3TFMA

Myosin x ph1n-ph2-ph1c tandem
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
208
structure length
208
Chain Sequence
PYFHSFLYMNGGLMNSWKRRWCVLKDETFLWFRSKQEALKQGWLHNNGGGSSTLSRRNWKKRWFVLRQSKLMYFENDSEEKLKGTVEVRSAKEIIDNTNKENGIDIIMADRTFHLIAESPEDASQWFSVLSQVHSSTDQEIREMHDEQANPQNAVGTLDVGLIDSVCASDSPDRPNSFVIITANRVLHCNADTPEEMHHWITLLQRSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin X
publication title Structural basis of the myosin X PH1N-PH2-PH1C tandem as a specific and acute cellular PI(3,4,5)P3 sensor
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Motor protein
total genus 50
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2011-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3tfmA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3tfmA01
2D9XA 3LJUX 3AU4A 1TQZA 2J0JA 1UEFA 2QKMA 1KZGA 3ULCA 5DHAB 1IRSA 3P6AA 5DHFB 1Q67A 1V5PA 5L81A 3T06A 1DBHA 3NSUA 1TJ6A 1SHCA 1WJ1A 5DI9B 2DX1A 4GPTB 4K81A 1WJMA 3A8QA 1J19A 4GXBA 2DHKA 3TO1A 3TVVA 1PMSA 1RRPB 1V88A 3V5WA 2XQNM 4F7UP 4MY6A 5HE1A 3HK0A 2CY4A 3KZ1A 3SYXA 4GN1A 5FI0A 5D3YA 3IVFA 4F7GA 1KZ7A 2KUPA 2LKOA 3ODXA 4ZRJA 1U27A 2CRFA 2YS5A 2KGXB 2P0DA 3HQCA 3VOQA 2Z0QA 3MDBC 1FHWA 5C5BA 5HE2A 5C5BB 2RVBB 1H4RA 4HHVA 2G35A 3PZDA 4CHJA 2COCA 1KI1B 5D3WA 3FM8C 1FGZA 3A8PA 5J3YA 1PLSA 2DN6A 4KAXB 3ZVRA 3ODWA 3QIJA 2COAA 5KQ1A 3WYFB 3X23A 3SO6A 3U8ZA 2K00A 2P0FA 1P3RA 3RCPA 2UVMA 2AEHA 1MPHA 3SNHA 1DROA 5DIFB 4DXAB 2RGNB 4P7IA 1WI1A 1ZVRA 1U5GA 3FEHA 3TW1A 5C6RA 1UNRA 5LOPB 1GG3A 1V5MA 2D9VA 3PEGA 4HAXB 1EF1A 2M14A 2YVCA 2DX5A 4HAYB 5J3QA 5D27A 1OMWA 2MWNB 2Y7BA 5KQ4A 4DBBA 5HE3A 1XCGA 2GJYA 4DX90 2J0MA 1Z87A 2RSGA 2X18A 4H8SA 5JLJB 3SUZA 1UPRA 2DKPA 2EC1A 1ISNA 3KRWA 1J0WA 3WA0A 4Z2NA 4MK0A 2ELAA 2NZ8B 1N3HA 1DYNA 2LYDA 2UZRA 4HAVB 3D8EA 2BCJA 3DXEA 3PVLA 4K17A 2MFQA 2YRYA 3DXDA 1W1GA 4HATB 1FOEA 1W1HA 1BTNA 2I5FA 1U5FA 1Y19B 2H7DA 4HB0B 2QKLA 1EVHA 4KHBB 2YSZA 4PNKA 1K5GB 2R0DA 1AWEA 1X11A 1XR0B 3F0WA 5JHGA 1DDWA 2VRWB 2Y8FA 3QBVB 1ZSQA 4Y94A 4IFSA 5GOWB 2HTHB 4HB4B 1V89A 3TCAA 3ULBA 1SGHA 5CLQB 5EFXA 4XWXA 2ROVA 2ROZB 3VIAA 1XKEA 4A6FA 4D0NB 2FJLA 2DKQA 2DFKA 4A6FB 3KRXA 2K2UA 1I7AA 2YF0A 1M7EA 2J59M 2D9ZA 4C0AA 2MKRA 1WG7A 3QWMA 1WGQA 5JHHA 4BBKA 2IYBA 3TFMA 1XD4A 2D9WA 4IAPA 4EJNA 1OY2A 1QC6A 4GZUA 3ZDTA 4Z2MB 3A98B 3DXCA 1NTYA 1ZM0A 2UZSA 2P0HA 3OANA 3SV1A 3BJIA 4GMVA 2N23A 1BAKA 4TKNA 2ELBA 2LOXA 4HDOA 4HDQA 4HAUB 4TYZA 1MAIA 2D10A 1UNQA 2CODA 1X1GA 1H10A 1ZC4B 1AQCA 3G9WA 2AL6A 4NY0A 1QQGA 1U2BA 4L6EA 2EMSA 3MPXA 4NSWA 2MDXA 3ML4A 5D3XA 2IFSA 1B55A 1X1FA 3AU5A 2Z0PA 4EMOA 1M7RA 2CY5A 1MK7B 2RUKB 2VKIA 1BWNA 2W2XD 5KCVA 1LB1A 4YONA 2ZPYA 5FI1A 2ADZA 1NI2A 2OQBA 3M1IB 2DYQA 2CAYA 1FB8A 4K2OA 2COFA 4IOYX 2W2XC 1MIXA 2RLOA 1BTKA 3PG7A 2VSZA 3D8FA 4CHMA 2EJ8A 3P7ZA 2DYNA 4B6HA 3KY9A 1X05A 1XX0A 1V5UA 2HE7A 4YL8A 1V61A 4CYEA 5CLLB 1EGXA 2P8VA 1MK9B 4ZRIA 5LONB 2E2XA 5HE0A 1Y5OA 3CIKA 1TXDA 1WGUA 