1IRSA

Irs-1 ptb domain complexed with a il-4 receptor phosphopeptide, nmr, minimized average structure
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
112
structure length
112
Chain Sequence
MGPAFKEVWQVILKPKGLGQTKNLIGIYRLCLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGEFWMQVDDSVVAQNMHETILEAMRAMSDEFRPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for IL-4 receptor phosphopeptide recognition by the IRS-1 PTB domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (signal transduction/peptide)
molecule keywords IRS-1
total genus 17
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 1996-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02174 IRS PTB domain (IRS-1 type)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1irsA00
3KRXA 1UPRA 1P5TA 4IOYX 1NTVA 2R0DA 4YL8A 5JP4A 1W1GA 2EMSA 4ZRIA 2UZSA 4GPTB 2YS3A 2D4QA 3PG7A 2ROVA 1ZC4B 5DI9B 3KSYA 1SGHA 3DXDA 4A6FB 2M38A 2DHJA 2VSZA 3GYOA 4NSWA 2VKIA 1KI1B 4NY0A 5DHAB 3LJUX 5KQ1A 3P6AA 5C16A 3ZVRA 1QC6A 1PMSA 4MT7A 2GJYA 1N3HA 1X05A 3U8ZA 1X11A 4K17A 3NSUA 2E2XA 1AWEA 2DYNA 1MK9B 5LOPB 1X86A 2DX1A 2NZ8B 2NMBA 4HDOA 2J0JA 5D27A 2I5FA 3RCPA 4C0AA 1I2HA 2X18A 2EJ8A 4D0NB 2P8VA 1U27A 2OTXA 1WJMA 3SUZA 1BAKA 2H7EA 1Y5OA 1H4RA 2V76A 5C5BA 2RVBB 3N7CA 3PVWA 3TCAA 2LYDA 4HAXB 1UNPA 2K2UA 2DKQA 4BBKA 1E5WA 3G9WA 1OMWA 2Y8FA 2VRWB 4EJNA 2YT0A 1FOEA 2YS5A 2I1KA 5EFXA 3VOQA 4DX8A 2Y8GA 3UZTA 1XX0A 2FJLA 3TW1A 2GS0A 4F7GA 1V5PA 3FEHA 5DHFB 5J3YA 3TFMA 1KZGA 5KCVA 4EKUA 3PEGA 1ZVRA 3HW2B 5FI1A 3BJIA 5HE0A 1U5EA 2DA0A 3QIJA 1UEFA 1DYNA 3P7ZA 4HAUB 1DDWA 2P0DA 1U2BA 3F5RA 2HE7A 1DDMA 3MPXA 1M7RA 1NI2A 4K81A 3KRWA 4CHJA 2DFKA 1I7AA 3QBVB 1TXDA 1V88A 3AU4A 4WJ7A 5HE2A 4A6FA 2ADZA 1FAOA 1DBHA 2HTHB 2L1CA 1U5DA 3T06A 4PNKA 3BINA 4ZRKA 4ZRJA 1UNQA 3ML4A 2BCJA 2ELBA 2Q13A 3FSSA 2GCLA 2LOZA 5DIFB 3KZ1A 1LB1A 2XQNM 3OANA 4GXBA 1V61A 1ZC3B 4KHOA 4H8SA 1ISNA 