3TFMA

Myosin x ph1n-ph2-ph1c tandem
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
208
structure length
208
Chain Sequence
PYFHSFLYMNGGLMNSWKRRWCVLKDETFLWFRSKQEALKQGWLHNNGGGSSTLSRRNWKKRWFVLRQSKLMYFENDSEEKLKGTVEVRSAKEIIDNTNKENGIDIIMADRTFHLIAESPEDASQWFSVLSQVHSSTDQEIREMHDEQANPQNAVGTLDVGLIDSVCASDSPDRPNSFVIITANRVLHCNADTPEEMHHWITLLQRSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin X
publication title Structural basis of the myosin X PH1N-PH2-PH1C tandem as a specific and acute cellular PI(3,4,5)P3 sensor
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Motor protein
total genus 50
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2011-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3tfmA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3tfmA01
4HAYB 1BAKA 2YF0A 1M7EA 1FB8A 1X1FA 1KI1B 2I5CA 2UZSA 4F7GA 1TJ6A 1FGYA 1DDWA 2DYNA 2I1KA 1OMWA 2MKRA 4F7UP 4DX90 2COAA 5C79A 4Z2NA 1U5GA 1H4RA 1Q67A 1ZC3B 2ROZB 2E2XA 4HB0B 3FEHA 2CRFA 4HB3B 2YT0A 2YSZA 2JP2A 2IFSA 2DN6A 2DLWA 1UNQA 2LG1A 2OTXA 1IRSA 1MKEA 1N3HA 2UVMA 2KGXB 2DA0A 3ML4A 3F5RA 2ZPYA 4HB4B 3HK0A 2RUKB 2Y8GA 2RSGA 1QQGA 2GJYA 1TQZA 4NSWA 4WVFB 2GCJA 1J19A 3D8FA 2IYBA 1LB1A 2Z0QA 5CLQB 4HDQA 3PP2A 3OANA 3KRWA 1RJ2A 5JHGA 1U5EA 1W1DA 5DI9B 2D9VA 5D3XA 2ADZA 1NU2A 1AQCA 1E5WA 4A6KA 2Y8FA 1UEFA 1EVHA 1ZM0A 5LOPB 2DTCA 3CIKA 5HE1A 1FHWA 2CY4A 3HQCA 3KZ1A 2HTHB 1BWNA 2GCLA 1V88A 3LJUX 2MFQA 3TFMA 2RLOA 2AEHA 2YS3A 3PVUA 1WG7A 3KRXA 1ZVRA 4K81A 1ISNA 3DXEA 2R0DA 1P3RA 2VRWB 2D9ZA 4GZUA 5HE3A 5C5BB 1DDVA 5HE0A 1P6SA 2ROVA 4HAWB 2LOZA 4B6HA 2D9WA 3D8EA 3M1IB 4EKUA 1Y19B 2W2WA 4HAXB 1DDMA 2K2UA 2V76A 4KHOA 1MIZB 1FHOA 1ZSQA 4GN1A 3DXCA 3A8PA 1X1GA 2N0YA 1V5MA 2P0HA 4CYEA 4L6EA 3AU5A 4CHJA 1TXDA 2Z0PA 2K2JA 1DYNA 2J59M 2I5FA 2EC1A 2AL6A 3A98B 3SUZA 1WGUA 1WJ1A 4IAPA 2RGNB 3MPXA 2D9YA 5D3WA 4MK0A 2KCJA 2EJ8A 1V89A 4YONA 1KZGA 3SO6A 4KHBB 2CY5A 4MY6A 1EGXA 2Q13A 4TKNA 4BBKA 1DROA 4HAUB 3SYXA 3RCPA 5JLJB 1UNPA 2RVBB 3FSSA 1U29A 5L81A 2VKIA 3IVFA 3G9WA 3AU4A 1FHXA 1RRPB 1WGQA 1U5FA 2H7DA 1OY2A 2LYDA 5KQ1A 5D3VA 1FGZA 1B55A 2OQBA 3PSCA 1GC6A 2R09A 3N7CA 1K5DB 2KUPA 1FOEA 3T06A 4GMVA 3ULBA 2H7EA 5JP4A 1OQNA 3UZTA 5FI1A 2J0MA 2YS5A 4A6FA 1UPQA 2M14A 3QBVB 3PG7A 3U7DA 1X05A 5C5BA 4K17A 3P7ZA 4KAXB 2DKPA 3VOQA 5DHAB 5DHFB 1GG3A 5C6RA 3V5WA 3ODWA 1FAOA 2D2QA 2Y7BA 3ZDTA 2DHIA 4K2OA 2DHJA 3ULCA 1I2HA 1XCGA 1XR0B 3QWMA 1I7AA 3KY9A 1QC6A 1U5DA 2PZ1A 2DKQA 1MAIA 2ELAA 5EFXA 4HHVA 1U2BA 4GMXB 3ZVRA 2YRYA 2DYQA 1WVHA 4F7HA 1EF1A 2I1JA 2X18A 2LKOA 1SGHA 1MPHA 2LULA 5J3TA 2P0DA 3O96A 2D10A 3TW1A 2QKMA 1GC7A 1BTNA 4EMOA 4GXBA 2YT1A 1NTYA 4EJNA 4PNKA 4ZRJA 2M38A 3NSUA 1V5UA 4C0AA 5D3YA 3F0WA 1AWEA 3HW2B 4YL8A 1XD4A 1WJMA 4NY0A 4XWXA 4ZRKA 2L2IA 5J3YA 4MT7A 3WYFB 3VIAA 4KHAA 1K5GB 2D4QA 1W1HA 1WI1A 2CAYA 2D11A 4CHMA 3MDBC 5J3QA 4HAZB 2L1CA 2RNRB 1V5PA 2ELBA 1EAZA 1XKEA 4K2PA 1Z87A 4IOYX 3U8ZA 1X86A 3P6AA 5DH9B 1NTVA 