1NU2A

Crystal structure of the murine disabled-1 (dab1) ptb domain-apoer2 peptide-pi-4,5p2 ternary complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
152
structure length
152
Chain Sequence
b'GQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Disabled homolog 1
publication title Origins of Peptide Selectivity and Phosphoinositide Binding Revealed by Structures of Disabled-1 PTB Domain Complexes
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 45
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1nu2A00
3ZDTA 1WVHA 2ZPYA 1P6SA 2Y7BA 1N3HA 3WA0A 1IRSA 2YSZA 2Q13A 1LW3A 5JLJB 3A98B 1P5TA 1NI2A 4GMVA 5D3YA 4F7GA 1UPQA 4CHJA 2YVCA 4B6HA 2EMSA 2Z0PA 1M7EA 4HAXB 5KCVA 4WSFA 1WJ1A 4IAPA 1Q67A 3SV1A 1GC6A 3TW1A 2W2WA 1OMWA 5KQ1A 1FOEA 4KHOA 1MAIA 1XX0A 2J59M 3LJUX 1XODA 2AL6A 1ZVRA 1X86A 2MFQA 2KGXB 2DN6A 4HAYB 1UNRA 2LYDA 5D3XA 4H8SA 5FI0A 4EJNA 5J3QA 4KHAA 4GN1A 2CY4A 3A8QA 3PSCA 4CYEA 4K2PA 3ODXA 2ELAA 2K2JA 2H7DA 3ML4A 1GC7A 2RUKB 1V61A 4MK0A 2JP2A 3WYFB 2RNRB 3RCPA 3NSUA 1FGYA 2YT1A 3AU5A 2BCJA 1Y5OA 2IYBA 3QWMA 2MKRA 1EAZA 3QBVB 4HAZB 1U5EA 4XWXA 5J3TA 1V88A 4MT7A 2CY5A 2DX5A 1OY2A 4HAVB 4IOYX 4EKUA 1PFJA 2P0DA 1XD4A 4GPTB 4ZRIA 1WI1A 1MK7B 2ADZA 3SO6A 3F5RA 2E2XA 5C16A 5DIFB 2N0YA 1DROA 5JHHA 1EVHA 1P3RA 3DXCA 1V5MA 2LG1A 1J0WA 4A6HA 1PLSA 3D8FA 1BTKA 2L2IA 2Y8FA 1MIXA 1MK9B 3ZVRA 4DBBA 1FAOA 4F7HA 2J0JA 5D27A 3PVUA 1WG7A 3OANA 2MDXA 4HATB 1W1DA 3D8EA 3D8DA 1X05A 4DXAB 2COCA 2DKQA 4HB3B 4K17A 2YS5A 5EFXA 2RGNB 2I5CA 1ZC4B 5CLLB 2K2UA 3TVVA 2Y8GA 4YL8A 2H7EA 3U7DA 2EMTA 1J19A 3KY9A 1K5DB 2VSZA 4PNKA 1RJ2A 3FSSA 2L1CA 3TO1A 1KI1B 4KVGB 1DBHA 4GZUA 3M1IB 3SUZA 5DHFB 1GG3A 2PZ1A 5L81A 5C5BB 4NSWA 4A6KA 5LONB 3PP2A 2YRYA 2VRWB 1FGZA 1UEFA 3TFMA 3FM8C 2GCJA 4HB0B 2YF0A 5CLQB 2KCJA 5J3YA 1KZ7A 3T06A 2UVMA 2D9XA 1U5GA 4HDQA 4ZRJA 3UZTA 4KHBB 1E5WA 2COAA 2D10A 3SYXA 4EMOA 2NZ8B 1I2HA 1NTYA 3BINA 2FJLA 5C5BA 2D9YA 2D9WA 1MKEA 2D4QA 2J0MA 4K81A 4K2OA 1KZGA 2I1JA 3GYPA 1UNPA 1U27A 2AEHA 3VOQA 1EF1A 5HE3A 4A6FB 2NMBA 2Z0OA 2CRFA 1V5UA 2P8VA 1U5DA 1ISNA 2RLOA 4HB4B 1QC6A 2GS0A 2I1KA 4Z2NA 2MWNB 2GCLA 2YS1A 1XCGA 4ZRKA 2DFKA 4TKNA 3ULBA 1I7AA 5DH9B 2YT0A 5D3WA 3X23A 1DDWA 2CODA 5D3VA 1X1FA 4PQ0A 2DYNA 1H4RA 4A6FA 1UNQA 1BTNA 1WJMA 1ZC3B 4CHMA 4GXBA 2OQBA 2Z0QA 3AU4A 1DYNA 1XR0B 3PEGA 2ROVA 2D9ZA 3HK0A 4YONA 2W2XC 2UZSA 4L6EA 4Z2MB 1H10A 2COFA 3U8ZA 1SGHA 2D9VA 5LOPB 2YS3A 4A5KA 1W1GA 2P0HA 5C79A 2M14A 2LOXA 5JHGA 2QKLA 1K5GB 3FEHA 5DHAB 2ELBA 2DKPA 3PZDA 2LOZA 2IFSA 2X18A 1FHOA 3G9WA 2UZRA 4MY6A 3O96A 3HQCA 1V5PA 1FHWA 4D0NB 4NY0A 1X11A 2D11A 2G35A 1FHXA 2CAYA 3N7CA 2DA0A 2DHKA 5JP4A 3BJIA 3KZ1A 1U5FA 3DXEA 2M38A 3KRWA 3KSYA 3MDBC 4Y94A 1MIZB 3P6AA 3MPXA 4DX90 2V76A 2DHIA 1X1GA 4HB2B 2HTHB 4HDOA 1ZM0A 1SHCA 2LKOA 2P0FA 2I5FA 4HAUB 1PMSA 3TCAA 3A8PA 1FB8A 2DHJA 2OTXA 5C6RA 2K00A 1U29A 3AJ4A 1NU2A 2DTCA 2VKIA 1WGUA 3ODOA 2ROZB 2DYQA 