3O96A 2DTCA 2KCJA 2W2XD 3AJ4A 2Z0OA 3D8DA 1EF1A 2IFSA 1Q67A 1TJ6A 3V5WA 3D8FA 2I1JA 1GG3A 1RRPB 2N23A 2CAYA 2QKLA 1WI1A 4PQ0A 1M7EA 4HAYB 2D2QA 3SV1A 3GYPA 1V5MA 2R09A 2DKPA 2LKOA 3ULBA 2YF0A 3D8EA 3M1IB 2DHKA 1EGXA 1WGQA 1XR0B 2KGXB 3HQCA 4HB0B 1J0WA 1WGUA 4F7HA 5J3TA 2QKMA 2J0KA 5HE1A 3PSCA 4HAZB 4WSFA 1Z87A 1MIZB 2RSGA 3PVUA 2EC1A 2D11A 3CIKA 4HB3B 5CLLB 2D9ZA 2DX5A 4GMVA 3A98B 2M14A 2ZPYA 4EMOA 4P7IA 2Z0QA 4KHAA 1MK7B 2I5CA 2YRYA 2GCJA 2RNRB 3X23A 5D3XA 1ZSQA 1B55A 2P0FA 4HAWB 5HE3A 4IFSA 2DLWA 2AEHA 2ELAA 1WJ1A 3ZDTA 2N0YA 1BWNA 1MIXA 4YONA 5D3WA 1FGZA 2D10A 1RJ2A 2YSZA 3SNHA 2Y7BA 3PP2A 1FHOA 5J3QA 2IYBA 5C5BB 1SHCA 5JLJB 1NTYA 4XWXA 5GOWB 3DXCA 2MDXA 2CY4A 1MKEA 1TQZA 2LG1A 2D9WA 4B6HA 5DH9B 4L6EA 4A6KA 5LONB 1DDVA 5CLQB 2KUPA 3VIAA 3U7DA 4F7UP 1J19A 1AQCA 2P0HA 5JHGA 2UZRA 4K2PA 1LW3A 2D9YA 3ODOA 1XODA 2COFA 2D9XA 1K5GB 1H10A 4A5KA 1K5DB 3FM8C 4GMXB 2LULA 2DYQA 2COCA 2J0MA 4HDQA 1NU2A 1X1FA 3SYXA 5L81A 1Y19B 1P3RA 1V5UA 4MY6A 4Z2MB 4KAXB 3ODWA 1W1HA 2ROZB 2K2JA 2DN6A 2MWNB 1UPQA 3QWMA 2K00A 1UNRA 3F0WA 2D9VA 2CODA 1GC7A 2CRFA 1GC6A 1U29A 2OQBA 2AL6A 3IVFA 5D3YA 4TKNA 2JP2A 4DXAB 2RUKB 5FI0A 1MAIA 1ZM0A 4DBBA 2W2XC 4KVGB 1FB8A 3PVLA 1QQGA 5JHHA 2Z0PA 4TYZA 2RGNB 3TO1A 2EMTA 1XCGA 3TVVA 1P6SA 3HK0A 1PFJA 5KQ4A 2PZ1A 4IAPA 2LOXA 1X1GA 4Y94A 1XKEA 2H7DA 1IRSA 3MDBC 4HATB 3ODXA 3KY9A 1U5GA 3ULCA 4GN1A 4HB4B 4Z2NA 4HAVB 3PZDA 5C79A 1EAZA 2CY5A 3WA0A 2G35A 2COAA 4K2OA 5C6RA 4GZUA 1OQNA 2J59M 2RLOA 1KZ7A 1FGYA 3A8PA 3DXEA 1V89A 2UVMA 1BTNA 1BTKA 3AU5A 2YT1A 4HB2B 4MK0A 4CYEA 1XD4A 1MPHA 4WVFB 1WG7A 4DX90 2DHIA 1PLSA 3CXBB 3SO6A 4KHBB 1WVHA 1FHWA 1OY2A 1FHXA 5D3VA 3A8QA 1U5FA 1W1DA 2L2IA 2MFQA 4A6HA 2MKRA 3WYFB 4HHVA 1EVHA 2YVCA 2W2WA 1DROA 4CHMA 2YS1A
chains in the Genus database with same CATH superfamily