1XODA 2LOXA 3D8DA 1UNRA 4GPTB 1P5TA 1MK9B 1LW3A 2J0KA 2XQNM 2YS1A 4TYZA 1KZ7A 2P0FA 4IFSA 3PVWA 3FM8C 3PZDA 4DXAB 1H10A 1UPRA 1V61A 2QKLA 2NMBA 3DXDA 2CODA 2DX5A 5KCVA 4D0NB 2GS0A 2HE7A 3QIJA 1DBHA 2W2XC 2G35A 5KQ4A 5DIFB 4H8SA 3GYOA 4PQ0A 1X11A 5C16A 1M7RA 3WA0A 2COCA 3A8QA 3PVLA 1NI2A 2DHKA 5FI0A 4DX8A 3BINA 1PLSA 2COFA 2Z0OA 4HAVB 2EMTA 2J0JA 2DX1A 2W2XD 4ZRIA 2MDXA 4HATB 4Z2MB 3TO1A 5HE2A 2EMSA 4HDOA 3TVVA 3TCAA 1J0WA 3CXBB 5CLLB 2K00A 1MIXA 3GYPA 5JHHA 2UZRA 3ODOA 5GOWB 1Y5OA 2BCJA 4A6FB 3KSYA 4P7IA 4WJ7A 3SNHA 4Y94A 2MWNB 1U27A 2N23A 2P8VA 2D9XA 3BJIA 3PEGA 2DFKA 3X23A 2VSZA 1PFJA 1PMSA 3ODXA 1W1GA 5D27A 1SHCA 1XX0A 1BTKA 3SV1A 1ZC4B 1MK7B 2NZ8B 4WSFA 4KVGB 3AJ4A 2YVCA 4HB2B 4DBBA 2FJLA 5LONB 4A6HA 4A5KA
chains in the Genus database with same CATH superfamily
4HAYB 1BAKA 2YF0A 1M7EA 1FB8A 1X1FA 3A58A 1KI1B 2I5CA 2UZSA 4F7GA 1TJ6A 1FGYA 1DDWA 2DYNA 2I1KA 1OMWA 5I2SA 2MKRA 3U12A 4F7UP 4DX90 2COAA 5C79A 4Z2NA 1U5GA 1H4RA 1Q67A 1ZC3B 2ROZB 2E2XA 4HB0B 3FEHA 2CRFA 4HB3B 4HSIA 2YT0A 2YSZA 2JP2A 2IFSA 2DN6A 2DLWA 1UNQA 2LG1A 2OTXA 1IRSA 1MKEA 1N3HA 2UVMA 2KGXB 2DA0A 3F5RA 2ZPYA 3ML4A 4HB4B 3HK0A 2RUKB 2Y8GA 3FVCA 4QJ5B 2RSGA 1QQGA 2GJYA 1TQZA 4NSWA 4WVFB 2GCJA 1J19A 2Z14A 3D8FA 2IYBA 1LB1A 2Z0QA 5CLQB 4HDQA 3PP2A 3OANA 2YT2A 3KRWA 1RJ2A 4OT1A 5JHGA 1U5EA 1W1DA 5DI9B 2D9VA 5D3XA 2ADZA 1NU2A 1T77A 1AQCA 1E5WA 4A6KA 2Y8FA 1UEFA 1EVHA 1ZM0A 5LOPB 2DTCA 3CIKA 5HE1A 1FHWA 2CY4A 3HQCA 3KZ1A 2KIEA 3NWAA 2HTHB 1BWNA 2GCLA 1V88A 3LJUX 2MFQA 3TFMA 2RLOA 3HSAA 2AEHA 2YS3A 3PVUA 1WG7A 3KRXA 1ZVRA 2Z4DA 4K81A 1ISNA 3DXEA 2R0DA 1P3RA 2VRWB 2D9ZA 4GZUA 5HE3A 5C5BB 1DDVA 5HE0A 1P6SA 2ROVA 4HAWB 2K8EA 2LOZA 4OSNA 4B6HA 2D9WA 3D8EA 3M1IB 5I2MA 4DIXA 4EKUA 1Y19B 2W2WA 4HAXB 1DDMA 2K2UA 2V76A 4KHOA 1MIZB 3B77A 1FHOA 1ZSQA 4GN1A 4QJ4B 3DXCA 3A8PA 1X1GA 2N0YA 1V5MA 2P0HA 4CYEA 4L6EA 3AU5A 4CHJA 1TXDA 2Z0PA 2K2JA 1DYNA 2J59M 2I5FA 2EC1A 2AL6A 3A98B 3SUZA 1WGUA 1WJ1A 3OHMB 4IAPA 2RGNB 3MPXA 2D9YA 5D3WA 4MK0A 2KCJA 2EJ8A 5IRSA 1V89A 4YONA 2Z59A 1KZGA 3SO6A 4KHBB 2CY5A 4MY6A 1EGXA 2Q13A 4TKNA 4BBKA 1DROA 2R2YA 4HAUB 3SYXA 3HIEA 2Z13A 3RCPA 5JLJB 1UNPA 2RVBB 3FSSA 1U29A 5L81A 5M4YB 2VKIA 3IVFA 3G9WA 3AU4A 1FHXA 1RRPB 1WGQA 1U5FA 2H7DA 1OY2A 2LYDA 5KQ1A 2RRFA 5D3VA 1FGZA 1B55A 2OQBA 3PSCA 1GC6A 2KUQA 2R09A 3N7CA 1K5DB 2KUPA 1FOEA 3T06A 4GMVA 3ULBA 2H7EA 5JP4A 1OQNA 3UZTA 2K49A 5FI1A 5LG4B 2J0MA 2YS5A 4A6FA 1UPQA 2M14A 3QBVB 3PG7A 1ZYIA 3U7DA 1X05A 5C5BA 4K17A 3P7ZA 4KAXB 4QXAB 2DKPA 3VOQA 5DHAB 5DHFB 1GG3A 5C6RA 3V5WA 2ZKMX 3ODWA 1FAOA 2D2QA 2Y7BA 3ZDTA 2DHIA 4K2OA 2DHJA 3ULCA 1I2HA 1XCGA 1XR0B 3QWMA 1I7AA 3KY9A 1QC6A 1U5DA 2PZ1A 2DKQA 1MAIA 2ELAA 5EFXA 4HHVA 1U2BA 4GMXB 3ZVRA 3NWFA 2YRYA 2DYQA 1WVHA 4F7HA 1EF1A 2I1JA 2X18A 2LKOA 1MI1A 1SGHA 1MPHA 2KR0A 2LULA 5J3TA 2P0DA 3O96A 2D10A 3TW1A 2QKMA 1GC7A 4GOUA 1BTNA 4EMOA 4GXBA 2YT1A 1NTYA 2KIGA 4EJNA 4PNKA 4ZRJA 2M38A 3NSUA 1V5UA 4C0AA 5D3YA 3F0WA 