1NU2A

Crystal structure of the murine disabled-1 (dab1) ptb domain-apoer2 peptide-pi-4,5p2 ternary complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
152
structure length
152
Chain Sequence
GQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Disabled homolog 1
publication title Origins of Peptide Selectivity and Phosphoinositide Binding Revealed by Structures of Disabled-1 PTB Domain Complexes
pubmed doi rcsb
source organism Mus musculus
total genus 45
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1nu2A00
2LG1A 1H10A 4F7HA 3ODXA 2PZ1A 2D9WA 2DKQA 5C16A 2OQBA 1UNRA 2QKMA 4MK0A 2COCA 2DYNA 3D8DA 3O96A 1FHWA 4ZRIA 2MKRA 1H4RA 5CLLB 1LW3A 1KZ7A 1K5GB 3TW1A 2UZSA 2UZRA 1QC6A 3PVWA 5LOPB 2DFKA 1P3RA 1XX0A 2GCLA 3SV1A 5HE2A 5FI1A 4HB4B 3IVFA 2E2XA 4HB2B 3A98B 1U5EA 2DA0A 1E5WA 2D9VA 1I7AA 4HHVA 4H8SA 3U8ZA 4CYEA 4DBBA 3HK0A 1DBHA 3FSSA 1KZGA 1X05A 2D10A 2ROVA 2IFSA 4TYZA 1N3HA 2H7EA 1BAKA 5GOWB 2M14A 1Y5OA 1MPHA 5KCVA 1MIXA 2VSZA 2KUPA 1BWNA 1X86A 4A6FB 4Z2NA 1NTYA 5DHFB 3ULCA 1ZVRA 3ODOA 1B55A 1XD4A 4MY6A 4A6FA 3G9WA 4DX90 2J0MA 2BCJA 3F5RA 1W1DA 2DYQA 2IYBA 3ULBA 2YT1A 2CY5A 4HB0B 5JLJB 2EC1A 4Z2MB 2RNRB 1GC6A 1EF1A 2I5CA 1NU2A 1OMWA 2Y7BA 2UVMA 1OQNA 1MIZB 3KRXA 2J0JA 1DDMA 1K5DB 2RLOA 3A8PA 1X11A 4MT7A 2K2JA 3KRWA 2P0HA 5J3TA 1GC7A 4B6HA 1V88A 1XR0B 3SNHA 5DHAB 4K81A 1SHCA 3M1IB 1KI1B 2RSGA 2Y8FA 2CY4A 1RRPB 3QIJA 2W2XC 3WYFB 1X1GA 3D8FA 4C0AA 1IRSA 2DHKA 3PG7A 4WSFA 1I2HA 1MK7B 1BTKA 2ELAA 3U7DA 2RUKB 4NSWA 1MK9B 4DXAB 3CIKA 3TFMA 1J0WA 2COAA 2VKIA 1MAIA 4TKNA 2YF0A 1AWEA 2DN6A 1M7EA 1AQCA 3UZTA 1NTVA 4ZRJA 1TXDA 1ZC4B 2VRWB 2DKPA 5J3YA 4K2PA 1FOEA 4HDQA 3VOQA 3AU5A 5FI0A 1U5DA 5HE0A 2MWNB 4F7UP 3V5WA 3ZDTA 4XWXA 1ZSQA 1OY2A 5KQ4A 4HAYB 1TQZA 2LOZA 2YS5A 3WA0A 4KVGB 4HAVB 5DH9B 3CXBB 2ZPYA 5D3XA 3BINA 1FGZA 5DIFB 4GZUA 2LULA 2LYDA 2L1CA 3SO6A 2JP2A 4YL8A 2HTHB 4HDOA 5C6RA 2K2UA 4Y94A 5JP4A 5JHHA 4HAXB 1W1GA 2CRFA 4CHJA 4EMOA 1DDVA 1ISNA 3PSCA 1J19A 3SYXA 1UNQA 2GS0A 3T06A 5C5BB 2DHIA 1PLSA 1V5UA 2K00A 2EMTA 2D2QA 1V5PA 5C5BA 1Q67A 2DLWA 5D3YA 1X1FA 2ROZB 5L81A 1P6SA 4KHBB 3GYOA 1ZM0A 2LOXA 3PEGA 4DX8A 1QQGA 2CODA 1MKEA 4IFSA 5D3WA 2HE7A 1XKEA 1U5FA 4GPTB 1W1HA 1PFJA 4KHAA 3HW2B 1FHXA 4EJNA 2MFQA 2Q13A 5C79A 3F0WA 1UPRA 3MPXA 2I1JA 3A8QA 3ML4A 3PVLA 2D9XA 1BTNA 2DX5A 1FAOA 2Y8GA 2I5FA 4KAXB 5DI9B 3TVVA 4L6EA 1V89A 3VIAA 2G35A 5HE1A 4IOYX 4PQ0A 4GMXB 3TO1A 2NMBA 1XODA 2D11A 3KSYA 3P7ZA 4F7GA 1WGQA 3AJ4A 2EMSA 2DTCA 4K17A 2RVBB 3DXCA 1V5MA 3ZVRA 2DX1A 3BJIA 1UNPA 2Z0PA 5D3VA 4ZRKA 5KQ1A 2DHJA 1EVHA 3PP2A 2Z0QA 1PMSA 2KGXB 1WVHA 1U29A 2YRYA 2L2IA 3FM8C 1EGXA 2I1KA 2YSZA 1LB1A 2ADZA 3P6AA 1GG3A 2COFA 2R0DA 2J0KA 1UPQA 2OTXA 3OANA 3KZ1A 2GJYA 2AL6A 2D9YA 4PNKA 4HATB 4A6HA 2N0YA 2D4QA 2ELBA 1U27A 3KY9A 1UEFA 2J59M 2P8VA 3FEHA 3QWMA 3HQCA 1FB8A 2FJLA 1ZC3B 2W2XD 2AEHA 1P5TA 4D0NB 1WG7A 2P0DA 2D9ZA 1SGHA 3MDBC 2P0FA 1M7RA 4HB3B 