4HHVA

Crystal structure of ceramide transfer protein pleckstrin homology domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
103
structure length
103
Chain Sequence
FSGPPVERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWIDAIEQHKTESGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Collagen type IV alpha-3-binding protein
publication title Crystal Structure of the Pleckstrin Homology Domain from the Ceramide Transfer Protein: Implications for Conformational Change upon Ligand Binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid transport
total genus 25
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4hhvA00
2LULA 1V5PA 3RCPA 1LW3A 2I5CA 1M7RA 1FHWA 1DROA 4GPTB 1EVHA 1QQGA 3PZDA 4HB4B 2YRYA 1U29A 2VKIA 3AU5A 2D9VA 3DXCA 5DHAB 4Z2NA 2J59M 1FB8A 5HE0A 3BINA 2YT1A 4B6HA 2W2XC 1WVHA 4IOYX 2DHIA 5KQ4A 1U2BA 1DBHA 2EMTA 2D9WA 2R0DA 2H7DA 2DTCA 1NU2A 4K81A 2DYQA 4HATB 2P0FA 3D8EA 4DBBA 2LOZA 3A8PA 2Q13A 2D2QA 1IRSA 2Y8GA 3A8QA 2RGNB 4HAWB 1E5WA 2IFSA 5D3VA 1XODA 3M1IB 1ZVRA 3ODXA 2I5FA 2LKOA 2EMSA 3IVFA 3PVLA 1KI1B 3MDBC 5GOWB 2KGXB 2DYNA 2K2UA 3F5RA 1PMSA 4NY0A 3U8ZA 4HDQA 4WSFA 1WJMA 2LYDA 3BJIA 4D0NB 5J3QA 1TJ6A 5J3TA 1X1GA 4YONA 2X18A 4C0AA 1AQCA 2RVBB 1MK9B 2YS3A 2D10A 4ZRJA 3SO6A 3HW2B 1SHCA 2J0MA 2CODA 3P6AA 3FSSA 1K5GB 3AJ4A 1MK7B 4A5KA 2OTXA 1FAOA 5LOPB 4HDOA 4IAPA 4P7IA 1K5DB 4HAZB 3TVVA 2D4QA 3QBVB 4EKUA 1MIZB 3ODOA 4KVGB 2YSZA 3P7ZA 1N3HA 1WJ1A 2G35A 3GYOA 2L1CA 2QKMA 1GG3A 1ZM0A 4A6KA 1J0WA 2J0KA 1WGQA 4GMVA 2Z0QA 4GN1A 3QIJA 1MKEA 2M14A 2W2WA 1FGYA 3LJUX 4K2PA 1EGXA 1WI1A 2EJ8A 1XD4A 2P8VA 3SUZA 3U7DA 2HTHB 3TW1A 1ISNA 4HAXB 3SYXA 3O96A 2D11A 3GYPA 1FGZA 3D8DA 2M38A 3NSUA 2CAYA 2KCJA 3TO1A 2OQBA 5DIFB 5D3XA 1OQNA 2W2XD 5HE2A 5JHHA 3AU4A 1X05A 3OANA 1BTNA 1NTYA 2GCLA 5L81A 1UNRA 3N7CA 2D9YA 1I7AA 5D3WA 3ML4A 2FJLA 1EAZA 3SV1A 5LONB 5C79A 3ZDTA 1PLSA 1W1DA 1ZC3B 1BWNA 5DI9B 5C5BA 4CHMA 3TFMA 3HQCA 1FHOA 3F0WA 3KRWA 2LG1A 4HAVB 1U5DA 1GC6A 2LOXA 4F7UP 1U5FA 4EJNA 1ZSQA 2RUKB 2P0HA 4F7GA 2GCJA 4GXBA 1U27A 5KQ1A 4F7HA 2L2IA 3DXDA 2DKPA 2J0JA 3WA0A 1RRPB 2YVCA 4A6FB 5J3YA 4PQ0A 4XWXA 3PVUA 5C16A 4H8SA 2RSGA 1U5GA 3TCAA 5C6RA 1FHXA 1UPRA 2Z0PA 2DA0A 2ROZB 1XR0B 3DXEA 3T06A 1B55A 4CYEA 2QKLA 4NSWA 1PFJA 2ROVA 3G9WA 5FI0A 2DHKA 4MK0A 1RJ2A 2D9ZA 3KSYA 2GJYA 1LB1A 5FI1A 2UZRA 4WVFB 4K17A 1XX0A 1WGUA 2IYBA 1X1FA 2KUPA 4HAYB 4EMOA 5JLJB 1FOEA 4TKNA 1NI2A 3QWMA 4HAUB 2AL6A 1Q67A 1V89A 3ULCA 4HHVA 2NMBA 2MWNB 5HE3A 3CIKA 4IFSA 2YT0A 2ZPYA 3PP2A 1H10A 2K2JA 4DXAB 2UZSA 3PG7A 1W1GA 1OY2A 5D3YA 2RLOA 2COAA 1AWEA 4A6FA 3FM8C 4GZUA 1V61A 2VSZA 1X86A 2N23A 1V5MA 3VOQA 5HE1A 3HK0A 2PZ1A 4MY6A 1MPHA 1DYNA 5D27A 4A6HA 2YF0A 1DDVA 2AEHA 2Z0OA 1Y19B 1U5EA 2DHJA 2ELBA 2DX1A 2Y7BA 2JP2A 1SGHA 3PVWA 5KCVA 2EC1A 3KZ1A 3VIAA 1QC6A 1V88A 3MPXA 2BCJA 1M7EA 2I1KA 4Z2MB 5CLQB 2DX5A 3WYFB 3UZTA 2R09A 3SNHA 4HB2B 1H4RA 1WG7A 1J19A 1BAKA 5DHFB 2MFQA 