1AWEA 3HW2B 4YL8A 1XD4A 3NWDA 1WJMA 4NY0A 4XWXA 4ZRKA 2L2IA 5J3YA 4MT7A 3WYFB 3VIAA 4KHAA 1K5GB 2D4QA 1W1HA 1WI1A 2CAYA 2D11A 4CHMA 3MDBC 5J3QA 4HAZB 2L1CA 2RNRB 1V5PA 2ELBA 1EAZA 2NBVA 1XKEA 4K2PA 1Z87A 4IOYX 3U8ZA 1X86A 3P6AA 5DH9B 1NTVA 1XODA 2LOXA 3D8DA 1UNRA 4GPTB 1P5TA 1MK9B 1LW3A 2J0KA 2XQNM 2YS1A 4TYZA 1KZ7A 2P0FA 4IFSA 3PVWA 3FM8C 3PZDA 4DXAB 1H10A 1UPRA 1V61A 2QKLA 2NMBA 3DXDA 2CODA 2DX5A 5KCVA 4D0NB 2GS0A 2HE7A 3QIJA 2FJUB 1DBHA 2W2XC 2G35A 5KQ4A 5DIFB 4GNKB 4H8SA 3GYOA 4PQ0A 1X11A 5C16A 1M7RA 3WA0A 2COCA 3A8QA 3PVLA 1NI2A 2DHKA 5FI0A 4DX8A 3BINA 1PLSA 2GUMA 2COFA 2Z0OA 4HAVB 2EMTA 2J0JA 2DX1A 2W2XD 4ZRIA 2MDXA 4CSQA 4HATB 4Z2MB 3TO1A 5HE2A 2EMSA 4HDOA 3TVVA 3TCAA 4QJ3B 1J0WA 3CXBB 5CLLB 2K00A 1MIXA 3GYPA 4D6WA 5JHHA 2UZRA 3ODOA 3NW8A 5GOWB 1Y5OA 2BCJA 4A6FB 3KSYA 4P7IA 4WJ7A 3SNHA 4Y94A 2MWNB 1U27A 2N23A 2P8VA 2D9XA 3BJIA 3PEGA 2DFKA 3X23A 2VSZA 1PFJA 1PMSA 4L1RA 3ODXA 1W1GA 3DCXA 5D27A 1SHCA 1XX0A 1BTKA 3SV1A 1ZC4B 1MK7B 2NZ8B 4KHBA 4WSFA 4KVGB 3AJ4A 2YVCA 4HB2B 4DBBA 2FJLA 5LONB 4A6HA 4A5KA
chains in the Genus database with same CATH topology
4HAYB 1BAKA 2YF0A 1M7EA 1FB8A 1X1FA 1KI1B 2I5CA 2UZSA 4F7GA 1TJ6A 1FGYA 1DDWA 2DYNA 2I1KA 1OMWA 2MKRA 4F7UP 4DX90 2COAA 5C79A 4Z2NA 1U5GA 1H4RA 1Q67A 1ZC3B 2ROZB 2E2XA 4HB0B 3FEHA 2CRFA 4HB3B 2YT0A 2YSZA 2JP2A 2IFSA 2DN6A 2DLWA 1UNQA 2LG1A 2OTXA 1IRSA 1MKEA 1N3HA 2UVMA 2KGXB 2DA0A 3ML4A 3F5RA 2ZPYA 4HB4B 3HK0A 2RUKB 2Y8GA 2RSGA 1QQGA 2GJYA 1TQZA 4NSWA 4WVFB 2GCJA 1J19A 3D8FA 2IYBA 1LB1A 2Z0QA 5CLQB 4HDQA 3PP2A 3OANA 3KRWA 1RJ2A 5JHGA 1U5EA 1W1DA 5DI9B 2D9VA 5D3XA 2ADZA 1NU2A 1AQCA 1E5WA 4A6KA 2Y8FA 1UEFA 1EVHA 1ZM0A 5LOPB 2DTCA 3CIKA 5HE1A 1FHWA 2CY4A 3HQCA 3KZ1A 2HTHB 1BWNA 2GCLA 1V88A 3LJUX 2MFQA 3TFMA 2RLOA 2AEHA 2YS3A 3PVUA 1WG7A 3KRXA 1ZVRA 4K81A 1ISNA 3DXEA 2R0DA 1P3RA 2VRWB 2D9ZA 4GZUA 5HE3A 5C5BB 1DDVA 5HE0A 1P6SA 2ROVA 4HAWB 2LOZA 4B6HA 2D9WA 3D8EA 3M1IB 4EKUA 1Y19B 2W2WA 4HAXB 1DDMA 2K2UA 2V76A 4KHOA 1MIZB 1FHOA 1ZSQA 4GN1A 3DXCA 3A8PA 1X1GA 2N0YA 1V5MA 2P0HA 4CYEA 4L6EA 3AU5A 4CHJA 1TXDA 2Z0PA 2K2JA 1DYNA 2J59M 2I5FA 2EC1A 2AL6A 3A98B 3SUZA 1WGUA 1WJ1A 4IAPA 2RGNB 3MPXA 2D9YA 5D3WA 4MK0A 2KCJA 2EJ8A 1V89A 4YONA 1KZGA 3SO6A 4KHBB 2CY5A 4MY6A 1EGXA 2Q13A 4TKNA 4BBKA 1DROA 4HAUB 3SYXA 3RCPA 5JLJB 1UNPA 2RVBB 3FSSA 1U29A 5L81A 2VKIA 3IVFA 3G9WA 3AU4A 1FHXA 1RRPB 1WGQA 1U5FA 2H7DA 1OY2A 2LYDA 5KQ1A 5D3VA 1FGZA 1B55A 2OQBA 3PSCA 1GC6A 2R09A 3N7CA 1K5DB 2KUPA 1FOEA 3T06A 4GMVA 3ULBA 2H7EA 5JP4A 1OQNA 3UZTA 5FI1A 2J0MA 2YS5A 4A6FA 1UPQA 2M14A 3QBVB 3PG7A 3U7DA 1X05A 5C5BA 4K17A 3P7ZA 4KAXB 2DKPA 3VOQA 5DHAB 5DHFB 1GG3A 5C6RA 3V5WA 3ODWA 1FAOA 2D2QA 2Y7BA 3ZDTA 2DHIA 4K2OA 2DHJA 3ULCA 1I2HA 1XCGA 1XR0B 3QWMA 1I7AA 3KY9A 1QC6A 1U5DA 2PZ1A 2DKQA 1MAIA 2ELAA 5EFXA 4HHVA 1U2BA 4GMXB 3ZVRA 2YRYA 2DYQA 1WVHA 4F7HA 1EF1A 2I1JA 2X18A 2LKOA 1SGHA 1MPHA 2LULA 5J3TA 2P0DA 3O96A 2D10A 3TW1A 2QKMA 1GC7A 1BTNA 4EMOA 4GXBA 