1NU2A

Crystal structure of the murine disabled-1 (dab1) ptb domain-apoer2 peptide-pi-4,5p2 ternary complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
152
structure length
152
Chain Sequence
GQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Origins of Peptide Selectivity and Phosphoinositide Binding Revealed by Structures of Disabled-1 PTB Domain Complexes
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Disabled homolog 1
total genus 45
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1nu2A00
1UPRA 2J0KA 4H8SA 2UVMA 2VSZA 4EJNA 4EMOA 3ULCA 5KQ1A 3TVVA 1DROA 3TCAA 2P0FA 5DI9B 5D3XA 1KZGA 1TXDA 1LB1A 2LG1A 1X1GA 2GS0A 2P0DA 1M7RA 2J59M 2YS5A 2DHJA 1PLSA 4KAXB 2YVCA 2E2XA 2M14A 2COFA 4Y94A 5HE1A 5GOWB 1SHCA 1OQNA 4ZRIA 1FHWA 4YONA 3D8FA 2LOZA 5D3VA 3T06A 3CIKA 1XKEA 4GXBA 1WVHA 5J3TA 1ZSQA 2L2IA 1GG3A 2UZSA 1EAZA 4HAUB 1X1FA 2Y7BA 4A6HA 4L6EA 1XR0B 3TFMA 2P0HA 1I2HA 4BBKA 1FOEA 1UNQA 5KQ4A 3KSYA 4K81A 5DIFB 5LONB 1UNRA 5D3YA 2ADZA 1U5EA 1AQCA 1NU2A 3G9WA 3SV1A 2DLWA 2VKIA 3KRWA 2MDXA 1Z87A 2NZ8B 1Q67A 5J3QA 1EGXA 2CY4A 1ZC4B 5L81A 4NY0A 5JP4A 2HE7A 2MWNB 4YL8A 2RVBB 1KI1B 1UEFA 1WJMA 4IFSA 3NSUA 2UZRA 3SO6A 1BAKA 2GCLA 2ELBA 1XD4A 4WVFB 3WA0A 2MKRA 2EMTA 3ODXA 2DKQA 1PMSA 2IYBA 2N0YA 3V5WA 3PP2A 2AL6A 2RGNB 1QQGA 1M7EA 2XQNM 4K2OA 2Z0QA 4GPTB 4B6HA 2ZPYA 2JP2A 2CAYA 3PG7A 2DN6A 1MK7B 4CHJA 3TW1A 1B55A 2DX1A 1BTKA 1P3RA 4DX90 4WJ7A 2GJYA 5D3WA 5JHHA 4Z2NA 3FM8C 3FEHA 3M1IB 4GN1A 1V5MA 3F0WA 1MK9B 3ZDTA 3PVUA 1V5UA 4CHMA 3IVFA 3SUZA 4A6KA 4F7UP 1RJ2A 1NTVA 2LULA 1WGUA 2RNRB 2W2XC 5D27A 3DXEA 4MT7A 4P7IA 2YT0A 1K5GB 1RRPB 2COCA 3CXBB 2N23A 1XCGA 1NTYA 2Y8FA 1ZC3B 2W2XD 2EJ8A 2YS1A 1UPQA 4HDOA 1MPHA 1SGHA 1H4RA 5KCVA 2YS3A 3ML4A 2V76A 2J0MA 3A8PA 4TYZA 2DYQA 4C0AA 3QIJA 2YF0A 1Y5OA 2D10A 1V88A 5J3YA 3D8DA 1X86A 2PZ1A 1K5DB 2I1JA 4F7GA 1BWNA 2D4QA 2FJLA 3QBVB 3HK0A 2D11A 2HTHB 5HE2A 4KHOA 3BJIA 5C16A 3QWMA 4K17A 2LKOA 2YSZA 5CLLB 3A98B 2H7DA 2I5CA 4HHVA 1WI1A 5HE3A 4HB0B 1MIZB 1P6SA 3DXCA 1DDWA 1GC7A 3U7DA 4F7HA 1PFJA 1X11A 3F5RA 4HAZB 3WYFB 1EF1A 3RCPA 1DDMA 5C6RA 3GYPA 1V89A 1V5PA 2DA0A 1DBHA 5DH9B 3DXDA 4D0NB 4DBBA 3ODWA 5DHAB 2Z0PA 4XWXA 1W1GA 1W1DA 4HAVB 3MPXA 1J19A 2R0DA 4MK0A 1U5FA 1FGYA 1LW3A 2Y8GA 5FI1A 2OTXA 2MFQA 3U8ZA 2KUPA 1J0WA 3PVWA 3AU4A 2EMSA 3SNHA 2Q13A 4IOYX 5JHGA 1TQZA 4HAXB 1WJ1A 4HATB 2AEHA 2DYNA 2NMBA 1DYNA 2ROZB 1WG7A 2I5FA 4A6FA 1MAIA 1DDVA 3SYXA 1FHOA 3KY9A 4EKUA 2YRYA 2LYDA 2COAA 4A6FB 2KGXB 2YT1A 1OMWA 2D2QA 4ZRKA 5JLJB 2L1CA 1P5TA 2CODA 3AU5A 2LOXA 1QC6A 3LJUX 3HQCA 4KHAA 2RSGA 1Y19B 2RUKB 3GYOA 4DX8A 5C79A 1E5WA 2KCJA 3O96A 2CRFA 2J0JA 2ELAA 1ISNA 3PZDA 3AJ4A 3X23A 4TKNA 1H10A 3TO1A 2DX5A 2R09A 2K00A 4A5KA 1U2BA 3D8EA 2DTCA 3PVLA 5HE0A 2W2WA 1U29A 3OANA 1XODA 1BTNA 1FHXA 4GMXB 1UNPA 2DFKA 1N3HA 1OY2A 1V61A 2DKPA 2H7EA 3PSCA 4WSFA 1TJ6A 4MY6A 2M38A 1EVHA 1U5GA 4DXAB 4HAWB 4IAPA 5LOPB 4HAYB 