3FEHA 2NZ8B 2H7EA 1XCGA 2Y8FA 2MDXA 1Z87A 2K00A 1GC7A 1KZGA 1UNPA 1UEFA 4PNKA 3PSCA 2MKRA 1DDWA 1KZ7A 4KHAA 1TQZA 1W1HA 2CRFA 4KHOA 2UVMA 1MAIA 4HB3B 4L6EA 1BTKA 1X11A 2I1JA 4MT7A 1XKEA 1EF1A 1ZC4B 2DLWA 1P6SA 4HB0B 3D8FA 4KHBB 3CXBB 3KRXA 4KAXB 1UPQA 2COCA 2E2XA 1OMWA 4GMXB 1TXDA 2COFA 2YS1A 5EFXA 3ULBA 2CY4A 3KY9A 2RNRB 3V5WA 3PEGA 1P3RA 2ADZA 4BBKA 1MIXA 2D9XA 3X23A 1UNQA 3ZVRA 1P5TA 5JHGA 2CY5A 2P0DA 1DDMA 2DFKA 2GS0A 5CLLB 1NTVA 2HE7A 5C5BB 2XQNM 3A98B 4WJ7A 2YS5A 3ODWA 4K2OA 4TYZA 2VRWB 1Y5OA 2DN6A 4ZRKA 2DKQA 2ELAA 1I2HA 4CHJA 5DH9B 4DX90 1V5UA 4YL8A 2V76A 5JP4A 4DX8A 4Y94A 4ZRIA 2N0YA
chains in the Genus database with same CATH superfamily
2LULA 1V5PA 3RCPA 1LW3A 2I5CA 1M7RA 1FHWA 1DROA 4GPTB 1EVHA 1QQGA 3PZDA 4HB4B 2YRYA 1U29A 2VKIA 3AU5A 2D9VA 3DXCA 5DHAB 4Z2NA 2J59M 1FB8A 5HE0A 3BINA 2YT1A 3NW8A 4B6HA 2W2XC 1WVHA 2KIEA 4IOYX 2DHIA 5KQ4A 4GNKB 1U2BA 1DBHA 2EMTA 2D9WA 2R0DA 2H7DA 2Z4DA 2DTCA 1NU2A 4K81A 2DYQA 4HATB 2P0FA 3D8EA 4DBBA 2LOZA 3A8PA 2Q13A 2D2QA 1IRSA 2Y8GA 3A8QA 2RGNB 4HAWB 1E5WA 2IFSA 5D3VA 1XODA 2Z14A 3M1IB 1ZVRA 3ODXA 2I5FA 2LKOA 2EMSA 3IVFA 3PVLA 1KI1B 3MDBC 5I2SA 5GOWB 2KGXB 2DYNA 2K2UA 3F5RA 1PMSA 4NY0A 3U8ZA 3B77A 4HDQA 4WSFA 1WJMA 3U12A 2LYDA 3BJIA 4D0NB 5J3QA 2NBVA 1TJ6A 5J3TA 1X1GA 4YONA 2X18A 4C0AA 1AQCA 2RVBB 1MK9B 2YS3A 2D10A 4ZRJA 3SO6A 2KR0A 3HW2B 1SHCA 2J0MA 2CODA 3P6AA 3FSSA 1K5GB 3AJ4A 1MK7B 4A5KA 2OTXA 1FAOA 5LOPB 4HDOA 4IAPA 3DCXA 4P7IA 1K5DB 4HAZB 3TVVA 2D4QA 3QBVB 4EKUA 1MIZB 3ODOA 4KVGB 2YSZA 3P7ZA 1N3HA 1WJ1A 2G35A 3GYOA 2L1CA 2QKMA 1MI1A 1GG3A 1ZM0A 4A6KA 1J0WA 2J0KA 1WGQA 4GMVA 2Z0QA 4GN1A 3QIJA 1MKEA 2M14A 4KHBA 2W2WA 1FGYA 3LJUX 3NWFA 4K2PA 4QJ3B 1EGXA 1WI1A 2EJ8A 4OSNA 1XD4A 2P8VA 3SUZA 3U7DA 2HTHB 3TW1A 1ISNA 4HAXB 3SYXA 3O96A 2D11A 3GYPA 5LG4B 1FGZA 3D8DA 2M38A 3NSUA 2CAYA 2KCJA 3TO1A 2OQBA 5DIFB 5D3XA 1OQNA 2W2XD 5HE2A 5JHHA 3AU4A 1X05A 3OANA 1BTNA 1NTYA 2GCLA 3NWAA 5L81A 2KUQA 3HIEA 1UNRA 3N7CA 2D9YA 1I7AA 4L1RA 5D3WA 3ML4A 2FJLA 1EAZA 3SV1A 5LONB 5C79A 3ZDTA 1PLSA 1W1DA 1ZC3B 1BWNA 5DI9B 5C5BA 4CHMA 5M4YB 3TFMA 3HQCA 1FHOA 3F0WA 3KRWA 2LG1A 4HAVB 1U5DA 3OHMB 1GC6A 2LOXA 4F7UP 2Z59A 1U5FA 4EJNA 1ZSQA 3NWDA 2R2YA 2RUKB 2P0HA 1ZYIA 2KIGA 4F7GA 2GCJA 4GXBA 1U27A 5KQ1A 4F7HA 2L2IA 3DXDA 2DKPA 2J0JA 3WA0A 1RRPB 2YVCA 4A6FB 5J3YA 4PQ0A 4XWXA 3PVUA 5C16A 5IRSA 4H8SA 2RSGA 1U5GA 3TCAA 5C6RA 1FHXA 2YT2A 1UPRA 2Z0PA 2DA0A 2ROZB 1XR0B 3DXEA 3T06A 2ZKMX 1B55A 4CYEA 2QKLA 4NSWA 1PFJA 2ROVA 3G9WA 5FI0A 2DHKA 4MK0A 1RJ2A 2D9ZA 3KSYA 2GJYA 1LB1A 5FI1A 2UZRA 4WVFB 4GOUA 4K17A 1XX0A 1WGUA 2IYBA 1X1FA 2KUPA 4HAYB 4EMOA 5JLJB 1FOEA 4TKNA 1NI2A 3QWMA 4HAUB 2AL6A 2GUMA 1Q67A 1V89A 3ULCA 4HHVA 2NMBA 2MWNB 5HE3A 3CIKA 4HSIA 4IFSA 2YT0A 2ZPYA 3PP2A 1H10A 2K2JA 4DXAB 2UZSA 3PG7A 1W1GA 1OY2A 5D3YA 2RLOA 2COAA 1AWEA 4A6FA 3FM8C 4GZUA 1V61A 2VSZA 1X86A 2N23A 4OT1A 1V5MA 3VOQA 5HE1A 3HK0A 2PZ1A 4MY6A 1MPHA 1DYNA 5D27A 4A6HA 