3KRXA 1UPRA 1P5TA 4IOYX 1NTVA 2R0DA 4YL8A 5JP4A 1W1GA 2EMSA 4ZRIA 2UZSA 4GPTB 2YS3A 2D4QA 3PG7A 2ROVA 2FJUB 1ZC4B 5DI9B 3KSYA 1SGHA 3DXDA 5I2SA 4A6FB 2M38A 2DHJA 2VSZA 3GYOA 4NSWA 2VKIA 1KI1B 4NY0A 5DHAB 3HSAA 3LJUX 5KQ1A 3P6AA 5C16A 3ZVRA 1QC6A 1PMSA 4MT7A 2GJYA 1N3HA 1X05A 3U8ZA 1X11A 4K17A 3NSUA 2E2XA 1AWEA 2DYNA 1MK9B 5LOPB 1X86A 2Z13A 2DX1A 2NZ8B 2NMBA 4HDOA 2J0JA 5D27A 2I5FA 3RCPA 4C0AA 1I2HA 2X18A 2EJ8A 4D0NB 2P8VA 1U27A 2OTXA 2Z14A 1WJMA 3SUZA 1BAKA 2H7EA 1Y5OA 1H4RA 2V76A 3OHMB 5C5BA 2RVBB 3N7CA 3PVWA 3TCAA 2LYDA 4HAXB 1UNPA 2K2UA 2DKQA 4BBKA 1E5WA 3G9WA 1OMWA 2Y8FA 2VRWB 4EJNA 2YT0A 1FOEA 4QJ4B 2YS5A 2I1KA 2RRFA 5EFXA 3VOQA 4DX8A 2Y8GA 3UZTA 1XX0A 2FJLA 3TW1A 2GS0A 4F7GA 1V5PA 3FEHA 5DHFB 5J3YA 3TFMA 1KZGA 5KCVA 4EKUA 3PEGA 1ZVRA 3HW2B 5FI1A 3BJIA 5HE0A 1U5EA 2DA0A 3QIJA 3NWFA 1UEFA 1DYNA 5LG4B 4QJ3B 2KR0A 3P7ZA 4HAUB 1DDWA 2P0DA 1U2BA 3F5RA 2HE7A 1DDMA 3MPXA 1M7RA 4OSNA 1NI2A 4K81A 3KRWA 4CHJA 2DFKA 2K8EA 1I7AA 3QBVB 1TXDA 1V88A 3AU4A 4WJ7A 5HE2A 4A6FA 2ADZA 1FAOA 1DBHA 2HTHB 2KUQA 2L1CA 3NWDA 1U5DA 3T06A 4PNKA 3BINA 4ZRKA 4ZRJA 4GNKB 1UNQA 3ML4A 2BCJA 2ELBA 2Q13A 3FSSA 2YT2A 2GCLA 2LOZA 5DIFB 3KZ1A 4D6WA 1LB1A 2XQNM 4QJ5B 3OANA 4GXBA 3HIEA 1V61A 1ZC3B 4KHOA 4H8SA 1ISNA 3O96A 2DTCA 2KCJA 2W2XD 3AJ4A 2Z0OA 3D8DA 1EF1A 2IFSA 4DIXA 2NBVA 3FVCA 1Q67A 1TJ6A 3V5WA 3D8FA 2I1JA 1GG3A 1RRPB 2N23A 2CAYA 2KIEA 2QKLA 1WI1A 4PQ0A 1M7EA 4HAYB 2D2QA 3SV1A 3GYPA 1V5MA 2R09A 2DKPA 2LKOA 3ULBA 2YF0A 3D8EA 3M1IB 2DHKA 1EGXA 1WGQA 1XR0B 2KGXB 3HQCA 3DCXA 1J0WA 1WGUA 4HB0B 4F7HA 5J3TA 2QKMA 2J0KA 5HE1A 3PSCA 4HAZB 4WSFA 1Z87A 1MIZB 2RSGA 3PVUA 2EC1A 2D11A 3CIKA 4HB3B 5CLLB 2D9ZA 2DX5A 4GMVA 3A98B 2M14A 2ZPYA 4CSQA 3NW8A 2GUMA 4EMOA 4P7IA 2Z0QA 4KHAA 1MK7B 2I5CA 2YRYA 2GCJA 2RNRB 3X23A 5D3XA 1ZSQA 1B55A 2P0FA 4HAWB 5HE3A 5IRSA 4IFSA 2DLWA 2ZKMX 2AEHA 2ELAA 1WJ1A 3ZDTA 2N0YA 1BWNA 1MIXA 4YONA 5D3WA 1FGZA 2D10A 1RJ2A 2YSZA 3SNHA 2Y7BA 3PP2A 1FHOA 5J3QA 2IYBA 5C5BB 1SHCA 5JLJB 2R2YA 1NTYA 4XWXA 5GOWB 3DXCA 2MDXA 2CY4A 