4K2PA 2EC1A 2DHKA 1ZM0A 1U5DA 1FGZA 2K2JA 5DHFB 4CYEA 1IRSA 5C5BB 1KZ7A 4PNKA 5EFXA 2D9YA 1FAOA 4HB4B 1XX0A 1I7AA 5C5BA 3ULBA 3VOQA 2Z0OA 4GMVA 4NSWA 1W1HA 2BCJA 4PQ0A 3KRXA 5FI0A 2I1KA 2CY5A 1U27A 2RLOA 1MIXA 2OQBA 3HW2B 2GCJA 2VRWB 2X18A 3A8QA 3VIAA 3ZVRA 3P6AA 2D9VA 2G35A 4KVGB 5CLQB 2IFSA 1MKEA 2ROVA 1GC6A 4ZRJA 1FB8A 4KHBB 1ZVRA 1AWEA 2QKLA 3BINA 4HB3B 1WGQA 2QKMA 3UZTA 1NI2A 3PEGA 2DHIA 4Z2MB 4HDQA 2D9ZA 3ODOA 3KZ1A 3MDBC 3FSSA 4HB2B 2D9XA 3P7ZA 1X05A 3N7CA 2K2UA 2D9WA 4GZUA 2P8VA
chains in the Genus database with same CATH superfamily
1UPRA 3U12A 2J0KA 4H8SA 2UVMA 2VSZA 4EJNA 4EMOA 3ULCA 5KQ1A 3TVVA 2Z4DA 1DROA 3TCAA 2P0FA 4QJ5B 5DI9B 5D3XA 1KZGA 1TXDA 1LB1A 2LG1A 1X1GA 2GS0A 2RRFA 2P0DA 1M7RA 2J59M 2YS5A 2DHJA 1PLSA 4KAXB 2YVCA 2E2XA 2M14A 1MI1A 2COFA 4Y94A 5HE1A 5GOWB 1SHCA 1OQNA 4ZRIA 1FHWA 4L1RA 4YONA 3D8FA 2LOZA 5D3VA 3T06A 3CIKA 1XKEA 4GXBA 1WVHA 5J3TA 1ZSQA 2L2IA 1GG3A 2UZSA 1EAZA 4HAUB 1X1FA 2Y7BA 4A6HA 4L6EA 1XR0B 3TFMA 2P0HA 1I2HA 4BBKA 1FOEA 1UNQA 5KQ4A 3KSYA 4K81A 5DIFB 5LONB 1UNRA 5D3YA 2ADZA 1U5EA 1AQCA 1NU2A 3G9WA 3SV1A 2DLWA 2VKIA 2GUMA 3KRWA 2MDXA 1Z87A 3OHMB 2NZ8B 1Q67A 5J3QA 1EGXA 2CY4A 1ZC4B 5L81A 4NY0A 5JP4A 2HE7A 2MWNB 4YL8A 2RVBB 1KI1B 1UEFA 1WJMA 4IFSA 3NSUA 2UZRA 3SO6A 1BAKA 2GCLA 2ELBA 1XD4A 4WVFB 3WA0A 2MKRA 2EMTA 3ODXA 2DKQA 1PMSA 2IYBA 2N0YA 3V5WA 3PP2A 2AL6A 2RGNB 1QQGA 1M7EA 2XQNM 4K2OA 2Z0QA 4QXAB 4GPTB 4B6HA 2ZPYA 2JP2A 2CAYA 3PG7A 2DN6A 1MK7B 3NWAA 3TW1A 1B55A 4CHJA 2DX1A 1BTKA 1P3RA 4DX90 4WJ7A 4OT1A 4OSNA 2GJYA 5D3WA 5JHHA 4Z2NA 3FM8C 3FEHA 3M1IB 4GN1A 1V5MA 2KR0A 3F0WA 1MK9B 3ZDTA 3PVUA 2FJUB 5LG4B 1V5UA 4CHMA 3IVFA 3SUZA 4A6KA 4F7UP 1RJ2A 1NTVA 2LULA 1WGUA 2RNRB 2W2XC 5D27A 3DXEA 4MT7A 4P7IA 2YT0A 1K5GB 1RRPB 2COCA 3CXBB 2N23A 1XCGA 1NTYA 2Y8FA 1ZC3B 2W2XD 2EJ8A 2YS1A 1UPQA 2ZKMX 4HDOA 1MPHA 1SGHA 1H4RA 5KCVA 3NW8A 2YS3A 3ML4A 2V76A 2KIEA 2J0MA 3A8PA 2K49A 4TYZA 3DCXA 2DYQA 2KUQA 4C0AA 3QIJA 2YF0A 1Y5OA 2D10A 1V88A 5J3YA 2K8EA 4CSQA 3D8DA 1X86A 2PZ1A 1K5DB 2I1JA 4F7GA 1BWNA 2D4QA 2FJLA 3QBVB 3HK0A 2D11A 2HTHB 5HE2A 4KHOA 3BJIA 5C16A 3QWMA 4K17A 2LKOA 2YSZA 5CLLB 4DIXA 3A98B 2H7DA 2I5CA 4HHVA 1WI1A 5HE3A 4HB0B 1MIZB 1P6SA 3DXCA 1DDWA 1GC7A 1T77A 4QJ3B 3U7DA 3B77A 4F7HA 1PFJA 1X11A 3F5RA 4HAZB 3WYFB 1EF1A 3RCPA 1DDMA 5C6RA 4HSIA 3GYPA 1V89A 2YT2A 3HIEA 1V5PA 2DA0A 1DBHA 5DH9B 3DXDA 4D0NB 4DBBA 3ODWA 4GNKB 5DHAB 2Z0PA 4XWXA 1W1GA 1W1DA 4HAVB 3MPXA 1J19A 2R0DA 4MK0A 1U5FA 1FGYA 1LW3A 2Y8GA 5FI1A 2Z13A 2OTXA 2MFQA 3U8ZA 2KUPA 1J0WA 3PVWA 3AU4A 2EMSA 3SNHA 2Q13A 4IOYX 5JHGA 1TQZA 2NBVA 4HAXB 1WJ1A 2AEHA 4HATB 2DYNA 2NMBA 1DYNA 2ROZB 1WG7A 5I2SA 2I5FA 4A6FA 1MAIA 1DDVA 3SYXA 1FHOA 3KY9A 4EKUA 2YRYA 2R2YA 2LYDA 3HSAA 2COAA 4A6FB 2KGXB 2YT1A 1OMWA 2D2QA 2Z14A 4ZRKA 5JLJB 2L1CA 1P5TA 2CODA 3AU5A 2LOXA 1QC6A 3LJUX 3HQCA 4KHAA 3FVCA 2RSGA 1Y19B 2RUKB 3GYOA 4DX8A 5C79A 1E5WA 2KCJA 3O96A 2CRFA 2J0JA 