1DDMA 4F7UP 2R09A 3SNHA 1V89A 3PVLA 2KUPA 2D2QA 1B55A 5HE1A 3HW2B 3PVWA 1OQNA 2DX1A 1ZSQA 3DXDA 2N23A 2GJYA 3PG7A 5GOWB 2DLWA 2EJ8A 3GYOA 4GMXB 5FI1A 1TXDA 1QQGA 1XKEA 3QIJA 1TJ6A 1NTVA 3ULCA 3V5WA 1EGXA 4HAWB 2QKMA 2LULA 1LB1A 3CXBB 2RVBB 1M7RA 4WVFB 2J0KA 1AWEA 4WJ7A 1RRPB 4DX8A 2W2XD 3IVFA 1TQZA 4C0AA 3ODWA 4KAXB 3VIAA 1BAKA 3KRXA 4P7IA 1MPHA 5KQ4A 1WGQA 2RSGA 3P7ZA 1AQCA 4BBKA 2R0DA 5DI9B 1U2BA 4HHVA 2XQNM 4TYZA 2EC1A 3CIKA 5HE2A 2HE7A 1Z87A 1UPRA 1Y19B 5HE0A 1BWNA 1W1HA 4IFSA 3F0WA 1DDVA
chains in the Genus database with same CATH superfamily
3ZDTA 1WVHA 2ZPYA 1P6SA 2Y7BA 1N3HA 3WA0A 1IRSA 2YSZA 2Q13A 1LW3A 5JLJB 4QJ3B 4QJ5B 3A98B 1P5TA 1NI2A 3B77A 4GMVA 5D3YA 4F7GA 1UPQA 4CHJA 2YVCA 4B6HA 2EMSA 2Z0PA 1M7EA 2GUMA 4HAXB 5KCVA 4WSFA 1WJ1A 4IAPA 1Q67A 3SV1A 1GC6A 3TW1A 1T77A 2W2WA 1OMWA 5KQ1A 1FOEA 4KHOA 1MAIA 1XX0A 2J59M 3LJUX 1XODA 3NWFA 2AL6A 1ZVRA 1X86A 2MFQA 2Z59A 2KGXB 5M4YB 2DN6A 4HAYB 1UNRA 2LYDA 5D3XA 4H8SA 4HSIA 5FI0A 4EJNA 5J3QA 4KHAA 4GN1A 2CY4A 2Z4DA 3A8QA 3PSCA 4CYEA 4K2PA 3ODXA 2ELAA 2K2JA 2H7DA 3ML4A 1GC7A 2RUKB 1V61A 4MK0A 2JP2A 3WYFB 2RNRB 3RCPA 3NSUA 1FGYA 3DCXA 2YT1A 3AU5A 2BCJA 1Y5OA 2IYBA 3QWMA 2MKRA 1EAZA 3QBVB 4HAZB 1U5EA 4XWXA 5J3TA 1V88A 4MT7A 2CY5A 2DX5A 1OY2A 4HAVB 4IOYX 4EKUA 1PFJA 2P0DA 1XD4A 4GPTB 4ZRIA 1WI1A 1MK7B 2ADZA 3SO6A 3F5RA 2E2XA 5C16A 5DIFB 2N0YA 1DROA 5JHHA 1EVHA 1P3RA 3DXCA 1V5MA 2LG1A 2YT2A 1J0WA 4A6HA 1PLSA 3D8FA 1BTKA 2L2IA 2Y8FA 1MIXA 1MK9B 3ZVRA 4DBBA 1FAOA 4F7HA 2J0JA 5D27A 3PVUA 1WG7A 3OANA 2MDXA 4HATB 1W1DA 3D8EA 3D8DA 1X05A 4DXAB 2COCA 2DKQA 4HB3B 4K17A 2YS5A 4L1RA 5EFXA 2RGNB 2I5CA 1ZC4B 5CLLB 2K2UA 3TVVA 2Y8GA 4YL8A 2KR0A 2H7EA 3U7DA 2EMTA 4OT1A 1J19A 3KY9A 1K5DB 2VSZA 4PNKA 1RJ2A 3FSSA 2L1CA 1MI1A 3TO1A 1KI1B 4KVGB 1DBHA 4GZUA 3M1IB 3SUZA 5DHFB 1GG3A 2PZ1A 5L81A 5C5BB 4NSWA 4A6KA 5LONB 3PP2A 2YRYA 2VRWB 1FGZA 1UEFA 3TFMA 3FM8C 2GCJA 4HB0B 2YF0A 5CLQB 2KCJA 5J3YA 4OSNA 1KZ7A 3T06A 2UVMA 2D9XA 1U5GA 4HDQA 4ZRJA 3U12A 3UZTA 4KHBB 1E5WA 2COAA 2D10A 3SYXA 4EMOA 2NZ8B 1I2HA 1NTYA 3FVCA 3BINA 2FJLA 5C5BA 2D9YA 2RRFA 2D9WA 1MKEA 2D4QA 2J0MA 4K81A 4K2OA 1KZGA 2I1JA 3GYPA 1UNPA 1U27A 2AEHA 3VOQA 1EF1A 5HE3A 4A6FB 2NMBA 2Z0OA 2K49A 2CRFA 2NBVA 1V5UA 2P8VA 1U5DA 5I2MA 1ISNA 2RLOA 4HB4B 2Z14A 1QC6A 2GS0A 2I1KA 4Z2NA 2MWNB 2GCLA 3HIEA 2YS1A 4KHBA 3HSAA 1XCGA 4ZRKA 2DFKA 4TKNA 4CSQA 3A58A 3ULBA 1I7AA 5DH9B 2YT0A 5I2SA 5D3WA 3X23A 1DDWA 2CODA 5D3VA 1X1FA 4PQ0A 2DYNA 1H4RA 4A6FA 4GNKB 1UNQA 1BTNA 1WJMA 1ZC3B 4CHMA 4GXBA 2OQBA 2Z0QA 5LG4B 3AU4A 1DYNA 1XR0B 3PEGA 2ROVA 2D9ZA 3HK0A 4YONA 2W2XC 2UZSA 4L6EA 4Z2MB 1H10A 2COFA 3U8ZA 1SGHA 2D9VA 5LOPB 2YS3A 2K8EA 4GOUA 4A5KA 1W1GA 2P0HA 5C79A 2M14A 2LOXA 5JHGA 2QKLA 1K5GB 3FEHA 5DHAB 2ELBA 2DKPA 3PZDA 2LOZA 2IFSA 2X18A 1FHOA 3G9WA 2UZRA 4MY6A 3O96A 3HQCA 1V5PA 1FHWA 4D0NB 4NY0A 1X11A 2D11A 2R2YA 2G35A 1FHXA 2CAYA 3N7CA 2DA0A 2DHKA 5JP4A 3BJIA 3KZ1A 