2YT1A 1NTYA 4EJNA 4PNKA 4ZRJA 2M38A 3NSUA 1V5UA 4C0AA 5D3YA 3F0WA 1AWEA 3HW2B 4YL8A 1XD4A 1WJMA 4NY0A 4XWXA 4ZRKA 2L2IA 5J3YA 4MT7A 3WYFB 3VIAA 4KHAA 1K5GB 2D4QA 1W1HA 1WI1A 2CAYA 2D11A 4CHMA 3MDBC 5J3QA 4HAZB 2L1CA 2RNRB 1V5PA 2ELBA 1EAZA 1XKEA 4K2PA 1Z87A 4IOYX 3U8ZA 1X86A 3P6AA 5DH9B 1NTVA 1XODA 2LOXA 3D8DA 1UNRA 4GPTB 1P5TA 1MK9B 1LW3A 2J0KA 2XQNM 2YS1A 4TYZA 1KZ7A 2P0FA 4IFSA 3PVWA 3FM8C 3PZDA 4DXAB 1H10A 1UPRA 1V61A 2QKLA 2NMBA 3DXDA 2CODA 2DX5A 5KCVA 4D0NB 2GS0A 2HE7A 3QIJA 1DBHA 2W2XC 2G35A 5KQ4A 5DIFB 4H8SA 3GYOA 4PQ0A 1X11A 5C16A 1M7RA 3WA0A 2COCA 3A8QA 3PVLA 1NI2A 2DHKA 5FI0A 4DX8A 3BINA 1PLSA 2COFA 2Z0OA 4HAVB 2EMTA 2J0JA 2DX1A 2W2XD 4ZRIA 2MDXA 4HATB 4Z2MB 3TO1A 5HE2A 2EMSA 4HDOA 3TVVA 3TCAA 1J0WA 3CXBB 5CLLB 2K00A 1MIXA 3GYPA 5JHHA 2UZRA 3ODOA 5GOWB 1Y5OA 2BCJA 4A6FB 3KSYA 4P7IA 4WJ7A 3SNHA 4Y94A 2MWNB 1U27A 2N23A 2P8VA 2D9XA 3BJIA 3PEGA 2DFKA 3X23A 2VSZA 1PFJA 1PMSA 3ODXA 1W1GA 5D27A 1SHCA 1XX0A 1BTKA 3SV1A 1ZC4B 1MK7B 2NZ8B 4WSFA 4KVGB 3AJ4A 2YVCA 4HB2B 4DBBA 2FJLA 5LONB 4A6HA 4A5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HAY B;  1BAK A;  2YF0 A;  1M7E A;  1FB8 A;  1X1F A;  1KI1 B;  2I5C A;  2UZS A;  4F7G A;  1TJ6 A;  1FGY A;  1DDW A;  2DYN A;  2I1K A;  1OMW A;  2MKR A;  4F7U P;  4DX9 0;  2COA A;  5C79 A;  4Z2N A;  1U5G A;  1H4R A;  1Q67 A;  1ZC3 B;  2ROZ B;  2E2X A;  4HB0 B;  3FEH A;  2CRF A;  4HB3 B;  2YT0 A;  2YSZ A;  2JP2 A;  2IFS A;  2DN6 A;  2DLW A;  1UNQ A;  2LG1 A;  2OTX A;  1IRS A;  1MKE A;  1N3H A;  2UVM A;  2KGX B;  2DA0 A;  3ML4 A;  3F5R A;  2ZPY A;  4HB4 B;  3HK0 A;  2RUK B;  2Y8G A;  2RSG A;  1QQG A;  2GJY A;  1TQZ A;  4NSW A;  4WVF B;  2GCJ A;  1J19 A;  3D8F A;  2IYB A;  1LB1 A;  2Z0Q A;  5CLQ B;  4HDQ A;  3PP2 A;  3OAN A;  3KRW A;  1RJ2 A;  5JHG A;  1U5E A;  1W1D A;  5DI9 B;  2D9V A;  5D3X A;  2ADZ A;  1NU2 A;  1AQC A;  1E5W A;  4A6K A;  2Y8F A;  1UEF A;  1EVH A;  1ZM0 A;  5LOP B;  2DTC A;  3CIK A;  5HE1 A;  1FHW A;  2CY4 A;  3HQC A;  3KZ1 A;  2HTH B;  1BWN A;  2GCL A;  1V88 A;  3LJU X;  2MFQ A;  3TFM A;  2RLO A;  2AEH A;  2YS3 A;  3PVU A;  1WG7 A;  3KRX A;  1ZVR A;  4K81 A;  1ISN A;  3DXE A;  2R0D A;  1P3R A;  2VRW B;  2D9Z A;  4GZU A;  5HE3 A;  5C5B B;  1DDV A;  5HE0 A;  1P6S A;  2ROV A;  4HAW B;  2LOZ A;  4B6H A;  2D9W A;  3D8E A;  3M1I B;  4EKU A;  1Y19 B;  2W2W A;  4HAX B;  1DDM A;  2K2U A;  2V76 A;  4KHO A;  1MIZ B;  1FHO A;  1ZSQ A;  4GN1 A;  3DXC A;  3A8P A;  1X1G A;  2N0Y A;  1V5M A;  2P0H A;  4CYE A;  4L6E A;  3AU5 A;  4CHJ A;  1TXD A;  2Z0P A;  2K2J A;  1DYN A;  2J59 M;  2I5F A;  2EC1 A;  2AL6 A;  3A98 B;  3SUZ A;  1WGU A;  1WJ1 A;  4IAP A;  2RGN B;  3MPX A;  2D9Y A;  5D3W A;  4MK0 A;  2KCJ A;  2EJ8 A;  1V89 A;  4YON A;  1KZG A;  3SO6 A;  4KHB B;  2CY5 A;  4MY6 A;  1EGX A;  2Q13 A;  4TKN A;  4BBK A;  1DRO A;  4HAU B;  3SYX A;  3RCP A;  5JLJ B;  1UNP A;  2RVB B;  3FSS A;  1U29 A;  5L81 A;  2VKI A;  3IVF A;  3G9W A;  