI1 A;  2VSZ A;  3AJ4 A;  2EC1 A;  2G35 A;  2COA A;  5HE2 A;  3QBV B;  4K17 A;  1ZM0 A;  2XQN M;  4CHJ A;  1P6S A;  2YS1 A;  2HE7 A;  2V76 A;  4CHM A;  2ROZ B;  1U29 A;  1DDW A;  3PZD A;  4K81 A;  2Z0Q A;  4PQ0 A;  2EMS A;  4HAZ B;  2CAY A;  4F7H A;  5C5B A;  1QQG A;  1KZG A;  2J59 M;  2K00 A;  3TFM A;  4IAP A;  1NTY A;  1X05 A;  1TQZ A;  1XR0 B;  5DHF B;  3KSY A;  5EFX A;  5KQ1 A;  2KUP A;  3TO1 A;  2E2X A;  1ZC3 B;  1I2H A;  3ODW A;  1ZC4 B;  2DX5 A;  4HAY B;  2HTH B;  1MIZ B;  2MWN B;  3KRW A;  3MDB C;  2DA0 A;  4MY6 A;  4GZU A;  3F5R A;  4HB4 B;  1K5G B;  2P8V A;  4ZRI A;  1EF1 A;  4A6H A;  5D27 A;  1EAZ A;  2Y8F A;  2Y7B A;  1MPH A;  4KVG B;  1UNQ A;  4HAV B;  2PZ1 A;  3WYF B;  1V88 A;  2ELA A;  5D3V A;  1FAO A;  2P0F A;  2J0K A;  4KAX B;  3CIK A;  3PVL A;  3AU5 A;  2UVM A;  3D8D A;  1IRS A;  3PVU A;  2YSZ A;  4HAT B;  3ZVR A;  4IOY X;  2RUK B;  2DKQ A;  4NSW A;  4GMV A;  4GMX B;  3NSU A;  1OQN A;  1UNP A;  3BJI A;  3SO6 A;  3N7C A;  1XX0 A;  3HQC A;  2LOX A;  1MIX A;  2DN6 A;  1X1F A;  2DKP A;  2P0D A;  2VKI A;  1ISN A;  3G9W A;  2W2W A;  5FI0 A;  2BCJ A;  3M1I B;  5DI9 B;  5DIF B;  1UEF A;  1M7E A;  2LYD A;  5CLQ B;  2K2J A;  3ML4 A;  1BWN A;  4F7U P;  2DHK A;  3T06 A;  1BTK A;  3OAN A;  1EVH A;  2YVC A;  3TCA A;  1WJM A;  1TJ6 A;  3GYP A;  3A8P A;  5D3Y A;  3SNH A;  1K5D B;  2VRW B;  2YRY A;  2ROV A;  4HB3 B;  4HHV A;  2DHJ A;  1PFJ A;  2P0H A;  2COD A;  1ZSQ A;  1AWE A;  1MAI A;  4F7G A;  1DYN A;  1XD4 A;  1GC7 A;  1KZ7 A;  4PNK A;  3PG7 A;  4HB0 B;  2CY5 A;  2DLW A;  1PMS A;  4HAX B;  1MK9 B;  5FI1 A;  2RLO A;  2Q13 A;  1V5U A;  2YF0 A;  4D0N B;  3ODO A;  1WVH A;  5JLJ B;  1E5W A;  4XWX A;  3SV1 A;  1KI1 B;  4Z2N A;  1Z87 A;  1U5D A;  1NI2 A;  1DRO A;  4P7I A;  3TW1 A;  1W1H A;  3WA0 A;  4EJN A;  3CXB B;  2GCJ A;  2JP2 A;  2FJL A;  2MDX A;  1XCG A;  2LG1 A;  2EMT A;  2D9V A;  1U27 A;  2D9W A; 
#chains in the Genus database with same CATH topology