4WSFA 4WVFB 2EMTA 2LG1A 4DX8A 1UPQA 3FSSA 5C79A 3D8DA 5JP4A 2OTXA 2I5CA 1K5DB 2H7EA 2GS0A 4MT7A 2R09A 4F7HA 1ZC3B 4A6HA 1W1DA 1OQNA 4HAWB 2K2JA 1LW3A 1X86A 1GC6A 2PZ1A 4WJ7A 1DDVA 1GC7A 2DA0A 3PSCA 5D3VA 2YS3A 1EAZA 2Y8GA 4HAZB 2KCJA 2DHJA 2L2IA 2YT0A 4ZRKA 4KVGB 1FAOA 2M38A 1MIZB 4KHOA 3GYOA 4KHAA 2D9YA 3PVWA 4A6KA 2JP2A 2L1CA 3N7CA 3GYPA 4K2PA 5C16A 2D11A 5J3TA 3KSYA 4EKUA 5DH9B 4GMXB 4A5KA 2N0YA 2D4QA 3AJ4A 1P6SA 3UZTA 3U7DA 2LOZA 3PP2A 3ODOA 3HW2B 3PVUA 1WVHA 2I1KA 2YS1A 1FHXA 1U5DA 2NMBA 1FHOA 3F5RA 3BINA 2V76A 4HB3B 2DTCA 2Q13A 2RNRB 2YT1A 2D2QA 2LULA 1I2HA 2DLWA 1UNPA 2W2WA 1XODA 1DDMA 2DHIA 2Z0OA 1P5TA 1MKEA 1E5WA 2J0KA 1NTVA 3O96A 2GCLA 2I1JA 3CXBB 1FGYA 1U29A 1RJ2A 4HB2B 4PQ0A 1U5EA 1NU2A 1PFJA 2GCJA
chains in the Genus database with same CATH superfamily
2D9XA 3LJUX 3AU4A 1TQZA 2J0JA 4L1RA 1UEFA 2QKMA 1KZGA 3ULCA 5DHAB 1IRSA 3P6AA 5DHFB 1Q67A 1V5PA 5L81A 3T06A 1DBHA 3NSUA 1TJ6A 1SHCA 1WJ1A 5DI9B 2DX1A 2KUQA 4GPTB 4K81A 1WJMA 3A8QA 1J19A 4GXBA 2DHKA 3TO1A 3TVVA 1PMSA 1RRPB 1V88A 3V5WA 2XQNM 4F7UP 4MY6A 5HE1A 1MI1A 3HK0A 2CY4A 3KZ1A 3SYXA 4GN1A 5FI0A 5D3YA 3IVFA 4F7GA 1KZ7A 2KUPA 2LKOA 3ODXA 4ZRJA 1U27A 2CRFA 2YS5A 2KGXB 2P0DA 3HQCA 3VOQA 2Z0QA 3MDBC 2RRFA 5IRSA 1FHWA 5C5BA 2FJUB 5HE2A 2GUMA 5C5BB 2RVBB 1H4RA 4CSQA 4HHVA 2G35A 3PZDA 4CHJA 2COCA 1KI1B 4QXAB 3FM8C 5D3WA 1FGZA 3A8PA 5J3YA 2K8EA 1PLSA 2DN6A 4KAXB 3ZVRA 3ODWA 3QIJA 2COAA 5KQ1A 3WYFB 3X23A 3SO6A 3U8ZA 2K00A 2P0FA 1P3RA 3RCPA 2UVMA 2AEHA 1MPHA 3SNHA 1DROA 2KIEA 5DIFB 4DXAB 2RGNB 4P7IA 1WI1A 1ZVRA 1U5GA 3FEHA 3TW1A 3FVCA 5C6RA 1UNRA 5LOPB 1GG3A 1V5MA 2D9VA 3PEGA 4HAXB 1EF1A 2M14A 2YVCA 2DX5A 4HAYB 5J3QA 5D27A 1OMWA 2MWNB 2Y7BA 5KQ4A 4DBBA 5HE3A 1XCGA 2GJYA 4DX90 2ZKMX 2J0MA 1Z87A 2RSGA 2X18A 4H8SA 5JLJB 3SUZA 1UPRA 2DKPA 2EC1A 1ISNA 3KRWA 1J0WA 3WA0A 4Z2NA 4MK0A 2ELAA 2NZ8B 1N3HA 1DYNA 2LYDA 2UZRA 4HAVB 3D8EA 2BCJA 3DXEA 3PVLA 4K17A 5I2SA 2MFQA 2YRYA 3DXDA 1W1GA 4HATB 1FOEA 1ZYIA 4KHBA 3NWAA 1W1HA 1BTNA 2I5FA 4OT1A 1U5FA 1Y19B 2H7DA 4HB0B 2QKLA 1EVHA 4KHBB 2YSZA 4PNKA 1K5GB 2R0DA 1AWEA 2Z59A 1X11A 1XR0B 3F0WA 5JHGA 1DDWA 2VRWB 2Y8FA 3QBVB 1ZSQA 4Y94A 4IFSA 5M4YB 5GOWB 2HTHB 4HB4B 1V89A 3TCAA 3ULBA 1SGHA 4OSNA 5CLQB 5EFXA 4XWXA 2ROVA 2ROZB 3VIAA 1XKEA 4A6FA 4D0NB 2FJLA 2DKQA 2DFKA 4A6FB 3KRXA 2K2UA 1I7AA 2YF0A 1M7EA 2J59M 2K49A 2D9ZA 4C0AA 2MKRA 1WG7A 3QWMA 1WGQA 5JHHA 4BBKA 2IYBA 3TFMA 1XD4A 2D9WA 4IAPA 4EJNA 1OY2A 1QC6A 4GZUA 3ZDTA 3U12A 4Z2MB 3A98B 3DXCA 4HSIA 1NTYA 5I2MA 1ZM0A 2UZSA 2P0HA 3OANA 3SV1A 4QJ3B 3BJIA 4GMVA 2R2YA 2N23A 1BAKA 4TKNA 2ELBA 2LOXA 2KIGA 4HDOA 4HDQA 2Z14A 4HAUB 4TYZA 1MAIA 2D10A 1UNQA 2CODA 1X1GA 1H10A 1ZC4B 1AQCA 3G9WA 2AL6A 4NY0A 1QQGA 1U2BA 4L6EA 2EMSA 3MPXA 4NSWA 4D6WA 3HSAA 2MDXA 3ML4A 5D3XA 2IFSA 1B55A 1X1FA 3AU5A 2Z0PA 4EMOA 1M7RA 4DIXA 2CY5A 1MK7B 2RUKB 2VKIA 1BWNA 2W2XD 5KCVA 1LB1A 4YONA 2ZPYA 5FI1A 2ADZA 1NI2A 2OQBA 3M1IB 2DYQA 2CAYA 1FB8A 4K2OA 2COFA 4IOYX 2W2XC 