5HE3A 2GCJA 4WJ7A 2CAYA 1EAZA 1V61A 3DXDA 1Y19B 2N23A 2QKLA 5EFXA 2NZ8B 1XCGA 1RJ2A 2YS1A 4GXBA 2EJ8A 4A5KA 3SUZA 2YT0A 1U5GA 3ODWA 4YONA 4EKUA 5J3QA 2YVCA 3N7CA 4HAUB 1WI1A 1DDWA 1FHOA 3GYPA 3AU4A 2M38A 4HAZB 1FGYA 1WGUA 3DXEA 1DROA 4HAWB 1WJMA 4GN1A 3NSUA 3D8EA 3QBVB 4CHMA 1NI2A 5LONB 2YS3A 4NY0A 3LJUX 1Z87A 2X18A 4WVFB 1TJ6A 5JHGA 3PZDA 1WJ1A 4A6KA 2H7DA 2XQNM 4BBKA 2R09A 2KCJA 2V76A 3PVUA 3TCAA 1U2BA 4GMVA 2W2WA 2RGNB 4KHOA 2MDXA 2Z0OA 4IAPA 5D27A 3X23A 3RCPA 4P7IA 1DYNA 4K2OA 2LKOA 5CLQB
chains in the Genus database with same CATH superfamily
2LG1A 1H10A 4F7HA 3ODXA 2PZ1A 2D9WA 2DKQA 5C16A 2OQBA 1UNRA 2QKMA 4MK0A 4QJ3B 2COCA 2DYNA 3D8DA 3O96A 1FHWA 4ZRIA 2MKRA 1H4RA 5CLLB 1LW3A 1KZ7A 1K5GB 3TW1A 2UZSA 2UZRA 1QC6A 3PVWA 5LOPB 2DFKA 1P3RA 1XX0A 2RRFA 3OHMB 2GCLA 2K49A 3SV1A 5HE2A 5FI1A 4HB4B 3IVFA 2E2XA 4HB2B 3A98B 2ZKMX 1U5EA 2DA0A 1E5WA 2D9VA 1I7AA 4HHVA 4H8SA 3U8ZA 4CYEA 4DBBA 3HK0A 1DBHA 3FSSA 1KZGA 1X05A 2D10A 2ROVA 2IFSA 4TYZA 1N3HA 2H7EA 1BAKA 5GOWB 2M14A 1Y5OA 1MPHA 5KCVA 1MIXA 2Z13A 2VSZA 2KUPA 1BWNA 2Z59A 1X86A 4A6FB 4Z2NA 1NTYA 5DHFB 2R2YA 3ULCA 1ZVRA 3ODOA 1B55A 1XD4A 4MY6A 4A6FA 3G9WA 4DX90 2J0MA 2BCJA 3F5RA 1W1DA 2DYQA 2IYBA 3ULBA 2YT1A 2CY5A 4HB0B 5JLJB 2EC1A 4Z2MB 2RNRB 1ZYIA 1GC6A 1EF1A 2I5CA 1NU2A 2NBVA 1OMWA 3B77A 2Y7BA 2UVMA 1OQNA 1MIZB 3KRXA 2J0JA 1DDMA 1K5DB 2RLOA 3A8PA 4QXAB 1X11A 3HSAA 4MT7A 2K2JA 2Z14A 3KRWA 2P0HA 5J3TA 1GC7A 4B6HA 1V88A 3NWFA 1XR0B 3SNHA 4CSQA 5DHAB 4K81A 1SHCA 3M1IB 1KI1B 2RSGA 2Y8FA 2CY4A 5I2SA 1RRPB 3QIJA 2W2XC 3WYFB 1X1GA 3D8FA 4C0AA 1IRSA 2DHKA 3PG7A 4WSFA 1I2HA 1MK7B 5LG4B 1BTKA 2ELAA 3U7DA 2RUKB 4NSWA 1MK9B 4DXAB 3CIKA 3TFMA 1J0WA 3NWDA 4GNKB 2COAA 2VKIA 1MAIA 4TKNA 2YF0A 1AWEA 3NWAA 2DN6A 1M7EA 1AQCA 3UZTA 1NTVA 4ZRJA 1TXDA 1ZC4B 3FVCA 2VRWB 2DKPA 5J3YA 4K2PA 1FOEA 3NW8A 4HDQA 3VOQA 2GUMA 3AU5A 5FI0A 1U5DA 5HE0A 2MWNB 4F7UP 3V5WA 3ZDTA 4D6WA 4XWXA 1ZSQA 1OY2A 5KQ4A 4HAYB 1TQZA 2LOZA 2YS5A 3WA0A 4KVGB 4HAVB 5DH9B 3CXBB 2ZPYA 5D3XA 3BINA 1FGZA 5DIFB 4GZUA 2LULA 2LYDA 2L1CA 3SO6A 2JP2A 4YL8A 2HTHB 4HDOA 5C6RA 2K2UA 4Y94A 5JP4A 5JHHA 4HAXB 1W1GA 2CRFA 4CHJA 4EMOA 1DDVA 1ISNA 3PSCA 1J19A 3SYXA 1UNQA 2GS0A 3T06A 5C5BB 2DHIA 4DIXA 1PLSA 1V5UA 2K00A 2EMTA 2D2QA 1V5PA 5C5BA 1Q67A 2Z4DA 2DLWA 5D3YA 1X1FA 2ROZB 5L81A 1P6SA 4KHBB 3GYOA 1ZM0A 2LOXA 3PEGA 4DX8A 1QQGA 2CODA 1MKEA 4IFSA 4KHBA 5D3WA 2HE7A 1XKEA 1U5FA 4GPTB 1W1HA 1PFJA 1T77A 4KHAA 3HW2B 1FHXA 4EJNA 2MFQA 2Q13A 4QJ5B 5C79A 3F0WA 1UPRA 3MPXA 2I1JA 3A8QA 3ML4A 3PVLA 2D9XA 1BTNA 2DX5A 1FAOA 2Y8GA 2I5FA 4KAXB 5DI9B 3TVVA 4L6EA 1V89A 3VIAA 2G35A 5HE1A 4IOYX 4PQ0A 4GMXB 3TO1A 2NMBA 1XODA 1MI1A 2D11A 3KSYA 3P7ZA 4F7GA 1WGQA 3AJ4A 2EMSA 2DTCA 4K17A 2RVBB 3DXCA 1V5MA 2KIEA 3ZVRA 2DX1A 3BJIA 1UNPA 2Z0PA 5D3VA 4ZRKA 5KQ1A 2DHJA 1EVHA 3A58A 3PP2A 2Z0QA 1PMSA 2KGXB 1WVHA 1U29A 2YRYA 2L2IA 3FM8C 1EGXA 2I1KA 2KIGA 2YSZA 1LB1A 2ADZA 3P6AA 4L1RA 