2YF0A 1DDVA 2AEHA 2Z0OA 1Y19B 1U5EA 2DHJA 2ELBA 2DX1A 2Y7BA 2JP2A 1SGHA 3PVWA 5KCVA 2EC1A 3KZ1A 3VIAA 1QC6A 1V88A 2FJUB 3MPXA 4QXAB 2BCJA 1M7EA 2I1KA 4Z2MB 4DIXA 5CLQB 2DX5A 3WYFB 3UZTA 2R09A 3SNHA 4HB2B 1H4RA 1WG7A 1J19A 1BAKA 3FVCA 5DHFB 2MFQA 3FEHA 2NZ8B 2H7EA 1XCGA 2Y8FA 2MDXA 1Z87A 2K00A 1GC7A 1KZGA 1UNPA 5I2MA 1UEFA 4PNKA 3PSCA 2MKRA 1DDWA 1KZ7A 4KHAA 1TQZA 1W1HA 2CRFA 4QJ5B 4KHOA 2UVMA 1MAIA 4HB3B 4L6EA 1BTKA 1X11A 2I1JA 4QJ4B 4MT7A 1XKEA 1EF1A 1ZC4B 2DLWA 1P6SA 4HB0B 3D8FA 4KHBB 3CXBB 3KRXA 4KAXB 1UPQA 2COCA 2E2XA 3HSAA 1OMWA 2K8EA 4GMXB 1TXDA 2COFA 2YS1A 5EFXA 2Z13A 2CY4A 3KY9A 3ULBA 2RNRB 3V5WA 3PEGA 1P3RA 2ADZA 4BBKA 1MIXA 2D9XA 4CSQA 3X23A 2K49A 1UNQA 3ZVRA 1P5TA 5JHGA 2CY5A 2P0DA 1DDMA 2DFKA 2GS0A 5CLLB 1NTVA 2HE7A 5C5BB 2XQNM 3A98B 4WJ7A 2YS5A 3ODWA 4K2OA 4TYZA 2VRWB 1Y5OA 2DN6A 4ZRKA 2DKQA 2ELAA 1I2HA 2RRFA 4CHJA 5DH9B 4DX90 1V5UA 4YL8A 2V76A 5JP4A 4DX8A 3A58A 4Y94A 4ZRIA 4D6WA 2N0YA 1T77A
chains in the Genus database with same CATH topology
2LULA 1V5PA 3RCPA 1LW3A 2I5CA 1M7RA 1FHWA 1DROA 4GPTB 1EVHA 1QQGA 3PZDA 4HB4B 2YRYA 1U29A 2VKIA 3AU5A 2D9VA 3DXCA 5DHAB 4Z2NA 2J59M 1FB8A 5HE0A 3BINA 2YT1A 4B6HA 2W2XC 1WVHA 4IOYX 2DHIA 5KQ4A 1U2BA 1DBHA 2EMTA 2D9WA 2R0DA 2H7DA 2DTCA 1NU2A 4K81A 2DYQA 4HATB 2P0FA 3D8EA 4DBBA 2LOZA 3A8PA 2Q13A 2D2QA 1IRSA 2Y8GA 3A8QA 2RGNB 4HAWB 1E5WA 2IFSA 5D3VA 1XODA 3M1IB 1ZVRA 3ODXA 2I5FA 2LKOA 2EMSA 3IVFA 3PVLA 1KI1B 3MDBC 5GOWB 2KGXB 2DYNA 2K2UA 3F5RA 1PMSA 4NY0A 3U8ZA 4HDQA 4WSFA 1WJMA 2LYDA 3BJIA 4D0NB 5J3QA 1TJ6A 5J3TA 1X1GA 4YONA 2X18A 4C0AA 1AQCA 2RVBB 1MK9B 2YS3A 2D10A 4ZRJA 3SO6A 3HW2B 1SHCA 2J0MA 2CODA 3P6AA 3FSSA 1K5GB 3AJ4A 1MK7B 4A5KA 2OTXA 1FAOA 5LOPB 4HDOA 4IAPA 4P7IA 1K5DB 4HAZB 3TVVA 2D4QA 3QBVB 4EKUA 1MIZB 3ODOA 4KVGB 2YSZA 3P7ZA 1N3HA 1WJ1A 2G35A 3GYOA 2L1CA 2QKMA 1GG3A 1ZM0A 4A6KA 1J0WA 2J0KA 1WGQA 4GMVA 2Z0QA 4GN1A 3QIJA 1MKEA 2M14A 2W2WA 1FGYA 3LJUX 4K2PA 1EGXA 1WI1A 2EJ8A 1XD4A 2P8VA 3SUZA 3U7DA 2HTHB 3TW1A 1ISNA 4HAXB 3SYXA 3O96A 2D11A 3GYPA 1FGZA 3D8DA 2M38A 3NSUA 2CAYA 2KCJA 3TO1A 2OQBA 5DIFB 5D3XA 1OQNA 2W2XD 5HE2A 5JHHA 3AU4A 1X05A 3OANA 1BTNA 1NTYA 2GCLA 5L81A 1UNRA 3N7CA 2D9YA 1I7AA 5D3WA 3ML4A 2FJLA 1EAZA 3SV1A 5LONB 5C79A 3ZDTA 1PLSA 1W1DA 1ZC3B 1BWNA 5DI9B 5C5BA 4CHMA 3TFMA 3HQCA 1FHOA 3F0WA 3KRWA 2LG1A 4HAVB 1U5DA 1GC6A 2LOXA 4F7UP 1U5FA 4EJNA 1ZSQA 2RUKB 2P0HA 4F7GA 2GCJA 4GXBA 1U27A 5KQ1A 4F7HA 2L2IA 3DXDA 2DKPA 2J0JA 3WA0A 1RRPB 2YVCA 4A6FB 5J3YA 4PQ0A 4XWXA 3PVUA 5C16A 4H8SA 2RSGA 1U5GA 3TCAA 5C6RA 1FHXA 1UPRA 2Z0PA 2DA0A 2ROZB 1XR0B 3DXEA 3T06A 1B55A 4CYEA 2QKLA 4NSWA 1PFJA 2ROVA 3G9WA 5FI0A 2DHKA 4MK0A 1RJ2A 2D9ZA 3KSYA 2GJYA 1LB1A 5FI1A 2UZRA 4WVFB 4K17A 1XX0A 1WGUA 2IYBA 1X1FA 2KUPA 4HAYB 4EMOA 5JLJB 1FOEA 4TKNA 1NI2A 3QWMA 4HAUB 2AL6A 1Q67A 1V89A 3ULCA 4HHVA 2NMBA 2MWNB 5HE3A 3CIKA 4IFSA 2YT0A 2ZPYA 3PP2A 1H10A 2K2JA 4DXAB 2UZSA 3PG7A 1W1GA 1OY2A 5D3YA 2RLOA 2COAA 1AWEA 