1MIXA 2RLOA 4QJ4B 1BTKA 3PG7A 2VSZA 3D8FA 4CHMA 2EJ8A 3P7ZA 2DYNA 4B6HA 3KY9A 1X05A 1XX0A 1V5UA 2HE7A 4YL8A 1V61A 4QJ5B 3NW8A 4CYEA 5CLLB 1EGXA 2P8VA 1MK9B 4ZRIA 5LONB 2E2XA 5HE0A 1Y5OA 3CIKA 1TXDA 1WGUA 4WSFA 4WVFB 2EMTA 2LG1A 4DX8A 1UPQA 3FSSA 5C79A 3OHMB 3D8DA 5JP4A 2OTXA 2I5CA 1K5DB 2H7EA 2GS0A 4MT7A 2R09A 4F7HA 1ZC3B 4A6HA 1W1DA 1OQNA 3NWFA 4HAWB 2K2JA 1LW3A 3HIEA 1X86A 1GC6A 2PZ1A 4WJ7A 1DDVA 2NBVA 1GC7A 2DA0A 3PSCA 5D3VA 2YS3A 3A58A 1EAZA 2Y8GA 4HAZB 2KCJA 2DHJA 2L2IA 2YT0A 4ZRKA 4KVGB 2Z13A 1FAOA 2M38A 1MIZB 4KHOA 3GYOA 2Z4DA 4KHAA 2D9YA 3PVWA 3DCXA 4A6KA 2JP2A 2L1CA 3N7CA 3GYPA 4GOUA 3NWDA 4K2PA 5C16A 2D11A 5J3TA 3KSYA 4EKUA 5DH9B 4GMXB 4A5KA 2N0YA 2D4QA 3AJ4A 1P6SA 3UZTA 3U7DA 2LOZA 3PP2A 3ODOA 3HW2B 3PVUA 2YT2A 1WVHA 2I1KA 2KR0A 2YS1A 1FHXA 1U5DA 2NMBA 1FHOA 3B77A 3F5RA 3BINA 2V76A 4HB3B 2DTCA 2Q13A 2RNRB 2YT1A 2D2QA 4GNKB 2LULA 1I2HA 2DLWA 1UNPA 2W2WA 1XODA 5LG4B 1DDMA 2DHIA 2Z0OA 1P5TA 1MKEA 1E5WA 2J0KA 1NTVA 3O96A 2GCLA 2I1JA 3CXBB 1FGYA 1U29A 1RJ2A 4HB2B 4PQ0A 1U5EA 1NU2A 1PFJA 1T77A 2GCJA
chains in the Genus database with same CATH topology
2D9XA 3LJUX 3AU4A 1TQZA 2J0JA 1UEFA 2QKMA 1KZGA 3ULCA 5DHAB 1IRSA 3P6AA 5DHFB 1Q67A 1V5PA 5L81A 3T06A 1DBHA 3NSUA 1TJ6A 1SHCA 1WJ1A 5DI9B 2DX1A 4GPTB 4K81A 1WJMA 3A8QA 1J19A 4GXBA 2DHKA 3TO1A 3TVVA 1PMSA 1RRPB 1V88A 3V5WA 2XQNM 4F7UP 4MY6A 5HE1A 3HK0A 2CY4A 3KZ1A 3SYXA 4GN1A 5FI0A 5D3YA 3IVFA 4F7GA 1KZ7A 2KUPA 2LKOA 3ODXA 4ZRJA 1U27A 2CRFA 2YS5A 2KGXB 2P0DA 3HQCA 3VOQA 2Z0QA 3MDBC 1FHWA 5C5BA 5HE2A 5C5BB 2RVBB 1H4RA 4HHVA 2G35A 3PZDA 4CHJA 2COCA 1KI1B 5D3WA 3FM8C 1FGZA 3A8PA 5J3YA 1PLSA 2DN6A 4KAXB 3ZVRA 3ODWA 3QIJA 2COAA 5KQ1A 3WYFB 3X23A 3SO6A 3U8ZA 2K00A 2P0FA 1P3RA 3RCPA 2UVMA 2AEHA 1MPHA 3SNHA 1DROA 5DIFB 4DXAB 2RGNB 4P7IA 1WI1A 1ZVRA 1U5GA 3FEHA 3TW1A 5C6RA 1UNRA 5LOPB 1GG3A 1V5MA 2D9VA 3PEGA 4HAXB 1EF1A 2M14A 2YVCA 2DX5A 4HAYB 5J3QA 5D27A 1OMWA 2MWNB 2Y7BA 5KQ4A 4DBBA 5HE3A 1XCGA 2GJYA 4DX90 2J0MA 1Z87A 2RSGA 2X18A 4H8SA 5JLJB 3SUZA 1UPRA 2DKPA 2EC1A 1ISNA 3KRWA 1J0WA 3WA0A 4Z2NA 4MK0A 2ELAA 2NZ8B 1N3HA 1DYNA 2LYDA 2UZRA 4HAVB 3D8EA 2BCJA 3DXEA 3PVLA 4K17A 2MFQA 2YRYA 3DXDA 1W1GA 4HATB 1FOEA 1W1HA 1BTNA 2I5FA 1U5FA 1Y19B 2H7DA 4HB0B 2QKLA 1EVHA 4KHBB 2YSZA 4PNKA 1K5GB 2R0DA 1AWEA 1X11A 1XR0B 3F0WA 5JHGA 1DDWA 2VRWB 2Y8FA 3QBVB 1ZSQA 4Y94A 4IFSA 5GOWB 2HTHB 4HB4B 1V89A 3TCAA 3ULBA 1SGHA 5CLQB 5EFXA 4XWXA 2ROVA 2ROZB 3VIAA 1XKEA 4A6FA 4D0NB 2FJLA 2DKQA 2DFKA 4A6FB 3KRXA 2K2UA 1I7AA 2YF0A 1M7EA 2J59M 2D9ZA 4C0AA 2MKRA 1WG7A 3QWMA 1WGQA 5JHHA 4BBKA 2IYBA 3TFMA 1XD4A 2D9WA 4IAPA 4EJNA 1OY2A 1QC6A 4GZUA 3ZDTA 4Z2MB 3A98B 3DXCA 1NTYA 1ZM0A 2UZSA 2P0HA 3OANA 3SV1A 3BJIA 4GMVA 2N23A 1BAKA 4TKNA 2ELBA 2LOXA 4HDOA 4HDQA 4HAUB 4TYZA 1MAIA 2D10A 1UNQA 2CODA 1X1GA 1H10A 1ZC4B 1AQCA 3G9WA 2AL6A 4NY0A 1QQGA 1U2BA 4L6EA 2EMSA 3MPXA 4NSWA 2MDXA 3ML4A 5D3XA 2IFSA 1B55A 1X1FA 3AU5A 2Z0PA 4EMOA 1M7RA 2CY5A 1MK7B 2RUKB 2VKIA 