2ELAA 1ISNA 3PZDA 3AJ4A 3X23A 4TKNA 1H10A 3TO1A 2DX5A 2KIGA 2R09A 2K00A 4A5KA 1U2BA 1ZYIA 3D8EA 2DTCA 3PVLA 5HE0A 2W2WA 1U29A 3OANA 1XODA 1BTNA 1FHXA 4GMXB 4KHBA 1UNPA 2DFKA 1N3HA 1OY2A 1V61A 2DKPA 2H7EA 4QJ4B 3PSCA 4WSFA 1TJ6A 4MY6A 2M38A 1EVHA 1U5GA 4DXAB 5I2MA 4HAWB 4IAPA 5LOPB 4HAYB 4K2PA 2EC1A 2DHKA 1ZM0A 1U5DA 1FGZA 2K2JA 5DHFB 4CYEA 3A58A 1IRSA 5C5BB 1KZ7A 4PNKA 5EFXA 2D9YA 1FAOA 4HB4B 1XX0A 1I7AA 5C5BA 3ULBA 3VOQA 2Z0OA 4GMVA 4NSWA 1W1HA 2BCJA 4PQ0A 3KRXA 5FI0A 2I1KA 2CY5A 1U27A 2RLOA 5IRSA 1MIXA 2OQBA 3HW2B 2GCJA 2VRWB 2X18A 3A8QA 3VIAA 3NWDA 3P6AA 3ZVRA 2D9VA 2G35A 4KVGB 4D6WA 5CLQB 2IFSA 1MKEA 2ROVA 1GC6A 4ZRJA 1FB8A 4KHBB 1ZVRA 1AWEA 2QKLA 3BINA 4HB3B 1WGQA 2QKMA 3UZTA 4GOUA 2Z59A 1NI2A 3NWFA 2DHIA 3PEGA 4Z2MB 4HDQA 2D9ZA 3ODOA 3KZ1A 3MDBC 3FSSA 4HB2B 2D9XA 3P7ZA 1X05A 3N7CA 2K2UA 2D9WA 4GZUA 2P8VA 5M4YB
chains in the Genus database with same CATH topology
1UPRA 2J0KA 4H8SA 2UVMA 2VSZA 4EJNA 4EMOA 3ULCA 5KQ1A 3TVVA 1DROA 3TCAA 2P0FA 5DI9B 5D3XA 1KZGA 1TXDA 1LB1A 2LG1A 1X1GA 2GS0A 2P0DA 1M7RA 2J59M 2YS5A 2DHJA 1PLSA 4KAXB 2YVCA 2E2XA 2M14A 2COFA 4Y94A 5HE1A 5GOWB 1SHCA 1OQNA 4ZRIA 1FHWA 4YONA 3D8FA 2LOZA 5D3VA 3T06A 3CIKA 1XKEA 4GXBA 1WVHA 5J3TA 1ZSQA 2L2IA 1GG3A 2UZSA 1EAZA 4HAUB 1X1FA 2Y7BA 4A6HA 4L6EA 1XR0B 3TFMA 2P0HA 1I2HA 4BBKA 1FOEA 1UNQA 5KQ4A 3KSYA 4K81A 5DIFB 5LONB 1UNRA 5D3YA 2ADZA 1U5EA 1AQCA 1NU2A 3G9WA 3SV1A 2DLWA 2VKIA 3KRWA 2MDXA 1Z87A 2NZ8B 1Q67A 5J3QA 1EGXA 2CY4A 1ZC4B 5L81A 4NY0A 5JP4A 2HE7A 2MWNB 4YL8A 2RVBB 1KI1B 1UEFA 1WJMA 4IFSA 3NSUA 2UZRA 3SO6A 1BAKA 2GCLA 2ELBA 1XD4A 4WVFB 3WA0A 2MKRA 2EMTA 3ODXA 2DKQA 1PMSA 2IYBA 2N0YA 3V5WA 3PP2A 2AL6A 2RGNB 1QQGA 1M7EA 2XQNM 4K2OA 2Z0QA 4GPTB 4B6HA 2ZPYA 2JP2A 2CAYA 3PG7A 2DN6A 1MK7B 4CHJA 3TW1A 1B55A 2DX1A 1BTKA 1P3RA 4DX90 4WJ7A 2GJYA 5D3WA 5JHHA 4Z2NA 3FM8C 3FEHA 3M1IB 4GN1A 1V5MA 3F0WA 1MK9B 3ZDTA 3PVUA 1V5UA 4CHMA 3IVFA 3SUZA 4A6KA 4F7UP 1RJ2A 1NTVA 2LULA 1WGUA 2RNRB 2W2XC 5D27A 3DXEA 4MT7A 4P7IA 2YT0A 1K5GB 1RRPB 2COCA 3CXBB 2N23A 1XCGA 1NTYA 2Y8FA 1ZC3B 2W2XD 2EJ8A 2YS1A 1UPQA 4HDOA 1MPHA 1SGHA 1H4RA 5KCVA 2YS3A 3ML4A 2V76A 2J0MA 3A8PA 4TYZA 2DYQA 4C0AA 3QIJA 2YF0A 1Y5OA 2D10A 1V88A 5J3YA 3D8DA 1X86A 2PZ1A 1K5DB 2I1JA 4F7GA 1BWNA 2D4QA 2FJLA 3QBVB 3HK0A 2D11A 2HTHB 5HE2A 4KHOA 3BJIA 5C16A 3QWMA 4K17A 2LKOA 2YSZA 5CLLB 3A98B 2H7DA 2I5CA 4HHVA 1WI1A 5HE3A 4HB0B 1MIZB 1P6SA 3DXCA 1DDWA 1GC7A 3U7DA 4F7HA 1PFJA 1X11A 3F5RA 4HAZB 3WYFB 1EF1A 3RCPA 1DDMA 5C6RA 3GYPA 1V89A 1V5PA 2DA0A 1DBHA 5DH9B 3DXDA 4D0NB 4DBBA 3ODWA 5DHAB 2Z0PA 4XWXA 1W1GA 1W1DA 4HAVB 3MPXA 1J19A 2R0DA 4MK0A 1U5FA 1FGYA 1LW3A 2Y8GA 5FI1A 2OTXA 2MFQA 3U8ZA 2KUPA 1J0WA 3PVWA 3AU4A 2EMSA 3SNHA 2Q13A 4IOYX 5JHGA 1TQZA 4HAXB 1WJ1A 4HATB 2AEHA 2DYNA 2NMBA 1DYNA 2ROZB 1WG7A 2I5FA 4A6FA 1MAIA 1DDVA 3SYXA 1FHOA 3KY9A 4EKUA 2YRYA 2LYDA 2COAA 4A6FB 2KGXB 2YT1A 1OMWA 2D2QA 4ZRKA 5JLJB 2L1CA 1P5TA 2CODA 