4A6FA 3FM8C 4GZUA 1V61A 2VSZA 1X86A 2N23A 1V5MA 3VOQA 5HE1A 3HK0A 2PZ1A 4MY6A 1MPHA 1DYNA 5D27A 4A6HA 2YF0A 1DDVA 2AEHA 2Z0OA 1Y19B 1U5EA 2DHJA 2ELBA 2DX1A 2Y7BA 2JP2A 1SGHA 3PVWA 5KCVA 2EC1A 3KZ1A 3VIAA 1QC6A 1V88A 3MPXA 2BCJA 1M7EA 2I1KA 4Z2MB 5CLQB 2DX5A 3WYFB 3UZTA 2R09A 3SNHA 4HB2B 1H4RA 1WG7A 1J19A 1BAKA 5DHFB 2MFQA 3FEHA 2NZ8B 2H7EA 1XCGA 2Y8FA 2MDXA 1Z87A 2K00A 1GC7A 1KZGA 1UNPA 1UEFA 4PNKA 3PSCA 2MKRA 1DDWA 1KZ7A 4KHAA 1TQZA 1W1HA 2CRFA 4KHOA 2UVMA 1MAIA 4HB3B 4L6EA 1BTKA 1X11A 2I1JA 4MT7A 1XKEA 1EF1A 1ZC4B 2DLWA 1P6SA 4HB0B 3D8FA 4KHBB 3CXBB 3KRXA 4KAXB 1UPQA 2COCA 2E2XA 1OMWA 4GMXB 1TXDA 2COFA 2YS1A 5EFXA 3ULBA 2CY4A 3KY9A 2RNRB 3V5WA 3PEGA 1P3RA 2ADZA 4BBKA 1MIXA 2D9XA 3X23A 1UNQA 3ZVRA 1P5TA 5JHGA 2CY5A 2P0DA 1DDMA 2DFKA 2GS0A 5CLLB 1NTVA 2HE7A 5C5BB 2XQNM 3A98B 4WJ7A 2YS5A 3ODWA 4K2OA 4TYZA 2VRWB 1Y5OA 2DN6A 4ZRKA 2DKQA 2ELAA 1I2HA 4CHJA 5DH9B 4DX90 1V5UA 4YL8A 2V76A 5JP4A 4DX8A 4Y94A 4ZRIA 2N0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LUL A;  1V5P A;  3RCP A;  1LW3 A;  2I5C A;  1M7R A;  1FHW A;  1DRO A;  4GPT B;  1EVH A;  1QQG A;  3PZD A;  4HB4 B;  2YRY A;  1U29 A;  2VKI A;  3AU5 A;  2D9V A;  3DXC A;  5DHA B;  4Z2N A;  2J59 M;  1FB8 A;  5HE0 A;  3BIN A;  2YT1 A;  4B6H A;  2W2X C;  1WVH A;  4IOY X;  2DHI A;  5KQ4 A;  1U2B A;  1DBH A;  2EMT A;  2D9W A;  2R0D A;  2H7D A;  2DTC A;  1NU2 A;  4K81 A;  2DYQ A;  4HAT B;  2P0F A;  3D8E A;  4DBB A;  2LOZ A;  3A8P A;  2Q13 A;  2D2Q A;  1IRS A;  2Y8G A;  3A8Q A;  2RGN B;  4HAW B;  1E5W A;  2IFS A;  5D3V A;  1XOD A;  3M1I B;  1ZVR A;  3ODX A;  2I5F A;  2LKO A;  2EMS A;  3IVF A;  3PVL A;  1KI1 B;  3MDB C;  5GOW B;  2KGX B;  2DYN A;  2K2U A;  3F5R A;  1PMS A;  4NY0 A;  3U8Z A;  4HDQ A;  4WSF A;  1WJM A;  2LYD A;  3BJI A;  4D0N B;  5J3Q A;  1TJ6 A;  5J3T A;  1X1G A;  4YON A;  2X18 A;  4C0A A;  1AQC A;  2RVB B;  1MK9 B;  2YS3 A;  2D10 A;  4ZRJ A;  3SO6 A;  3HW2 B;  1SHC A;  2J0M A;  2COD A;  3P6A A;  3FSS A;  1K5G B;  3AJ4 A;  1MK7 B;  4A5K A;  2OTX A;  1FAO A;  5LOP B;  4HDO A;  4IAP A;  4P7I A;  1K5D B;  4HAZ B;  3TVV A;  2D4Q A;  3QBV B;  4EKU A;  1MIZ B;  3ODO A;  4KVG B;  2YSZ A;  3P7Z A;  1N3H A;  1WJ1 A;  2G35 A;  3GYO A;  2L1C A;  2QKM A;  1GG3 A;  1ZM0 A;  4A6K A;  1J0W A;  2J0K A;  1WGQ A;  4GMV A;  2Z0Q A;  4GN1 A;  3QIJ A;  1MKE A;  2M14 A;  2W2W A;  1FGY A;  3LJU X;  4K2P A;  1EGX A;  1WI1 A;  2EJ8 A;  1XD4 A;  2P8V A;  3SUZ A;  3U7D A;  2HTH B;  3TW1 A;  1ISN A;  4HAX B;  3SYX A;  3O96 A;  2D11 A;  3GYP A;  1FGZ A;  3D8D A;  2M38 A;  3NSU A;  2CAY A;  2KCJ A;  3TO1 A;  2OQB A;  5DIF B;  5D3X A;  1OQN A;  2W2X D;  5HE2 A;  5JHH A;  3AU4 A;  1X05 A;  3OAN A;  1BTN A;  1NTY A;  2GCL A;  5L81 A;  1UNR A;  3N7C A;  2D9Y A;  1I7A A;  5D3W A;  3ML4 A;  2FJL A;  1EAZ A;  3SV1 A;  5LON B;  5C79 A;  3ZDT A;  1PLS A;  1W1D A;  1ZC3 B;  1BWN A;  5DI9 B;  5C5B A;  4CHM A;  3TFM A;  3HQC