1MKEA 1TQZA 2LG1A 2D9WA 4B6HA 5DH9B 4L6EA 4KHBA 4A6KA 5LONB 1DDVA 5CLQB 2KUPA 3VIAA 3U7DA 4F7UP 1J19A 1AQCA 2P0HA 5JHGA 2UZRA 4K2PA 1LW3A 2D9YA 3ODOA 1XODA 2COFA 2D9XA 1K5GB 1H10A 4OT1A 4A5KA 1K5DB 3FM8C 4GMXB 2LULA 2DYQA 2COCA 2J0MA 4HDQA 1NU2A 1X1FA 3SYXA 5L81A 1Y19B 1P3RA 1V5UA 4MY6A 4Z2MB 4KAXB 3ODWA 1W1HA 2ROZB 2K2JA 2DN6A 4GOUA 4HSIA 3B77A 2MWNB 1UPQA 3QWMA 2Z59A 2K00A 1UNRA 1ZYIA 3F0WA 2D9VA 2CODA 1GC7A 2CRFA 1GC6A 1U29A 2OQBA 2AL6A 3IVFA 5D3YA 2KIGA 4TKNA 5M4YB 2JP2A 4DXAB 2RUKB 5FI0A 1MAIA 1ZM0A 4DBBA 4QXAB 2W2XC 4KVGB 1FB8A 3PVLA 3U12A 1QQGA 5JHHA 2Z0PA 4TYZA 2RGNB 3TO1A 2EMTA 1XCGA 3TVVA 1P6SA 3HK0A 1PFJA 5KQ4A 2PZ1A 4IAPA 2LOXA 1X1GA 4Y94A 1XKEA 2H7DA 1IRSA 3MDBC 4HATB 3ODXA 3KY9A 1U5GA 3ULCA 4GN1A 4HB4B 4L1RA 4Z2NA 4HAVB 3PZDA 5C79A 1EAZA 2CY5A 3A58A 1MI1A 5I2MA 3WA0A 2G35A 2COAA 1T77A 4K2OA 5C6RA 4GZUA 1OQNA 2J59M 2RLOA 1KZ7A 1FGYA 3A8PA 3DXEA 1V89A 2UVMA 1BTNA 1BTKA 3AU5A 2YT1A 4HB2B 2K49A 4MK0A 4CYEA 1XD4A 1MPHA 4WVFB 1WG7A 4DX90 2DHIA 1PLSA 3CXBB 3SO6A 4KHBB 1WVHA 1FHWA 1OY2A 1FHXA 5D3VA 3A8QA 1U5FA 1W1DA 2L2IA 2MFQA 4A6HA 2MKRA 3WYFB 4HHVA 1EVHA 2YVCA 2W2WA 1DROA 2Z4DA 4CHMA 3NWAA 2YS1A
chains in the Genus database with same CATH topology
3KRXA 1UPRA 1P5TA 4IOYX 1NTVA 2R0DA 4YL8A 5JP4A 1W1GA 2EMSA 4ZRIA 2UZSA 4GPTB 2YS3A 2D4QA 3PG7A 2ROVA 1ZC4B 5DI9B 3KSYA 1SGHA 3DXDA 4A6FB 2M38A 2DHJA 2VSZA 3GYOA 4NSWA 2VKIA 1KI1B 4NY0A 5DHAB 3LJUX 5KQ1A 3P6AA 5C16A 3ZVRA 1QC6A 1PMSA 4MT7A 2GJYA 1N3HA 1X05A 3U8ZA 1X11A 4K17A 3NSUA 2E2XA 1AWEA 2DYNA 1MK9B 5LOPB 1X86A 2DX1A 2NZ8B 2NMBA 4HDOA 2J0JA 5D27A 2I5FA 3RCPA 4C0AA 1I2HA 2X18A 2EJ8A 4D0NB 2P8VA 1U27A 2OTXA 1WJMA 3SUZA 1BAKA 2H7EA 1Y5OA 1H4RA 2V76A 5C5BA 2RVBB 3N7CA 3PVWA 3TCAA 2LYDA 4HAXB 1UNPA 2K2UA 2DKQA 4BBKA 1E5WA 3G9WA 1OMWA 2Y8FA 2VRWB 4EJNA 2YT0A 1FOEA 2YS5A 2I1KA 5EFXA 3VOQA 4DX8A 2Y8GA 3UZTA 1XX0A 2FJLA 3TW1A 2GS0A 4F7GA 1V5PA 3FEHA 5DHFB 