1U5FA 3DXEA 2M38A 3KRWA 3KSYA 3MDBC 4Y94A 1MIZB 3P6AA 3MPXA 4DX90 2V76A 2DHIA 1X1GA 4HB2B 2HTHB 4HDOA 1ZM0A 4QXAB 1SHCA 2LKOA 2P0FA 2I5FA 4HAUB 1PMSA 3TCAA 3A8PA 1FB8A 2DHJA 2OTXA 5C6RA 2K00A 1U29A 3AJ4A 1NU2A 2DTCA 2VKIA 1WGUA 3ODOA 2ROZB 2DYQA 1DDMA 4F7UP 2ZKMX 2R09A 3NWAA 1V89A 3SNHA 3NWDA 3PVLA 2KUPA 2D2QA 4D6WA 1B55A 5HE1A 3HW2B 3PVWA 1OQNA 2DX1A 3OHMB 1ZSQA 3DXDA 2N23A 2GJYA 3PG7A 5GOWB 3NW8A 2DLWA 2EJ8A 2FJUB 3GYOA 4GMXB 5FI1A 2Z13A 1TXDA 1QQGA 1XKEA 3QIJA 2KUQA 1TJ6A 1NTVA 2KIGA 3ULCA 3V5WA 1EGXA 4HAWB 2QKMA 2LULA 1LB1A 3CXBB 2RVBB 4QJ4B 1M7RA 4WVFB 2J0KA 1AWEA 4WJ7A 1RRPB 4DX8A 2W2XD 3IVFA 1TQZA 4C0AA 3ODWA 4KAXB 3VIAA 1BAKA 1ZYIA 4DIXA 3KRXA 4P7IA 1MPHA 5KQ4A 1WGQA 2RSGA 3P7ZA 1AQCA 4BBKA 2R0DA 5DI9B 1U2BA 4HHVA 2XQNM 4TYZA 2EC1A 3CIKA 5HE2A 2HE7A 1Z87A 2KIEA 5IRSA 1UPRA 1Y19B 5HE0A 1BWNA 1W1HA 4IFSA 3F0WA 1DDVA
chains in the Genus database with same CATH topology
3ZDTA 1WVHA 2ZPYA 1P6SA 2Y7BA 1N3HA 3WA0A 1IRSA 2YSZA 2Q13A 1LW3A 5JLJB 3A98B 1P5TA 1NI2A 4GMVA 5D3YA 4F7GA 1UPQA 4CHJA 2YVCA 4B6HA 2EMSA 2Z0PA 1M7EA 4HAXB 5KCVA 4WSFA 1WJ1A 4IAPA 1Q67A 3SV1A 1GC6A 3TW1A 2W2WA 1OMWA 5KQ1A 1FOEA 4KHOA 1MAIA 1XX0A 2J59M 3LJUX 1XODA 2AL6A 1ZVRA 1X86A 2MFQA 2KGXB 2DN6A 4HAYB 1UNRA 2LYDA 5D3XA 4H8SA 5FI0A 4EJNA 5J3QA 4KHAA 4GN1A 2CY4A 3A8QA 3PSCA 4CYEA 4K2PA 3ODXA 2ELAA 2K2JA 2H7DA 3ML4A 1GC7A 2RUKB 1V61A 4MK0A 2JP2A 3WYFB 2RNRB 3RCPA 3NSUA 1FGYA 2YT1A 3AU5A 2BCJA 1Y5OA 2IYBA 3QWMA 2MKRA 1EAZA 3QBVB 4HAZB 1U5EA 4XWXA 5J3TA 1V88A 4MT7A 2CY5A 2DX5A 1OY2A 4HAVB 4IOYX 4EKUA 1PFJA 2P0DA 1XD4A 4GPTB 4ZRIA 1WI1A 1MK7B 2ADZA 3SO6A 3F5RA 2E2XA 5C16A 5DIFB 2N0YA 1DROA 5JHHA 1EVHA 1P3RA 3DXCA 1V5MA 2LG1A 1J0WA 4A6HA 1PLSA 3D8FA 1BTKA 2L2IA 2Y8FA 1MIXA 1MK9B 3ZVRA 4DBBA 1FAOA 4F7HA 2J0JA 5D27A 3PVUA 1WG7A 3OANA 2MDXA 4HATB 1W1DA 3D8EA 3D8DA 1X05A 4DXAB 2COCA 2DKQA 4HB3B 4K17A 2YS5A 5EFXA 2RGNB 2I5CA 1ZC4B 5CLLB 2K2UA 3TVVA 2Y8GA 4YL8A 2H7EA 3U7DA 2EMTA 1J19A 3KY9A 1K5DB 2VSZA 4PNKA 1RJ2A 3FSSA 2L1CA 3TO1A 1KI1B 4KVGB 1DBHA 4GZUA 3M1IB 3SUZA 5DHFB 1GG3A 2PZ1A 5L81A 5C5BB 4NSWA 4A6KA 5LONB 3PP2A 2YRYA 2VRWB 1FGZA 1UEFA 3TFMA 3FM8C 2GCJA 4HB0B 2YF0A 5CLQB 2KCJA 5J3YA 1KZ7A 3T06A 2UVMA 2D9XA 1U5GA 4HDQA 4ZRJA 3UZTA 4KHBB 1E5WA 2COAA 2D10A 3SYXA 4EMOA 2NZ8B 1I2HA 1NTYA 3BINA 2FJLA 5C5BA 2D9YA 2D9WA 1MKEA 2D4QA 2J0MA 4K81A 4K2OA 1KZGA 2I1JA 3GYPA 1UNPA 1U27A 2AEHA 3VOQA 1EF1A 5HE3A 4A6FB 2NMBA 2Z0OA 2CRFA 1V5UA 2P8VA 1U5DA 1ISNA 2RLOA 4HB4B 1QC6A 2GS0A 2I1KA 4Z2NA 2MWNB 2GCLA 2YS1A 1XCGA 4ZRKA 2DFKA 4TKNA 3ULBA 1I7AA 5DH9B 2YT0A 5D3WA 3X23A 1DDWA 2CODA 5D3VA 1X1FA 4PQ0A 2DYNA 1H4RA 4A6FA 1UNQA 1BTNA 1WJMA 1ZC3B 4CHMA 4GXBA 2OQBA 2Z0QA 3AU4A 1DYNA 1XR0B 3PEGA 2ROVA 2D9ZA 3HK0A 4YONA 2W2XC 2UZSA 4L6EA 4Z2MB 1H10A 2COFA 3U8ZA 1SGHA 2D9VA 5LOPB 2YS3A 4A5KA 1W1GA 2P0HA 5C79A 2M14A 2LOXA 5JHGA 2QKLA 1K5GB 3FEHA 5DHAB 2ELBA 2DKPA 3PZDA 2LOZA 2IFSA 2X18A 1FHOA 