3TFMA

Myosin x ph1n-ph2-ph1c tandem
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
208
structure length
208
Chain Sequence
PYFHSFLYMNGGLMNSWKRRWCVLKDETFLWFRSKQEALKQGWLHNNGGGSSTLSRRNWKKRWFVLRQSKLMYFENDSEEKLKGTVEVRSAKEIIDNTNKENGIDIIMADRTFHLIAESPEDASQWFSVLSQVHSSTDQEIREMHDEQANPQNAVGTLDVGLIDSVCASDSPDRPNSFVIITANRVLHCNADTPEEMHHWITLLQRSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Motor protein
molecule keywords Myosin X
publication title Structural basis of the myosin X PH1N-PH2-PH1C tandem as a specific and acute cellular PI(3,4,5)P3 sensor
pubmed doi rcsb
source organism Rattus norvegicus
total genus 50
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2011-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3tfmA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3tfmA01
3AU5A 2K2UA 5C79A 2UZRA 3A8PA 1XCGA 2DFKA 2KGXB 3TVVA 2J0JA 1EF1A 3PSCA 2M38A 2EC1A 5JHHA 4DXAB 2YF0A 4KAXB 5HE1A 5EFXA 5C5BB 3SO6A 2CAYA 2DYQA 1GC6A 4GN1A 2QKMA 2Y8FA 1QC6A 2DLWA 3HQCA 1V89A 3TO1A 4MT7A 4A5KA 1XX0A 1V5MA 1X11A 3DXCA 1Q67A 2L1CA 1BTKA 3KRWA 1SHCA 2RUKB 1KZGA 5GOWB 2PZ1A 5D3VA 2EJ8A 2LOZA 3TCAA 1X1FA 5KCVA 2HTHB 3LJUX 3GYPA 1WVHA 1J0WA 1ZM0A 4HB2B 3CXBB 3A8QA 1UEFA 1Z87A 1UPQA 3ULBA 2R09A 1X86A 3TW1A 3X23A 1DYNA 1B55A 2DHIA 1DROA 3ULCA 2KUPA 2VRWB 1P3RA 5DHAB 4A6FA 2LULA 2EMTA 5D3WA 3PP2A 2D9XA 3ZVRA 3ZDTA 1FGYA 1WG7A 2H7EA 5C16A 2CY4A 4ZRIA 4EMOA 4D0NB 3KZ1A 4KVGB 1OQNA 4HDQA 3BJIA 1QQGA 4HB0B 2K00A 3PVLA 4HDOA 3A98B 1TJ6A 1OY2A 1RJ2A 2NZ8B 3N7CA 4WVFB 1PFJA 1OMWA 1W1HA 1U5DA 1DDVA 2DN6A 1UNRA 1XD4A 1ZC4B 1UPRA 3PZDA 4PQ0A 4Z2MB 3F5RA 3FSSA 4IOYX 2CY5A 4B6HA 1U5EA 2EMSA 4EKUA 4TKNA 2DKQA 4DBBA 1WGQA 2Z0OA 4EJNA 2YS5A 5JP4A 1M7EA 1MKEA 4NY0A 1IRSA 1KZ7A 3AJ4A 1WJMA 4C0AA 3HK0A 3ML4A 1ZC3B 1X05A 4KHBB 1MIZB 1K5DB 4A6KA 1FHWA 2E2XA 1MPHA 4HAWB 2DX5A 1FAOA 2IFSA 2GCLA 1I2HA 1U2BA 1Y19B 1M7RA 5J3TA 3MDBC 2N23A 2UVMA 5KQ4A 3MPXA 1V5UA 3DXEA 1TXDA 1FHXA 2N0YA 1GG3A 1GC7A 3AU4A 3SUZA 5JLJB 4WSFA 1N3HA 1NU2A 3PEGA 2VKIA 1V88A 5L81A 2COFA 4K2PA 2V76A 4CHJA 4F7GA 2COAA 2W2XD 3M1IB 5C6RA 1DDMA 4GXBA 4GPTB 2P0DA 3QWMA 4XWXA 4Y94A 3ODXA 2ELBA 1ZSQA 2R0DA 2Z0PA 2AL6A 2G35A 4H8SA 2HE7A 2LG1A 2DTCA 4YONA 2D9VA 4DX90 5LONB 1AQCA 3BINA 2Z0QA 2P0HA 2MWNB 1V61A 3O96A 3FM8C 5CLQB 2FJLA 1NTYA 1FGZA 2K2JA 5KQ1A 4IAPA 1P5TA 2D2QA 1BAKA 2D10A 3HW2B 4IFSA 4WJ7A 5D3XA 2GJYA 2J0MA 1E5WA 3D8EA 5HE3A 4HAZB 5D27A 3V5WA 5D3YA 2BCJA 1NTVA 1Y5OA 2DKPA 3SYXA 2IYBA 4HAVB 3QBVB 4PNKA 5DHFB 1FB8A 5FI1A 3F0WA 2KCJA 1X1GA 2DHJA 2J0KA 2P8VA 4A6FB 1NI2A 4HAUB 4KHOA 1MK9B 2GS0A 3D8DA 2D9ZA 4NSWA 2D4QA 2ADZA 4GZUA 1FOEA 1H4RA 4ZRKA 5DIFB 4Z2NA 4K2OA 1FHOA 2XQNM 1MK7B 2LYDA 1MIXA 3SV1A 1XODA 3WA0A 4GMVA 1UNPA 2I5FA 4HB3B 4L6EA 1P6SA 1LW3A 1J19A 2NMBA 5CLLB 2I1KA 1AWEA 1EGXA 3OANA 4A6HA 4P7IA 3D8FA 3P6AA 3TFMA 3KY9A 1TQZA 2QKLA 2GCJA 3PVUA 1WJ1A 3U8ZA 4TYZA 4YL8A 3NSUA 2DYNA 1K5GB 4ZRJA 1KI1B 2DHKA 2LKOA 3RCPA 