3AU4 A;  1FHX A;  1RRP B;  1WGQ A;  1U5F A;  2H7D A;  1OY2 A;  2LYD A;  5KQ1 A;  5D3V A;  1FGZ A;  1B55 A;  2OQB A;  3PSC A;  1GC6 A;  2R09 A;  3N7C A;  1K5D B;  2KUP A;  1FOE A;  3T06 A;  4GMV A;  3ULB A;  2H7E A;  5JP4 A;  1OQN A;  3UZT A;  5FI1 A;  2J0M A;  2YS5 A;  4A6F A;  1UPQ A;  2M14 A;  3QBV B;  3PG7 A;  3U7D A;  1X05 A;  5C5B A;  4K17 A;  3P7Z A;  4KAX B;  2DKP A;  3VOQ A;  5DHA B;  5DHF B;  1GG3 A;  5C6R A;  3V5W A;  3ODW A;  1FAO A;  2D2Q A;  2Y7B A;  3ZDT A;  2DHI A;  4K2O A;  2DHJ A;  3ULC A;  1I2H A;  1XCG A;  1XR0 B;  3QWM A;  1I7A A;  3KY9 A;  1QC6 A;  1U5D A;  2PZ1 A;  2DKQ A;  1MAI A;  2ELA A;  5EFX A;  4HHV A;  1U2B A;  4GMX B;  3ZVR A;  2YRY A;  2DYQ A;  1WVH A;  4F7H A;  1EF1 A;  2I1J A;  2X18 A;  2LKO A;  1SGH A;  1MPH A;  2LUL A;  5J3T A;  2P0D A;  3O96 A;  2D10 A;  3TW1 A;  2QKM A;  1GC7 A;  1BTN A;  4EMO A;  4GXB A;  2YT1 A;  1NTY A;  4EJN A;  4PNK A;  4ZRJ A;  2M38 A;  3NSU A;  1V5U A;  4C0A A;  5D3Y A;  3F0W A;  1AWE A;  3HW2 B;  4YL8 A;  1XD4 A;  1WJM A;  4NY0 A;  4XWX A;  4ZRK A;  2L2I A;  5J3Y A;  4MT7 A;  3WYF B;  3VIA A;  4KHA A;  1K5G B;  2D4Q A;  1W1H A;  1WI1 A;  2CAY A;  2D11 A;  4CHM A;  3MDB C;  5J3Q A;  4HAZ B;  2L1C A;  2RNR B;  1V5P A;  2ELB A;  1EAZ A;  1XKE A;  4K2P A;  1Z87 A;  4IOY X;  3U8Z A;  1X86 A;  3P6A A;  5DH9 B;  1NTV A;  1XOD A;  2LOX A;  3D8D A;  1UNR A;  4GPT B;  1P5T A;  1MK9 B;  1LW3 A;  2J0K A;  2XQN M;  2YS1 A;  4TYZ A;  1KZ7 A;  2P0F A;  4IFS A;  3PVW A;  3FM8 C;  3PZD A;  4DXA B;  1H10 A;  1UPR A;  1V61 A;  2QKL A;  2NMB A;  3DXD A;  2COD A;  2DX5 A;  5KCV A;  4D0N B;  2GS0 A;  2HE7 A;  3QIJ A;  1DBH A;  2W2X C;  2G35 A;  5KQ4 A;  5DIF B;  4H8S A;  3GYO A;  4PQ0 A;  1X11 A;  5C16 A;  1M7R A;  3WA0 A;  2COC A;  3A8Q A;  3PVL A;  1NI2 A;  2DHK A;  5FI0 A;  4DX8 A;  3BIN A;  1PLS A;  2COF A;  2Z0O A;  4HAV B;  2EMT A;  2J0J A;  2DX1 A;  2W2X D;  4ZRI A;  2MDX A;  4HAT B;  4Z2M B;  3TO1 A;  5HE2 A;  2EMS A;  4HDO A;  3TVV A;  3TCA A;  1J0W A;  3CXB B;  5CLL B;  2K00 A;  1MIX A;  3GYP A;  5JHH A;  2UZR A;  3ODO A;  5GOW B;  1Y5O A;  2BCJ A;  4A6F B;  3KSY A;  4P7I A;  4WJ7 A;  3SNH A;  4Y94 A;  2MWN B;  1U27 A;  2N23 A;  2P8V A;  2D9X A;  3BJI A;  3PEG A;  2DFK A;  3X23 A;  2VSZ A;  1PFJ A;  1PMS A;  3ODX A;  1W1G A;  5D27 A;  1SHC A;  1XX0 A;  1BTK A;  3SV1 A;  1ZC4 B;  1MK7 B;  2NZ8 B;  4WSF A;  4KVG B;  3AJ4 A;  2YVC A;  4HB2 B;  4DBB A;  2FJL A;  5LON B;  4A6H A;  4A5K A; 
#chains in the Genus database with same CATH topology