3AU5A 2LOXA 1QC6A 3LJUX 3HQCA 4KHAA 2RSGA 1Y19B 2RUKB 3GYOA 4DX8A 5C79A 1E5WA 2KCJA 3O96A 2CRFA 2J0JA 2ELAA 1ISNA 3PZDA 3AJ4A 3X23A 4TKNA 1H10A 3TO1A 2DX5A 2R09A 2K00A 4A5KA 1U2BA 3D8EA 2DTCA 3PVLA 5HE0A 2W2WA 1U29A 3OANA 1XODA 1BTNA 1FHXA 4GMXB 1UNPA 2DFKA 1N3HA 1OY2A 1V61A 2DKPA 2H7EA 3PSCA 4WSFA 1TJ6A 4MY6A 2M38A 1EVHA 1U5GA 4DXAB 4HAWB 4IAPA 5LOPB 4HAYB 4K2PA 2EC1A 2DHKA 1ZM0A 1U5DA 1FGZA 2K2JA 5DHFB 4CYEA 1IRSA 5C5BB 1KZ7A 4PNKA 5EFXA 2D9YA 1FAOA 4HB4B 1XX0A 1I7AA 5C5BA 3ULBA 3VOQA 2Z0OA 4GMVA 4NSWA 1W1HA 2BCJA 4PQ0A 3KRXA 5FI0A 2I1KA 2CY5A 1U27A 2RLOA 1MIXA 2OQBA 3HW2B 2GCJA 2VRWB 2X18A 3A8QA 3VIAA 3ZVRA 3P6AA 2D9VA 2G35A 4KVGB 5CLQB 2IFSA 1MKEA 2ROVA 1GC6A 4ZRJA 1FB8A 4KHBB 1ZVRA 1AWEA 2QKLA 3BINA 4HB3B 1WGQA 2QKMA 3UZTA 1NI2A 3PEGA 2DHIA 4Z2MB 4HDQA 2D9ZA 3ODOA 3KZ1A 3MDBC 3FSSA 4HB2B 2D9XA 3P7ZA 1X05A 3N7CA 2K2UA 2D9WA 4GZUA 2P8VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UPR A;  2J0K A;  4H8S A;  2UVM A;  2VSZ A;  4EJN A;  4EMO A;  3ULC A;  5KQ1 A;  3TVV A;  1DRO A;  3TCA A;  2P0F A;  5DI9 B;  5D3X A;  1KZG A;  1TXD A;  1LB1 A;  2LG1 A;  1X1G A;  2GS0 A;  2P0D A;  1M7R A;  2J59 M;  2YS5 A;  2DHJ A;  1PLS A;  4KAX B;  2YVC A;  2E2X A;  2M14 A;  2COF A;  4Y94 A;  5HE1 A;  5GOW B;  1SHC A;  1OQN A;  4ZRI A;  1FHW A;  4YON A;  3D8F A;  2LOZ A;  5D3V A;  3T06 A;  3CIK A;  1XKE A;  4GXB A;  1WVH A;  5J3T A;  1ZSQ A;  2L2I A;  1GG3 A;  2UZS A;  1EAZ A;  4HAU B;  1X1F A;  2Y7B A;  4A6H A;  4L6E A;  1XR0 B;  3TFM A;  2P0H A;  1I2H A;  4BBK A;  1FOE A;  1UNQ A;  5KQ4 A;  3KSY A;  4K81 A;  5DIF B;  5LON B;  1UNR A;  5D3Y A;  2ADZ A;  1U5E A;  1AQC A;  1NU2 A;  3G9W A;  3SV1 A;  2DLW A;  2VKI A;  3KRW A;  2MDX A;  1Z87 A;  2NZ8 B;  1Q67 A;  5J3Q A;  1EGX A;  2CY4 A;  1ZC4 B;  5L81 A;  4NY0 A;  5JP4 A;  2HE7 A;  2MWN B;  4YL8 A;  2RVB B;  1KI1 B;  1UEF A;  1WJM A;  4IFS A;  3NSU A;  2UZR A;  3SO6 A;  1BAK A;  2GCL A;  2ELB A;  1XD4 A;  4WVF B;  3WA0 A;  2MKR A;  2EMT A;  3ODX A;  2DKQ A;  1PMS A;  2IYB A;  2N0Y A;  3V5W A;  3PP2 A;  2AL6 A;  2RGN B;  1QQG A;  1M7E A;  2XQN M;  4K2O A;  2Z0Q A;  4GPT B;  4B6H A;  2ZPY A;  2JP2 A;  2CAY A;  3PG7 A;  2DN6 A;  1MK7 B;  4CHJ A;  3TW1 A;  1B55 A;  2DX1 A;  1BTK A;  1P3R A;  4DX9 0;  4WJ7 A;  2GJY A;  5D3W A;  5JHH A;  4Z2N A;  3FM8 C;  3FEH A;  3M1I B;  4GN1 A;  1V5M A;  3F0W A;  1MK9 B;  3ZDT A;  3PVU A;  1V5U A;  4CHM A;  3IVF A;  3SUZ A;  4A6K A;  4F7U P;  1RJ2 A;  1NTV A;  2LUL A;  1WGU A;  2RNR B;  2W2X C;  5D27 A;  3DXE A;  4MT7 A;  4P7I A;  2YT0 A;  1K5G B;  1RRP B;  2COC A;  3CXB B;  2N23 A;  1XCG A;  1NTY A;  2Y8F A;  1ZC3 B;  2W2X D;  2EJ8 A;  2YS1 A;  1UPQ A;  4HDO A;  1MPH A;  1SGH A;  1H4R A;  5KCV A;  2YS3 A;  3ML4 A;  2V76 A;  2J0M A;  3A8P A;  4TYZ A;  2DYQ A;  4C0A A;  3QIJ A;  2YF0 A;  1Y5O A;  2D10 A;  1V88 A;  5J3Y A;  3D8D A;  1X86 A;  2PZ1 A;  1K5D B;  2I1J A;  