4HAYB 1UNQA 3G9WA 2M14A 1U5FA 2ZPYA 2MKRA 5DI9B 4K17A 5JHGA 2CRFA 2OQBA 2COCA 2Q13A 2Y7BA 1LB1A 1SGHA 2YS1A 2D9WA 4KHAA 1DBHA 1RRPB 2DX1A 4HB4B 2MFQA 2RVBB 3KRXA 2JP2A 2W2WA 1DDWA 1ZVRA 4K81A 2YSZA 4F7UP 1U27A 3VOQA 2YRYA 1I7AA 1PLSA 3T06A 5J3YA 5J3QA 2DA0A 2RLOA 4BBKA 3P7ZA 2AEHA 3PVWA 3GYOA 2YS3A 2LOXA 2RNRB 2RGNB 2ROZB 1BTNA 1ISNA 3KSYA 4MK0A 3PG7A 2OTXA 1BWNA 2YT1A 3DXDA 3ODOA 4CYEA 2VSZA 3ODWA 2YVCA 2P0FA 4HATB 2I1JA 1W1GA 1XKEA 4HHVA 5DH9B 5C5BA 1MAIA 2D11A 1V5PA 2UZSA 2H7DA 3IVFA 5HE0A 1H10A 3WYFB 2RSGA 2L2IA 3VIAA 3SNHA 4GMXB 1WI1A 5LOPB 2I5CA 4MY6A 2ELAA 1W1DA 3UZTA 5FI0A 4HAXB 2W2XC 2MDXA 2D9YA 1EAZA 3U7DA 4F7HA 4CHMA 1EVHA 1PMSA 1WGUA 2Y8GA 2ROVA 2YT0A 3CIKA 1U29A 2X18A 1U5GA 2CODA 3QIJA 4DX8A 2J59M 5HE2A 1XR0B 3FEHA
chains in the Genus database with same CATH superfamily
4GOUA 3AU5A 2K2UA 5C79A 2UZRA 3A8PA 1XCGA 2Z59A 2DFKA 2KGXB 3TVVA 2J0JA 1EF1A 3PSCA 4D6WA 2M38A 2EC1A 5JHHA 4DXAB 2YF0A 5LG4B 4KAXB 5HE1A 5EFXA 5C5BB 3SO6A 2CAYA 2DYQA 1GC6A 4GN1A 2QKMA 2Y8FA 1QC6A 2DLWA 3HQCA 2K49A 1V89A 3TO1A 4MT7A 4A5KA 4QJ4B 1XX0A 1V5MA 1X11A 3DXCA 1Q67A 2L1CA 1BTKA 3KRWA 1SHCA 2RUKB 1KZGA 5GOWB 2PZ1A 5D3VA 2EJ8A 2LOZA 3TCAA 1X1FA 5KCVA 2HTHB 3LJUX 3GYPA 1WVHA 1J0WA 1ZM0A 4HB2B 3CXBB 3A8QA 1UEFA 3NWDA 1Z87A 1UPQA 2Z14A 3ULBA 2R09A 1X86A 3TW1A 3X23A 1DYNA 1B55A 2DHIA 1DROA 3ULCA 2KUPA 2VRWB 1P3RA 5DHAB 4A6FA 3NW8A 2LULA 2EMTA 5D3WA 3PP2A 2D9XA 3ZVRA 3ZDTA 1FGYA 1WG7A 2H7EA 4QJ5B 4KHBA 5C16A 2CY4A 4ZRIA 4EMOA 4D0NB 3KZ1A 4KVGB 1OQNA 2NBVA 4HDQA 3BJIA 5I2MA 1QQGA 1MI1A 4HB0B 2K00A 3PVLA 4HDOA 2R2YA 4QJ3B 3A98B 1TJ6A 1OY2A 1RJ2A 2NZ8B 3N7CA 2FJUB 5M4YB 4WVFB 1PFJA 1OMWA 1W1HA 1U5DA 1DDVA 2DN6A 1UNRA 1XD4A 1ZC4B 1UPRA 3PZDA 4PQ0A 4Z2MB 3F5RA 3FSSA 4IOYX 2CY5A 4B6HA 1U5EA 2EMSA 4EKUA 4TKNA 2DKQA 4DBBA 1WGQA 2Z0OA 4EJNA 2YS5A 5JP4A 1M7EA 1MKEA 4NY0A 1IRSA 3HSAA 1KZ7A 3AJ4A 1WJMA 4C0AA 3HK0A 3FVCA 3ML4A 1ZC3B 1X05A 4KHBB 1MIZB 1K5DB 4A6KA 1FHWA 2E2XA 1MPHA 4HAWB 2DX5A 1FAOA 2IFSA 2GCLA 3HIEA 1I2HA 1U2BA 1Y19B 1M7RA 5J3TA 3MDBC 2Z13A 2N23A 2UVMA 5KQ4A 3MPXA 1V5UA 4L1RA 1ZYIA 3DXEA 1TXDA 1FHXA 2N0YA 1GG3A 1GC7A 3AU4A 3SUZA 5JLJB 4WSFA 1N3HA 1NU2A 3PEGA 3OHMB 2VKIA 1V88A 5L81A 2COFA 4K2PA 2V76A 4CHJA 4F7GA 2COAA 2W2XD 3M1IB 5C6RA 1DDMA 5I2SA 4GXBA 4GPTB 2P0DA 3QWMA 4XWXA 4Y94A 3ODXA 2ELBA 1ZSQA 2R0DA 3NWFA 2Z0PA 2AL6A 2G35A 4H8SA 2HE7A 2LG1A 2DTCA 4YONA 2D9VA 4DX90 1T77A 5LONB 1AQCA 3BINA 2Z0QA 2P0HA 2MWNB 1V61A 3O96A 3FM8C 5CLQB 2FJLA 1NTYA 1FGZA 2KR0A 2K2JA 5KQ1A 4IAPA 1P5TA 2D2QA 1BAKA 2D10A 3HW2B 4IFSA 4WJ7A 5D3XA 2GJYA 2J0MA 1E5WA 3D8EA 4DIXA 5HE3A 4HAZB 5D27A 3V5WA 5D3YA 1XR0B 2BCJA 1NTVA 1Y5OA 2DKPA 3SYXA 2IYBA 4HAVB 2KIGA 3QBVB 4PNKA 2KUQA 5DHFB 1FB8A 2KIEA 5FI1A 3F0WA 2KCJA 1X1GA 2DHJA 2J0KA 5IRSA 2P8VA 4A6FB 1NI2A 4HAUB 4KHOA 1MK9B 2GS0A 3D8DA 2D9ZA 4NSWA 2D4QA 2ADZA 4GZUA 1FOEA 1H4RA 4ZRKA 5DIFB 4Z2NA 4K2OA 1FHOA 2XQNM 1MK7B 2RRFA 2LYDA 1MIXA 3SV1A 1XODA 3WA0A 3NWAA 4GMVA 