 4HAY B;  1BAK A;  2YF0 A;  1M7E A;  1FB8 A;  1X1F A;  3A58 A;  1KI1 B;  2I5C A;  2UZS A;  4F7G A;  1TJ6 A;  1FGY A;  1DDW A;  2DYN A;  2I1K A;  1OMW A;  5I2S A;  2MKR A;  3U12 A;  4F7U P;  4DX9 0;  2COA A;  5C79 A;  4Z2N A;  1U5G A;  1H4R A;  1Q67 A;  1ZC3 B;  2ROZ B;  2E2X A;  4HB0 B;  3FEH A;  2CRF A;  4HB3 B;  4HSI A;  2YT0 A;  2YSZ A;  2JP2 A;  2IFS A;  2DN6 A;  2DLW A;  1UNQ A;  2LG1 A;  2OTX A;  1IRS A;  1MKE A;  1N3H A;  2UVM A;  2KGX B;  2DA0 A;  3F5R A;  2ZPY A;  3ML4 A;  4HB4 B;  3HK0 A;  2RUK B;  2Y8G A;  3FVC A;  4QJ5 B;  2RSG A;  1QQG A;  2GJY A;  1TQZ A;  4NSW A;  4WVF B;  2GCJ A;  1J19 A;  2Z14 A;  3D8F A;  2IYB A;  1LB1 A;  2Z0Q A;  5CLQ B;  4HDQ A;  3PP2 A;  3OAN A;  2YT2 A;  3KRW A;  1RJ2 A;  4OT1 A;  5JHG A;  1U5E A;  1W1D A;  5DI9 B;  2D9V A;  5D3X A;  2ADZ A;  1NU2 A;  1T77 A;  1AQC A;  1E5W A;  4A6K A;  2Y8F A;  1UEF A;  1EVH A;  1ZM0 A;  5LOP B;  2DTC A;  3CIK A;  5HE1 A;  1FHW A;  2CY4 A;  3HQC A;  3KZ1 A;  2KIE A;  3NWA A;  2HTH B;  1BWN A;  2GCL A;  1V88 A;  3LJU X;  2MFQ A;  3TFM A;  2RLO A;  3HSA A;  2AEH A;  2YS3 A;  3PVU A;  1WG7 A;  3KRX A;  1ZVR A;  2Z4D A;  4K81 A;  1ISN A;  3DXE A;  2R0D A;  1P3R A;  2VRW B;  2D9Z A;  4GZU A;  5HE3 A;  5C5B B;  1DDV A;  5HE0 A;  1P6S A;  2ROV A;  4HAW B;  2K8E A;  2LOZ A;  4OSN A;  4B6H A;  2D9W A;  3D8E A;  3M1I B;  5I2M A;  4DIX A;  4EKU A;  1Y19 B;  2W2W A;  4HAX B;  1DDM A;  2K2U A;  2V76 A;  4KHO A;  1MIZ B;  3B77 A;  1FHO A;  1ZSQ A;  4GN1 A;  4QJ4 B;  3DXC A;  3A8P A;  1X1G A;  2N0Y A;  1V5M A;  2P0H A;  4CYE A;  4L6E A;  3AU5 A;  4CHJ A;  1TXD A;  2Z0P A;  2K2J A;  1DYN A;  2J59 M;  2I5F A;  2EC1 A;  2AL6 A;  3A98 B;  3SUZ A;  1WGU A;  1WJ1 A;  3OHM B;  4IAP A;  2RGN B;  3MPX A;  2D9Y A;  5D3W A;  4MK0 A;  2KCJ A;  2EJ8 A;  5IRS A;  1V89 A;  4YON A;  2Z59 A;  1KZG A;  3SO6 A;  4KHB B;  2CY5 A;  4MY6 A;  1EGX A;  2Q13 A;  4TKN A;  4BBK A;  1DRO A;  2R2Y A;  4HAU B;  3SYX A;  3HIE A;  2Z13 A;  3RCP A;  5JLJ B;  1UNP A;  2RVB B;  3FSS A;  1U29 A;  5L81 A;  5M4Y B;  2VKI A;  3IVF A;  3G9W A;  3AU4 A;  1FHX A;  1RRP B;  1WGQ A;  1U5F A;  2H7D A;  1OY2 A;  2LYD A;  5KQ1 A;  2RRF A;  5D3V A;  1FGZ A;  1B55 A;  2OQB A;  3PSC A;  1GC6 A;  2KUQ A;  2R09 A;  3N7C A;  1K5D B;  2KUP A;  1FOE A;  3T06 A;  4GMV A;  3ULB A;  2H7E A;  5JP4 A;  1OQN A;  3UZT A;  2K49 A;  5FI1 A;  5LG4 B;  2J0M A;  2YS5 A;  4A6F A;  1UPQ A;  2M14 A;  3QBV B;  3PG7 A;  1ZYI A;  3U7D A;  1X05 A;  5C5B A;  4K17 A;  3P7Z A;  4KAX B;  4QXA B;  2DKP A;  3VOQ A;  5DHA B;  5DHF B;  1GG3 A;  5C6R A;  3V5W A;  2ZKM X;  3ODW A;  1FAO A;  2D2Q A;  2Y7B A;  3ZDT A;  2DHI A;  4K2O A;  2DHJ A;  3ULC A;  1I2H A;  1XCG A;  1XR0 B;  3QWM A;  1I7A A;  3KY9 A;  1QC6 A;  1U5D A;  2PZ1 A;  2DKQ A;  1MAI A;  2ELA A;  5EFX A;  4HHV A;  1U2B A;  4GMX B;  3ZVR A;  3NWF A;  2YRY A;  2DYQ A;  1WVH A;  4F7H A;  1EF1 A;  2I1J A;  2X18 A;  2LKO A;  1MI1 A;  1SGH A;  1MPH A;  2KR0 A;  2LUL A;  5J3T A;  2P0D A;  3O96 A;  2D10 A;  3TW1 A;  2QKM A;  1GC7 A;  4GOU A;  1BTN A;  4EMO A;  4GXB A;  2YT1 A;  1NTY A;  2KIG A;  4EJN A;  4PNK A;  4ZRJ A;  2M38 A;  3NSU A;  1V5U A;  4C0A A;  5D3Y A;  3F0W A;  1AWE A;  3HW2 B;  4YL8 A;  1XD4 A;  3NWD A;  1WJM A;  4NY0 A;  4XWX A;  4ZRK A;  2L2I A;  5J3Y A;  4MT7 A;  3WYF B;  3VIA A;  4KHA A;  