3G9WA 2UZRA 4MY6A 3O96A 3HQCA 1V5PA 1FHWA 4D0NB 4NY0A 1X11A 2D11A 2G35A 1FHXA 2CAYA 3N7CA 2DA0A 2DHKA 5JP4A 3BJIA 3KZ1A 1U5FA 3DXEA 2M38A 3KRWA 3KSYA 3MDBC 4Y94A 1MIZB 3P6AA 3MPXA 4DX90 2V76A 2DHIA 1X1GA 4HB2B 2HTHB 4HDOA 1ZM0A 1SHCA 2LKOA 2P0FA 2I5FA 4HAUB 1PMSA 3TCAA 3A8PA 1FB8A 2DHJA 2OTXA 5C6RA 2K00A 1U29A 3AJ4A 1NU2A 2DTCA 2VKIA 1WGUA 3ODOA 2ROZB 2DYQA 1DDMA 4F7UP 2R09A 3SNHA 1V89A 3PVLA 2KUPA 2D2QA 1B55A 5HE1A 3HW2B 3PVWA 1OQNA 2DX1A 1ZSQA 3DXDA 2N23A 2GJYA 3PG7A 5GOWB 2DLWA 2EJ8A 3GYOA 4GMXB 5FI1A 1TXDA 1QQGA 1XKEA 3QIJA 1TJ6A 1NTVA 3ULCA 3V5WA 1EGXA 4HAWB 2QKMA 2LULA 1LB1A 3CXBB 2RVBB 1M7RA 4WVFB 2J0KA 1AWEA 4WJ7A 1RRPB 4DX8A 2W2XD 3IVFA 1TQZA 4C0AA 3ODWA 4KAXB 3VIAA 1BAKA 3KRXA 4P7IA 1MPHA 5KQ4A 1WGQA 2RSGA 3P7ZA 1AQCA 4BBKA 2R0DA 5DI9B 1U2BA 4HHVA 2XQNM 4TYZA 2EC1A 3CIKA 5HE2A 2HE7A 1Z87A 1UPRA 1Y19B 5HE0A 1BWNA 1W1HA 4IFSA 3F0WA 1DDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZDT A;  1WVH A;  2ZPY A;  1P6S A;  2Y7B A;  1N3H A;  3WA0 A;  1IRS A;  2YSZ A;  2Q13 A;  1LW3 A;  5JLJ B;  3A98 B;  1P5T A;  1NI2 A;  4GMV A;  5D3Y A;  4F7G A;  1UPQ A;  4CHJ A;  2YVC A;  4B6H A;  2EMS A;  2Z0P A;  1M7E A;  4HAX B;  5KCV A;  4WSF A;  1WJ1 A;  4IAP A;  1Q67 A;  3SV1 A;  1GC6 A;  3TW1 A;  2W2W A;  1OMW A;  5KQ1 A;  1FOE A;  4KHO A;  1MAI A;  1XX0 A;  2J59 M;  3LJU X;  1XOD A;  2AL6 A;  1ZVR A;  1X86 A;  2MFQ A;  2KGX B;  2DN6 A;  4HAY B;  1UNR A;  2LYD A;  5D3X A;  4H8S A;  5FI0 A;  4EJN A;  5J3Q A;  4KHA A;  4GN1 A;  2CY4 A;  3A8Q A;  3PSC A;  4CYE A;  4K2P A;  3ODX A;  2ELA A;  2K2J A;  2H7D A;  3ML4 A;  1GC7 A;  2RUK B;  1V61 A;  4MK0 A;  2JP2 A;  3WYF B;  2RNR B;  3RCP A;  3NSU A;  1FGY A;  2YT1 A;  3AU5 A;  2BCJ A;  1Y5O A;  2IYB A;  3QWM A;  2MKR A;  1EAZ A;  3QBV B;  4HAZ B;  1U5E A;  4XWX A;  5J3T A;  1V88 A;  4MT7 A;  2CY5 A;  2DX5 A;  1OY2 A;  4HAV B;  4IOY X;  4EKU A;  1PFJ A;  2P0D A;  1XD4 A;  4GPT B;  4ZRI A;  1WI1 A;  1MK7 B;  2ADZ A;  3SO6 A;  3F5R A;  2E2X A;  5C16 A;  5DIF B;  2N0Y A;  1DRO A;  5JHH A;  1EVH A;  1P3R A;  3DXC A;  1V5M A;  2LG1 A;  1J0W A;  4A6H A;  1PLS A;  3D8F A;  1BTK A;  2L2I A;  2Y8F A;  1MIX A;  1MK9 B;  3ZVR A;  4DBB A;  1FAO A;  4F7H A;  2J0J A;  5D27 A;  3PVU A;  1WG7 A;  3OAN A;  2MDX A;  4HAT B;  1W1D A;  3D8E A;  3D8D A;  1X05 A;  4DXA B;  2COC A;  2DKQ A;  4HB3 B;  4K17 A;  2YS5 A;  5EFX A;  2RGN B;  2I5C A;  1ZC4 B;  5CLL B;  2K2U A;  3TVV A;  2Y8G A;  4YL8 A;  2H7E A;  3U7D A;  2EMT A;  1J19 A;  3KY9 A;  1K5D B;  2VSZ A;  4PNK A;  1RJ2 A;  3FSS A;  2L1C A;  3TO1 A;  1KI1 B;  4KVG B;  1DBH A;  4GZU A;  3M1I B;  3SUZ A;  5DHF B;  1GG3 A;  2PZ1 A;  5L81 A;  5C5B B;  4NSW A;  4A6K A;  5LON B;  3PP2 A;  2YRY A;  2VRW B;  1FGZ A;  1UEF A;  3TFM A;  3FM8 C;  2GCJ A;  4HB0 B;  2YF0 A;  5CLQ B;  2KCJ A;  5J3Y A;  1KZ7 A;  3T06 A;  2UVM A;  2D9X A;  1U5G A;  4HDQ A;  4ZRJ A;  3UZT A;  4KHB