1UNPA 2I5FA 4HB3B 4L6EA 1P6SA 1LW3A 1J19A 2NMBA 5CLLB 2I1KA 1AWEA 1EGXA 3OANA 4A6HA 4P7IA 3D8FA 3P6AA 3TFMA 3KY9A 1TQZA 2QKLA 2GCJA 2YT2A 3PVUA 1WJ1A 3U8ZA 4TYZA 4YL8A 4GNKB 3NSUA 2DYNA 1K5GB 4ZRJA 1KI1B 2DHKA 2LKOA 4QXAB 3RCPA 4HAYB 1UNQA 3G9WA 2M14A 1U5FA 2ZPYA 2MKRA 5DI9B 4K17A 5JHGA 2CRFA 2OQBA 2COCA 2Q13A 3A58A 2Y7BA 1LB1A 1SGHA 2YS1A 2D9WA 4KHAA 1DBHA 1RRPB 2DX1A 4HB4B 2MFQA 2RVBB 3KRXA 2JP2A 2W2WA 1DDWA 1ZVRA 4K81A 2YSZA 4F7UP 1U27A 3VOQA 2YRYA 1I7AA 1PLSA 3T06A 3B77A 5J3YA 5J3QA 4OSNA 2DA0A 2RLOA 4BBKA 3P7ZA 2AEHA 3PVWA 3GYOA 2YS3A 2LOXA 2Z4DA 2RNRB 2RGNB 2ROZB 1BTNA 1ISNA 3KSYA 4MK0A 3PG7A 2OTXA 1BWNA 2YT1A 3DXDA 3ODOA 4CYEA 2VSZA 3ODWA 2YVCA 2P0FA 4HATB 2I1JA 2GUMA 4CSQA 1W1GA 1XKEA 4HHVA 5DH9B 5C5BA 3U12A 1MAIA 2D11A 1V5PA 2UZSA 3DCXA 2H7DA 3IVFA 5HE0A 1H10A 3WYFB 2RSGA 2L2IA 3VIAA 3SNHA 4GMXB 1WI1A 5LOPB 2I5CA 4MY6A 2ELAA 1W1DA 3UZTA 5FI0A 4HAXB 2W2XC 2MDXA 2D9YA 2ZKMX 1EAZA 3U7DA 4F7HA 4CHMA 1EVHA 1PMSA 1WGUA 2Y8GA 2ROVA 2YT0A 3CIKA 1U29A 4HSIA 2X18A 1U5GA 2CODA 3QIJA 4OT1A 4DX8A 2J59M 5HE2A 2K8EA 3FEHA
chains in the Genus database with same CATH topology
3AU5A 2K2UA 5C79A 2UZRA 3A8PA 1XCGA 2DFKA 2KGXB 3TVVA 2J0JA 1EF1A 3PSCA 2M38A 2EC1A 5JHHA 4DXAB 2YF0A 4KAXB 5HE1A 5EFXA 5C5BB 3SO6A 2CAYA 2DYQA 1GC6A 4GN1A 2QKMA 2Y8FA 1QC6A 2DLWA 3HQCA 1V89A 3TO1A 4MT7A 4A5KA 1XX0A 1V5MA 1X11A 3DXCA 1Q67A 2L1CA 1BTKA 3KRWA 1SHCA 2RUKB 1KZGA 5GOWB 2PZ1A 5D3VA 2EJ8A 2LOZA 3TCAA 1X1FA 5KCVA 2HTHB 3LJUX 3GYPA 1WVHA 1J0WA 1ZM0A 4HB2B 3CXBB 3A8QA 1UEFA 1Z87A 1UPQA 3ULBA 2R09A 1X86A 3TW1A 3X23A 1DYNA 1B55A 2DHIA 1DROA 3ULCA 2KUPA 2VRWB 1P3RA 5DHAB 4A6FA 2LULA 2EMTA 5D3WA 3PP2A 2D9XA 3ZVRA 3ZDTA 1FGYA 1WG7A 2H7EA 5C16A 2CY4A 4ZRIA 4EMOA 4D0NB 3KZ1A 4KVGB 1OQNA 4HDQA 3BJIA 1QQGA 4HB0B 2K00A 3PVLA 4HDOA 3A98B 1TJ6A 1OY2A 1RJ2A 2NZ8B 3N7CA 4WVFB 1PFJA 1OMWA 1W1HA 1U5DA 1DDVA 2DN6A 1UNRA 1XD4A 1ZC4B 1UPRA 3PZDA 4PQ0A 4Z2MB 3F5RA 3FSSA 4IOYX 2CY5A 4B6HA 1U5EA 2EMSA 4EKUA 4TKNA 2DKQA 4DBBA 1WGQA 2Z0OA 4EJNA 2YS5A 5JP4A 1M7EA 1MKEA 4NY0A 1IRSA 1KZ7A 3AJ4A 1WJMA 4C0AA 3HK0A 3ML4A 1ZC3B 1X05A 4KHBB 1MIZB 1K5DB 4A6KA 1FHWA 2E2XA 1MPHA 4HAWB 2DX5A 1FAOA 2IFSA 2GCLA 1I2HA 1U2BA 1Y19B 1M7RA 5J3TA 3MDBC 2N23A 2UVMA 5KQ4A 3MPXA 1V5UA 3DXEA 1TXDA 1FHXA 2N0YA 1GG3A 1GC7A 3AU4A 3SUZA 5JLJB 4WSFA 1N3HA 1NU2A 3PEGA 2VKIA 1V88A 5L81A 2COFA 4K2PA 2V76A 4CHJA 4F7GA 2COAA 2W2XD 3M1IB 5C6RA 1DDMA 4GXBA 4GPTB 2P0DA 3QWMA 4XWXA 4Y94A 3ODXA 2ELBA 1ZSQA 2R0DA 2Z0PA 2AL6A 2G35A 4H8SA 2HE7A 2LG1A 2DTCA 4YONA 2D9VA 4DX90 5LONB 1AQCA 3BINA 2Z0QA 2P0HA 2MWNB 1V61A 3O96A 3FM8C 5CLQB 2FJLA 1NTYA 1FGZA 2K2JA 5KQ1A 4IAPA 1P5TA 2D2QA 1BAKA 2D10A 3HW2B 4IFSA 4WJ7A 5D3XA 2GJYA 2J0MA 1E5WA 3D8EA 5HE3A 4HAZB 5D27A 3V5WA 5D3YA 2BCJA 1NTVA 1Y5OA 2DKPA 3SYXA 2IYBA 4HAVB 3QBVB 4PNKA 5DHFB 1FB8A 5FI1A 3F0WA 2KCJA 1X1GA 2DHJA 2J0KA 2P8VA 4A6FB 1NI2A 4HAUB 4KHOA 1MK9B 2GS0A 3D8DA 2D9ZA 4NSWA 2D4QA 2ADZA 4GZUA 1FOEA 1H4RA 