1GG3A 2COFA 2R0DA 2J0KA 2YT2A 1UPQA 2OTXA 3OANA 3KZ1A 2GJYA 2AL6A 2KR0A 2D9YA 4GOUA 4PNKA 4HATB 4QJ4B 4A6HA 2N0YA 2D4QA 2ELBA 1U27A 3KY9A 1UEFA 2J59M 2P8VA 3FEHA 3QWMA 3HQCA 1FB8A 2FJLA 3HIEA 1ZC3B 2W2XD 2AEHA 1P5TA 4D0NB 1WG7A 2P0DA 2D9ZA 1SGHA 3MDBC 2P0FA 1M7RA 4HB3B 5HE3A 2GCJA 4WJ7A 5IRSA 2CAYA 1EAZA 1V61A 3DXDA 1Y19B 2N23A 2QKLA 5EFXA 2NZ8B 1XCGA 1RJ2A 2YS1A 4GXBA 2EJ8A 4A5KA 3SUZA 2YT0A 2FJUB 1U5GA 3ODWA 4YONA 4EKUA 5J3QA 4OT1A 2KUQA 2YVCA 3N7CA 4HAUB 1WI1A 1DDWA 1FHOA 3GYPA 3AU4A 2M38A 4HAZB 1FGYA 1WGUA 3DXEA 1DROA 4HAWB 1WJMA 4HSIA 4OSNA 4GN1A 3NSUA 3D8EA 3QBVB 4CHMA 1NI2A 5LONB 2YS3A 5I2MA 4NY0A 3LJUX 1Z87A 2X18A 4WVFB 1TJ6A 5M4YB 5JHGA 2K8EA 3PZDA 1WJ1A 4A6KA 2H7DA 2XQNM 4BBKA 2R09A 2KCJA 2V76A 3PVUA 3TCAA 1U2BA 4GMVA 2W2WA 2RGNB 4KHOA 2MDXA 2Z0OA 4IAPA 5D27A 3X23A 3RCPA 4P7IA 3DCXA 1DYNA 3U12A 4K2OA 2LKOA 5CLQB
chains in the Genus database with same CATH topology
2LG1A 1H10A 4F7HA 3ODXA 2PZ1A 2D9WA 2DKQA 5C16A 2OQBA 1UNRA 2QKMA 4MK0A 2COCA 2DYNA 3D8DA 3O96A 1FHWA 4ZRIA 2MKRA 1H4RA 5CLLB 1LW3A 1KZ7A 1K5GB 3TW1A 2UZSA 2UZRA 1QC6A 3PVWA 5LOPB 2DFKA 1P3RA 1XX0A 2GCLA 3SV1A 5HE2A 5FI1A 4HB4B 3IVFA 2E2XA 4HB2B 3A98B 1U5EA 2DA0A 1E5WA 2D9VA 1I7AA 4HHVA 4H8SA 3U8ZA 4CYEA 4DBBA 3HK0A 1DBHA 3FSSA 1KZGA 1X05A 2D10A 2ROVA 2IFSA 4TYZA 1N3HA 2H7EA 1BAKA 5GOWB 2M14A 1Y5OA 1MPHA 5KCVA 1MIXA 2VSZA 2KUPA 1BWNA 1X86A 4A6FB 4Z2NA 1NTYA 5DHFB 3ULCA 1ZVRA 3ODOA 1B55A 1XD4A 4MY6A 4A6FA 3G9WA 4DX90 2J0MA 2BCJA 3F5RA 1W1DA 2DYQA 2IYBA 3ULBA 2YT1A 2CY5A 4HB0B 5JLJB 2EC1A 4Z2MB 2RNRB 1GC6A 1EF1A 2I5CA 1NU2A 1OMWA 2Y7BA 2UVMA 1OQNA 1MIZB 3KRXA 2J0JA 1DDMA 1K5DB 2RLOA 3A8PA 1X11A 4MT7A 2K2JA 3KRWA 2P0HA 5J3TA 1GC7A 4B6HA 1V88A 1XR0B 3SNHA 5DHAB 4K81A 1SHCA 3M1IB 1KI1B 2RSGA 2Y8FA 2CY4A 1RRPB 3QIJA 2W2XC 3WYFB 1X1GA 3D8FA 4C0AA 1IRSA 2DHKA 3PG7A 4WSFA 1I2HA 1MK7B 1BTKA 2ELAA 3U7DA 2RUKB 4NSWA 1MK9B 4DXAB 3CIKA 3TFMA 1J0WA 2COAA 2VKIA 1MAIA 4TKNA 2YF0A 1AWEA 2DN6A 1M7EA 1AQCA 3UZTA 1NTVA 4ZRJA 1TXDA 1ZC4B 2VRWB 2DKPA 5J3YA 4K2PA 1FOEA 4HDQA 3VOQA 3AU5A 5FI0A 1U5DA 5HE0A 2MWNB 4F7UP 3V5WA 3ZDTA 4XWXA 1ZSQA 1OY2A 5KQ4A 4HAYB 1TQZA 2LOZA 2YS5A 3WA0A 4KVGB 4HAVB 5DH9B 3CXBB 2ZPYA 5D3XA 3BINA 1FGZA 5DIFB 4GZUA 2LULA 2LYDA 2L1CA 3SO6A 2JP2A 4YL8A 2HTHB 4HDOA 5C6RA 2K2UA 4Y94A 5JP4A 5JHHA 4HAXB 1W1GA 2CRFA 4CHJA 4EMOA 1DDVA 1ISNA 3PSCA 1J19A 3SYXA 1UNQA 2GS0A 3T06A 5C5BB 2DHIA 1PLSA 1V5UA 2K00A 2EMTA 2D2QA 1V5PA 5C5BA 1Q67A 2DLWA 5D3YA 1X1FA 2ROZB 5L81A 1P6SA 4KHBB 3GYOA 1ZM0A 2LOXA 3PEGA 4DX8A 1QQGA 2CODA 1MKEA 4IFSA 5D3WA 2HE7A 1XKEA 1U5FA 4GPTB 1W1HA 1PFJA 4KHAA 3HW2B 1FHXA 4EJNA 2MFQA 2Q13A 5C79A 3F0WA 1UPRA 3MPXA 2I1JA 3A8QA 3ML4A 3PVLA 2D9XA 1BTNA 2DX5A 1FAOA 2Y8GA 2I5FA 4KAXB 5DI9B 3TVVA 4L6EA 1V89A 3VIAA 2G35A 5HE1A 4IOYX 4PQ0A 4GMXB 3TO1A 2NMBA 1XODA 2D11A 3KSYA 3P7ZA 4F7GA 1WGQA 3AJ4A 2EMSA 2DTCA 4K17A 2RVBB 3DXCA 1V5MA 3ZVRA 2DX1A 3BJIA 1UNPA 2Z0PA 