5J3YA 3TFMA 1KZGA 5KCVA 4EKUA 3PEGA 1ZVRA 3HW2B 5FI1A 3BJIA 5HE0A 1U5EA 2DA0A 3QIJA 1UEFA 1DYNA 3P7ZA 4HAUB 1DDWA 2P0DA 1U2BA 3F5RA 2HE7A 1DDMA 3MPXA 1M7RA 1NI2A 4K81A 3KRWA 4CHJA 2DFKA 1I7AA 3QBVB 1TXDA 1V88A 3AU4A 4WJ7A 5HE2A 4A6FA 2ADZA 1FAOA 1DBHA 2HTHB 2L1CA 1U5DA 3T06A 4PNKA 3BINA 4ZRKA 4ZRJA 1UNQA 3ML4A 2BCJA 2ELBA 2Q13A 3FSSA 2GCLA 2LOZA 5DIFB 3KZ1A 1LB1A 2XQNM 3OANA 4GXBA 1V61A 1ZC3B 4KHOA 4H8SA 1ISNA 3O96A 2DTCA 2KCJA 2W2XD 3AJ4A 2Z0OA 3D8DA 1EF1A 2IFSA 1Q67A 1TJ6A 3V5WA 3D8FA 2I1JA 1GG3A 1RRPB 2N23A 2CAYA 2QKLA 1WI1A 4PQ0A 1M7EA 4HAYB 2D2QA 3SV1A 3GYPA 1V5MA 2R09A 2DKPA 2LKOA 3ULBA 2YF0A 3D8EA 3M1IB 2DHKA 1EGXA 1WGQA 1XR0B 2KGXB 3HQCA 4HB0B 1J0WA 1WGUA 4F7HA 5J3TA 2QKMA 2J0KA 5HE1A 3PSCA 4HAZB 4WSFA 1Z87A 1MIZB 2RSGA 3PVUA 2EC1A 2D11A 3CIKA 4HB3B 5CLLB 2D9ZA 2DX5A 4GMVA 3A98B 2M14A 2ZPYA 4EMOA 4P7IA 2Z0QA 4KHAA 1MK7B 2I5CA 2YRYA 2GCJA 2RNRB 3X23A 5D3XA 1ZSQA 1B55A 2P0FA 4HAWB 5HE3A 4IFSA 2DLWA 2AEHA 2ELAA 1WJ1A 3ZDTA 2N0YA 1BWNA 1MIXA 4YONA 5D3WA 1FGZA 2D10A 1RJ2A 2YSZA 3SNHA 2Y7BA 3PP2A 1FHOA 5J3QA 2IYBA 5C5BB 1SHCA 5JLJB 1NTYA 4XWXA 5GOWB 3DXCA 2MDXA 2CY4A 1MKEA 1TQZA 2LG1A 2D9WA 4B6HA 5DH9B 4L6EA 4A6KA 5LONB 1DDVA 5CLQB 2KUPA 3VIAA 3U7DA 4F7UP 1J19A 1AQCA 2P0HA 5JHGA 2UZRA 4K2PA 1LW3A 2D9YA 3ODOA 1XODA 2COFA 2D9XA 1K5GB 1H10A 4A5KA 1K5DB 3FM8C 4GMXB 2LULA 2DYQA 2COCA 2J0MA 4HDQA 1NU2A 1X1FA 3SYXA 5L81A 1Y19B 1P3RA 1V5UA 4MY6A 4Z2MB 4KAXB 3ODWA 1W1HA 2ROZB 2K2JA 2DN6A 2MWNB 1UPQA 3QWMA 2K00A 1UNRA 3F0WA 2D9VA 2CODA 1GC7A 2CRFA 1GC6A 1U29A 2OQBA 2AL6A 3IVFA 5D3YA 4TKNA 2JP2A 4DXAB 2RUKB 5FI0A 1MAIA 1ZM0A 4DBBA 2W2XC 4KVGB 1FB8A 3PVLA 1QQGA 5JHHA 2Z0PA 4TYZA 2RGNB 3TO1A 2EMTA 1XCGA 3TVVA 1P6SA 3HK0A 1PFJA 5KQ4A 2PZ1A 4IAPA 2LOXA 1X1GA 4Y94A 1XKEA 2H7DA 1IRSA 3MDBC 4HATB 3ODXA 3KY9A 1U5GA 3ULCA 4GN1A 4HB4B 4Z2NA 4HAVB 3PZDA 5C79A 1EAZA 2CY5A 3WA0A 2G35A 2COAA 4K2OA 5C6RA 4GZUA 1OQNA 2J59M 2RLOA 