4ZRKA 5DIFB 4Z2NA 4K2OA 1FHOA 2XQNM 1MK7B 2LYDA 1MIXA 3SV1A 1XODA 3WA0A 4GMVA 1UNPA 2I5FA 4HB3B 4L6EA 1P6SA 1LW3A 1J19A 2NMBA 5CLLB 2I1KA 1AWEA 1EGXA 3OANA 4A6HA 4P7IA 3D8FA 3P6AA 3TFMA 3KY9A 1TQZA 2QKLA 2GCJA 3PVUA 1WJ1A 3U8ZA 4TYZA 4YL8A 3NSUA 2DYNA 1K5GB 4ZRJA 1KI1B 2DHKA 2LKOA 3RCPA 4HAYB 1UNQA 3G9WA 2M14A 1U5FA 2ZPYA 2MKRA 5DI9B 4K17A 5JHGA 2CRFA 2OQBA 2COCA 2Q13A 2Y7BA 1LB1A 1SGHA 2YS1A 2D9WA 4KHAA 1DBHA 1RRPB 2DX1A 4HB4B 2MFQA 2RVBB 3KRXA 2JP2A 2W2WA 1DDWA 1ZVRA 4K81A 2YSZA 4F7UP 1U27A 3VOQA 2YRYA 1I7AA 1PLSA 3T06A 5J3YA 5J3QA 2DA0A 2RLOA 4BBKA 3P7ZA 2AEHA 3PVWA 3GYOA 2YS3A 2LOXA 2RNRB 2RGNB 2ROZB 1BTNA 1ISNA 3KSYA 4MK0A 3PG7A 2OTXA 1BWNA 2YT1A 3DXDA 3ODOA 4CYEA 2VSZA 3ODWA 2YVCA 2P0FA 4HATB 2I1JA 1W1GA 1XKEA 4HHVA 5DH9B 5C5BA 1MAIA 2D11A 1V5PA 2UZSA 2H7DA 3IVFA 5HE0A 1H10A 3WYFB 2RSGA 2L2IA 3VIAA 3SNHA 4GMXB 1WI1A 5LOPB 2I5CA 4MY6A 2ELAA 1W1DA 3UZTA 5FI0A 4HAXB 2W2XC 2MDXA 2D9YA 1EAZA 3U7DA 4F7HA 4CHMA 1EVHA 1PMSA 1WGUA 2Y8GA 2ROVA 2YT0A 3CIKA 1U29A 2X18A 1U5GA 2CODA 3QIJA 4DX8A 2J59M 5HE2A 1XR0B 3FEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AU5 A;  2K2U A;  5C79 A;  2UZR A;  3A8P A;  1XCG A;  2DFK A;  2KGX B;  3TVV A;  2J0J A;  1EF1 A;  3PSC A;  2M38 A;  2EC1 A;  5JHH A;  4DXA B;  2YF0 A;  4KAX B;  5HE1 A;  5EFX A;  5C5B B;  3SO6 A;  2CAY A;  2DYQ A;  1GC6 A;  4GN1 A;  2QKM A;  2Y8F A;  1QC6 A;  2DLW A;  3HQC A;  1V89 A;  3TO1 A;  4MT7 A;  4A5K A;  1XX0 A;  1V5M A;  1X11 A;  3DXC A;  1Q67 A;  2L1C A;  1BTK A;  3KRW A;  1SHC A;  2RUK B;  1KZG A;  5GOW B;  2PZ1 A;  5D3V A;  2EJ8 A;  2LOZ A;  3TCA A;  1X1F A;  5KCV A;  2HTH B;  3LJU X;  3GYP A;  1WVH A;  1J0W A;  1ZM0 A;  4HB2 B;  3CXB B;  3A8Q A;  1UEF A;  1Z87 A;  1UPQ A;  3ULB A;  2R09 A;  1X86 A;  3TW1 A;  3X23 A;  1DYN A;  1B55 A;  2DHI A;  1DRO A;  3ULC A;  2KUP A;  2VRW B;  1P3R A;  5DHA B;  4A6F A;  2LUL A;  2EMT A;  5D3W A;  3PP2 A;  2D9X A;  3ZVR A;  3ZDT A;  1FGY A;  1WG7 A;  2H7E A;  5C16 A;  2CY4 A;  4ZRI A;  4EMO A;  4D0N B;  3KZ1 A;  4KVG B;  1OQN A;  4HDQ A;  3BJI A;  1QQG A;  4HB0 B;  2K00 A;  3PVL A;  4HDO A;  3A98 B;  1TJ6 A;  1OY2 A;  1RJ2 A;  2NZ8 B;  3N7C A;  4WVF B;  1PFJ A;  1OMW A;  1W1H A;  1U5D A;  1DDV A;  2DN6 A;  1UNR A;  1XD4 A;  1ZC4 B;  1UPR A;  3PZD A;  4PQ0 A;  4Z2M B;  3F5R A;  3FSS A;  4IOY X;  2CY5 A;  4B6H A;  1U5E A;  2EMS A;  4EKU A;  4TKN A;  2DKQ A;  4DBB A;  1WGQ A;  2Z0O A;  4EJN A;  2YS5 A;  5JP4 A;  1M7E A;  1MKE A;  4NY0 A;  1IRS A;  1KZ7 A;  3AJ4 A;  1WJM A;  4C0A A;  3HK0 A;  3ML4 A;  1ZC3 B;  1X05 A;  4KHB B;  1MIZ B;  1K5D B;  4A6K A;  1FHW A;  2E2X A;  1MPH A;  4HAW B;  2DX5 A;  1FAO A;  2IFS A;  2GCL A;  1I2H A;  1U2B A;  1Y19 B;  1M7R A;  5J3T A;  3MDB C;  2N23 A;  2UVM A;  5KQ4 A;  3MPX A;  1V5U A;  3DXE A;  1TXD A;  1FHX A;  2N0Y A;  1GG3 A;  1GC7 A;  3AU4 A;  3SUZ A;  5JLJ B;  4WSF A;  1N3H A;  1NU2 A;  3PEG A;  2VKI A;  1V88 A;  5L81 A;  2COF