1K5G B;  2D4Q A;  1W1H A;  1WI1 A;  2CAY A;  2D11 A;  4CHM A;  3MDB C;  5J3Q A;  4HAZ B;  2L1C A;  2RNR B;  1V5P A;  2ELB A;  1EAZ A;  2NBV A;  1XKE A;  4K2P A;  1Z87 A;  4IOY X;  3U8Z A;  1X86 A;  3P6A A;  5DH9 B;  1NTV A;  1XOD A;  2LOX A;  3D8D A;  1UNR A;  4GPT B;  1P5T A;  1MK9 B;  1LW3 A;  2J0K A;  2XQN M;  2YS1 A;  4TYZ A;  1KZ7 A;  2P0F A;  4IFS A;  3PVW A;  3FM8 C;  3PZD A;  4DXA B;  1H10 A;  1UPR A;  1V61 A;  2QKL A;  2NMB A;  3DXD A;  2COD A;  2DX5 A;  5KCV A;  4D0N B;  2GS0 A;  2HE7 A;  3QIJ A;  2FJU B;  1DBH A;  2W2X C;  2G35 A;  5KQ4 A;  5DIF B;  4GNK B;  4H8S A;  3GYO A;  4PQ0 A;  1X11 A;  5C16 A;  1M7R A;  3WA0 A;  2COC A;  3A8Q A;  3PVL A;  1NI2 A;  2DHK A;  5FI0 A;  4DX8 A;  3BIN A;  1PLS A;  2GUM A;  2COF A;  2Z0O A;  4HAV B;  2EMT A;  2J0J A;  2DX1 A;  2W2X D;  4ZRI A;  2MDX A;  4CSQ A;  4HAT B;  4Z2M B;  3TO1 A;  5HE2 A;  2EMS A;  4HDO A;  3TVV A;  3TCA A;  4QJ3 B;  1J0W A;  3CXB B;  5CLL B;  2K00 A;  1MIX A;  3GYP A;  4D6W A;  5JHH A;  2UZR A;  3ODO A;  3NW8 A;  5GOW B;  1Y5O A;  2BCJ A;  4A6F B;  3KSY A;  4P7I A;  4WJ7 A;  3SNH A;  4Y94 A;  2MWN B;  1U27 A;  2N23 A;  2P8V A;  2D9X A;  3BJI A;  3PEG A;  2DFK A;  3X23 A;  2VSZ A;  1PFJ A;  1PMS A;  4L1R A;  3ODX A;  1W1G A;  3DCX A;  5D27 A;  1SHC A;  1XX0 A;  1BTK A;  3SV1 A;  1ZC4 B;  1MK7 B;  2NZ8 B;  4KHB A;  4WSF A;  4KVG B;  3AJ4 A;  2YVC A;  4HB2 B;  4DBB A;  2FJL A;  5LON B;  4A6H A;  4A5K A; 
#chains in the Genus database with same CATH homology
 4HAY B;  1BAK A;  2YF0 A;  1M7E A;  1FB8 A;  1X1F A;  1KI1 B;  2I5C A;  2UZS A;  4F7G A;  1TJ6 A;  1FGY A;  1DDW A;  2DYN A;  2I1K A;  1OMW A;  2MKR A;  4F7U P;  4DX9 0;  2COA A;  5C79 A;  4Z2N A;  1U5G A;  1H4R A;  1Q67 A;  1ZC3 B;  2ROZ B;  2E2X A;  4HB0 B;  3FEH A;  2CRF A;  4HB3 B;  2YT0 A;  2YSZ A;  2JP2 A;  2IFS A;  2DN6 A;  2DLW A;  1UNQ A;  2LG1 A;  2OTX A;  1IRS A;  1MKE A;  1N3H A;  2UVM A;  2KGX B;  2DA0 A;  3ML4 A;  3F5R A;  2ZPY A;  4HB4 B;  3HK0 A;  2RUK B;  2Y8G A;  2RSG A;  1QQG A;  2GJY A;  1TQZ A;  4NSW A;  4WVF B;  2GCJ A;  1J19 A;  3D8F A;  2IYB A;  1LB1 A;  2Z0Q A;  5CLQ B;  4HDQ A;  3PP2 A;  3OAN A;  3KRW A;  1RJ2 A;  5JHG A;  1U5E A;  1W1D A;  5DI9 B;  2D9V A;  5D3X A;  2ADZ A;  1NU2 A;  1AQC A;  1E5W A;  4A6K A;  2Y8F A;  1UEF A;  1EVH A;  1ZM0 A;  5LOP B;  2DTC A;  3CIK A;  5HE1 A;  1FHW A;  2CY4 A;  3HQC A;  3KZ1 A;  2HTH B;  1BWN A;  2GCL A;  1V88 A;  3LJU X;  2MFQ A;  3TFM A;  2RLO A;  2AEH A;  2YS3 A;  3PVU A;  1WG7 A;  3KRX A;  1ZVR A;  4K81 A;  1ISN A;  3DXE A;  2R0D A;  1P3R A;  2VRW B;  2D9Z A;  4GZU A;  5HE3 A;  5C5B B;  1DDV A;  5HE0 A;  1P6S A;  2ROV A;  4HAW B;  2LOZ A;  4B6H A;  2D9W A;  3D8E A;  3M1I B;  4EKU A;  1Y19 B;  2W2W A;  4HAX B;  1DDM A;  2K2U A;  2V76 A;  4KHO A;  1MIZ B;  1FHO A;  1ZSQ A;  4GN1 A;  3DXC A;  3A8P A;  1X1G A;  2N0Y A;  1V5M A;  2P0H A;  4CYE A;  4L6E A;  3AU5 A;  4CHJ A;  1TXD A;  