5D3VA 4ZRKA 5KQ1A 2DHJA 1EVHA 3PP2A 2Z0QA 1PMSA 2KGXB 1WVHA 1U29A 2YRYA 2L2IA 3FM8C 1EGXA 2I1KA 2YSZA 1LB1A 2ADZA 3P6AA 1GG3A 2COFA 2R0DA 2J0KA 1UPQA 2OTXA 3OANA 3KZ1A 2GJYA 2AL6A 2D9YA 4PNKA 4HATB 4A6HA 2N0YA 2D4QA 2ELBA 1U27A 3KY9A 1UEFA 2J59M 2P8VA 3FEHA 3QWMA 3HQCA 1FB8A 2FJLA 1ZC3B 2W2XD 2AEHA 1P5TA 4D0NB 1WG7A 2P0DA 2D9ZA 1SGHA 3MDBC 2P0FA 1M7RA 4HB3B 5HE3A 2GCJA 4WJ7A 2CAYA 1EAZA 1V61A 3DXDA 1Y19B 2N23A 2QKLA 5EFXA 2NZ8B 1XCGA 1RJ2A 2YS1A 4GXBA 2EJ8A 4A5KA 3SUZA 2YT0A 1U5GA 3ODWA 4YONA 4EKUA 5J3QA 2YVCA 3N7CA 4HAUB 1WI1A 1DDWA 1FHOA 3GYPA 3AU4A 2M38A 4HAZB 1FGYA 1WGUA 3DXEA 1DROA 4HAWB 1WJMA 4GN1A 3NSUA 3D8EA 3QBVB 4CHMA 1NI2A 5LONB 2YS3A 4NY0A 3LJUX 1Z87A 2X18A 4WVFB 1TJ6A 5JHGA 3PZDA 1WJ1A 4A6KA 2H7DA 2XQNM 4BBKA 2R09A 2KCJA 2V76A 3PVUA 3TCAA 1U2BA 4GMVA 2W2WA 2RGNB 4KHOA 2MDXA 2Z0OA 4IAPA 5D27A 3X23A 3RCPA 4P7IA 1DYNA 4K2OA 2LKOA 5CLQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LG1 A;  1H10 A;  4F7H A;  3ODX A;  2PZ1 A;  2D9W A;  2DKQ A;  5C16 A;  2OQB A;  1UNR A;  2QKM A;  4MK0 A;  2COC A;  2DYN A;  3D8D A;  3O96 A;  1FHW A;  4ZRI A;  2MKR A;  1H4R A;  5CLL B;  1LW3 A;  1KZ7 A;  1K5G B;  3TW1 A;  2UZS A;  2UZR A;  1QC6 A;  3PVW A;  5LOP B;  2DFK A;  1P3R A;  1XX0 A;  2GCL A;  3SV1 A;  5HE2 A;  5FI1 A;  4HB4 B;  3IVF A;  2E2X A;  4HB2 B;  3A98 B;  1U5E A;  2DA0 A;  1E5W A;  2D9V A;  1I7A A;  4HHV A;  4H8S A;  3U8Z A;  4CYE A;  4DBB A;  3HK0 A;  1DBH A;  3FSS A;  1KZG A;  1X05 A;  2D10 A;  2ROV A;  2IFS A;  4TYZ A;  1N3H A;  2H7E A;  1BAK A;  5GOW B;  2M14 A;  1Y5O A;  1MPH A;  5KCV A;  1MIX A;  2VSZ A;  2KUP A;  1BWN A;  1X86 A;  4A6F B;  4Z2N A;  1NTY A;  5DHF B;  3ULC A;  1ZVR A;  3ODO A;  1B55 A;  1XD4 A;  4MY6 A;  4A6F A;  3G9W A;  4DX9 0;  2J0M A;  2BCJ A;  3F5R A;  1W1D A;  2DYQ A;  2IYB A;  3ULB A;  2YT1 A;  2CY5 A;  4HB0 B;  5JLJ B;  2EC1 A;  4Z2M B;  2RNR B;  1GC6 A;  1EF1 A;  2I5C A;  1NU2 A;  1OMW A;  2Y7B A;  2UVM A;  1OQN A;  1MIZ B;  3KRX A;  2J0J A;  1DDM A;  1K5D B;  2RLO A;  3A8P A;  1X11 A;  4MT7 A;  2K2J A;  3KRW A;  2P0H A;  5J3T A;  1GC7 A;  4B6H A;  1V88 A;  1XR0 B;  3SNH A;  5DHA B;  4K81 A;  1SHC A;  3M1I B;  1KI1 B;  2RSG A;  2Y8F A;  2CY4 A;  1RRP B;  3QIJ A;  2W2X C;  3WYF B;  1X1G A;  3D8F A;  4C0A A;  1IRS A;  2DHK A;  3PG7 A;  4WSF A;  1I2H A;  1MK7 B;  1BTK A;  2ELA A;  3U7D A;  2RUK B;  4NSW A;  1MK9 B;  4DXA B;  3CIK A;  3TFM A;  1J0W A;  2COA A;  2VKI A;  1MAI A;  4TKN A;  2YF0 A;  1AWE A;  2DN6 A;  1M7E A;  1AQC A;  3UZT A;  1NTV A;  4ZRJ A;  1TXD A;  1ZC4 B;  2VRW B;  2DKP A;  5J3Y A;  4K2P A;  1FOE A;  4HDQ A;  3VOQ A;  3AU5 A;  5FI0 A;  1U5D A;  5HE0 A;  2MWN B;  4F7U P;  3V5W A;  3ZDT A;  4XWX A;  1ZSQ A;  1OY2 A;  5KQ4 A;  4HAY B;  1TQZ A;  2LOZ A;  2YS5 A;  3WA0 A;  4KVG B;  4HAV B;  5DH9 B;  3CXB B;  2ZPY A;  5D3X A;  3BIN A;  1FGZ A;  5DIF B;  4GZU A;  2LUL A;  2LYD A;  2L1C