A;  4K2P A;  2V76 A;  4CHJ A;  4F7G A;  2COA A;  2W2X D;  3M1I B;  5C6R A;  1DDM A;  4GXB A;  4GPT B;  2P0D A;  3QWM A;  4XWX A;  4Y94 A;  3ODX A;  2ELB A;  1ZSQ A;  2R0D A;  2Z0P A;  2AL6 A;  2G35 A;  4H8S A;  2HE7 A;  2LG1 A;  2DTC A;  4YON A;  2D9V A;  4DX9 0;  5LON B;  1AQC A;  3BIN A;  2Z0Q A;  2P0H A;  2MWN B;  1V61 A;  3O96 A;  3FM8 C;  5CLQ B;  2FJL A;  1NTY A;  1FGZ A;  2K2J A;  5KQ1 A;  4IAP A;  1P5T A;  2D2Q A;  1BAK A;  2D10 A;  3HW2 B;  4IFS A;  4WJ7 A;  5D3X A;  2GJY A;  2J0M A;  1E5W A;  3D8E A;  5HE3 A;  4HAZ B;  5D27 A;  3V5W A;  5D3Y A;  2BCJ A;  1NTV A;  1Y5O A;  2DKP A;  3SYX A;  2IYB A;  4HAV B;  3QBV B;  4PNK A;  5DHF B;  1FB8 A;  5FI1 A;  3F0W A;  2KCJ A;  1X1G A;  2DHJ A;  2J0K A;  2P8V A;  4A6F B;  1NI2 A;  4HAU B;  4KHO A;  1MK9 B;  2GS0 A;  3D8D A;  2D9Z A;  4NSW A;  2D4Q A;  2ADZ A;  4GZU A;  1FOE A;  1H4R A;  4ZRK A;  5DIF B;  4Z2N A;  4K2O A;  1FHO A;  2XQN M;  1MK7 B;  2LYD A;  1MIX A;  3SV1 A;  1XOD A;  3WA0 A;  4GMV A;  1UNP A;  2I5F A;  4HB3 B;  4L6E A;  1P6S A;  1LW3 A;  1J19 A;  2NMB A;  5CLL B;  2I1K A;  1AWE A;  1EGX A;  3OAN A;  4A6H A;  4P7I A;  3D8F A;  3P6A A;  3TFM A;  3KY9 A;  1TQZ A;  2QKL A;  2GCJ A;  3PVU A;  1WJ1 A;  3U8Z A;  4TYZ A;  4YL8 A;  3NSU A;  2DYN A;  1K5G B;  4ZRJ A;  1KI1 B;  2DHK A;  2LKO A;  3RCP A;  4HAY B;  1UNQ A;  3G9W A;  2M14 A;  1U5F A;  2ZPY A;  2MKR A;  5DI9 B;  4K17 A;  5JHG A;  2CRF A;  2OQB A;  2COC A;  2Q13 A;  2Y7B A;  1LB1 A;  1SGH A;  2YS1 A;  2D9W A;  4KHA A;  1DBH A;  1RRP B;  2DX1 A;  4HB4 B;  2MFQ A;  2RVB B;  3KRX A;  2JP2 A;  2W2W A;  1DDW A;  1ZVR A;  4K81 A;  2YSZ A;  4F7U P;  1U27 A;  3VOQ A;  2YRY A;  1I7A A;  1PLS A;  3T06 A;  5J3Y A;  5J3Q A;  2DA0 A;  2RLO A;  4BBK A;  3P7Z A;  2AEH A;  3PVW A;  3GYO A;  2YS3 A;  2LOX A;  2RNR B;  2RGN B;  2ROZ B;  1BTN A;  1ISN A;  3KSY A;  4MK0 A;  3PG7 A;  2OTX A;  1BWN A;  2YT1 A;  3DXD A;  3ODO A;  4CYE A;  2VSZ A;  3ODW A;  2YVC A;  2P0F A;  4HAT B;  2I1J A;  1W1G A;  1XKE A;  4HHV A;  5DH9 B;  5C5B A;  1MAI A;  2D11 A;  1V5P A;  2UZS A;  2H7D A;  3IVF A;  5HE0 A;  1H10 A;  3WYF B;  2RSG A;  2L2I A;  3VIA A;  3SNH A;  4GMX B;  1WI1 A;  5LOP B;  2I5C A;  4MY6 A;  2ELA A;  1W1D A;  3UZT A;  5FI0 A;  4HAX B;  2W2X C;  2MDX A;  2D9Y A;  1EAZ A;  3U7D A;  4F7H A;  4CHM A;  1EVH A;  1PMS A;  1WGU A;  2Y8G A;  2ROV A;  2YT0 A;  3CIK A;  1U29 A;  2X18 A;  1U5G A;  2COD A;  3QIJ A;  4DX8 A;  2J59 M;  5HE2 A;  1XR0 B;  3FEH A; 
#chains in the Genus database with same CATH topology