1BWNA 2W2XD 5KCVA 1LB1A 4YONA 2ZPYA 5FI1A 2ADZA 1NI2A 2OQBA 3M1IB 2DYQA 2CAYA 1FB8A 4K2OA 2COFA 4IOYX 2W2XC 1MIXA 2RLOA 1BTKA 3PG7A 2VSZA 3D8FA 4CHMA 2EJ8A 3P7ZA 2DYNA 4B6HA 3KY9A 1X05A 1XX0A 1V5UA 2HE7A 4YL8A 1V61A 4CYEA 5CLLB 1EGXA 2P8VA 1MK9B 4ZRIA 5LONB 2E2XA 5HE0A 1Y5OA 3CIKA 1TXDA 1WGUA 4WSFA 4WVFB 2EMTA 2LG1A 4DX8A 1UPQA 3FSSA 5C79A 3D8DA 5JP4A 2OTXA 2I5CA 1K5DB 2H7EA 2GS0A 4MT7A 2R09A 4F7HA 1ZC3B 4A6HA 1W1DA 1OQNA 4HAWB 2K2JA 1LW3A 1X86A 1GC6A 2PZ1A 4WJ7A 1DDVA 1GC7A 2DA0A 3PSCA 5D3VA 2YS3A 1EAZA 2Y8GA 4HAZB 2KCJA 2DHJA 2L2IA 2YT0A 4ZRKA 4KVGB 1FAOA 2M38A 1MIZB 4KHOA 3GYOA 4KHAA 2D9YA 3PVWA 4A6KA 2JP2A 2L1CA 3N7CA 3GYPA 4K2PA 5C16A 2D11A 5J3TA 3KSYA 4EKUA 5DH9B 4GMXB 4A5KA 2N0YA 2D4QA 3AJ4A 1P6SA 3UZTA 3U7DA 2LOZA 3PP2A 3ODOA 3HW2B 3PVUA 1WVHA 2I1KA 2YS1A 1FHXA 1U5DA 2NMBA 1FHOA 3F5RA 3BINA 2V76A 4HB3B 2DTCA 2Q13A 2RNRB 2YT1A 2D2QA 2LULA 1I2HA 2DLWA 1UNPA 2W2WA 1XODA 1DDMA 2DHIA 2Z0OA 1P5TA 1MKEA 1E5WA 2J0KA 1NTVA 3O96A 2GCLA 2I1JA 3CXBB 1FGYA 1U29A 1RJ2A 4HB2B 4PQ0A 1U5EA 1NU2A 1PFJA 2GCJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D9X A;  3LJU X;  3AU4 A;  1TQZ A;  2J0J A;  1UEF A;  2QKM A;  1KZG A;  3ULC A;  5DHA B;  1IRS A;  3P6A A;  5DHF B;  1Q67 A;  1V5P A;  5L81 A;  3T06 A;  1DBH A;  3NSU A;  1TJ6 A;  1SHC A;  1WJ1 A;  5DI9 B;  2DX1 A;  4GPT B;  4K81 A;  1WJM A;  3A8Q A;  1J19 A;  4GXB A;  2DHK A;  3TO1 A;  3TVV A;  1PMS A;  1RRP B;  1V88 A;  3V5W A;  2XQN M;  4F7U P;  4MY6 A;  5HE1 A;  3HK0 A;  2CY4 A;  3KZ1 A;  3SYX A;  4GN1 A;  5FI0 A;  5D3Y A;  3IVF A;  4F7G A;  1KZ7 A;  2KUP A;  2LKO A;  3ODX A;  4ZRJ A;  1U27 A;  2CRF A;  2YS5 A;  2KGX B;  2P0D A;  3HQC A;  3VOQ A;  2Z0Q A;  3MDB C;  1FHW A;  5C5B A;  5HE2 A;  5C5B B;  2RVB B;  1H4R A;  4HHV A;  2G35 A;  3PZD A;  4CHJ A;  2COC A;  1KI1 B;  5D3W A;  3FM8 C;  1FGZ A;  3A8P A;  5J3Y A;  1PLS A;  2DN6 A;  4KAX B;  3ZVR A;  3ODW A;  3QIJ A;  2COA A;  5KQ1 A;  3WYF B;  3X23 A;  3SO6 A;  3U8Z A;  2K00 A;  2P0F A;  1P3R A;  3RCP A;  2UVM A;  2AEH A;  1MPH A;  3SNH A;  1DRO A;  5DIF B;  4DXA B;  2RGN B;  4P7I A;  1WI1 A;  1ZVR A;  1U5G A;  3FEH A;  3TW1 A;  5C6R A;  1UNR A;  5LOP B;  1GG3 A;  1V5M A;  2D9V A;  3PEG A;  4HAX B;  1EF1 A;  2M14 A;  2YVC A;  2DX5 A;  4HAY B;  5J3Q A;  5D27 A;  1OMW A;  2MWN B;  2Y7B A;  5KQ4 A;  4DBB A;  5HE3 A;  1XCG A;  2GJY A;  4DX9 0;  2J0M A;  1Z87 A;  2RSG A;  2X18 A;  4H8S A;  5JLJ B;  3SUZ A;  1UPR A;  2DKP A;  2EC1 A;  1ISN A;  3KRW A;  1J0W A;  3WA0 A;  4Z2N A;  4MK0 A;  2ELA A;  2NZ8 B;  1N3H A;  1DYN A;  2LYD A;  2UZR A;  4HAV B;  3D8E A;  2BCJ A;  3DXE A;  3PVL A;  4K17 A;  2MFQ A;  2YRY A;  3DXD A;  1W1G A;  4HAT B;  1FOE A;  1W1H A;  1BTN A;  2I5F A;  1U5F A;  1Y19 B;  2H7D A;  4HB0 B;  2QKL A;  1EVH A;  4KHB B;  2YSZ A;  4PNK A;  1K5G B;  2R0D A;  1AWE A;  1X11 A;  1XR0 B;  3F0W A;  5JHG A;  1DDW A;  2VRW B;  2Y8F A;  3QBV B;  1ZSQ A;  4Y94 A;  4IFS A;  