B;  1E5W A;  2COA A;  2D10 A;  3SYX A;  4EMO A;  2NZ8 B;  1I2H A;  1NTY A;  3BIN A;  2FJL A;  5C5B A;  2D9Y A;  2D9W A;  1MKE A;  2D4Q A;  2J0M A;  4K81 A;  4K2O A;  1KZG A;  2I1J A;  3GYP A;  1UNP A;  1U27 A;  2AEH A;  3VOQ A;  1EF1 A;  5HE3 A;  4A6F B;  2NMB A;  2Z0O A;  2CRF A;  1V5U A;  2P8V A;  1U5D A;  1ISN A;  2RLO A;  4HB4 B;  1QC6 A;  2GS0 A;  2I1K A;  4Z2N A;  2MWN B;  2GCL A;  2YS1 A;  1XCG A;  4ZRK A;  2DFK A;  4TKN A;  3ULB A;  1I7A A;  5DH9 B;  2YT0 A;  5D3W A;  3X23 A;  1DDW A;  2COD A;  5D3V A;  1X1F A;  4PQ0 A;  2DYN A;  1H4R A;  4A6F A;  1UNQ A;  1BTN A;  1WJM A;  1ZC3 B;  4CHM A;  4GXB A;  2OQB A;  2Z0Q A;  3AU4 A;  1DYN A;  1XR0 B;  3PEG A;  2ROV A;  2D9Z A;  3HK0 A;  4YON A;  2W2X C;  2UZS A;  4L6E A;  4Z2M B;  1H10 A;  2COF A;  3U8Z A;  1SGH A;  2D9V A;  5LOP B;  2YS3 A;  4A5K A;  1W1G A;  2P0H A;  5C79 A;  2M14 A;  2LOX A;  5JHG A;  2QKL A;  1K5G B;  3FEH A;  5DHA B;  2ELB A;  2DKP A;  3PZD A;  2LOZ A;  2IFS A;  2X18 A;  1FHO A;  3G9W A;  2UZR A;  4MY6 A;  3O96 A;  3HQC A;  1V5P A;  1FHW A;  4D0N B;  4NY0 A;  1X11 A;  2D11 A;  2G35 A;  1FHX A;  2CAY A;  3N7C A;  2DA0 A;  2DHK A;  5JP4 A;  3BJI A;  3KZ1 A;  1U5F A;  3DXE A;  2M38 A;  3KRW A;  3KSY A;  3MDB C;  4Y94 A;  1MIZ B;  3P6A A;  3MPX A;  4DX9 0;  2V76 A;  2DHI A;  1X1G A;  4HB2 B;  2HTH B;  4HDO A;  1ZM0 A;  1SHC A;  2LKO A;  2P0F A;  2I5F A;  4HAU B;  1PMS A;  3TCA A;  3A8P A;  1FB8 A;  2DHJ A;  2OTX A;  5C6R A;  2K00 A;  1U29 A;  3AJ4 A;  1NU2 A;  2DTC A;  2VKI A;  1WGU A;  3ODO A;  2ROZ B;  2DYQ A;  1DDM A;  4F7U P;  2R09 A;  3SNH A;  1V89 A;  3PVL A;  2KUP A;  2D2Q A;  1B55 A;  5HE1 A;  3HW2 B;  3PVW A;  1OQN A;  2DX1 A;  1ZSQ A;  3DXD A;  2N23 A;  2GJY A;  3PG7 A;  5GOW B;  2DLW A;  2EJ8 A;  3GYO A;  4GMX B;  5FI1 A;  1TXD A;  1QQG A;  1XKE A;  3QIJ A;  1TJ6 A;  1NTV A;  3ULC A;  3V5W A;  1EGX A;  4HAW B;  2QKM A;  2LUL A;  1LB1 A;  3CXB B;  2RVB B;  1M7R A;  4WVF B;  2J0K A;  1AWE A;  4WJ7 A;  1RRP B;  4DX8 A;  2W2X D;  3IVF A;  1TQZ A;  4C0A A;  3ODW A;  4KAX B;  3VIA A;  1BAK A;  3KRX A;  4P7I A;  1MPH A;  5KQ4 A;  1WGQ A;  2RSG A;  3P7Z A;  1AQC A;  4BBK A;  2R0D A;  5DI9 B;  1U2B A;  4HHV A;  2XQN M;  4TYZ A;  2EC1 A;  3CIK A;  5HE2 A;  2HE7 A;  1Z87 A;  1UPR A;  1Y19 B;  5HE0 A;  1BWN A;  1W1H A;  4IFS A;  3F0W A;  1DDV A; 
#chains in the Genus database with same CATH topology
 3ZDT A;  1WVH A;  2ZPY A;  1P6S A;  2Y7B A;  1N3H A;  3WA0 A;  1IRS A;  2YSZ A;  2Q13 A;  1LW3 A;  5JLJ B;  4QJ3 B;  4QJ5 B;  3A98 B;  1P5T A;  1NI2 A;  3B77 A;  4GMV A;  5D3Y A;  4F7G A;  1UPQ A;  4CHJ A;  2YVC A;  4B6H A;  2EMS A;  2Z0P A;  1M7E A;  2GUM A;  4HAX B;  5KCV A;  4WSF A;  1WJ1 A;  4IAP A;  1Q67 A;  3SV1 A;  1GC6 A;  3TW1 A;  1T77 A;  2W2W A;  1OMW A;  5KQ1 A;  1FOE A;  4KHO A;  1MAI A;  1XX0 A;  2J59 M;  3LJU X;  1XOD A;  3NWF A;  2AL6 A;  1ZVR A;  1X86 A;  