 4GOU A;  3AU5 A;  2K2U A;  5C79 A;  2UZR A;  3A8P A;  1XCG A;  2Z59 A;  2DFK A;  2KGX B;  3TVV A;  2J0J A;  1EF1 A;  3PSC A;  4D6W A;  2M38 A;  2EC1 A;  5JHH A;  4DXA B;  2YF0 A;  5LG4 B;  4KAX B;  5HE1 A;  5EFX A;  5C5B B;  3SO6 A;  2CAY A;  2DYQ A;  1GC6 A;  4GN1 A;  2QKM A;  2Y8F A;  1QC6 A;  2DLW A;  3HQC A;  2K49 A;  1V89 A;  3TO1 A;  4MT7 A;  4A5K A;  4QJ4 B;  1XX0 A;  1V5M A;  1X11 A;  3DXC A;  1Q67 A;  2L1C A;  1BTK A;  3KRW A;  1SHC A;  2RUK B;  1KZG A;  5GOW B;  2PZ1 A;  5D3V A;  2EJ8 A;  2LOZ A;  3TCA A;  1X1F A;  5KCV A;  2HTH B;  3LJU X;  3GYP A;  1WVH A;  1J0W A;  1ZM0 A;  4HB2 B;  3CXB B;  3A8Q A;  1UEF A;  3NWD A;  1Z87 A;  1UPQ A;  2Z14 A;  3ULB A;  2R09 A;  1X86 A;  3TW1 A;  3X23 A;  1DYN A;  1B55 A;  2DHI A;  1DRO A;  3ULC A;  2KUP A;  2VRW B;  1P3R A;  5DHA B;  4A6F A;  3NW8 A;  2LUL A;  2EMT A;  5D3W A;  3PP2 A;  2D9X A;  3ZVR A;  3ZDT A;  1FGY A;  1WG7 A;  2H7E A;  4QJ5 B;  4KHB A;  5C16 A;  2CY4 A;  4ZRI A;  4EMO A;  4D0N B;  3KZ1 A;  4KVG B;  1OQN A;  2NBV A;  4HDQ A;  3BJI A;  5I2M A;  1QQG A;  1MI1 A;  4HB0 B;  2K00 A;  3PVL A;  4HDO A;  2R2Y A;  4QJ3 B;  3A98 B;  1TJ6 A;  1OY2 A;  1RJ2 A;  2NZ8 B;  3N7C A;  2FJU B;  5M4Y B;  4WVF B;  1PFJ A;  1OMW A;  1W1H A;  1U5D A;  1DDV A;  2DN6 A;  1UNR A;  1XD4 A;  1ZC4 B;  1UPR A;  3PZD A;  4PQ0 A;  4Z2M B;  3F5R A;  3FSS A;  4IOY X;  2CY5 A;  4B6H A;  1U5E A;  2EMS A;  4EKU A;  4TKN A;  2DKQ A;  4DBB A;  1WGQ A;  2Z0O A;  4EJN A;  2YS5 A;  5JP4 A;  1M7E A;  1MKE A;  4NY0 A;  1IRS A;  3HSA A;  1KZ7 A;  3AJ4 A;  1WJM A;  4C0A A;  3HK0 A;  3FVC A;  3ML4 A;  1ZC3 B;  1X05 A;  4KHB B;  1MIZ B;  1K5D B;  4A6K A;  1FHW A;  2E2X A;  1MPH A;  4HAW B;  2DX5 A;  1FAO A;  2IFS A;  2GCL A;  3HIE A;  1I2H A;  1U2B A;  1Y19 B;  1M7R A;  5J3T A;  3MDB C;  2Z13 A;  2N23 A;  2UVM A;  5KQ4 A;  3MPX A;  1V5U A;  4L1R A;  1ZYI A;  3DXE A;  1TXD A;  1FHX A;  2N0Y A;  1GG3 A;  1GC7 A;  3AU4 A;  3SUZ A;  5JLJ B;  4WSF A;  1N3H A;  1NU2 A;  3PEG A;  3OHM B;  2VKI A;  1V88 A;  5L81 A;  2COF A;  4K2P A;  2V76 A;  4CHJ A;  4F7G A;  2COA A;  2W2X D;  3M1I B;  5C6R A;  1DDM A;  5I2S A;  4GXB A;  4GPT B;  2P0D A;  3QWM A;  4XWX A;  4Y94 A;  3ODX A;  2ELB A;  1ZSQ A;  2R0D A;  3NWF A;  2Z0P A;  2AL6 A;  2G35 A;  4H8S A;  2HE7 A;  2LG1 A;  2DTC A;  4YON A;  2D9V A;  4DX9 0;  1T77 A;  5LON B;  1AQC A;  3BIN A;  2Z0Q A;  2P0H A;  2MWN B;  1V61 A;  3O96 A;  3FM8 C;  5CLQ B;  2FJL A;  1NTY A;  1FGZ A;  2KR0 A;  2K2J A;  5KQ1 A;  4IAP A;  1P5T A;  2D2Q A;  1BAK A;  2D10 A;  3HW2 B;  4IFS A;  4WJ7 A;  5D3X A;  2GJY A;  2J0M A;  1E5W A;  3D8E A;  4DIX A;  5HE3 A;  4HAZ B;  5D27 A;  3V5W A;  5D3Y A;  1XR0 B;  2BCJ A;  1NTV A;  1Y5O A;  2DKP A;  3SYX A;  2IYB A;  4HAV B;  2KIG A;  3QBV B;  4PNK A;  2KUQ A;  5DHF B;  1FB8 A;  2KIE A;  5FI1 A;  3F0W A;  2KCJ A;  1X1G A;  2DHJ A;  2J0K A;  5IRS A;  2P8V A;  4A6F B;  1NI2 A;  4HAU B;  4KHO A;  1MK9 B;  2GS0 A;  3D8D A;  2D9Z A;  4NSW A;  2D4Q A;  2ADZ A;  4GZU A;  1FOE A;  1H4R A;  4ZRK A;  5DIF B;  4Z2N A;  4K2O A;  1FHO A;  2XQN M;  1MK7 B;  2RRF A;  2LYD A;  1MIX A;  3SV1 A;  1XOD A;  3WA0 A;  3NWA A;  4GMV A;  1UNP A;  2I5F A;  4HB3 B;  4L6E A;  1P6S A;  1LW3 A;  1J19 A;  2NMB A;  5CLL B;  2I1K A;  1AWE A;  1EGX A;  3OAN A;  4A6H A;  4P7I A;  3D8F A;  3P6A