 4OSN A;  4CYE A;  3SYX A;  4GPT B;  2DHI A;  1T77 A;  1I7A A;  2K8E A;  1FHO A;  2NZ8 B;  4CSQ A;  1H4R A;  1SHC A;  3HK0 A;  3HIE A;  1Y19 B;  1ZVR A;  2IYB A;  1EGX A;  3HW2 B;  3QWM A;  2YT2 A;  2L2I A;  4MK0 A;  2QKL A;  4DXA B;  1FHW A;  5C16 A;  1DDM A;  2FJU B;  2Z0O A;  4HAW B;  3ODX A;  1OY2 A;  1WGQ A;  3DXE A;  2Z59 A;  2R2Y A;  1UPR A;  3KZ1 A;  5HE0 A;  2COC A;  1BTN A;  1V5P A;  4B6H A;  2J0M A;  4MT7 A;  2GJY A;  2I1K A;  3LJU X;  1TXD A;  4YON A;  1J0W A;  2RRF A;  2DYN A;  3U8Z A;  4ZRK A;  1B55 A;  1FGZ A;  2ADZ A;  3B77 A;  3D8E A;  2AEH A;  3FEH A;  1FOE A;  3P6A A;  2CRF A;  1GG3 A;  3U7D A;  5DH9 B;  1U5E A;  5CLL B;  1Q67 A;  5GOW B;  2DX1 A;  1QC6 A;  3UZT A;  2YT1 A;  5J3Y A;  1FGY A;  5JHH A;  4A6F A;  2L1C A;  1LB1 A;  4L1R A;  3FM8 C;  1LW3 A;  5LOP B;  3MPX A;  4WSF A;  5D3X A;  2YS5 A;  3HSA A;  4HB2 B;  5KCV A;  3F0W A;  4A6F B;  3IVF A;  2KIG A;  3PP2 A;  4GN1 A;  1X1G A;  1RRP B;  1WJ1 A;  3V5W A;  2D4Q A;  4QJ5 B;  3FVC A;  1NU2 A;  1ZYI A;  1N3H A;  3P7Z A;  4HDQ A;  3TVV A;  2AL6 A;  1M7R A;  2W2X C;  2I1J A;  1P3R A;  2D9Z A;  1DDV A;  3KRX A;  4KHO A;  3D8F A;  4QJ3 B;  4HAU B;  2I5F A;  5C79 A;  1V61 A;  2GUM A;  2K49 A;  2OTX A;  1OMW A;  2KGX B;  2D9X A;  2DFK A;  3PSC A;  2OQB A;  2D10 A;  5JP4 A;  5C5B B;  1W1G A;  1H10 A;  2W2X D;  3BIN A;  1XOD A;  3GYO A;  4DBB A;  3DXC A;  4HDO A;  2KR0 A;  2Z4D A;  4DX9 0;  2EJ8 A;  1BAK A;  2ZPY A;  3VIA A;  1NTV A;  4EKU A;  2RNR B;  5IRS A;  2QKM A;  3AU4 A;  1U5F A;  4H8S A;  2MFQ A;  4TKN A;  3ULC A;  2DYQ A;  2M38 A;  2UZR A;  3VOQ A;  2D9Y A;  4C0A A;  1MI1 A;  2H7E A;  5J3T A;  1PLS A;  5D3W A;  2UZS A;  1P5T A;  2Z13 A;  3O96 A;  3RCP A;  5C6R A;  1FB8 A;  1V89 A;  2D2Q A;  3QIJ A;  4L6E A;  5JHG A;  2NBV A;  4EMO A;  2Y8G A;  3U12 A;  1X11 A;  1GC6 A;  2M14 A;  3X23 A;  2J0J A;  2RVB B;  3ZDT A;  2I5C A;  2YT0 A;  3SUZ A;  2K2U A;  1WG7 A;  4K2P A;  2YS3 A;  4DX8 A;  2LKO A;  4K2O A;  3FSS A;  3DXD A;  2GS0 A;  2COF A;  2LUL A;  4Z2M B;  5DHA B;  1FHX A;  2NMB A;  4A6K A;  2LOZ A;  1MKE A;  1W1D A;  2CY4 A;  4GXB A;  3A8Q A;  5J3Q A;  5KQ4 A;  4BBK A;  4A5K A;  1Y5O A;  2KUQ A;  1MK7 B;  2N23 A;  2GCL A;  3DCX A;  3KY9 A;  3NWA A;  1DBH A;  1V5M A;  2ELB A;  5I2S A;  3ULB A;  5HE3 A;  1XKE A;  3PVW A;  1X86 A;  3PEG A;  4KHA A;  4WJ7 A;  1SGH A;  2DTC A;  2KCJ A;  4TYZ A;  1UNR A;  2MKR A;  4WVF B;  5L81 A;  1UPQ A;  3A98 B;  3OHM B;  4ZRJ A;  2RSG A;  4YL8 A;  4Y94 