A;  1FHO A;  3F0W A;  3KRW A;  2LG1 A;  4HAV B;  1U5D A;  1GC6 A;  2LOX A;  4F7U P;  1U5F A;  4EJN A;  1ZSQ A;  2RUK B;  2P0H A;  4F7G A;  2GCJ A;  4GXB A;  1U27 A;  5KQ1 A;  4F7H A;  2L2I A;  3DXD A;  2DKP A;  2J0J A;  3WA0 A;  1RRP B;  2YVC A;  4A6F B;  5J3Y A;  4PQ0 A;  4XWX A;  3PVU A;  5C16 A;  4H8S A;  2RSG A;  1U5G A;  3TCA A;  5C6R A;  1FHX A;  1UPR A;  2Z0P A;  2DA0 A;  2ROZ B;  1XR0 B;  3DXE A;  3T06 A;  1B55 A;  4CYE A;  2QKL A;  4NSW A;  1PFJ A;  2ROV A;  3G9W A;  5FI0 A;  2DHK A;  4MK0 A;  1RJ2 A;  2D9Z A;  3KSY A;  2GJY A;  1LB1 A;  5FI1 A;  2UZR A;  4WVF B;  4K17 A;  1XX0 A;  1WGU A;  2IYB A;  1X1F A;  2KUP A;  4HAY B;  4EMO A;  5JLJ B;  1FOE A;  4TKN A;  1NI2 A;  3QWM A;  4HAU B;  2AL6 A;  1Q67 A;  1V89 A;  3ULC A;  4HHV A;  2NMB A;  2MWN B;  5HE3 A;  3CIK A;  4IFS A;  2YT0 A;  2ZPY A;  3PP2 A;  1H10 A;  2K2J A;  4DXA B;  2UZS A;  3PG7 A;  1W1G A;  1OY2 A;  5D3Y A;  2RLO A;  2COA A;  1AWE A;  4A6F A;  3FM8 C;  4GZU A;  1V61 A;  2VSZ A;  1X86 A;  2N23 A;  1V5M A;  3VOQ A;  5HE1 A;  3HK0 A;  2PZ1 A;  4MY6 A;  1MPH A;  1DYN A;  5D27 A;  4A6H A;  2YF0 A;  1DDV A;  2AEH A;  2Z0O A;  1Y19 B;  1U5E A;  2DHJ A;  2ELB A;  2DX1 A;  2Y7B A;  2JP2 A;  1SGH A;  3PVW A;  5KCV A;  2EC1 A;  3KZ1 A;  3VIA A;  1QC6 A;  1V88 A;  3MPX A;  2BCJ A;  1M7E A;  2I1K A;  4Z2M B;  5CLQ B;  2DX5 A;  3WYF B;  3UZT A;  2R09 A;  3SNH A;  4HB2 B;  1H4R A;  1WG7 A;  1J19 A;  1BAK A;  5DHF B;  2MFQ A;  3FEH A;  2NZ8 B;  2H7E A;  1XCG A;  2Y8F A;  2MDX A;  1Z87 A;  2K00 A;  1GC7 A;  1KZG A;  1UNP A;  1UEF A;  4PNK A;  3PSC A;  2MKR A;  1DDW A;  1KZ7 A;  4KHA A;  1TQZ A;  1W1H A;  2CRF A;  4KHO A;  2UVM A;  1MAI A;  4HB3 B;  4L6E A;  1BTK A;  1X11 A;  2I1J A;  4MT7 A;  1XKE A;  1EF1 A;  1ZC4 B;  2DLW A;  1P6S A;  4HB0 B;  3D8F A;  4KHB B;  3CXB B;  3KRX A;  4KAX B;  1UPQ A;  2COC A;  2E2X A;  1OMW A;  4GMX B;  1TXD A;  2COF A;  2YS1 A;  5EFX A;  3ULB A;  2CY4 A;  3KY9 A;  2RNR B;  3V5W A;  3PEG A;  1P3R A;  2ADZ A;  4BBK A;  1MIX A;  2D9X A;  3X23 A;  1UNQ A;  3ZVR A;  1P5T A;  5JHG A;  2CY5 A;  2P0D A;  1DDM A;  2DFK A;  2GS0 A;  5CLL B;  1NTV A;  2HE7 A;  5C5B B;  2XQN M;  3A98 B;  4WJ7 A;  2YS5 A;  3ODW A;  4K2O A;  4TYZ A;  2VRW B;  1Y5O A;  2DN6 A;  4ZRK A;  2DKQ A;  2ELA A;  1I2H A;  4CHJ A;  5DH9 B;  4DX9 0;  1V5U A;  4YL8 A;  2V76 A;  5JP4 A;  4DX8 A;  4Y94 A;  4ZRI A;  2N0Y A; 
#chains in the Genus database with same CATH topology
 2LUL A;  1V5P A;  3RCP A;  1LW3 A;  2I5C A;  1M7R A;  1FHW A;  1DRO A;  4GPT B;  1EVH A;  1QQG A;  3PZD A;  4HB4 B;  2YRY A;  1U29 A;  2VKI A;  3AU5 A;  2D9V A;  3DXC A;  5DHA B;  4Z2N A;  2J59 M;  1FB8 A;  5HE0 A;  3BIN A;  2YT1 A;  3NW8 A;  4B6H A;  2W2X C;  1WVH A;  2KIE A;  4IOY X;  2DHI A;  5KQ4 A;  4GNK B;  1U2B A;  1DBH A;  2EMT A;  2D9W A;  2R0D A;  2H7D A;  2Z4D A;  2DTC A;  1NU2 A;  4K81 A;  2DYQ A;  4HAT B;  2P0F A;  