5GOW B;  2HTH B;  4HB4 B;  1V89 A;  3TCA A;  3ULB A;  1SGH A;  5CLQ B;  5EFX A;  4XWX A;  2ROV A;  2ROZ B;  3VIA A;  1XKE A;  4A6F A;  4D0N B;  2FJL A;  2DKQ A;  2DFK A;  4A6F B;  3KRX A;  2K2U A;  1I7A A;  2YF0 A;  1M7E A;  2J59 M;  2D9Z A;  4C0A A;  2MKR A;  1WG7 A;  3QWM A;  1WGQ A;  5JHH A;  4BBK A;  2IYB A;  3TFM A;  1XD4 A;  2D9W A;  4IAP A;  4EJN A;  1OY2 A;  1QC6 A;  4GZU A;  3ZDT A;  4Z2M B;  3A98 B;  3DXC A;  1NTY A;  1ZM0 A;  2UZS A;  2P0H A;  3OAN A;  3SV1 A;  3BJI A;  4GMV A;  2N23 A;  1BAK A;  4TKN A;  2ELB A;  2LOX A;  4HDO A;  4HDQ A;  4HAU B;  4TYZ A;  1MAI A;  2D10 A;  1UNQ A;  2COD A;  1X1G A;  1H10 A;  1ZC4 B;  1AQC A;  3G9W A;  2AL6 A;  4NY0 A;  1QQG A;  1U2B A;  4L6E A;  2EMS A;  3MPX A;  4NSW A;  2MDX A;  3ML4 A;  5D3X A;  2IFS A;  1B55 A;  1X1F A;  3AU5 A;  2Z0P A;  4EMO A;  1M7R A;  2CY5 A;  1MK7 B;  2RUK B;  2VKI A;  1BWN A;  2W2X D;  5KCV A;  1LB1 A;  4YON A;  2ZPY A;  5FI1 A;  2ADZ A;  1NI2 A;  2OQB A;  3M1I B;  2DYQ A;  2CAY A;  1FB8 A;  4K2O A;  2COF A;  4IOY X;  2W2X C;  1MIX A;  2RLO A;  1BTK A;  3PG7 A;  2VSZ A;  3D8F A;  4CHM A;  2EJ8 A;  3P7Z A;  2DYN A;  4B6H A;  3KY9 A;  1X05 A;  1XX0 A;  1V5U A;  2HE7 A;  4YL8 A;  1V61 A;  4CYE A;  5CLL B;  1EGX A;  2P8V A;  1MK9 B;  4ZRI A;  5LON B;  2E2X A;  5HE0 A;  1Y5O A;  3CIK A;  1TXD A;  1WGU A;  4WSF A;  4WVF B;  2EMT A;  2LG1 A;  4DX8 A;  1UPQ A;  3FSS A;  5C79 A;  3D8D A;  5JP4 A;  2OTX A;  2I5C A;  1K5D B;  2H7E A;  2GS0 A;  4MT7 A;  2R09 A;  4F7H A;  1ZC3 B;  4A6H A;  1W1D A;  1OQN A;  4HAW B;  2K2J A;  1LW3 A;  1X86 A;  1GC6 A;  2PZ1 A;  4WJ7 A;  1DDV A;  1GC7 A;  2DA0 A;  3PSC A;  5D3V A;  2YS3 A;  1EAZ A;  2Y8G A;  4HAZ B;  2KCJ A;  2DHJ A;  2L2I A;  2YT0 A;  4ZRK A;  4KVG B;  1FAO A;  2M38 A;  1MIZ B;  4KHO A;  3GYO A;  4KHA A;  2D9Y A;  3PVW A;  4A6K A;  2JP2 A;  2L1C A;  3N7C A;  3GYP A;  4K2P A;  5C16 A;  2D11 A;  5J3T A;  3KSY A;  4EKU A;  5DH9 B;  4GMX B;  4A5K A;  2N0Y A;  2D4Q A;  3AJ4 A;  1P6S A;  3UZT A;  3U7D A;  2LOZ A;  3PP2 A;  3ODO A;  3HW2 B;  3PVU A;  1WVH A;  2I1K A;  2YS1 A;  1FHX A;  1U5D A;  2NMB A;  1FHO A;  3F5R A;  3BIN A;  2V76 A;  4HB3 B;  2DTC A;  2Q13 A;  2RNR B;  2YT1 A;  2D2Q A;  2LUL A;  1I2H A;  2DLW A;  1UNP A;  2W2W A;  1XOD A;  1DDM A;  2DHI A;  2Z0O A;  1P5T A;  1MKE A;  1E5W A;  2J0K A;  1NTV A;  3O96 A;  2GCL A;  2I1J A;  3CXB B;  1FGY A;  1U29 A;  1RJ2 A;  4HB2 B;  4PQ0 A;  1U5E A;  1NU2 A;  1PFJ A;  2GCJ A; 
#chains in the Genus database with same CATH topology