A;  3SO6 A;  2JP2 A;  4YL8 A;  2HTH B;  4HDO A;  5C6R A;  2K2U A;  4Y94 A;  5JP4 A;  5JHH A;  4HAX B;  1W1G A;  2CRF A;  4CHJ A;  4EMO A;  1DDV A;  1ISN A;  3PSC A;  1J19 A;  3SYX A;  1UNQ A;  2GS0 A;  3T06 A;  5C5B B;  2DHI A;  1PLS A;  1V5U A;  2K00 A;  2EMT A;  2D2Q A;  1V5P A;  5C5B A;  1Q67 A;  2DLW A;  5D3Y A;  1X1F A;  2ROZ B;  5L81 A;  1P6S A;  4KHB B;  3GYO A;  1ZM0 A;  2LOX A;  3PEG A;  4DX8 A;  1QQG A;  2COD A;  1MKE A;  4IFS A;  5D3W A;  2HE7 A;  1XKE A;  1U5F A;  4GPT B;  1W1H A;  1PFJ A;  4KHA A;  3HW2 B;  1FHX A;  4EJN A;  2MFQ A;  2Q13 A;  5C79 A;  3F0W A;  1UPR A;  3MPX A;  2I1J A;  3A8Q A;  3ML4 A;  3PVL A;  2D9X A;  1BTN A;  2DX5 A;  1FAO A;  2Y8G A;  2I5F A;  4KAX B;  5DI9 B;  3TVV A;  4L6E A;  1V89 A;  3VIA A;  2G35 A;  5HE1 A;  4IOY X;  4PQ0 A;  4GMX B;  3TO1 A;  2NMB A;  1XOD A;  2D11 A;  3KSY A;  3P7Z A;  4F7G A;  1WGQ A;  3AJ4 A;  2EMS A;  2DTC A;  4K17 A;  2RVB B;  3DXC A;  1V5M A;  3ZVR A;  2DX1 A;  3BJI A;  1UNP A;  2Z0P A;  5D3V A;  4ZRK A;  5KQ1 A;  2DHJ A;  1EVH A;  3PP2 A;  2Z0Q A;  1PMS A;  2KGX B;  1WVH A;  1U29 A;  2YRY A;  2L2I A;  3FM8 C;  1EGX A;  2I1K A;  2YSZ A;  1LB1 A;  2ADZ A;  3P6A A;  1GG3 A;  2COF A;  2R0D A;  2J0K A;  1UPQ A;  2OTX A;  3OAN A;  3KZ1 A;  2GJY A;  2AL6 A;  2D9Y A;  4PNK A;  4HAT B;  4A6H A;  2N0Y A;  2D4Q A;  2ELB A;  1U27 A;  3KY9 A;  1UEF A;  2J59 M;  2P8V A;  3FEH A;  3QWM A;  3HQC A;  1FB8 A;  2FJL A;  1ZC3 B;  2W2X D;  2AEH A;  1P5T A;  4D0N B;  1WG7 A;  2P0D A;  2D9Z A;  1SGH A;  3MDB C;  2P0F A;  1M7R A;  4HB3 B;  5HE3 A;  2GCJ A;  4WJ7 A;  2CAY A;  1EAZ A;  1V61 A;  3DXD A;  1Y19 B;  2N23 A;  2QKL A;  5EFX A;  2NZ8 B;  1XCG A;  1RJ2 A;  2YS1 A;  4GXB A;  2EJ8 A;  4A5K A;  3SUZ A;  2YT0 A;  1U5G A;  3ODW A;  4YON A;  4EKU A;  5J3Q A;  2YVC A;  3N7C A;  4HAU B;  1WI1 A;  1DDW A;  1FHO A;  3GYP A;  3AU4 A;  2M38 A;  4HAZ B;  1FGY A;  1WGU A;  3DXE A;  1DRO A;  4HAW B;  1WJM A;  4GN1 A;  3NSU A;  3D8E A;  3QBV B;  4CHM A;  1NI2 A;  5LON B;  2YS3 A;  4NY0 A;  3LJU X;  1Z87 A;  2X18 A;  4WVF B;  1TJ6 A;  5JHG A;  3PZD A;  1WJ1 A;  4A6K A;  2H7D A;  2XQN M;  4BBK A;  2R09 A;  2KCJ A;  2V76 A;  3PVU A;  3TCA A;  1U2B A;  4GMV A;  2W2W A;  2RGN B;  4KHO A;  2MDX A;  2Z0O A;  4IAP A;  5D27 A;  3X23 A;  3RCP A;  4P7I A;  1DYN A;  4K2O A;  2LKO A;  5CLQ B; 
#chains in the Genus database with same CATH topology
 2LG1 A;  1H10 A;  4F7H A;  3ODX A;  2PZ1 A;  2D9W A;  2DKQ A;  5C16 A;  2OQB A;  1UNR A;  2QKM A;  4MK0 A;  4QJ3 B;  2COC A;  2DYN A;  3D8D A;  3O96 A;  1FHW A;  4ZRI A;  2MKR A;  1H4R A;  5CLL B;  1LW3 A;  1KZ7 A;  1K5G B;  3TW1 A;  2UZS A;  2UZR A;  1QC6 A;  3PVW A;  5LOP B;  2DFK A;  1P3R A;  1XX0 A;  2RRF A;  3OHM B;  2GCL A;  2K49 A;  3SV1 A;  5HE2 A;  5FI1 A;  4HB4 B;  3IVF A;  2E2X A;  4HB2 B;  3A98 B;  2ZKM X;  1U5E A;  2DA0 A;  1E5W A;  2D9V A;  1I7A A;  4HHV A;  