4F7G A;  1BWN A;  2D4Q A;  2FJL A;  3QBV B;  3HK0 A;  2D11 A;  2HTH B;  5HE2 A;  4KHO A;  3BJI A;  5C16 A;  3QWM A;  4K17 A;  2LKO A;  2YSZ A;  5CLL B;  3A98 B;  2H7D A;  2I5C A;  4HHV A;  1WI1 A;  5HE3 A;  4HB0 B;  1MIZ B;  1P6S A;  3DXC A;  1DDW A;  1GC7 A;  3U7D A;  4F7H A;  1PFJ A;  1X11 A;  3F5R A;  4HAZ B;  3WYF B;  1EF1 A;  3RCP A;  1DDM A;  5C6R A;  3GYP A;  1V89 A;  1V5P A;  2DA0 A;  1DBH A;  5DH9 B;  3DXD A;  4D0N B;  4DBB A;  3ODW A;  5DHA B;  2Z0P A;  4XWX A;  1W1G A;  1W1D A;  4HAV B;  3MPX A;  1J19 A;  2R0D A;  4MK0 A;  1U5F A;  1FGY A;  1LW3 A;  2Y8G A;  5FI1 A;  2OTX A;  2MFQ A;  3U8Z A;  2KUP A;  1J0W A;  3PVW A;  3AU4 A;  2EMS A;  3SNH A;  2Q13 A;  4IOY X;  5JHG A;  1TQZ A;  4HAX B;  1WJ1 A;  4HAT B;  2AEH A;  2DYN A;  2NMB A;  1DYN A;  2ROZ B;  1WG7 A;  2I5F A;  4A6F A;  1MAI A;  1DDV A;  3SYX A;  1FHO A;  3KY9 A;  4EKU A;  2YRY A;  2LYD A;  2COA A;  4A6F B;  2KGX B;  2YT1 A;  1OMW A;  2D2Q A;  4ZRK A;  5JLJ B;  2L1C A;  1P5T A;  2COD A;  3AU5 A;  2LOX A;  1QC6 A;  3LJU X;  3HQC A;  4KHA A;  2RSG A;  1Y19 B;  2RUK B;  3GYO A;  4DX8 A;  5C79 A;  1E5W A;  2KCJ A;  3O96 A;  2CRF A;  2J0J A;  2ELA A;  1ISN A;  3PZD A;  3AJ4 A;  3X23 A;  4TKN A;  1H10 A;  3TO1 A;  2DX5 A;  2R09 A;  2K00 A;  4A5K A;  1U2B A;  3D8E A;  2DTC A;  3PVL A;  5HE0 A;  2W2W A;  1U29 A;  3OAN A;  1XOD A;  1BTN A;  1FHX A;  4GMX B;  1UNP A;  2DFK A;  1N3H A;  1OY2 A;  1V61 A;  2DKP A;  2H7E A;  3PSC A;  4WSF A;  1TJ6 A;  4MY6 A;  2M38 A;  1EVH A;  1U5G A;  4DXA B;  4HAW B;  4IAP A;  5LOP B;  4HAY B;  4K2P A;  2EC1 A;  2DHK A;  1ZM0 A;  1U5D A;  1FGZ A;  2K2J A;  5DHF B;  4CYE A;  1IRS A;  5C5B B;  1KZ7 A;  4PNK A;  5EFX A;  2D9Y A;  1FAO A;  4HB4 B;  1XX0 A;  1I7A A;  5C5B A;  3ULB A;  3VOQ A;  2Z0O A;  4GMV A;  4NSW A;  1W1H A;  2BCJ A;  4PQ0 A;  3KRX A;  5FI0 A;  2I1K A;  2CY5 A;  1U27 A;  2RLO A;  1MIX A;  2OQB A;  3HW2 B;  2GCJ A;  2VRW B;  2X18 A;  3A8Q A;  3VIA A;  3ZVR A;  3P6A A;  2D9V A;  2G35 A;  4KVG B;  5CLQ B;  2IFS A;  1MKE A;  2ROV A;  1GC6 A;  4ZRJ A;  1FB8 A;  4KHB B;  1ZVR A;  1AWE A;  2QKL A;  3BIN A;  4HB3 B;  1WGQ A;  2QKM A;  3UZT A;  1NI2 A;  3PEG A;  2DHI A;  4Z2M B;  4HDQ A;  2D9Z A;  3ODO A;  3KZ1 A;  3MDB C;  3FSS A;  4HB2 B;  2D9X A;  3P7Z A;  1X05 A;  3N7C A;  2K2U A;  2D9W A;  4GZU A;  2P8V A; 
#chains in the Genus database with same CATH topology
 1UPR A;  3U12 A;  2J0K A;  4H8S A;  2UVM A;  2VSZ A;  4EJN A;  4EMO A;  3ULC A;  5KQ1 A;  3TVV A;  2Z4D A;  1DRO A;  3TCA A;  2P0F A;  4QJ5 B;  5DI9 B;  5D3X A;  1KZG A;  1TXD A;  1LB1 A;  2LG1 A;  1X1G A;  2GS0 A;  2RRF A;  2P0D A;  1M7R A;  2J59 M;  2YS5 A;  2DHJ A;  1PLS A;  4KAX B;  2YVC A;  2E2X A;  2M14 A;  1MI1 A;  2COF A;  4Y94 A;  5HE1 A;  5GOW B;  1SHC A;  1OQN A;  4ZRI A;  1FHW A;  4L1R A;  4YON A;  3D8F A;  2LOZ A;  5D3V A;  3T06 A;  3CIK A;  1XKE A;  4GXB A;  