1KZ7A 1FGYA 3A8PA 3DXEA 1V89A 2UVMA 1BTNA 1BTKA 3AU5A 2YT1A 4HB2B 4MK0A 4CYEA 1XD4A 1MPHA 4WVFB 1WG7A 4DX90 2DHIA 1PLSA 3CXBB 3SO6A 4KHBB 1WVHA 1FHWA 1OY2A 1FHXA 5D3VA 3A8QA 1U5FA 1W1DA 2L2IA 2MFQA 4A6HA 2MKRA 3WYFB 4HHVA 1EVHA 2YVCA 2W2WA 1DROA 4CHMA 2YS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KRX A;  1UPR A;  1P5T A;  4IOY X;  1NTV A;  2R0D A;  4YL8 A;  5JP4 A;  1W1G A;  2EMS A;  4ZRI A;  2UZS A;  4GPT B;  2YS3 A;  2D4Q A;  3PG7 A;  2ROV A;  1ZC4 B;  5DI9 B;  3KSY A;  1SGH A;  3DXD A;  4A6F B;  2M38 A;  2DHJ A;  2VSZ A;  3GYO A;  4NSW A;  2VKI A;  1KI1 B;  4NY0 A;  5DHA B;  3LJU X;  5KQ1 A;  3P6A A;  5C16 A;  3ZVR A;  1QC6 A;  1PMS A;  4MT7 A;  2GJY A;  1N3H A;  1X05 A;  3U8Z A;  1X11 A;  4K17 A;  3NSU A;  2E2X A;  1AWE A;  2DYN A;  1MK9 B;  5LOP B;  1X86 A;  2DX1 A;  2NZ8 B;  2NMB A;  4HDO A;  2J0J A;  5D27 A;  2I5F A;  3RCP A;  4C0A A;  1I2H A;  2X18 A;  2EJ8 A;  4D0N B;  2P8V A;  1U27 A;  2OTX A;  1WJM A;  3SUZ A;  1BAK A;  2H7E A;  1Y5O A;  1H4R A;  2V76 A;  5C5B A;  2RVB B;  3N7C A;  3PVW A;  3TCA A;  2LYD A;  4HAX B;  1UNP A;  2K2U A;  2DKQ A;  4BBK A;  1E5W A;  3G9W A;  1OMW A;  2Y8F A;  2VRW B;  4EJN A;  2YT0 A;  1FOE A;  2YS5 A;  2I1K A;  5EFX A;  3VOQ A;  4DX8 A;  2Y8G A;  3UZT A;  1XX0 A;  2FJL A;  3TW1 A;  2GS0 A;  4F7G A;  1V5P A;  3FEH A;  5DHF B;  5J3Y A;  3TFM A;  1KZG A;  5KCV A;  4EKU A;  3PEG A;  1ZVR A;  3HW2 B;  5FI1 A;  3BJI A;  5HE0 A;  1U5E A;  2DA0 A;  3QIJ A;  1UEF A;  1DYN A;  3P7Z A;  4HAU B;  1DDW A;  2P0D A;  1U2B A;  3F5R A;  2HE7 A;  1DDM A;  3MPX A;  1M7R A;  1NI2 A;  4K81 A;  3KRW A;  4CHJ A;  2DFK A;  1I7A A;  3QBV B;  1TXD A;  1V88 A;  3AU4 A;  4WJ7 A;  5HE2 A;  4A6F A;  2ADZ A;  1FAO A;  1DBH A;  2HTH B;  2L1C A;  1U5D A;  3T06 A;  4PNK A;  3BIN A;  4ZRK A;  4ZRJ A;  1UNQ A;  3ML4 A;  2BCJ A;  2ELB A;  2Q13 A;  3FSS A;  2GCL A;  2LOZ A;  5DIF B;  3KZ1 