4H8S A;  3U8Z A;  4CYE A;  4DBB A;  3HK0 A;  1DBH A;  3FSS A;  1KZG A;  1X05 A;  2D10 A;  2ROV A;  2IFS A;  4TYZ A;  1N3H A;  2H7E A;  1BAK A;  5GOW B;  2M14 A;  1Y5O A;  1MPH A;  5KCV A;  1MIX A;  2Z13 A;  2VSZ A;  2KUP A;  1BWN A;  2Z59 A;  1X86 A;  4A6F B;  4Z2N A;  1NTY A;  5DHF B;  2R2Y A;  3ULC A;  1ZVR A;  3ODO A;  1B55 A;  1XD4 A;  4MY6 A;  4A6F A;  3G9W A;  4DX9 0;  2J0M A;  2BCJ A;  3F5R A;  1W1D A;  2DYQ A;  2IYB A;  3ULB A;  2YT1 A;  2CY5 A;  4HB0 B;  5JLJ B;  2EC1 A;  4Z2M B;  2RNR B;  1ZYI A;  1GC6 A;  1EF1 A;  2I5C A;  1NU2 A;  2NBV A;  1OMW A;  3B77 A;  2Y7B A;  2UVM A;  1OQN A;  1MIZ B;  3KRX A;  2J0J A;  1DDM A;  1K5D B;  2RLO A;  3A8P A;  4QXA B;  1X11 A;  3HSA A;  4MT7 A;  2K2J A;  2Z14 A;  3KRW A;  2P0H A;  5J3T A;  1GC7 A;  4B6H A;  1V88 A;  3NWF A;  1XR0 B;  3SNH A;  4CSQ A;  5DHA B;  4K81 A;  1SHC A;  3M1I B;  1KI1 B;  2RSG A;  2Y8F A;  2CY4 A;  5I2S A;  1RRP B;  3QIJ A;  2W2X C;  3WYF B;  1X1G A;  3D8F A;  4C0A A;  1IRS A;  2DHK A;  3PG7 A;  4WSF A;  1I2H A;  1MK7 B;  5LG4 B;  1BTK A;  2ELA A;  3U7D A;  2RUK B;  4NSW A;  1MK9 B;  4DXA B;  3CIK A;  3TFM A;  1J0W A;  3NWD A;  4GNK B;  2COA A;  2VKI A;  1MAI A;  4TKN A;  2YF0 A;  1AWE A;  3NWA A;  2DN6 A;  1M7E A;  1AQC A;  3UZT A;  1NTV A;  4ZRJ A;  1TXD A;  1ZC4 B;  3FVC A;  2VRW B;  2DKP A;  5J3Y A;  4K2P A;  1FOE A;  3NW8 A;  4HDQ A;  3VOQ A;  2GUM A;  3AU5 A;  5FI0 A;  1U5D A;  5HE0 A;  2MWN B;  4F7U P;  3V5W A;  3ZDT A;  4D6W A;  4XWX A;  1ZSQ A;  1OY2 A;  5KQ4 A;  4HAY B;  1TQZ A;  2LOZ A;  2YS5 A;  3WA0 A;  4KVG B;  4HAV B;  5DH9 B;  3CXB B;  2ZPY A;  5D3X A;  3BIN A;  1FGZ A;  5DIF B;  4GZU A;  2LUL A;  2LYD A;  2L1C A;  3SO6 A;  2JP2 A;  4YL8 A;  2HTH B;  4HDO A;  5C6R A;  2K2U A;  4Y94 A;  5JP4 A;  5JHH A;  4HAX B;  1W1G A;  2CRF A;  4CHJ A;  4EMO A;  1DDV A;  1ISN A;  3PSC A;  1J19 A;  3SYX A;  1UNQ A;  2GS0 A;  3T06 A;  5C5B B;  2DHI A;  4DIX A;  1PLS A;  1V5U A;  2K00 A;  2EMT A;  2D2Q A;  1V5P A;  5C5B A;  1Q67 A;  2Z4D A;  2DLW A;  5D3Y A;  1X1F A;  2ROZ B;  5L81 A;  1P6S A;  4KHB B;  3GYO A;  1ZM0 A;  2LOX A;  3PEG A;  4DX8 A;  1QQG A;  2COD A;  1MKE A;  4IFS A;  4KHB A;  5D3W A;  2HE7 A;  1XKE A;  1U5F A;  4GPT B;  1W1H A;  1PFJ A;  1T77 A;  4KHA A;  3HW2 B;  1FHX A;  4EJN A;  2MFQ A;  2Q13 A;  4QJ5 B;  5C79 A;  3F0W A;  1UPR A;  3MPX A;  2I1J A;  3A8Q A;  3ML4 A;  3PVL A;  2D9X A;  1BTN A;  2DX5 A;  1FAO A;  2Y8G A;  2I5F A;  4KAX B;  5DI9 B;  3TVV A;  4L6E A;  1V89 A;  3VIA A;  2G35 A;  5HE1 A;  4IOY X;  4PQ0 A;  4GMX B;  3TO1 A;  2NMB A;  1XOD A;  1MI1 A;  2D11 A;  3KSY A;  3P7Z A;  4F7G A;  1WGQ A;  3AJ4 A;  2EMS A;  2DTC A;  4K17 A;  2RVB B;  3DXC A;  1V5M A;  2KIE A;  3ZVR A;  2DX1 A;  3BJI A;  1UNP A;  2Z0P A;  5D3V A;  4ZRK A;  5KQ1 A;  2DHJ A;  1EVH A;  3A58 A;  3PP2 A;  2Z0Q A;  1PMS A;  2KGX B;  1WVH A;  1U29 A;  2YRY A;  2L2I A;  