A;  3TFM A;  3KY9 A;  1TQZ A;  2QKL A;  2GCJ A;  2YT2 A;  3PVU A;  1WJ1 A;  3U8Z A;  4TYZ A;  4YL8 A;  4GNK B;  3NSU A;  2DYN A;  1K5G B;  4ZRJ A;  1KI1 B;  2DHK A;  2LKO A;  4QXA B;  3RCP A;  4HAY B;  1UNQ A;  3G9W A;  2M14 A;  1U5F A;  2ZPY A;  2MKR A;  5DI9 B;  4K17 A;  5JHG A;  2CRF A;  2OQB A;  2COC A;  2Q13 A;  3A58 A;  2Y7B A;  1LB1 A;  1SGH A;  2YS1 A;  2D9W A;  4KHA A;  1DBH A;  1RRP B;  2DX1 A;  4HB4 B;  2MFQ A;  2RVB B;  3KRX A;  2JP2 A;  2W2W A;  1DDW A;  1ZVR A;  4K81 A;  2YSZ A;  4F7U P;  1U27 A;  3VOQ A;  2YRY A;  1I7A A;  1PLS A;  3T06 A;  3B77 A;  5J3Y A;  5J3Q A;  4OSN A;  2DA0 A;  2RLO A;  4BBK A;  3P7Z A;  2AEH A;  3PVW A;  3GYO A;  2YS3 A;  2LOX A;  2Z4D A;  2RNR B;  2RGN B;  2ROZ B;  1BTN A;  1ISN A;  3KSY A;  4MK0 A;  3PG7 A;  2OTX A;  1BWN A;  2YT1 A;  3DXD A;  3ODO A;  4CYE A;  2VSZ A;  3ODW A;  2YVC A;  2P0F A;  4HAT B;  2I1J A;  2GUM A;  4CSQ A;  1W1G A;  1XKE A;  4HHV A;  5DH9 B;  5C5B A;  3U12 A;  1MAI A;  2D11 A;  1V5P A;  2UZS A;  3DCX A;  2H7D A;  3IVF A;  5HE0 A;  1H10 A;  3WYF B;  2RSG A;  2L2I A;  3VIA A;  3SNH A;  4GMX B;  1WI1 A;  5LOP B;  2I5C A;  4MY6 A;  2ELA A;  1W1D A;  3UZT A;  5FI0 A;  4HAX B;  2W2X C;  2MDX A;  2D9Y A;  2ZKM X;  1EAZ A;  3U7D A;  4F7H A;  4CHM A;  1EVH A;  1PMS A;  1WGU A;  2Y8G A;  2ROV A;  2YT0 A;  3CIK A;  1U29 A;  4HSI A;  2X18 A;  1U5G A;  2COD A;  3QIJ A;  4OT1 A;  4DX8 A;  2J59 M;  5HE2 A;  2K8E A;  3FEH A; 
#chains in the Genus database with same CATH homology
 3AU5 A;  2K2U A;  5C79 A;  2UZR A;  3A8P A;  1XCG A;  2DFK A;  2KGX B;  3TVV A;  2J0J A;  1EF1 A;  3PSC A;  2M38 A;  2EC1 A;  5JHH A;  4DXA B;  2YF0 A;  4KAX B;  5HE1 A;  5EFX A;  5C5B B;  3SO6 A;  2CAY A;  2DYQ A;  1GC6 A;  4GN1 A;  2QKM A;  2Y8F A;  1QC6 A;  2DLW A;  3HQC A;  1V89 A;  3TO1 A;  4MT7 A;  4A5K A;  1XX0 A;  1V5M A;  1X11 A;  3DXC A;  1Q67 A;  2L1C A;  1BTK A;  3KRW A;  1SHC A;  2RUK B;  1KZG A;  5GOW B;  2PZ1 A;  5D3V A;  2EJ8 A;  2LOZ A;  3TCA A;  1X1F A;  5KCV A;  2HTH B;  3LJU X;  3GYP A;  1WVH A;  1J0W A;  1ZM0 A;  4HB2 B;  3CXB B;  3A8Q A;  1UEF A;  1Z87 A;  1UPQ A;  3ULB A;  2R09 A;  1X86 A;  3TW1 A;  3X23 A;  1DYN A;  1B55 A;  2DHI A;  1DRO A;  3ULC A;  2KUP A;  2VRW B;  1P3R A;  5DHA B;  4A6F A;  2LUL A;  2EMT A;  5D3W A;  3PP2 A;  2D9X A;  3ZVR A;  3ZDT A;  1FGY A;  1WG7 A;  2H7E A;  5C16 A;  2CY4 A;  4ZRI A;  4EMO A;  4D0N B;  3KZ1 A;  4KVG B;  1OQN A;  4HDQ A;  3BJI A;  1QQG A;  4HB0 B;  2K00 A;  3PVL A;  4HDO A;  3A98 B;  1TJ6 A;  1OY2 A;  1RJ2 A;  2NZ8 B;  3N7C A;  4WVF B;  1PFJ A;  1OMW A;  1W1H A;  1U5D A;  1DDV A;  2DN6 A;  1UNR A;  1XD4 A;  1ZC4 B;  1UPR A;  3PZD A;  4PQ0 A;  4Z2M B;  3F5R A;  3FSS A;  4IOY X;  2CY5 A;  4B6H A;  1U5E A;  2EMS A;  4EKU A;  4TKN A;  2DKQ A;  4DBB A;  1WGQ A;  2Z0O A;  4EJN A;  2YS5 A;  5JP4 A;  1M7E A;  1MKE A;  4NY0 A;  1IRS A;  1KZ7 A;  3AJ4 A;  1WJM A;  4C0A A;  3HK0 A;  3ML4 