3D8E A;  4DBB A;  2LOZ A;  3A8P A;  2Q13 A;  2D2Q A;  1IRS A;  2Y8G A;  3A8Q A;  2RGN B;  4HAW B;  1E5W A;  2IFS A;  5D3V A;  1XOD A;  2Z14 A;  3M1I B;  1ZVR A;  3ODX A;  2I5F A;  2LKO A;  2EMS A;  3IVF A;  3PVL A;  1KI1 B;  3MDB C;  5I2S A;  5GOW B;  2KGX B;  2DYN A;  2K2U A;  3F5R A;  1PMS A;  4NY0 A;  3U8Z A;  3B77 A;  4HDQ A;  4WSF A;  1WJM A;  3U12 A;  2LYD A;  3BJI A;  4D0N B;  5J3Q A;  2NBV A;  1TJ6 A;  5J3T A;  1X1G A;  4YON A;  2X18 A;  4C0A A;  1AQC A;  2RVB B;  1MK9 B;  2YS3 A;  2D10 A;  4ZRJ A;  3SO6 A;  2KR0 A;  3HW2 B;  1SHC A;  2J0M A;  2COD A;  3P6A A;  3FSS A;  1K5G B;  3AJ4 A;  1MK7 B;  4A5K A;  2OTX A;  1FAO A;  5LOP B;  4HDO A;  4IAP A;  3DCX A;  4P7I A;  1K5D B;  4HAZ B;  3TVV A;  2D4Q A;  3QBV B;  4EKU A;  1MIZ B;  3ODO A;  4KVG B;  2YSZ A;  3P7Z A;  1N3H A;  1WJ1 A;  2G35 A;  3GYO A;  2L1C A;  2QKM A;  1MI1 A;  1GG3 A;  1ZM0 A;  4A6K A;  1J0W A;  2J0K A;  1WGQ A;  4GMV A;  2Z0Q A;  4GN1 A;  3QIJ A;  1MKE A;  2M14 A;  4KHB A;  2W2W A;  1FGY A;  3LJU X;  3NWF A;  4K2P A;  4QJ3 B;  1EGX A;  1WI1 A;  2EJ8 A;  4OSN A;  1XD4 A;  2P8V A;  3SUZ A;  3U7D A;  2HTH B;  3TW1 A;  1ISN A;  4HAX B;  3SYX A;  3O96 A;  2D11 A;  3GYP A;  5LG4 B;  1FGZ A;  3D8D A;  2M38 A;  3NSU A;  2CAY A;  2KCJ A;  3TO1 A;  2OQB A;  5DIF B;  5D3X A;  1OQN A;  2W2X D;  5HE2 A;  5JHH A;  3AU4 A;  1X05 A;  3OAN A;  1BTN A;  1NTY A;  2GCL A;  3NWA A;  5L81 A;  2KUQ A;  3HIE A;  1UNR A;  3N7C A;  2D9Y A;  1I7A A;  4L1R A;  5D3W A;  3ML4 A;  2FJL A;  1EAZ A;  3SV1 A;  5LON B;  5C79 A;  3ZDT A;  1PLS A;  1W1D A;  1ZC3 B;  1BWN A;  5DI9 B;  5C5B A;  4CHM A;  5M4Y B;  3TFM A;  3HQC A;  1FHO A;  3F0W A;  3KRW A;  2LG1 A;  4HAV B;  1U5D A;  3OHM B;  1GC6 A;  2LOX A;  4F7U P;  2Z59 A;  1U5F A;  4EJN A;  1ZSQ A;  3NWD A;  2R2Y A;  2RUK B;  2P0H A;  1ZYI A;  2KIG A;  4F7G A;  2GCJ A;  4GXB A;  1U27 A;  5KQ1 A;  4F7H A;  2L2I A;  3DXD A;  2DKP A;  2J0J A;  3WA0 A;  1RRP B;  2YVC A;  4A6F B;  5J3Y A;  4PQ0 A;  4XWX A;  3PVU A;  5C16 A;  5IRS A;  4H8S A;  2RSG A;  1U5G A;  3TCA A;  5C6R A;  1FHX A;  2YT2 A;  1UPR A;  2Z0P A;  2DA0 A;  2ROZ B;  1XR0 B;  3DXE A;  3T06 A;  2ZKM X;  1B55 A;  4CYE A;  2QKL A;  4NSW A;  1PFJ A;  2ROV A;  3G9W A;  5FI0 A;  2DHK A;  4MK0 A;  1RJ2 A;  2D9Z A;  3KSY A;  2GJY A;  1LB1 A;  5FI1 A;  2UZR A;  4WVF B;  4GOU A;  4K17 A;  1XX0 A;  1WGU A;  2IYB A;  1X1F A;  2KUP A;  4HAY B;  4EMO A;  5JLJ B;  1FOE A;  4TKN A;  1NI2 A;  3QWM A;  4HAU B;  2AL6 A;  2GUM A;  1Q67 A;  1V89 A;  3ULC A;  4HHV A;  2NMB A;  2MWN B;  5HE3 A;  3CIK A;  4HSI A;  4IFS A;  2YT0 A;  2ZPY A;  3PP2 A;  1H10 A;  2K2J A;  4DXA B;  2UZS A;  3PG7 A;  1W1G A;  1OY2 A;  5D3Y A;  2RLO A;  2COA A;  1AWE A;  4A6F A;  3FM8 C;  4GZU A;  1V61 A;  2VSZ A;  1X86 A;  2N23 A;  4OT1 A;  1V5M A;  3VOQ A;  5HE1 A;  3HK0 A;  2PZ1 A;  4MY6 A;  1MPH A;  1DYN A;  5D27 A;  4A6H A;  2YF0 A;  1DDV A;  