 2D9X A;  3LJU X;  3AU4 A;  1TQZ A;  2J0J A;  4L1R A;  1UEF A;  2QKM A;  1KZG A;  3ULC A;  5DHA B;  1IRS A;  3P6A A;  5DHF B;  1Q67 A;  1V5P A;  5L81 A;  3T06 A;  1DBH A;  3NSU A;  1TJ6 A;  1SHC A;  1WJ1 A;  5DI9 B;  2DX1 A;  2KUQ A;  4GPT B;  4K81 A;  1WJM A;  3A8Q A;  1J19 A;  4GXB A;  2DHK A;  3TO1 A;  3TVV A;  1PMS A;  1RRP B;  1V88 A;  3V5W A;  2XQN M;  4F7U P;  4MY6 A;  5HE1 A;  1MI1 A;  3HK0 A;  2CY4 A;  3KZ1 A;  3SYX A;  4GN1 A;  5FI0 A;  5D3Y A;  3IVF A;  4F7G A;  1KZ7 A;  2KUP A;  2LKO A;  3ODX A;  4ZRJ A;  1U27 A;  2CRF A;  2YS5 A;  2KGX B;  2P0D A;  3HQC A;  3VOQ A;  2Z0Q A;  3MDB C;  2RRF A;  5IRS A;  1FHW A;  5C5B A;  2FJU B;  5HE2 A;  2GUM A;  5C5B B;  2RVB B;  1H4R A;  4CSQ A;  4HHV A;  2G35 A;  3PZD A;  4CHJ A;  2COC A;  1KI1 B;  4QXA B;  3FM8 C;  5D3W A;  1FGZ A;  3A8P A;  5J3Y A;  2K8E A;  1PLS A;  2DN6 A;  4KAX B;  3ZVR A;  3ODW A;  3QIJ A;  2COA A;  5KQ1 A;  3WYF B;  3X23 A;  3SO6 A;  3U8Z A;  2K00 A;  2P0F A;  1P3R A;  3RCP A;  2UVM A;  2AEH A;  1MPH A;  3SNH A;  1DRO A;  2KIE A;  5DIF B;  4DXA B;  2RGN B;  4P7I A;  1WI1 A;  1ZVR A;  1U5G A;  3FEH A;  3TW1 A;  3FVC A;  5C6R A;  1UNR A;  5LOP B;  1GG3 A;  1V5M A;  2D9V A;  3PEG A;  4HAX B;  1EF1 A;  2M14 A;  2YVC A;  2DX5 A;  4HAY B;  5J3Q A;  5D27 A;  1OMW A;  2MWN B;  2Y7B A;  5KQ4 A;  4DBB A;  5HE3 A;  1XCG A;  2GJY A;  4DX9 0;  2ZKM X;  2J0M A;  1Z87 A;  2RSG A;  2X18 A;  4H8S A;  5JLJ B;  3SUZ A;  1UPR A;  2DKP A;  2EC1 A;  1ISN A;  3KRW A;  1J0W A;  3WA0 A;  4Z2N A;  4MK0 A;  2ELA A;  2NZ8 B;  1N3H A;  1DYN A;  2LYD A;  2UZR A;  4HAV B;  3D8E A;  2BCJ A;  3DXE A;  3PVL A;  4K17 A;  5I2S A;  2MFQ A;  2YRY A;  3DXD A;  1W1G A;  4HAT B;  1FOE A;  1ZYI A;  4KHB A;  3NWA A;  1W1H A;  1BTN A;  2I5F A;  4OT1 A;  1U5F A;  1Y19 B;  2H7D A;  4HB0 B;  2QKL A;  1EVH A;  4KHB B;  2YSZ A;  4PNK A;  1K5G B;  2R0D A;  1AWE A;  2Z59 A;  1X11 A;  1XR0 B;  3F0W A;  5JHG A;  1DDW A;  2VRW B;  2Y8F A;  3QBV B;  1ZSQ A;  4Y94 A;  4IFS A;  5M4Y B;  5GOW B;  2HTH B;  4HB4 B;  1V89 A;  3TCA A;  3ULB A;  1SGH A;  4OSN A;  5CLQ B;  5EFX A;  4XWX A;  2ROV A;  2ROZ B;  3VIA A;  1XKE A;  4A6F A;  4D0N B;  2FJL A;  2DKQ A;  2DFK A;  4A6F B;  3KRX A;  2K2U A;  1I7A A;  2YF0 A;  1M7E A;  2J59 M;  2K49 A;  2D9Z A;  4C0A A;  2MKR A;  1WG7 A;  3QWM A;  1WGQ A;  5JHH A;  4BBK A;  2IYB A;  3TFM A;  1XD4 A;  2D9W A;  4IAP A;  4EJN A;  1OY2 A;  1QC6 A;  4GZU A;  3ZDT A;  3U12 A;  4Z2M B;  3A98 B;  3DXC A;  4HSI A;  1NTY A;  5I2M A;  1ZM0 A;  2UZS A;  2P0H A;  3OAN A;  3SV1 A;  4QJ3 B;  3BJI A;  4GMV A;  2R2Y A;  2N23 A;  1BAK A;  4TKN A;  2ELB A;  2LOX A;  2KIG A;  4HDO A;  4HDQ A;  2Z14 A;  4HAU B;  4TYZ A;  1MAI A;  2D10 A;  1UNQ A;  2COD A;  1X1G A;  1H10 A;  1ZC4 B;  1AQC A;  3G9W A;  2AL6 A;  4NY0 A;  1QQG A;  1U2B A;  4L6E A;  2EMS A;  3MPX A;  4NSW A;  4D6W A;  3HSA A;  2MDX A;  3ML4 A;  5D3X A;  2IFS A;  1B55 A;  1X1F A;  3AU5 A;  2Z0P A;  4EMO A;  1M7R A;  4DIX A;  2CY5 A;  1MK7 B;  2RUK B;  2VKI A;  1BWN A;  2W2X D;  5KCV A;  1LB1 A;  4YON A;  2ZPY A;  5FI1 A;  2ADZ A;  1NI2 A;  2OQB A;  3M1I B;  2DYQ A;  2CAY A;  1FB8 A;  4K2O A;  2COF A;  4IOY X;  2W2X C;  1MIX A;  2RLO A;  4QJ4 B;  1BTK A;  3PG7 A;  2VSZ A;  3D8F A;  4CHM A;  2EJ8 A;  3P7Z A;  2DYN A;  4B6H A;  3KY9 A;  1X05 A;  1XX0 A;  