3FM8 C;  1EGX A;  2I1K A;  2KIG A;  2YSZ A;  1LB1 A;  2ADZ A;  3P6A A;  4L1R A;  1GG3 A;  2COF A;  2R0D A;  2J0K A;  2YT2 A;  1UPQ A;  2OTX A;  3OAN A;  3KZ1 A;  2GJY A;  2AL6 A;  2KR0 A;  2D9Y A;  4GOU A;  4PNK A;  4HAT B;  4QJ4 B;  4A6H A;  2N0Y A;  2D4Q A;  2ELB A;  1U27 A;  3KY9 A;  1UEF A;  2J59 M;  2P8V A;  3FEH A;  3QWM A;  3HQC A;  1FB8 A;  2FJL A;  3HIE A;  1ZC3 B;  2W2X D;  2AEH A;  1P5T A;  4D0N B;  1WG7 A;  2P0D A;  2D9Z A;  1SGH A;  3MDB C;  2P0F A;  1M7R A;  4HB3 B;  5HE3 A;  2GCJ A;  4WJ7 A;  5IRS A;  2CAY A;  1EAZ A;  1V61 A;  3DXD A;  1Y19 B;  2N23 A;  2QKL A;  5EFX A;  2NZ8 B;  1XCG A;  1RJ2 A;  2YS1 A;  4GXB A;  2EJ8 A;  4A5K A;  3SUZ A;  2YT0 A;  2FJU B;  1U5G A;  3ODW A;  4YON A;  4EKU A;  5J3Q A;  4OT1 A;  2KUQ A;  2YVC A;  3N7C A;  4HAU B;  1WI1 A;  1DDW A;  1FHO A;  3GYP A;  3AU4 A;  2M38 A;  4HAZ B;  1FGY A;  1WGU A;  3DXE A;  1DRO A;  4HAW B;  1WJM A;  4HSI A;  4OSN A;  4GN1 A;  3NSU A;  3D8E A;  3QBV B;  4CHM A;  1NI2 A;  5LON B;  2YS3 A;  5I2M A;  4NY0 A;  3LJU X;  1Z87 A;  2X18 A;  4WVF B;  1TJ6 A;  5M4Y B;  5JHG A;  2K8E A;  3PZD A;  1WJ1 A;  4A6K A;  2H7D A;  2XQN M;  4BBK A;  2R09 A;  2KCJ A;  2V76 A;  3PVU A;  3TCA A;  1U2B A;  4GMV A;  2W2W A;  2RGN B;  4KHO A;  2MDX A;  2Z0O A;  4IAP A;  5D27 A;  3X23 A;  3RCP A;  4P7I A;  3DCX A;  1DYN A;  3U12 A;  4K2O A;  2LKO A;  5CLQ B; 
#chains in the Genus database with same CATH homology
 2LG1 A;  1H10 A;  4F7H A;  3ODX A;  2PZ1 A;  2D9W A;  2DKQ A;  5C16 A;  2OQB A;  1UNR A;  2QKM A;  4MK0 A;  2COC A;  2DYN A;  3D8D A;  3O96 A;  1FHW A;  4ZRI A;  2MKR A;  1H4R A;  5CLL B;  1LW3 A;  1KZ7 A;  1K5G B;  3TW1 A;  2UZS A;  2UZR A;  1QC6 A;  3PVW A;  5LOP B;  2DFK A;  1P3R A;  1XX0 A;  2GCL A;  3SV1 A;  5HE2 A;  5FI1 A;  4HB4 B;  3IVF A;  2E2X A;  4HB2 B;  3A98 B;  1U5E A;  2DA0 A;  1E5W A;  2D9V A;  1I7A A;  4HHV A;  4H8S A;  3U8Z A;  4CYE A;  4DBB A;  3HK0 A;  1DBH A;  3FSS A;  1KZG A;  1X05 A;  2D10 A;  2ROV A;  2IFS A;  4TYZ A;  1N3H A;  2H7E A;  1BAK A;  5GOW B;  2M14 A;  1Y5O A;  1MPH A;  5KCV A;  1MIX A;  2VSZ A;  2KUP A;  1BWN A;  1X86 A;  4A6F B;  4Z2N A;  1NTY A;  5DHF B;  3ULC A;  1ZVR A;  3ODO A;  1B55 A;  1XD4 A;  4MY6 A;  4A6F A;  3G9W A;  4DX9 0;  2J0M A;  2BCJ A;  3F5R A;  1W1D A;  2DYQ A;  2IYB A;  3ULB A;  2YT1 A;  2CY5 A;  4HB0 B;  5JLJ B;  2EC1 A;  4Z2M B;  2RNR B;  1GC6 A;  1EF1 A;  2I5C A;  1NU2 A;  1OMW A;  2Y7B A;  2UVM A;  1OQN A;  1MIZ B;  3KRX A;  2J0J A;  1DDM A;  1K5D B;  2RLO A;  3A8P A;  1X11 A;  4MT7 A;  2K2J A;  3KRW A;  2P0H A;  5J3T A;  1GC7 A;  4B6H A;  1V88 A;  1XR0 B;  3SNH A;  5DHA B;  4K81 A;  1SHC A;  3M1I B;  1KI1 B;  2RSG A;  2Y8F A;  2CY4 A;  1RRP B;  3QIJ A;  2W2X C;  3WYF B;  1X1G A;  3D8F A;  4C0A A;  1IRS A;  2DHK A;  3PG7 A;  4WSF A;  1I2H A;  1MK7 B;  1BTK A;  2ELA A;  3U7D A;  2RUK B;  4NSW A;  1MK9 B;  4DXA B;  3CIK