2MFQ A;  2Z59 A;  2KGX B;  5M4Y B;  2DN6 A;  4HAY B;  1UNR A;  2LYD A;  5D3X A;  4H8S A;  4HSI A;  5FI0 A;  4EJN A;  5J3Q A;  4KHA A;  4GN1 A;  2CY4 A;  2Z4D A;  3A8Q A;  3PSC A;  4CYE A;  4K2P A;  3ODX A;  2ELA A;  2K2J A;  2H7D A;  3ML4 A;  1GC7 A;  2RUK B;  1V61 A;  4MK0 A;  2JP2 A;  3WYF B;  2RNR B;  3RCP A;  3NSU A;  1FGY A;  3DCX A;  2YT1 A;  3AU5 A;  2BCJ A;  1Y5O A;  2IYB A;  3QWM A;  2MKR A;  1EAZ A;  3QBV B;  4HAZ B;  1U5E A;  4XWX A;  5J3T A;  1V88 A;  4MT7 A;  2CY5 A;  2DX5 A;  1OY2 A;  4HAV B;  4IOY X;  4EKU A;  1PFJ A;  2P0D A;  1XD4 A;  4GPT B;  4ZRI A;  1WI1 A;  1MK7 B;  2ADZ A;  3SO6 A;  3F5R A;  2E2X A;  5C16 A;  5DIF B;  2N0Y A;  1DRO A;  5JHH A;  1EVH A;  1P3R A;  3DXC A;  1V5M A;  2LG1 A;  2YT2 A;  1J0W A;  4A6H A;  1PLS A;  3D8F A;  1BTK A;  2L2I A;  2Y8F A;  1MIX A;  1MK9 B;  3ZVR A;  4DBB A;  1FAO A;  4F7H A;  2J0J A;  5D27 A;  3PVU A;  1WG7 A;  3OAN A;  2MDX A;  4HAT B;  1W1D A;  3D8E A;  3D8D A;  1X05 A;  4DXA B;  2COC A;  2DKQ A;  4HB3 B;  4K17 A;  2YS5 A;  4L1R A;  5EFX A;  2RGN B;  2I5C A;  1ZC4 B;  5CLL B;  2K2U A;  3TVV A;  2Y8G A;  4YL8 A;  2KR0 A;  2H7E A;  3U7D A;  2EMT A;  4OT1 A;  1J19 A;  3KY9 A;  1K5D B;  2VSZ A;  4PNK A;  1RJ2 A;  3FSS A;  2L1C A;  1MI1 A;  3TO1 A;  1KI1 B;  4KVG B;  1DBH A;  4GZU A;  3M1I B;  3SUZ A;  5DHF B;  1GG3 A;  2PZ1 A;  5L81 A;  5C5B B;  4NSW A;  4A6K A;  5LON B;  3PP2 A;  2YRY A;  2VRW B;  1FGZ A;  1UEF A;  3TFM A;  3FM8 C;  2GCJ A;  4HB0 B;  2YF0 A;  5CLQ B;  2KCJ A;  5J3Y A;  4OSN A;  1KZ7 A;  3T06 A;  2UVM A;  2D9X A;  1U5G A;  4HDQ A;  4ZRJ A;  3U12 A;  3UZT A;  4KHB B;  1E5W A;  2COA A;  2D10 A;  3SYX A;  4EMO A;  2NZ8 B;  1I2H A;  1NTY A;  3FVC A;  3BIN A;  2FJL A;  5C5B A;  2D9Y A;  2RRF A;  2D9W A;  1MKE A;  2D4Q A;  2J0M A;  4K81 A;  4K2O A;  1KZG A;  2I1J A;  3GYP A;  1UNP A;  1U27 A;  2AEH A;  3VOQ A;  1EF1 A;  5HE3 A;  4A6F B;  2NMB A;  2Z0O A;  2K49 A;  2CRF A;  2NBV A;  1V5U A;  2P8V A;  1U5D A;  5I2M A;  1ISN A;  2RLO A;  4HB4 B;  2Z14 A;  1QC6 A;  2GS0 A;  2I1K A;  4Z2N A;  2MWN B;  2GCL A;  3HIE A;  2YS1 A;  4KHB A;  3HSA A;  1XCG A;  4ZRK A;  2DFK A;  4TKN A;  4CSQ A;  3A58 A;  3ULB A;  1I7A A;  5DH9 B;  2YT0 A;  5I2S A;  5D3W A;  3X23 A;  1DDW A;  2COD A;  5D3V A;  1X1F A;  4PQ0 A;  2DYN A;  1H4R A;  4A6F A;  4GNK B;  1UNQ A;  1BTN A;  1WJM A;  1ZC3 B;  4CHM A;  4GXB A;  2OQB A;  2Z0Q A;  5LG4 B;  3AU4 A;  1DYN A;  1XR0 B;  3PEG A;  2ROV A;  2D9Z A;  3HK0 A;  4YON A;  2W2X C;  2UZS A;  4L6E A;  4Z2M B;  1H10 A;  2COF A;  3U8Z A;  1SGH A;  2D9V A;  5LOP B;  2YS3 A;  2K8E A;  4GOU A;  4A5K A;  1W1G A;  2P0H A;  5C79 A;  2M14 A;  2LOX A;  5JHG A;  2QKL A;  1K5G B;  3FEH A;  5DHA B;  2ELB A;  2DKP A;  3PZD A;  2LOZ A;  2IFS A;  2X18 A;  1FHO A;  3G9W A;  2UZR A;  4MY6 A;  3O96 A;  3HQC A;  1V5P A;  1FHW A;  4D0N B;  4NY0 A;  1X11 A;  2D11 A;  2R2Y A;  