2AEH A;  2Z0O A;  1Y19 B;  1U5E A;  2DHJ A;  2ELB A;  2DX1 A;  2Y7B A;  2JP2 A;  1SGH A;  3PVW A;  5KCV A;  2EC1 A;  3KZ1 A;  3VIA A;  1QC6 A;  1V88 A;  2FJU B;  3MPX A;  4QXA B;  2BCJ A;  1M7E A;  2I1K A;  4Z2M B;  4DIX A;  5CLQ B;  2DX5 A;  3WYF B;  3UZT A;  2R09 A;  3SNH A;  4HB2 B;  1H4R A;  1WG7 A;  1J19 A;  1BAK A;  3FVC A;  5DHF B;  2MFQ A;  3FEH A;  2NZ8 B;  2H7E A;  1XCG A;  2Y8F A;  2MDX A;  1Z87 A;  2K00 A;  1GC7 A;  1KZG A;  1UNP A;  5I2M A;  1UEF A;  4PNK A;  3PSC A;  2MKR A;  1DDW A;  1KZ7 A;  4KHA A;  1TQZ A;  1W1H A;  2CRF A;  4QJ5 B;  4KHO A;  2UVM A;  1MAI A;  4HB3 B;  4L6E A;  1BTK A;  1X11 A;  2I1J A;  4QJ4 B;  4MT7 A;  1XKE A;  1EF1 A;  1ZC4 B;  2DLW A;  1P6S A;  4HB0 B;  3D8F A;  4KHB B;  3CXB B;  3KRX A;  4KAX B;  1UPQ A;  2COC A;  2E2X A;  3HSA A;  1OMW A;  2K8E A;  4GMX B;  1TXD A;  2COF A;  2YS1 A;  5EFX A;  2Z13 A;  2CY4 A;  3KY9 A;  3ULB A;  2RNR B;  3V5W A;  3PEG A;  1P3R A;  2ADZ A;  4BBK A;  1MIX A;  2D9X A;  4CSQ A;  3X23 A;  2K49 A;  1UNQ A;  3ZVR A;  1P5T A;  5JHG A;  2CY5 A;  2P0D A;  1DDM A;  2DFK A;  2GS0 A;  5CLL B;  1NTV A;  2HE7 A;  5C5B B;  2XQN M;  3A98 B;  4WJ7 A;  2YS5 A;  3ODW A;  4K2O A;  4TYZ A;  2VRW B;  1Y5O A;  2DN6 A;  4ZRK A;  2DKQ A;  2ELA A;  1I2H A;  2RRF A;  4CHJ A;  5DH9 B;  4DX9 0;  1V5U A;  4YL8 A;  2V76 A;  5JP4 A;  4DX8 A;  3A58 A;  4Y94 A;  4ZRI A;  4D6W A;  2N0Y A;  1T77 A; 
#chains in the Genus database with same CATH homology
 2LUL A;  1V5P A;  3RCP A;  1LW3 A;  2I5C A;  1M7R A;  1FHW A;  1DRO A;  4GPT B;  1EVH A;  1QQG A;  3PZD A;  4HB4 B;  2YRY A;  1U29 A;  2VKI A;  3AU5 A;  2D9V A;  3DXC A;  5DHA B;  4Z2N A;  2J59 M;  1FB8 A;  5HE0 A;  3BIN A;  2YT1 A;  4B6H A;  2W2X C;  1WVH A;  4IOY X;  2DHI A;  5KQ4 A;  1U2B A;  1DBH A;  2EMT A;  2D9W A;  2R0D A;  2H7D A;  2DTC A;  1NU2 A;  4K81 A;  2DYQ A;  4HAT B;  2P0F A;  3D8E A;  4DBB A;  2LOZ A;  3A8P A;  2Q13 A;  2D2Q A;  1IRS A;  2Y8G A;  3A8Q A;  2RGN B;  4HAW B;  1E5W A;  2IFS A;  5D3V A;  1XOD A;  3M1I B;  1ZVR A;  3ODX A;  2I5F A;  2LKO A;  2EMS A;  3IVF A;  3PVL A;  1KI1 B;  3MDB C;  5GOW B;  2KGX B;  2DYN A;  2K2U A;  3F5R A;  1PMS A;  4NY0 A;  3U8Z A;  4HDQ A;  4WSF A;  1WJM A;  2LYD A;  3BJI A;  4D0N B;  5J3Q A;  1TJ6 A;  5J3T A;  1X1G A;  4YON A;  2X18 A;  4C0A A;  1AQC A;  2RVB B;  1MK9 B;  2YS3 A;  2D10 A;  4ZRJ A;  3SO6 A;  3HW2 B;  1SHC A;  2J0M A;  2COD A;  3P6A A;  3FSS A;  1K5G B;  3AJ4 A;  1MK7 B;  4A5K A;  2OTX A;  1FAO A;  5LOP B;  4HDO A;  4IAP A;  4P7I A;  1K5D B;  4HAZ B;  3TVV A;  2D4Q A;  3QBV B;  4EKU A;  1MIZ B;  3ODO A;  4KVG B;  2YSZ A;  3P7Z A;  1N3H A;  1WJ1 A;  2G35 A;  3GYO A;  2L1C A;  2QKM A;  1GG3 A;  1ZM0 A;  4A6K A;  1J0W A;  2J0K A;  1WGQ A;  4GMV A;  2Z0Q A;  4GN1 A;  3QIJ A;  1MKE A;  2M14 A;  2W2W A;  1FGY A;  3LJU X;  4K2P A;  1EGX A;  1WI1 A;  2EJ8 A;  1XD4 A;  2P8V A;  3SUZ A;  3U7D A;  2HTH