1WVH A;  5J3T A;  1ZSQ A;  2L2I A;  1GG3 A;  2UZS A;  1EAZ A;  4HAU B;  1X1F A;  2Y7B A;  4A6H A;  4L6E A;  1XR0 B;  3TFM A;  2P0H A;  1I2H A;  4BBK A;  1FOE A;  1UNQ A;  5KQ4 A;  3KSY A;  4K81 A;  5DIF B;  5LON B;  1UNR A;  5D3Y A;  2ADZ A;  1U5E A;  1AQC A;  1NU2 A;  3G9W A;  3SV1 A;  2DLW A;  2VKI A;  2GUM A;  3KRW A;  2MDX A;  1Z87 A;  3OHM B;  2NZ8 B;  1Q67 A;  5J3Q A;  1EGX A;  2CY4 A;  1ZC4 B;  5L81 A;  4NY0 A;  5JP4 A;  2HE7 A;  2MWN B;  4YL8 A;  2RVB B;  1KI1 B;  1UEF A;  1WJM A;  4IFS A;  3NSU A;  2UZR A;  3SO6 A;  1BAK A;  2GCL A;  2ELB A;  1XD4 A;  4WVF B;  3WA0 A;  2MKR A;  2EMT A;  3ODX A;  2DKQ A;  1PMS A;  2IYB A;  2N0Y A;  3V5W A;  3PP2 A;  2AL6 A;  2RGN B;  1QQG A;  1M7E A;  2XQN M;  4K2O A;  2Z0Q A;  4QXA B;  4GPT B;  4B6H A;  2ZPY A;  2JP2 A;  2CAY A;  3PG7 A;  2DN6 A;  1MK7 B;  3NWA A;  3TW1 A;  1B55 A;  4CHJ A;  2DX1 A;  1BTK A;  1P3R A;  4DX9 0;  4WJ7 A;  4OT1 A;  4OSN A;  2GJY A;  5D3W A;  5JHH A;  4Z2N A;  3FM8 C;  3FEH A;  3M1I B;  4GN1 A;  1V5M A;  2KR0 A;  3F0W A;  1MK9 B;  3ZDT A;  3PVU A;  2FJU B;  5LG4 B;  1V5U A;  4CHM A;  3IVF A;  3SUZ A;  4A6K A;  4F7U P;  1RJ2 A;  1NTV A;  2LUL A;  1WGU A;  2RNR B;  2W2X C;  5D27 A;  3DXE A;  4MT7 A;  4P7I A;  2YT0 A;  1K5G B;  1RRP B;  2COC A;  3CXB B;  2N23 A;  1XCG A;  1NTY A;  2Y8F A;  1ZC3 B;  2W2X D;  2EJ8 A;  2YS1 A;  1UPQ A;  2ZKM X;  4HDO A;  1MPH A;  1SGH A;  1H4R A;  5KCV A;  3NW8 A;  2YS3 A;  3ML4 A;  2V76 A;  2KIE A;  2J0M A;  3A8P A;  2K49 A;  4TYZ A;  3DCX A;  2DYQ A;  2KUQ A;  4C0A A;  3QIJ A;  2YF0 A;  1Y5O A;  2D10 A;  1V88 A;  5J3Y A;  2K8E A;  4CSQ A;  3D8D A;  1X86 A;  2PZ1 A;  1K5D B;  2I1J A;  4F7G A;  1BWN A;  2D4Q A;  2FJL A;  3QBV B;  3HK0 A;  2D11 A;  2HTH B;  5HE2 A;  4KHO A;  3BJI A;  5C16 A;  3QWM A;  4K17 A;  2LKO A;  2YSZ A;  5CLL B;  4DIX A;  3A98 B;  2H7D A;  2I5C A;  4HHV A;  1WI1 A;  5HE3 A;  4HB0 B;  1MIZ B;  1P6S A;  3DXC A;  1DDW A;  1GC7 A;  1T77 A;  4QJ3 B;  3U7D A;  3B77 A;  4F7H A;  1PFJ A;  1X11 A;  3F5R A;  4HAZ B;  3WYF B;  1EF1 A;  3RCP A;  1DDM A;  5C6R A;  4HSI A;  3GYP A;  1V89 A;  2YT2 A;  3HIE A;  1V5P A;  2DA0 A;  1DBH A;  5DH9 B;  3DXD A;  4D0N B;  4DBB A;  3ODW A;  4GNK B;  5DHA B;  2Z0P A;  4XWX A;  1W1G A;  1W1D A;  4HAV B;  3MPX A;  1J19 A;  2R0D A;  4MK0 A;  1U5F A;  1FGY A;  1LW3 A;  2Y8G A;  5FI1 A;  2Z13 A;  2OTX A;  2MFQ A;  3U8Z A;  2KUP A;  1J0W A;  3PVW A;  3AU4 A;  2EMS A;  3SNH A;  2Q13 A;  4IOY X;  5JHG A;  1TQZ A;  2NBV A;  4HAX B;  1WJ1 A;  2AEH A;  4HAT B;  2DYN A;  2NMB A;  1DYN A;  2ROZ B;  1WG7 A;  5I2S A;  2I5F A;  4A6F A;  1MAI A;  1DDV A;  3SYX A;  1FHO A;  3KY9 A;  4EKU A;  2YRY A;  2R2Y A;  2LYD A;  3HSA A;  2COA A;  4A6F B;  2KGX B;  2YT1 A;  1OMW A;  2D2Q A;  2Z14 A;  4ZRK A;  5JLJ B;  2L1C A;  1P5T A;  2COD A;  3AU5 A;  2LOX A;  1QC6 A;  3LJU X;  3HQC A;  4KHA A;  3FVC A;  2RSG A;  1Y19 