A;  3TFM A;  1J0W A;  2COA A;  2VKI A;  1MAI A;  4TKN A;  2YF0 A;  1AWE A;  2DN6 A;  1M7E A;  1AQC A;  3UZT A;  1NTV A;  4ZRJ A;  1TXD A;  1ZC4 B;  2VRW B;  2DKP A;  5J3Y A;  4K2P A;  1FOE A;  4HDQ A;  3VOQ A;  3AU5 A;  5FI0 A;  1U5D A;  5HE0 A;  2MWN B;  4F7U P;  3V5W A;  3ZDT A;  4XWX A;  1ZSQ A;  1OY2 A;  5KQ4 A;  4HAY B;  1TQZ A;  2LOZ A;  2YS5 A;  3WA0 A;  4KVG B;  4HAV B;  5DH9 B;  3CXB B;  2ZPY A;  5D3X A;  3BIN A;  1FGZ A;  5DIF B;  4GZU A;  2LUL A;  2LYD A;  2L1C A;  3SO6 A;  2JP2 A;  4YL8 A;  2HTH B;  4HDO A;  5C6R A;  2K2U A;  4Y94 A;  5JP4 A;  5JHH A;  4HAX B;  1W1G A;  2CRF A;  4CHJ A;  4EMO A;  1DDV A;  1ISN A;  3PSC A;  1J19 A;  3SYX A;  1UNQ A;  2GS0 A;  3T06 A;  5C5B B;  2DHI A;  1PLS A;  1V5U A;  2K00 A;  2EMT A;  2D2Q A;  1V5P A;  5C5B A;  1Q67 A;  2DLW A;  5D3Y A;  1X1F A;  2ROZ B;  5L81 A;  1P6S A;  4KHB B;  3GYO A;  1ZM0 A;  2LOX A;  3PEG A;  4DX8 A;  1QQG A;  2COD A;  1MKE A;  4IFS A;  5D3W A;  2HE7 A;  1XKE A;  1U5F A;  4GPT B;  1W1H A;  1PFJ A;  4KHA A;  3HW2 B;  1FHX A;  4EJN A;  2MFQ A;  2Q13 A;  5C79 A;  3F0W A;  1UPR A;  3MPX A;  2I1J A;  3A8Q A;  3ML4 A;  3PVL A;  2D9X A;  1BTN A;  2DX5 A;  1FAO A;  2Y8G A;  2I5F A;  4KAX B;  5DI9 B;  3TVV A;  4L6E A;  1V89 A;  3VIA A;  2G35 A;  5HE1 A;  4IOY X;  4PQ0 A;  4GMX B;  3TO1 A;  2NMB A;  1XOD A;  2D11 A;  3KSY A;  3P7Z A;  4F7G A;  1WGQ A;  3AJ4 A;  2EMS A;  2DTC A;  4K17 A;  2RVB B;  3DXC A;  1V5M A;  3ZVR A;  2DX1 A;  3BJI A;  1UNP A;  2Z0P A;  5D3V A;  4ZRK A;  5KQ1 A;  2DHJ A;  1EVH A;  3PP2 A;  2Z0Q A;  1PMS A;  2KGX B;  1WVH A;  1U29 A;  2YRY A;  2L2I A;  3FM8 C;  1EGX A;  2I1K A;  2YSZ A;  1LB1 A;  2ADZ A;  3P6A A;  1GG3 A;  2COF A;  2R0D A;  2J0K A;  1UPQ A;  2OTX A;  3OAN A;  3KZ1 A;  2GJY A;  2AL6 A;  2D9Y A;  4PNK A;  4HAT B;  4A6H A;  2N0Y A;  2D4Q A;  2ELB A;  1U27 A;  3KY9 A;  1UEF A;  2J59 M;  2P8V A;  3FEH A;  3QWM A;  3HQC A;  1FB8 A;  2FJL A;  1ZC3 B;  2W2X D;  2AEH A;  1P5T A;  4D0N B;  1WG7 A;  2P0D A;  2D9Z A;  1SGH A;  3MDB C;  2P0F A;  1M7R A;  4HB3 B;  5HE3 A;  2GCJ A;  4WJ7 A;  2CAY A;  1EAZ A;  1V61 A;  3DXD A;  1Y19 B;  2N23 A;  2QKL A;  5EFX A;  2NZ8 B;  1XCG A;  1RJ2 A;  2YS1 A;  4GXB A;  2EJ8 A;  4A5K A;  3SUZ A;  2YT0 A;  1U5G A;  3ODW A;  4YON A;  4EKU A;  5J3Q A;  2YVC A;  3N7C A;  4HAU B;  1WI1 A;  1DDW A;  1FHO A;  3GYP A;  3AU4 A;  2M38 A;  4HAZ B;  1FGY A;  1WGU A;  3DXE A;  1DRO A;  4HAW B;  1WJM A;  4GN1 A;  3NSU A;  3D8E A;  3QBV B;  4CHM A;  1NI2 A;  5LON B;  2YS3 A;  4NY0 A;  3LJU X;  1Z87 A;  2X18 A;  4WVF B;  1TJ6 A;  5JHG A;  3PZD A;  1WJ1 A;  4A6K A;  2H7D A;  2XQN M;  4BBK A;  2R09 A;  2KCJ A;  2V76 A;  3PVU A;  3TCA A;  1U2B A;  4GMV A;  2W2W A;  2RGN B;  4KHO A;  2MDX A;  2Z0O A;  4IAP A;  5D27 A;  3X23 A;  3RCP A;  4P7I A;  1DYN A;  4K2O A;  2LKO A;  5CLQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...