A;  1U5G A;  4NY0 A;  1RJ2 A;  2RGN B;  2R0D A;  4KHB B;  2N0Y A;  5HE1 A;  3NWD A;  4IFS A;  1J19 A;  1WGU A;  1U2B A;  3NWF A;  2Z0P A;  2H7D A;  2IFS A;  5LON B;  2D11 A;  1AQC A;  2R09 A;  2X18 A;  1WI1 A;  2VSZ A;  3AJ4 A;  2EC1 A;  2G35 A;  2COA A;  5HE2 A;  3QBV B;  4K17 A;  1ZM0 A;  2XQN M;  4CHJ A;  4QJ4 B;  1P6S A;  2YS1 A;  2HE7 A;  2V76 A;  4CHM A;  2ROZ B;  1U29 A;  1DDW A;  3PZD A;  4K81 A;  2Z0Q A;  3NW8 A;  4PQ0 A;  2EMS A;  4HAZ B;  2CAY A;  4F7H A;  5C5B A;  1QQG A;  1KZG A;  2J59 M;  2K00 A;  3TFM A;  4IAP A;  1NTY A;  1X05 A;  1TQZ A;  1XR0 B;  5DHF B;  3KSY A;  5EFX A;  5KQ1 A;  2KUP A;  3TO1 A;  2E2X A;  1ZC3 B;  1I2H A;  3ODW A;  1ZC4 B;  2DX5 A;  4HAY B;  2HTH B;  1MIZ B;  3A58 A;  2MWN B;  3KRW A;  3MDB C;  2DA0 A;  4MY6 A;  4GZU A;  3F5R A;  4HB4 B;  1K5G B;  2P8V A;  4ZRI A;  1EF1 A;  4A6H A;  5D27 A;  1EAZ A;  2Y8F A;  2Y7B A;  1MPH A;  4KVG B;  1UNQ A;  4HAV B;  2PZ1 A;  4QXA B;  3WYF B;  1V88 A;  2ELA A;  5D3V A;  1FAO A;  2P0F A;  2J0K A;  4OT1 A;  4KAX B;  3CIK A;  3PVL A;  3AU5 A;  2UVM A;  3D8D A;  1IRS A;  3PVU A;  2YSZ A;  4HAT B;  3ZVR A;  4IOY X;  2RUK B;  2DKQ A;  4NSW A;  2Z14 A;  4GMV A;  4GMX B;  3NSU A;  1OQN A;  1UNP A;  4GNK B;  3BJI A;  3SO6 A;  2KIE A;  3N7C A;  1XX0 A;  3HQC A;  2LOX A;  1MIX A;  2DN6 A;  1X1F A;  2DKP A;  2P0D A;  2VKI A;  1ISN A;  3G9W A;  2W2W A;  5FI0 A;  2BCJ A;  3M1I B;  5DI9 B;  5DIF B;  1UEF A;  1M7E A;  2LYD A;  4D6W A;  5CLQ B;  2K2J A;  3ML4 A;  1BWN A;  4F7U P;  2DHK A;  3T06 A;  1BTK A;  3OAN A;  1EVH A;  2YVC A;  3TCA A;  1WJM A;  1TJ6 A;  3GYP A;  3A8P A;  5D3Y A;  3SNH A;  1K5D B;  2VRW B;  2YRY A;  2ROV A;  4HB3 B;  4HHV A;  2DHJ A;  1PFJ A;  2P0H A;  2COD A;  1ZSQ A;  1AWE A;  1MAI A;  4F7G A;  1DYN A;  1XD4 A;  1GC7 A;  1KZ7 A;  4PNK A;  3PG7 A;  4HB0 B;  2CY5 A;  2DLW A;  1PMS A;  4HSI A;  4HAX B;  1MK9 B;  5FI1 A;  2RLO A;  2Q13 A;  1V5U A;  2YF0 A;  4D0N B;  3ODO A;  4DIX A;  1WVH A;  5JLJ B;  1E5W A;  2ZKM X;  4XWX A;  3SV1 A;  1KI1 B;  4Z2N A;  1Z87 A;  5LG4 B;  1U5D A;  1NI2 A;  1DRO A;  4P7I A;  3TW1 A;  1W1H A;  3WA0 A;  5I2M A;  4EJN A;  3CXB B;  4GOU A;  2GCJ A;  2JP2 A;  5M4Y B;  2FJL A;  2MDX A;  1XCG A;  2LG1 A;  2EMT A;  2D9V A;  4KHB A;  1U27 A;  2D9W A; 