B;  2RUK B;  3GYO A;  4DX8 A;  5C79 A;  1E5W A;  2KCJ A;  3O96 A;  2CRF A;  2J0J A;  2ELA A;  1ISN A;  3PZD A;  3AJ4 A;  3X23 A;  4TKN A;  1H10 A;  3TO1 A;  2DX5 A;  2KIG A;  2R09 A;  2K00 A;  4A5K A;  1U2B A;  1ZYI A;  3D8E A;  2DTC A;  3PVL A;  5HE0 A;  2W2W A;  1U29 A;  3OAN A;  1XOD A;  1BTN A;  1FHX A;  4GMX B;  4KHB A;  1UNP A;  2DFK A;  1N3H A;  1OY2 A;  1V61 A;  2DKP A;  2H7E A;  4QJ4 B;  3PSC A;  4WSF A;  1TJ6 A;  4MY6 A;  2M38 A;  1EVH A;  1U5G A;  4DXA B;  5I2M A;  4HAW B;  4IAP A;  5LOP B;  4HAY B;  4K2P A;  2EC1 A;  2DHK A;  1ZM0 A;  1U5D A;  1FGZ A;  2K2J A;  5DHF B;  4CYE A;  3A58 A;  1IRS A;  5C5B B;  1KZ7 A;  4PNK A;  5EFX A;  2D9Y A;  1FAO A;  4HB4 B;  1XX0 A;  1I7A A;  5C5B A;  3ULB A;  3VOQ A;  2Z0O A;  4GMV A;  4NSW A;  1W1H A;  2BCJ A;  4PQ0 A;  3KRX A;  5FI0 A;  2I1K A;  2CY5 A;  1U27 A;  2RLO A;  5IRS A;  1MIX A;  2OQB A;  3HW2 B;  2GCJ A;  2VRW B;  2X18 A;  3A8Q A;  3VIA A;  3NWD A;  3P6A A;  3ZVR A;  2D9V A;  2G35 A;  4KVG B;  4D6W A;  5CLQ B;  2IFS A;  1MKE A;  2ROV A;  1GC6 A;  4ZRJ A;  1FB8 A;  4KHB B;  1ZVR A;  1AWE A;  2QKL A;  3BIN A;  4HB3 B;  1WGQ A;  2QKM A;  3UZT A;  4GOU A;  2Z59 A;  1NI2 A;  3NWF A;  2DHI A;  3PEG A;  4Z2M B;  4HDQ A;  2D9Z A;  3ODO A;  3KZ1 A;  3MDB C;  3FSS A;  4HB2 B;  2D9X A;  3P7Z A;  1X05 A;  3N7C A;  2K2U A;  2D9W A;  4GZU A;  2P8V A;  5M4Y B; 
#chains in the Genus database with same CATH homology
 1UPR A;  2J0K A;  4H8S A;  2UVM A;  2VSZ A;  4EJN A;  4EMO A;  3ULC A;  5KQ1 A;  3TVV A;  1DRO A;  3TCA A;  2P0F A;  5DI9 B;  5D3X A;  1KZG A;  1TXD A;  1LB1 A;  2LG1 A;  1X1G A;  2GS0 A;  2P0D A;  1M7R A;  2J59 M;  2YS5 A;  2DHJ A;  1PLS A;  4KAX B;  2YVC A;  2E2X A;  2M14 A;  2COF A;  4Y94 A;  5HE1 A;  5GOW B;  1SHC A;  1OQN A;  4ZRI A;  1FHW A;  4YON A;  3D8F A;  2LOZ A;  5D3V A;  3T06 A;  3CIK A;  1XKE A;  4GXB A;  1WVH A;  5J3T A;  1ZSQ A;  2L2I A;  1GG3 A;  2UZS A;  1EAZ A;  4HAU B;  1X1F A;  2Y7B A;  4A6H A;  4L6E A;  1XR0 B;  3TFM A;  2P0H A;  1I2H A;  4BBK A;  1FOE A;  1UNQ A;  5KQ4 A;  3KSY A;  4K81 A;  5DIF B;  5LON B;  1UNR A;  5D3Y A;  2ADZ A;  1U5E A;  1AQC A;  1NU2 A;  3G9W A;  3SV1 A;  2DLW A;  2VKI A;  3KRW A;  2MDX A;  1Z87 A;  2NZ8 B;  1Q67 A;  5J3Q A;  1EGX A;  2CY4 A;  1ZC4 B;  5L81 A;  4NY0 A;  5JP4 A;  2HE7 A;  2MWN B;  4YL8 A;  2RVB B;  1KI1 B;  1UEF A;  1WJM A;  4IFS A;  3NSU A;  2UZR A;  3SO6 A;  1BAK A;  2GCL A;  2ELB A;  1XD4 A;  4WVF B;  3WA0 A;  2MKR A;  2EMT A;  3ODX A;  2DKQ A;  1PMS A;  2IYB A;  2N0Y A;  3V5W A;  3PP2 A;  2AL6 A;  2RGN B;  1QQG A;  1M7E A;  2XQN M;  4K2O A;  2Z0Q A;  4GPT B;  4B6H A;  2ZPY A;  2JP2 A;  2CAY A;  3PG7 A;  2DN6 A;  1MK7 B;  4CHJ A;  3TW1 A;  1B55 A;  2DX1 A;  1BTK A;  1P3R A;  4DX9 0;  4WJ7 A;  2GJY A;  5D3W A;  5JHH A;  4Z2N A;  3FM8 C;  3FEH A;  3M1I B;  4GN1 A;  1V5M A;  3F0W A;  1MK9 B;  3ZDT A;  3PVU A;  1V5U