1V5U A;  2HE7 A;  4YL8 A;  1V61 A;  4QJ5 B;  3NW8 A;  4CYE A;  5CLL B;  1EGX A;  2P8V A;  1MK9 B;  4ZRI A;  5LON B;  2E2X A;  5HE0 A;  1Y5O A;  3CIK A;  1TXD A;  1WGU A;  4WSF A;  4WVF B;  2EMT A;  2LG1 A;  4DX8 A;  1UPQ A;  3FSS A;  5C79 A;  3OHM B;  3D8D A;  5JP4 A;  2OTX A;  2I5C A;  1K5D B;  2H7E A;  2GS0 A;  4MT7 A;  2R09 A;  4F7H A;  1ZC3 B;  4A6H A;  1W1D A;  1OQN A;  3NWF A;  4HAW B;  2K2J A;  1LW3 A;  3HIE A;  1X86 A;  1GC6 A;  2PZ1 A;  4WJ7 A;  1DDV A;  2NBV A;  1GC7 A;  2DA0 A;  3PSC A;  5D3V A;  2YS3 A;  3A58 A;  1EAZ A;  2Y8G A;  4HAZ B;  2KCJ A;  2DHJ A;  2L2I A;  2YT0 A;  4ZRK A;  4KVG B;  2Z13 A;  1FAO A;  2M38 A;  1MIZ B;  4KHO A;  3GYO A;  2Z4D A;  4KHA A;  2D9Y A;  3PVW A;  3DCX A;  4A6K A;  2JP2 A;  2L1C A;  3N7C A;  3GYP A;  4GOU A;  3NWD A;  4K2P A;  5C16 A;  2D11 A;  5J3T A;  3KSY A;  4EKU A;  5DH9 B;  4GMX B;  4A5K A;  2N0Y A;  2D4Q A;  3AJ4 A;  1P6S A;  3UZT A;  3U7D A;  2LOZ A;  3PP2 A;  3ODO A;  3HW2 B;  3PVU A;  2YT2 A;  1WVH A;  2I1K A;  2KR0 A;  2YS1 A;  1FHX A;  1U5D A;  2NMB A;  1FHO A;  3B77 A;  3F5R A;  3BIN A;  2V76 A;  4HB3 B;  2DTC A;  2Q13 A;  2RNR B;  2YT1 A;  2D2Q A;  4GNK B;  2LUL A;  1I2H A;  2DLW A;  1UNP A;  2W2W A;  1XOD A;  5LG4 B;  1DDM A;  2DHI A;  2Z0O A;  1P5T A;  1MKE A;  1E5W A;  2J0K A;  1NTV A;  3O96 A;  2GCL A;  2I1J A;  3CXB B;  1FGY A;  1U29 A;  1RJ2 A;  4HB2 B;  4PQ0 A;  1U5E A;  1NU2 A;  1PFJ A;  1T77 A;  2GCJ A; 
#chains in the Genus database with same CATH homology
 2D9X A;  3LJU X;  3AU4 A;  1TQZ A;  2J0J A;  1UEF A;  2QKM A;  1KZG A;  3ULC A;  5DHA B;  1IRS A;  3P6A A;  5DHF B;  1Q67 A;  1V5P A;  5L81 A;  3T06 A;  1DBH A;  3NSU A;  1TJ6 A;  1SHC A;  1WJ1 A;  5DI9 B;  2DX1 A;  4GPT B;  4K81 A;  1WJM A;  3A8Q A;  1J19 A;  4GXB A;  2DHK A;  3TO1 A;  3TVV A;  1PMS A;  1RRP B;  1V88 A;  3V5W A;  2XQN M;  4F7U P;  4MY6 A;  5HE1 A;  3HK0 A;  2CY4 A;  3KZ1 A;  3SYX A;  4GN1 A;  5FI0 A;  5D3Y A;  3IVF A;  4F7G A;  1KZ7 A;  2KUP A;  2LKO A;  3ODX A;  4ZRJ A;  1U27 A;  2CRF A;  2YS5 A;  2KGX B;  2P0D A;  3HQC A;  3VOQ A;  2Z0Q A;  3MDB C;  1FHW A;  5C5B A;  5HE2 A;  5C5B B;  2RVB B;  1H4R A;  4HHV A;  2G35 A;  3PZD A;  4CHJ A;  2COC A;  1KI1 B;  5D3W A;  3FM8 C;  1FGZ A;  3A8P A;  5J3Y A;  1PLS A;  2DN6 A;  4KAX B;  3ZVR A;  3ODW A;  3QIJ A;  2COA A;  5KQ1 A;  3WYF B;  3X23 A;  3SO6 A;  3U8Z A;  2K00 A;  2P0F A;  1P3R A;  3RCP A;  2UVM A;  2AEH A;  1MPH A;  3SNH A;  1DRO A;  5DIF B;  4DXA B;  2RGN B;  4P7I A;  1WI1 A;  1ZVR A;  1U5G A;  3FEH A;  3TW1 A;  5C6R A;  1UNR A;  5LOP B;  1GG3 A;  1V5M A;  2D9V A;  3PEG A;  4HAX B;  1EF1 A;  2M14 A;  2YVC A;  2DX5 A;  4HAY B;  5J3Q A;  5D27 A;  1OMW A;  2MWN B;  2Y7B A;  5KQ4 A;  4DBB A;  5HE3 A;  1XCG A;  2GJY A;  4DX9 0;  2J0M A;  1Z87 A;  2RSG A;  2X18 A;  4H8S A;  5JLJ B;  3SUZ A;  1UPR A;  2DKP A;  2EC1 A;  1ISN A;  3KRW A;  1J0W A;  3WA0 A;  4Z2N A;  4MK0 A;  2ELA A;  