A;  1LB1 A;  2XQN M;  3OAN A;  4GXB A;  1V61 A;  1ZC3 B;  4KHO A;  4H8S A;  1ISN A;  3O96 A;  2DTC A;  2KCJ A;  2W2X D;  3AJ4 A;  2Z0O A;  3D8D A;  1EF1 A;  2IFS A;  1Q67 A;  1TJ6 A;  3V5W A;  3D8F A;  2I1J A;  1GG3 A;  1RRP B;  2N23 A;  2CAY A;  2QKL A;  1WI1 A;  4PQ0 A;  1M7E A;  4HAY B;  2D2Q A;  3SV1 A;  3GYP A;  1V5M A;  2R09 A;  2DKP A;  2LKO A;  3ULB A;  2YF0 A;  3D8E A;  3M1I B;  2DHK A;  1EGX A;  1WGQ A;  1XR0 B;  2KGX B;  3HQC A;  4HB0 B;  1J0W A;  1WGU A;  4F7H A;  5J3T A;  2QKM A;  2J0K A;  5HE1 A;  3PSC A;  4HAZ B;  4WSF A;  1Z87 A;  1MIZ B;  2RSG A;  3PVU A;  2EC1 A;  2D11 A;  3CIK A;  4HB3 B;  5CLL B;  2D9Z A;  2DX5 A;  4GMV A;  3A98 B;  2M14 A;  2ZPY A;  4EMO A;  4P7I A;  2Z0Q A;  4KHA A;  1MK7 B;  2I5C A;  2YRY A;  2GCJ A;  2RNR B;  3X23 A;  5D3X A;  1ZSQ A;  1B55 A;  2P0F A;  4HAW B;  5HE3 A;  4IFS A;  2DLW A;  2AEH A;  2ELA A;  1WJ1 A;  3ZDT A;  2N0Y A;  1BWN A;  1MIX A;  4YON A;  5D3W A;  1FGZ A;  2D10 A;  1RJ2 A;  2YSZ A;  3SNH A;  2Y7B A;  3PP2 A;  1FHO A;  5J3Q A;  2IYB A;  5C5B B;  1SHC A;  5JLJ B;  1NTY A;  4XWX A;  5GOW B;  3DXC A;  2MDX A;  2CY4 A;  1MKE A;  1TQZ A;  2LG1 A;  2D9W A;  4B6H A;  5DH9 B;  4L6E A;  4A6K A;  5LON B;  1DDV A;  5CLQ B;  2KUP A;  3VIA A;  3U7D A;  4F7U P;  1J19 A;  1AQC A;  2P0H A;  5JHG A;  2UZR A;  4K2P A;  1LW3 A;  2D9Y A;  3ODO A;  1XOD A;  2COF A;  2D9X A;  1K5G B;  1H10 A;  4A5K A;  1K5D B;  3FM8 C;  4GMX B;  2LUL A;  2DYQ A;  2COC A;  2J0M A;  4HDQ A;  1NU2 A;  1X1F A;  3SYX A;  5L81 A;  1Y19 B;  1P3R A;  1V5U A;  4MY6 A;  4Z2M B;  4KAX B;  3ODW A;  1W1H A;  2ROZ B;  2K2J A;  2DN6 A;  2MWN B;  1UPQ A;  3QWM A;  2K00 A;  1UNR A;  3F0W A;  2D9V A;  2COD A;  1GC7 A;  2CRF A;  1GC6 A;  1U29 A;  2OQB A;  2AL6 A;  3IVF A;  5D3Y A;  4TKN A;  2JP2 A;  4DXA B;  2RUK B;  5FI0 A;  1MAI A;  1ZM0 A;  4DBB A;  2W2X C;  4KVG B;  1FB8 A;  3PVL A;  1QQG A;  5JHH