A;  1ZC3 B;  1X05 A;  4KHB B;  1MIZ B;  1K5D B;  4A6K A;  1FHW A;  2E2X A;  1MPH A;  4HAW B;  2DX5 A;  1FAO A;  2IFS A;  2GCL A;  1I2H A;  1U2B A;  1Y19 B;  1M7R A;  5J3T A;  3MDB C;  2N23 A;  2UVM A;  5KQ4 A;  3MPX A;  1V5U A;  3DXE A;  1TXD A;  1FHX A;  2N0Y A;  1GG3 A;  1GC7 A;  3AU4 A;  3SUZ A;  5JLJ B;  4WSF A;  1N3H A;  1NU2 A;  3PEG A;  2VKI A;  1V88 A;  5L81 A;  2COF A;  4K2P A;  2V76 A;  4CHJ A;  4F7G A;  2COA A;  2W2X D;  3M1I B;  5C6R A;  1DDM A;  4GXB A;  4GPT B;  2P0D A;  3QWM A;  4XWX A;  4Y94 A;  3ODX A;  2ELB A;  1ZSQ A;  2R0D A;  2Z0P A;  2AL6 A;  2G35 A;  4H8S A;  2HE7 A;  2LG1 A;  2DTC A;  4YON A;  2D9V A;  4DX9 0;  5LON B;  1AQC A;  3BIN A;  2Z0Q A;  2P0H A;  2MWN B;  1V61 A;  3O96 A;  3FM8 C;  5CLQ B;  2FJL A;  1NTY A;  1FGZ A;  2K2J A;  5KQ1 A;  4IAP A;  1P5T A;  2D2Q A;  1BAK A;  2D10 A;  3HW2 B;  4IFS A;  4WJ7 A;  5D3X A;  2GJY A;  2J0M A;  1E5W A;  3D8E A;  5HE3 A;  4HAZ B;  5D27 A;  3V5W A;  5D3Y A;  2BCJ A;  1NTV A;  1Y5O A;  2DKP A;  3SYX A;  2IYB A;  4HAV B;  3QBV B;  4PNK A;  5DHF B;  1FB8 A;  5FI1 A;  3F0W A;  2KCJ A;  1X1G A;  2DHJ A;  2J0K A;  2P8V A;  4A6F B;  1NI2 A;  4HAU B;  4KHO A;  1MK9 B;  2GS0 A;  3D8D A;  2D9Z A;  4NSW A;  2D4Q A;  2ADZ A;  4GZU A;  1FOE A;  1H4R A;  4ZRK A;  5DIF B;  4Z2N A;  4K2O A;  1FHO A;  2XQN M;  1MK7 B;  2LYD A;  1MIX A;  3SV1 A;  1XOD A;  3WA0 A;  4GMV A;  1UNP A;  2I5F A;  4HB3 B;  4L6E A;  1P6S A;  1LW3 A;  1J19 A;  2NMB A;  5CLL B;  2I1K A;  1AWE A;  1EGX A;  3OAN A;  4A6H A;  4P7I A;  3D8F A;  3P6A A;  3TFM A;  3KY9 A;  1TQZ A;  2QKL A;  2GCJ A;  3PVU A;  1WJ1 A;  3U8Z A;  4TYZ A;  4YL8 A;  3NSU A;  2DYN A;  1K5G B;  4ZRJ A;  1KI1 B;  2DHK A;  2LKO A;  3RCP A;  4HAY B;  1UNQ A;  3G9W A;  2M14 A;  1U5F A;  2ZPY A;  2MKR A;  5DI9 B;  4K17 A;  5JHG A;  2CRF A;  2OQB A;  2COC A;  2Q13 A;  2Y7B A;  1LB1 A;  1SGH A;  2YS1 A;  2D9W A;  4KHA A;  1DBH A;  1RRP B;  2DX1 A;  4HB4 B;  2MFQ A;  2RVB B;  3KRX A;  2JP2 A;  2W2W A;  1DDW A;  1ZVR A;  4K81 A;  2YSZ A;  4F7U P;  1U27 A;  3VOQ A;  2YRY A;  1I7A A;  1PLS A;  3T06 A;  5J3Y A;  5J3Q A;  2DA0 A;  2RLO A;  4BBK A;  3P7Z A;  2AEH A;  3PVW A;  3GYO A;  2YS3 A;  2LOX A;  2RNR B;  2RGN B;  2ROZ B;  1BTN A;  1ISN A;  3KSY A;  4MK0 A;  3PG7 A;  2OTX A;  1BWN A;  2YT1 A;  3DXD A;  3ODO A;  4CYE A;  2VSZ A;  3ODW A;  2YVC A;  2P0F A;  4HAT B;  2I1J A;  1W1G A;  1XKE A;  4HHV A;  5DH9 B;  5C5B A;  1MAI A;  2D11 A;  1V5P A;  2UZS A;  2H7D A;  3IVF A;  5HE0 A;  1H10 A;  3WYF B;  2RSG A;  2L2I A;  3VIA A;  3SNH A;  4GMX B;  1WI1 A;  5LOP B;  2I5C A;  4MY6 A;  2ELA A;  1W1D A;  3UZT A;  5FI0 A;  4HAX B;  2W2X C;  2MDX A;  2D9Y A;  1EAZ A;  3U7D A;  4F7H A;  4CHM A;  1EVH A;  1PMS A;  1WGU A;  2Y8G A;  2ROV A;  2YT0 A;  3CIK A;  1U29 A;  2X18 A;  1U5G A;  2COD A;  3QIJ A;  4DX8 A;  2J59 M;  5HE2 A;  1XR0 B;  3FEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...