B;  3TW1 A;  1ISN A;  4HAX B;  3SYX A;  3O96 A;  2D11 A;  3GYP A;  1FGZ A;  3D8D A;  2M38 A;  3NSU A;  2CAY A;  2KCJ A;  3TO1 A;  2OQB A;  5DIF B;  5D3X A;  1OQN A;  2W2X D;  5HE2 A;  5JHH A;  3AU4 A;  1X05 A;  3OAN A;  1BTN A;  1NTY A;  2GCL A;  5L81 A;  1UNR A;  3N7C A;  2D9Y A;  1I7A A;  5D3W A;  3ML4 A;  2FJL A;  1EAZ A;  3SV1 A;  5LON B;  5C79 A;  3ZDT A;  1PLS A;  1W1D A;  1ZC3 B;  1BWN A;  5DI9 B;  5C5B A;  4CHM A;  3TFM A;  3HQC A;  1FHO A;  3F0W A;  3KRW A;  2LG1 A;  4HAV B;  1U5D A;  1GC6 A;  2LOX A;  4F7U P;  1U5F A;  4EJN A;  1ZSQ A;  2RUK B;  2P0H A;  4F7G A;  2GCJ A;  4GXB A;  1U27 A;  5KQ1 A;  4F7H A;  2L2I A;  3DXD A;  2DKP A;  2J0J A;  3WA0 A;  1RRP B;  2YVC A;  4A6F B;  5J3Y A;  4PQ0 A;  4XWX A;  3PVU A;  5C16 A;  4H8S A;  2RSG A;  1U5G A;  3TCA A;  5C6R A;  1FHX A;  1UPR A;  2Z0P A;  2DA0 A;  2ROZ B;  1XR0 B;  3DXE A;  3T06 A;  1B55 A;  4CYE A;  2QKL A;  4NSW A;  1PFJ A;  2ROV A;  3G9W A;  5FI0 A;  2DHK A;  4MK0 A;  1RJ2 A;  2D9Z A;  3KSY A;  2GJY A;  1LB1 A;  5FI1 A;  2UZR A;  4WVF B;  4K17 A;  1XX0 A;  1WGU A;  2IYB A;  1X1F A;  2KUP A;  4HAY B;  4EMO A;  5JLJ B;  1FOE A;  4TKN A;  1NI2 A;  3QWM A;  4HAU B;  2AL6 A;  1Q67 A;  1V89 A;  3ULC A;  4HHV A;  2NMB A;  2MWN B;  5HE3 A;  3CIK A;  4IFS A;  2YT0 A;  2ZPY A;  3PP2 A;  1H10 A;  2K2J A;  4DXA B;  2UZS A;  3PG7 A;  1W1G A;  1OY2 A;  5D3Y A;  2RLO A;  2COA A;  1AWE A;  4A6F A;  3FM8 C;  4GZU A;  1V61 A;  2VSZ A;  1X86 A;  2N23 A;  1V5M A;  3VOQ A;  5HE1 A;  3HK0 A;  2PZ1 A;  4MY6 A;  1MPH A;  1DYN A;  5D27 A;  4A6H A;  2YF0 A;  1DDV A;  2AEH A;  2Z0O A;  1Y19 B;  1U5E A;  2DHJ A;  2ELB A;  2DX1 A;  2Y7B A;  2JP2 A;  1SGH A;  3PVW A;  5KCV A;  2EC1 A;  3KZ1 A;  3VIA A;  1QC6 A;  1V88 A;  3MPX A;  2BCJ A;  1M7E A;  2I1K A;  4Z2M B;  5CLQ B;  2DX5 A;  3WYF B;  3UZT A;  2R09 A;  3SNH A;  4HB2 B;  1H4R A;  1WG7 A;  1J19 A;  1BAK A;  5DHF B;  2MFQ A;  3FEH A;  2NZ8 B;  2H7E A;  1XCG A;  2Y8F A;  2MDX A;  1Z87 A;  2K00 A;  1GC7 A;  1KZG A;  1UNP A;  1UEF A;  4PNK A;  3PSC A;  2MKR A;  1DDW A;  1KZ7 A;  4KHA A;  1TQZ A;  1W1H A;  2CRF A;  4KHO A;  2UVM A;  1MAI A;  4HB3 B;  4L6E A;  1BTK A;  1X11 A;  2I1J A;  4MT7 A;  1XKE A;  1EF1 A;  1ZC4 B;  2DLW A;  1P6S A;  4HB0 B;  3D8F A;  4KHB B;  3CXB B;  3KRX A;  4KAX B;  1UPQ A;  2COC A;  2E2X A;  1OMW A;  4GMX B;  1TXD A;  2COF A;  2YS1 A;  5EFX A;  3ULB A;  2CY4 A;  3KY9 A;  2RNR B;  3V5W A;  3PEG A;  1P3R A;  2ADZ A;  4BBK A;  1MIX A;  2D9X A;  3X23 A;  1UNQ A;  3ZVR A;  1P5T A;  5JHG A;  2CY5 A;  2P0D A;  1DDM A;  2DFK A;  2GS0 A;  5CLL B;  1NTV A;  2HE7 A;  5C5B B;  2XQN M;  3A98 B;  4WJ7 A;  2YS5 A;  3ODW A;  4K2O A;  4TYZ A;  2VRW B;  1Y5O A;  2DN6 A;  4ZRK A;  2DKQ A;  2ELA A;  1I2H A;  4CHJ A;  5DH9 B;  4DX9 0;  1V5U A;  4YL8 A;  2V76 A;  5JP4 A;  4DX8 A;  4Y94 A;  4ZRI A;  2N0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...