#chains in the Genus database with same CATH homology
 4CYE A;  3SYX A;  4GPT B;  2DHI A;  1I7A A;  1FHO A;  2NZ8 B;  1H4R A;  1SHC A;  3HK0 A;  1Y19 B;  1ZVR A;  2IYB A;  1EGX A;  3HW2 B;  3QWM A;  2L2I A;  4MK0 A;  2QKL A;  4DXA B;  1FHW A;  5C16 A;  1DDM A;  2Z0O A;  4HAW B;  3ODX A;  1OY2 A;  1WGQ A;  3DXE A;  1UPR A;  3KZ1 A;  5HE0 A;  2COC A;  1BTN A;  1V5P A;  4B6H A;  2J0M A;  4MT7 A;  2GJY A;  2I1K A;  3LJU X;  1TXD A;  4YON A;  1J0W A;  2DYN A;  3U8Z A;  4ZRK A;  1B55 A;  1FGZ A;  2ADZ A;  3D8E A;  2AEH A;  3FEH A;  1FOE A;  3P6A A;  2CRF A;  1GG3 A;  3U7D A;  5DH9 B;  1U5E A;  5CLL B;  1Q67 A;  5GOW B;  2DX1 A;  1QC6 A;  3UZT A;  2YT1 A;  5J3Y A;  1FGY A;  5JHH A;  4A6F A;  2L1C A;  1LB1 A;  3FM8 C;  1LW3 A;  5LOP B;  3MPX A;  4WSF A;  5D3X A;  2YS5 A;  4HB2 B;  5KCV A;  3F0W A;  4A6F B;  3IVF A;  3PP2 A;  4GN1 A;  1X1G A;  1RRP B;  1WJ1 A;  3V5W A;  2D4Q A;  1NU2 A;  1N3H A;  3P7Z A;  4HDQ A;  3TVV A;  2AL6 A;  1M7R A;  2W2X C;  2I1J A;  1P3R A;  2D9Z A;  1DDV A;  3KRX A;  4KHO A;  3D8F A;  4HAU B;  2I5F A;  5C79 A;  1V61 A;  2OTX A;  1OMW A;  2KGX B;  2D9X A;  2DFK A;  3PSC A;  2OQB A;  2D10 A;  5JP4 A;  5C5B B;  1W1G A;  1H10 A;  2W2X D;  3BIN A;  1XOD A;  3GYO A;  4DBB A;  3DXC A;  4HDO A;  4DX9 0;  2EJ8 A;  1BAK A;  2ZPY A;  3VIA A;  1NTV A;  4EKU A;  2RNR B;  2QKM A;  3AU4 A;  1U5F A;  4H8S A;  2MFQ A;  4TKN A;  3ULC A;  2DYQ A;  2M38 A;  2UZR A;  3VOQ A;  2D9Y A;  4C0A A;  2H7E A;  5J3T A;  1PLS A;  5D3W A;  2UZS A;  1P5T A;  3O96 A;  3RCP A;  5C6R A;  1FB8 A;  1V89 A;  2D2Q A;  3QIJ A;  4L6E A;  5JHG A;  4EMO A;  2Y8G A;  1X11 A;  1GC6 A;  2M14 A;  3X23 A;  2J0J A;  2RVB B;  3ZDT A;  2I5C A;  2YT0 A;  3SUZ A;  2K2U A;  1WG7 A;  4K2P A;  2YS3 A;  4DX8 A;  2LKO A;  4K2O A;  3FSS A;  3DXD A;  2GS0 A;  2COF A;  2LUL A;  4Z2M B;  5DHA B;  1FHX A;  2NMB A;  4A6K A;  2LOZ A;  1MKE A;  1W1D A;  2CY4 A;  4GXB A;  3A8Q A;  5J3Q A;  5KQ4 A;  4BBK A;  4A5K A;  1Y5O A;  1MK7 B;  2N23 A;  2GCL A;  3KY9 A;  1DBH A;  1V5M A;  2ELB A;  3ULB A;  5HE3 A;  1XKE A;  3PVW A;  1X86 A;  3PEG A;  4KHA A;  4WJ7 A;  1SGH A;  2DTC A;  2KCJ A;  4TYZ A;  1UNR A;  2MKR