A;  4CHM A;  3IVF A;  3SUZ A;  4A6K A;  4F7U P;  1RJ2 A;  1NTV A;  2LUL A;  1WGU A;  2RNR B;  2W2X C;  5D27 A;  3DXE A;  4MT7 A;  4P7I A;  2YT0 A;  1K5G B;  1RRP B;  2COC A;  3CXB B;  2N23 A;  1XCG A;  1NTY A;  2Y8F A;  1ZC3 B;  2W2X D;  2EJ8 A;  2YS1 A;  1UPQ A;  4HDO A;  1MPH A;  1SGH A;  1H4R A;  5KCV A;  2YS3 A;  3ML4 A;  2V76 A;  2J0M A;  3A8P A;  4TYZ A;  2DYQ A;  4C0A A;  3QIJ A;  2YF0 A;  1Y5O A;  2D10 A;  1V88 A;  5J3Y A;  3D8D A;  1X86 A;  2PZ1 A;  1K5D B;  2I1J A;  4F7G A;  1BWN A;  2D4Q A;  2FJL A;  3QBV B;  3HK0 A;  2D11 A;  2HTH B;  5HE2 A;  4KHO A;  3BJI A;  5C16 A;  3QWM A;  4K17 A;  2LKO A;  2YSZ A;  5CLL B;  3A98 B;  2H7D A;  2I5C A;  4HHV A;  1WI1 A;  5HE3 A;  4HB0 B;  1MIZ B;  1P6S A;  3DXC A;  1DDW A;  1GC7 A;  3U7D A;  4F7H A;  1PFJ A;  1X11 A;  3F5R A;  4HAZ B;  3WYF B;  1EF1 A;  3RCP A;  1DDM A;  5C6R A;  3GYP A;  1V89 A;  1V5P A;  2DA0 A;  1DBH A;  5DH9 B;  3DXD A;  4D0N B;  4DBB A;  3ODW A;  5DHA B;  2Z0P A;  4XWX A;  1W1G A;  1W1D A;  4HAV B;  3MPX A;  1J19 A;  2R0D A;  4MK0 A;  1U5F A;  1FGY A;  1LW3 A;  2Y8G A;  5FI1 A;  2OTX A;  2MFQ A;  3U8Z A;  2KUP A;  1J0W A;  3PVW A;  3AU4 A;  2EMS A;  3SNH A;  2Q13 A;  4IOY X;  5JHG A;  1TQZ A;  4HAX B;  1WJ1 A;  4HAT B;  2AEH A;  2DYN A;  2NMB A;  1DYN A;  2ROZ B;  1WG7 A;  2I5F A;  4A6F A;  1MAI A;  1DDV A;  3SYX A;  1FHO A;  3KY9 A;  4EKU A;  2YRY A;  2LYD A;  2COA A;  4A6F B;  2KGX B;  2YT1 A;  1OMW A;  2D2Q A;  4ZRK A;  5JLJ B;  2L1C A;  1P5T A;  2COD A;  3AU5 A;  2LOX A;  1QC6 A;  3LJU X;  3HQC A;  4KHA A;  2RSG A;  1Y19 B;  2RUK B;  3GYO A;  4DX8 A;  5C79 A;  1E5W A;  2KCJ A;  3O96 A;  2CRF A;  2J0J A;  2ELA A;  1ISN A;  3PZD A;  3AJ4 A;  3X23 A;  4TKN A;  1H10 A;  3TO1 A;  2DX5 A;  2R09 A;  2K00 A;  4A5K A;  1U2B A;  3D8E A;  2DTC A;  3PVL A;  5HE0 A;  2W2W A;  1U29 A;  3OAN A;  1XOD A;  1BTN A;  1FHX A;  4GMX B;  1UNP A;  2DFK A;  1N3H A;  1OY2 A;  1V61 A;  2DKP A;  2H7E A;  3PSC A;  4WSF A;  1TJ6 A;  4MY6 A;  2M38 A;  1EVH A;  1U5G A;  4DXA B;  4HAW B;  4IAP A;  5LOP B;  4HAY B;  4K2P A;  2EC1 A;  2DHK A;  1ZM0 A;  1U5D A;  1FGZ A;  2K2J A;  5DHF B;  4CYE A;  1IRS A;  5C5B B;  1KZ7 A;  4PNK A;  5EFX A;  2D9Y A;  1FAO A;  4HB4 B;  1XX0 A;  1I7A A;  5C5B A;  3ULB A;  3VOQ A;  2Z0O A;  4GMV A;  4NSW A;  1W1H A;  2BCJ A;  4PQ0 A;  3KRX A;  5FI0 A;  2I1K A;  2CY5 A;  1U27 A;  2RLO A;  1MIX A;  2OQB A;  3HW2 B;  2GCJ A;  2VRW B;  2X18 A;  3A8Q A;  3VIA A;  3ZVR A;  3P6A A;  2D9V A;  2G35 A;  4KVG B;  5CLQ B;  2IFS A;  1MKE A;  2ROV A;  1GC6 A;  4ZRJ A;  1FB8 A;  4KHB B;  1ZVR A;  1AWE A;  2QKL A;  3BIN A;  4HB3 B;  1WGQ A;  2QKM A;  3UZT A;  1NI2 A;  3PEG A;  2DHI A;  4Z2M B;  4HDQ A;  2D9Z A;  3ODO A;  3KZ1 A;  3MDB C;  3FSS A;  4HB2 B;  2D9X A;  3P7Z A;  1X05 A;  3N7C A;  2K2U A;  2D9W A;  4GZU A;  2P8V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...