2G35 A;  1FHX A;  2CAY A;  3N7C A;  2DA0 A;  2DHK A;  5JP4 A;  3BJI A;  3KZ1 A;  1U5F A;  3DXE A;  2M38 A;  3KRW A;  3KSY A;  3MDB C;  4Y94 A;  1MIZ B;  3P6A A;  3MPX A;  4DX9 0;  2V76 A;  2DHI A;  1X1G A;  4HB2 B;  2HTH B;  4HDO A;  1ZM0 A;  4QXA B;  1SHC A;  2LKO A;  2P0F A;  2I5F A;  4HAU B;  1PMS A;  3TCA A;  3A8P A;  1FB8 A;  2DHJ A;  2OTX A;  5C6R A;  2K00 A;  1U29 A;  3AJ4 A;  1NU2 A;  2DTC A;  2VKI A;  1WGU A;  3ODO A;  2ROZ B;  2DYQ A;  1DDM A;  4F7U P;  2ZKM X;  2R09 A;  3NWA A;  1V89 A;  3SNH A;  3NWD A;  3PVL A;  2KUP A;  2D2Q A;  4D6W A;  1B55 A;  5HE1 A;  3HW2 B;  3PVW A;  1OQN A;  2DX1 A;  3OHM B;  1ZSQ A;  3DXD A;  2N23 A;  2GJY A;  3PG7 A;  5GOW B;  3NW8 A;  2DLW A;  2EJ8 A;  2FJU B;  3GYO A;  4GMX B;  5FI1 A;  2Z13 A;  1TXD A;  1QQG A;  1XKE A;  3QIJ A;  2KUQ A;  1TJ6 A;  1NTV A;  2KIG A;  3ULC A;  3V5W A;  1EGX A;  4HAW B;  2QKM A;  2LUL A;  1LB1 A;  3CXB B;  2RVB B;  4QJ4 B;  1M7R A;  4WVF B;  2J0K A;  1AWE A;  4WJ7 A;  1RRP B;  4DX8 A;  2W2X D;  3IVF A;  1TQZ A;  4C0A A;  3ODW A;  4KAX B;  3VIA A;  1BAK A;  1ZYI A;  4DIX A;  3KRX A;  4P7I A;  1MPH A;  5KQ4 A;  1WGQ A;  2RSG A;  3P7Z A;  1AQC A;  4BBK A;  2R0D A;  5DI9 B;  1U2B A;  4HHV A;  2XQN M;  4TYZ A;  2EC1 A;  3CIK A;  5HE2 A;  2HE7 A;  1Z87 A;  2KIE A;  5IRS A;  1UPR A;  1Y19 B;  5HE0 A;  1BWN A;  1W1H A;  4IFS A;  3F0W A;  1DDV A; 
#chains in the Genus database with same CATH homology
 3ZDT A;  1WVH A;  2ZPY A;  1P6S A;  2Y7B A;  1N3H A;  3WA0 A;  1IRS A;  2YSZ A;  2Q13 A;  1LW3 A;  5JLJ B;  3A98 B;  1P5T A;  1NI2 A;  4GMV A;  5D3Y A;  4F7G A;  1UPQ A;  4CHJ A;  2YVC A;  4B6H A;  2EMS A;  2Z0P A;  1M7E A;  4HAX B;  5KCV A;  4WSF A;  1WJ1 A;  4IAP A;  1Q67 A;  3SV1 A;  1GC6 A;  3TW1 A;  2W2W A;  1OMW A;  5KQ1 A;  1FOE A;  4KHO A;  1MAI A;  1XX0 A;  2J59 M;  3LJU X;  1XOD A;  2AL6 A;  1ZVR A;  1X86 A;  2MFQ A;  2KGX B;  2DN6 A;  4HAY B;  1UNR A;  2LYD A;  5D3X A;  4H8S A;  5FI0 A;  4EJN A;  5J3Q A;  4KHA A;  4GN1 A;  2CY4 A;  3A8Q A;  3PSC A;  4CYE A;  4K2P A;  3ODX A;  2ELA A;  2K2J A;  2H7D A;  3ML4 A;  1GC7 A;  2RUK B;  1V61 A;  4MK0 A;  2JP2 A;  3WYF B;  2RNR B;  3RCP A;  3NSU A;  1FGY A;  2YT1 A;  3AU5 A;  2BCJ A;  1Y5O A;  2IYB A;  3QWM A;  2MKR A;  1EAZ A;  3QBV B;  4HAZ B;  1U5E A;  4XWX A;  5J3T A;  1V88 A;  4MT7 A;  2CY5 A;  2DX5 A;  1OY2 A;  4HAV B;  4IOY X;  4EKU A;  1PFJ A;  2P0D A;  1XD4 A;  4GPT B;  4ZRI A;  1WI1 A;  1MK7 B;  2ADZ A;  3SO6 A;  3F5R A;  2E2X A;  5C16 A;  5DIF B;  2N0Y A;  1DRO A;  5JHH A;  1EVH A;  1P3R A;  3DXC A;  1V5M A;  2LG1 A;  1J0W A;  4A6H A;  1PLS A;  3D8F A;  1BTK A;  2L2I A;  2Y8F A;  1MIX A;  1MK9 B;  3ZVR A;  4DBB A;  1FAO A;  4F7H A;  2J0J A;  5D27 A;  3PVU A;  1WG7 A;  3OAN A;  2MDX A;  4HAT B;  1W1D A;  3D8E A;  3D8D A;  1X05 A;  4DXA B;  2COC A;  2DKQ A;  4HB3 B;  4K17 A;  2YS5 A;  5EFX A;  2RGN B;  2I5C A;  1ZC4 