2NZ8 B;  1N3H A;  1DYN A;  2LYD A;  2UZR A;  4HAV B;  3D8E A;  2BCJ A;  3DXE A;  3PVL A;  4K17 A;  2MFQ A;  2YRY A;  3DXD A;  1W1G A;  4HAT B;  1FOE A;  1W1H A;  1BTN A;  2I5F A;  1U5F A;  1Y19 B;  2H7D A;  4HB0 B;  2QKL A;  1EVH A;  4KHB B;  2YSZ A;  4PNK A;  1K5G B;  2R0D A;  1AWE A;  1X11 A;  1XR0 B;  3F0W A;  5JHG A;  1DDW A;  2VRW B;  2Y8F A;  3QBV B;  1ZSQ A;  4Y94 A;  4IFS A;  5GOW B;  2HTH B;  4HB4 B;  1V89 A;  3TCA A;  3ULB A;  1SGH A;  5CLQ B;  5EFX A;  4XWX A;  2ROV A;  2ROZ B;  3VIA A;  1XKE A;  4A6F A;  4D0N B;  2FJL A;  2DKQ A;  2DFK A;  4A6F B;  3KRX A;  2K2U A;  1I7A A;  2YF0 A;  1M7E A;  2J59 M;  2D9Z A;  4C0A A;  2MKR A;  1WG7 A;  3QWM A;  1WGQ A;  5JHH A;  4BBK A;  2IYB A;  3TFM A;  1XD4 A;  2D9W A;  4IAP A;  4EJN A;  1OY2 A;  1QC6 A;  4GZU A;  3ZDT A;  4Z2M B;  3A98 B;  3DXC A;  1NTY A;  1ZM0 A;  2UZS A;  2P0H A;  3OAN A;  3SV1 A;  3BJI A;  4GMV A;  2N23 A;  1BAK A;  4TKN A;  2ELB A;  2LOX A;  4HDO A;  4HDQ A;  4HAU B;  4TYZ A;  1MAI A;  2D10 A;  1UNQ A;  2COD A;  1X1G A;  1H10 A;  1ZC4 B;  1AQC A;  3G9W A;  2AL6 A;  4NY0 A;  1QQG A;  1U2B A;  4L6E A;  2EMS A;  3MPX A;  4NSW A;  2MDX A;  3ML4 A;  5D3X A;  2IFS A;  1B55 A;  1X1F A;  3AU5 A;  2Z0P A;  4EMO A;  1M7R A;  2CY5 A;  1MK7 B;  2RUK B;  2VKI A;  1BWN A;  2W2X D;  5KCV A;  1LB1 A;  4YON A;  2ZPY A;  5FI1 A;  2ADZ A;  1NI2 A;  2OQB A;  3M1I B;  2DYQ A;  2CAY A;  1FB8 A;  4K2O A;  2COF A;  4IOY X;  2W2X C;  1MIX A;  2RLO A;  1BTK A;  3PG7 A;  2VSZ A;  3D8F A;  4CHM A;  2EJ8 A;  3P7Z A;  2DYN A;  4B6H A;  3KY9 A;  1X05 A;  1XX0 A;  1V5U A;  2HE7 A;  4YL8 A;  1V61 A;  4CYE A;  5CLL B;  1EGX A;  2P8V A;  1MK9 B;  4ZRI A;  5LON B;  2E2X A;  5HE0 A;  1Y5O A;  3CIK A;  1TXD A;  1WGU A;  4WSF A;  4WVF B;  2EMT A;  2LG1 A;  4DX8 A;  1UPQ A;  3FSS A;  5C79 A;  3D8D A;  5JP4 A;  2OTX A;  2I5C A;  1K5D B;  2H7E A;  2GS0 A;  4MT7 A;  2R09 A;  4F7H A;  1ZC3 B;  4A6H A;  1W1D A;  1OQN A;  4HAW B;  2K2J A;  1LW3 A;  1X86 A;  1GC6 A;  2PZ1 A;  4WJ7 A;  1DDV A;  1GC7 A;  2DA0 A;  3PSC A;  5D3V A;  2YS3 A;  1EAZ A;  2Y8G A;  4HAZ B;  2KCJ A;  2DHJ A;  2L2I A;  2YT0 A;  4ZRK A;  4KVG B;  1FAO A;  2M38 A;  1MIZ B;  4KHO A;  3GYO A;  4KHA A;  2D9Y A;  3PVW A;  4A6K A;  2JP2 A;  2L1C A;  3N7C A;  3GYP A;  4K2P A;  5C16 A;  2D11 A;  5J3T A;  3KSY A;  4EKU A;  5DH9 B;  4GMX B;  4A5K A;  2N0Y A;  2D4Q A;  3AJ4 A;  1P6S A;  3UZT A;  3U7D A;  2LOZ A;  3PP2 A;  3ODO A;  3HW2 B;  3PVU A;  1WVH A;  2I1K A;  2YS1 A;  1FHX A;  1U5D A;  2NMB A;  1FHO A;  3F5R A;  3BIN A;  2V76 A;  4HB3 B;  2DTC A;  2Q13 A;  2RNR B;  2YT1 A;  2D2Q A;  2LUL A;  1I2H A;  2DLW A;  1UNP A;  2W2W A;  1XOD A;  1DDM A;  2DHI A;  2Z0O A;  1P5T A;  1MKE A;  1E5W A;  2J0K A;  1NTV A;  3O96 A;  2GCL A;  2I1J A;  3CXB B;  1FGY A;  1U29 A;  1RJ2 A;  4HB2 B;  4PQ0 A;  1U5E A;  1NU2 A;  1PFJ A;  2GCJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...