2Z0P A;  2K2J A;  1DYN A;  2J59 M;  2I5F A;  2EC1 A;  2AL6 A;  3A98 B;  3SUZ A;  1WGU A;  1WJ1 A;  4IAP A;  2RGN B;  3MPX A;  2D9Y A;  5D3W A;  4MK0 A;  2KCJ A;  2EJ8 A;  1V89 A;  4YON A;  1KZG A;  3SO6 A;  4KHB B;  2CY5 A;  4MY6 A;  1EGX A;  2Q13 A;  4TKN A;  4BBK A;  1DRO A;  4HAU B;  3SYX A;  3RCP A;  5JLJ B;  1UNP A;  2RVB B;  3FSS A;  1U29 A;  5L81 A;  2VKI A;  3IVF A;  3G9W A;  3AU4 A;  1FHX A;  1RRP B;  1WGQ A;  1U5F A;  2H7D A;  1OY2 A;  2LYD A;  5KQ1 A;  5D3V A;  1FGZ A;  1B55 A;  2OQB A;  3PSC A;  1GC6 A;  2R09 A;  3N7C A;  1K5D B;  2KUP A;  1FOE A;  3T06 A;  4GMV A;  3ULB A;  2H7E A;  5JP4 A;  1OQN A;  3UZT A;  5FI1 A;  2J0M A;  2YS5 A;  4A6F A;  1UPQ A;  2M14 A;  3QBV B;  3PG7 A;  3U7D A;  1X05 A;  5C5B A;  4K17 A;  3P7Z A;  4KAX B;  2DKP A;  3VOQ A;  5DHA B;  5DHF B;  1GG3 A;  5C6R A;  3V5W A;  3ODW A;  1FAO A;  2D2Q A;  2Y7B A;  3ZDT A;  2DHI A;  4K2O A;  2DHJ A;  3ULC A;  1I2H A;  1XCG A;  1XR0 B;  3QWM A;  1I7A A;  3KY9 A;  1QC6 A;  1U5D A;  2PZ1 A;  2DKQ A;  1MAI A;  2ELA A;  5EFX A;  4HHV A;  1U2B A;  4GMX B;  3ZVR A;  2YRY A;  2DYQ A;  1WVH A;  4F7H A;  1EF1 A;  2I1J A;  2X18 A;  2LKO A;  1SGH A;  1MPH A;  2LUL A;  5J3T A;  2P0D A;  3O96 A;  2D10 A;  3TW1 A;  2QKM A;  1GC7 A;  1BTN A;  4EMO A;  4GXB A;  2YT1 A;  1NTY A;  4EJN A;  4PNK A;  4ZRJ A;  2M38 A;  3NSU A;  1V5U A;  4C0A A;  5D3Y A;  3F0W A;  1AWE A;  3HW2 B;  4YL8 A;  1XD4 A;  1WJM A;  4NY0 A;  4XWX A;  4ZRK A;  2L2I A;  5J3Y A;  4MT7 A;  3WYF B;  3VIA A;  4KHA A;  1K5G B;  2D4Q A;  1W1H A;  1WI1 A;  2CAY A;  2D11 A;  4CHM A;  3MDB C;  5J3Q A;  4HAZ B;  2L1C A;  2RNR B;  1V5P A;  2ELB A;  1EAZ A;  1XKE A;  4K2P A;  1Z87 A;  4IOY X;  3U8Z A;  1X86 A;  3P6A A;  5DH9 B;  1NTV A;  1XOD A;  2LOX A;  3D8D A;  1UNR A;  4GPT B;  1P5T A;  1MK9 B;  1LW3 A;  2J0K A;  2XQN M;  2YS1 A;  4TYZ A;  1KZ7 A;  2P0F A;  4IFS A;  3PVW A;  3FM8 C;  3PZD A;  4DXA B;  1H10 A;  1UPR A;  1V61 A;  2QKL A;  2NMB A;  3DXD A;  2COD A;  2DX5 A;  5KCV A;  4D0N B;  2GS0 A;  2HE7 A;  3QIJ A;  1DBH A;  2W2X C;  2G35 A;  5KQ4 A;  5DIF B;  4H8S A;  3GYO A;  4PQ0 A;  1X11 A;  5C16 A;  1M7R A;  3WA0 A;  2COC A;  3A8Q A;  3PVL A;  1NI2 A;  2DHK A;  5FI0 A;  4DX8 A;  3BIN A;  1PLS A;  2COF A;  2Z0O A;  4HAV B;  2EMT A;  2J0J A;  2DX1 A;  2W2X D;  4ZRI A;  2MDX A;  4HAT B;  4Z2M B;  3TO1 A;  5HE2 A;  2EMS A;  4HDO A;  3TVV A;  3TCA A;  1J0W A;  3CXB B;  5CLL B;  2K00 A;  1MIX A;  3GYP A;  5JHH A;  2UZR A;  3ODO A;  5GOW B;  1Y5O A;  2BCJ A;  4A6F B;  3KSY A;  4P7I A;  4WJ7 A;  3SNH A;  4Y94 A;  2MWN B;  1U27 A;  2N23 A;  2P8V A;  2D9X A;  3BJI A;  3PEG A;  2DFK A;  3X23 A;  2VSZ A;  1PFJ A;  1PMS A;  3ODX A;  1W1G A;  5D27 A;  1SHC A;  1XX0 A;  1BTK A;  3SV1 A;  1ZC4 B;  1MK7 B;  2NZ8 B;  4WSF A;  4KVG B;  3AJ4 A;  2YVC A;  4HB2 B;  4DBB A;  2FJL A;  5LON B;  4A6H A;  4A5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...