B;  5CLL B;  2K2U A;  3TVV A;  2Y8G A;  4YL8 A;  2H7E A;  3U7D A;  2EMT A;  1J19 A;  3KY9 A;  1K5D B;  2VSZ A;  4PNK A;  1RJ2 A;  3FSS A;  2L1C A;  3TO1 A;  1KI1 B;  4KVG B;  1DBH A;  4GZU A;  3M1I B;  3SUZ A;  5DHF B;  1GG3 A;  2PZ1 A;  5L81 A;  5C5B B;  4NSW A;  4A6K A;  5LON B;  3PP2 A;  2YRY A;  2VRW B;  1FGZ A;  1UEF A;  3TFM A;  3FM8 C;  2GCJ A;  4HB0 B;  2YF0 A;  5CLQ B;  2KCJ A;  5J3Y A;  1KZ7 A;  3T06 A;  2UVM A;  2D9X A;  1U5G A;  4HDQ A;  4ZRJ A;  3UZT A;  4KHB B;  1E5W A;  2COA A;  2D10 A;  3SYX A;  4EMO A;  2NZ8 B;  1I2H A;  1NTY A;  3BIN A;  2FJL A;  5C5B A;  2D9Y A;  2D9W A;  1MKE A;  2D4Q A;  2J0M A;  4K81 A;  4K2O A;  1KZG A;  2I1J A;  3GYP A;  1UNP A;  1U27 A;  2AEH A;  3VOQ A;  1EF1 A;  5HE3 A;  4A6F B;  2NMB A;  2Z0O A;  2CRF A;  1V5U A;  2P8V A;  1U5D A;  1ISN A;  2RLO A;  4HB4 B;  1QC6 A;  2GS0 A;  2I1K A;  4Z2N A;  2MWN B;  2GCL A;  2YS1 A;  1XCG A;  4ZRK A;  2DFK A;  4TKN A;  3ULB A;  1I7A A;  5DH9 B;  2YT0 A;  5D3W A;  3X23 A;  1DDW A;  2COD A;  5D3V A;  1X1F A;  4PQ0 A;  2DYN A;  1H4R A;  4A6F A;  1UNQ A;  1BTN A;  1WJM A;  1ZC3 B;  4CHM A;  4GXB A;  2OQB A;  2Z0Q A;  3AU4 A;  1DYN A;  1XR0 B;  3PEG A;  2ROV A;  2D9Z A;  3HK0 A;  4YON A;  2W2X C;  2UZS A;  4L6E A;  4Z2M B;  1H10 A;  2COF A;  3U8Z A;  1SGH A;  2D9V A;  5LOP B;  2YS3 A;  4A5K A;  1W1G A;  2P0H A;  5C79 A;  2M14 A;  2LOX A;  5JHG A;  2QKL A;  1K5G B;  3FEH A;  5DHA B;  2ELB A;  2DKP A;  3PZD A;  2LOZ A;  2IFS A;  2X18 A;  1FHO A;  3G9W A;  2UZR A;  4MY6 A;  3O96 A;  3HQC A;  1V5P A;  1FHW A;  4D0N B;  4NY0 A;  1X11 A;  2D11 A;  2G35 A;  1FHX A;  2CAY A;  3N7C A;  2DA0 A;  2DHK A;  5JP4 A;  3BJI A;  3KZ1 A;  1U5F A;  3DXE A;  2M38 A;  3KRW A;  3KSY A;  3MDB C;  4Y94 A;  1MIZ B;  3P6A A;  3MPX A;  4DX9 0;  2V76 A;  2DHI A;  1X1G A;  4HB2 B;  2HTH B;  4HDO A;  1ZM0 A;  1SHC A;  2LKO A;  2P0F A;  2I5F A;  4HAU B;  1PMS A;  3TCA A;  3A8P A;  1FB8 A;  2DHJ A;  2OTX A;  5C6R A;  2K00 A;  1U29 A;  3AJ4 A;  1NU2 A;  2DTC A;  2VKI A;  1WGU A;  3ODO A;  2ROZ B;  2DYQ A;  1DDM A;  4F7U P;  2R09 A;  3SNH A;  1V89 A;  3PVL A;  2KUP A;  2D2Q A;  1B55 A;  5HE1 A;  3HW2 B;  3PVW A;  1OQN A;  2DX1 A;  1ZSQ A;  3DXD A;  2N23 A;  2GJY A;  3PG7 A;  5GOW B;  2DLW A;  2EJ8 A;  3GYO A;  4GMX B;  5FI1 A;  1TXD A;  1QQG A;  1XKE A;  3QIJ A;  1TJ6 A;  1NTV A;  3ULC A;  3V5W A;  1EGX A;  4HAW B;  2QKM A;  2LUL A;  1LB1 A;  3CXB B;  2RVB B;  1M7R A;  4WVF B;  2J0K A;  1AWE A;  4WJ7 A;  1RRP B;  4DX8 A;  2W2X D;  3IVF A;  1TQZ A;  4C0A A;  3ODW A;  4KAX B;  3VIA A;  1BAK A;  3KRX A;  4P7I A;  1MPH A;  5KQ4 A;  1WGQ A;  2RSG A;  3P7Z A;  1AQC A;  4BBK A;  2R0D A;  5DI9 B;  1U2B A;  4HHV A;  2XQN M;  4TYZ A;  2EC1 A;  3CIK A;  5HE2 A;  2HE7 A;  1Z87 A;  1UPR A;  1Y19 B;  5HE0 A;  1BWN A;  1W1H A;  4IFS A;  3F0W A;  1DDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...