A;  4WVF B;  5L81 A;  1UPQ A;  3A98 B;  4ZRJ A;  2RSG A;  4YL8 A;  4Y94 A;  1U5G A;  4NY0 A;  1RJ2 A;  2RGN B;  2R0D A;  4KHB B;  2N0Y A;  5HE1 A;  4IFS A;  1J19 A;  1WGU A;  1U2B A;  2Z0P A;  2H7D A;  2IFS A;  5LON B;  2D11 A;  1AQC A;  2R09 A;  2X18 A;  1WI1 A;  2VSZ A;  3AJ4 A;  2EC1 A;  2G35 A;  2COA A;  5HE2 A;  3QBV B;  4K17 A;  1ZM0 A;  2XQN M;  4CHJ A;  1P6S A;  2YS1 A;  2HE7 A;  2V76 A;  4CHM A;  2ROZ B;  1U29 A;  1DDW A;  3PZD A;  4K81 A;  2Z0Q A;  4PQ0 A;  2EMS A;  4HAZ B;  2CAY A;  4F7H A;  5C5B A;  1QQG A;  1KZG A;  2J59 M;  2K00 A;  3TFM A;  4IAP A;  1NTY A;  1X05 A;  1TQZ A;  1XR0 B;  5DHF B;  3KSY A;  5EFX A;  5KQ1 A;  2KUP A;  3TO1 A;  2E2X A;  1ZC3 B;  1I2H A;  3ODW A;  1ZC4 B;  2DX5 A;  4HAY B;  2HTH B;  1MIZ B;  2MWN B;  3KRW A;  3MDB C;  2DA0 A;  4MY6 A;  4GZU A;  3F5R A;  4HB4 B;  1K5G B;  2P8V A;  4ZRI A;  1EF1 A;  4A6H A;  5D27 A;  1EAZ A;  2Y8F A;  2Y7B A;  1MPH A;  4KVG B;  1UNQ A;  4HAV B;  2PZ1 A;  3WYF B;  1V88 A;  2ELA A;  5D3V A;  1FAO A;  2P0F A;  2J0K A;  4KAX B;  3CIK A;  3PVL A;  3AU5 A;  2UVM A;  3D8D A;  1IRS A;  3PVU A;  2YSZ A;  4HAT B;  3ZVR A;  4IOY X;  2RUK B;  2DKQ A;  4NSW A;  4GMV A;  4GMX B;  3NSU A;  1OQN A;  1UNP A;  3BJI A;  3SO6 A;  3N7C A;  1XX0 A;  3HQC A;  2LOX A;  1MIX A;  2DN6 A;  1X1F A;  2DKP A;  2P0D A;  2VKI A;  1ISN A;  3G9W A;  2W2W A;  5FI0 A;  2BCJ A;  3M1I B;  5DI9 B;  5DIF B;  1UEF A;  1M7E A;  2LYD A;  5CLQ B;  2K2J A;  3ML4 A;  1BWN A;  4F7U P;  2DHK A;  3T06 A;  1BTK A;  3OAN A;  1EVH A;  2YVC A;  3TCA A;  1WJM A;  1TJ6 A;  3GYP A;  3A8P A;  5D3Y A;  3SNH A;  1K5D B;  2VRW B;  2YRY A;  2ROV A;  4HB3 B;  4HHV A;  2DHJ A;  1PFJ A;  2P0H A;  2COD A;  1ZSQ A;  1AWE A;  1MAI A;  4F7G A;  1DYN A;  1XD4 A;  1GC7 A;  1KZ7 A;  4PNK A;  3PG7 A;  4HB0 B;  2CY5 A;  2DLW A;  1PMS A;  4HAX B;  1MK9 B;  5FI1 A;  2RLO A;  2Q13 A;  1V5U A;  2YF0 A;  4D0N B;  3ODO A;  1WVH A;  5JLJ B;  1E5W A;  4XWX A;  3SV1 A;  1KI1 B;  4Z2N A;  1Z87 A;  1U5D A;  1NI2 A;  1DRO A;  4P7I A;  3TW1 A;  1W1H A;  3WA0 A;  4EJN A;  3CXB B;  2GCJ A;  2JP2 A;  2FJL A;  2MDX A;  1XCG A;  2LG1 A;  2EMT A;  2D9V A;  1U27 A;  2D9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...