A;  2Z0P A;  4TYZ A;  2RGN B;  3TO1 A;  2EMT A;  1XCG A;  3TVV A;  1P6S A;  3HK0 A;  1PFJ A;  5KQ4 A;  2PZ1 A;  4IAP A;  2LOX A;  1X1G A;  4Y94 A;  1XKE A;  2H7D A;  1IRS A;  3MDB C;  4HAT B;  3ODX A;  3KY9 A;  1U5G A;  3ULC A;  4GN1 A;  4HB4 B;  4Z2N A;  4HAV B;  3PZD A;  5C79 A;  1EAZ A;  2CY5 A;  3WA0 A;  2G35 A;  2COA A;  4K2O A;  5C6R A;  4GZU A;  1OQN A;  2J59 M;  2RLO A;  1KZ7 A;  1FGY A;  3A8P A;  3DXE A;  1V89 A;  2UVM A;  1BTN A;  1BTK A;  3AU5 A;  2YT1 A;  4HB2 B;  4MK0 A;  4CYE A;  1XD4 A;  1MPH A;  4WVF B;  1WG7 A;  4DX9 0;  2DHI A;  1PLS A;  3CXB B;  3SO6 A;  4KHB B;  1WVH A;  1FHW A;  1OY2 A;  1FHX A;  5D3V A;  3A8Q A;  1U5F A;  1W1D A;  2L2I A;  2MFQ A;  4A6H A;  2MKR A;  3WYF B;  4HHV A;  1EVH A;  2YVC A;  2W2W A;  1DRO A;  4CHM A;  2YS1 A; 
#chains in the Genus database with same CATH topology
 3KRX A;  1UPR A;  1P5T A;  4IOY X;  1NTV A;  2R0D A;  4YL8 A;  5JP4 A;  1W1G A;  2EMS A;  4ZRI A;  2UZS A;  4GPT B;  2YS3 A;  2D4Q A;  3PG7 A;  2ROV A;  2FJU B;  1ZC4 B;  5DI9 B;  3KSY A;  1SGH A;  3DXD A;  5I2S A;  4A6F B;  2M38 A;  2DHJ A;  2VSZ A;  3GYO A;  4NSW A;  2VKI A;  1KI1 B;  4NY0 A;  5DHA B;  3HSA A;  3LJU X;  5KQ1 A;  3P6A A;  5C16 A;  3ZVR A;  1QC6 A;  1PMS A;  4MT7 A;  2GJY A;  1N3H A;  1X05 A;  3U8Z A;  1X11 A;  4K17 A;  3NSU A;  2E2X A;  1AWE A;  2DYN A;  1MK9 B;  5LOP B;  1X86 A;  2Z13 A;  2DX1 A;  2NZ8 B;  2NMB A;  4HDO A;  2J0J A;  5D27 A;  2I5F A;  3RCP A;  4C0A A;  1I2H A;  2X18 A;  2EJ8 A;  4D0N B;  2P8V A;  1U27 A;  2OTX A;  2Z14 A;  1WJM A;  3SUZ A;  1BAK A;  2H7E A;  1Y5O A;  1H4R A;  2V76 A;  3OHM B;  5C5B A;  2RVB B;  3N7C A;  3PVW A;  3TCA A;  2LYD A;  4HAX B;  1UNP A;  2K2U A;  2DKQ A;  4BBK A;  1E5W A;  3G9W A;  1OMW A;  2Y8F A;  2VRW B;  4EJN A;  2YT0 A;  1FOE A;  4QJ4 B;  2YS5 A;  2I1K A;  2RRF A;  5EFX A;  3VOQ A;  4DX8 A;  2Y8G A;  3UZT A;  1XX0 A;  2FJL A;  3TW1 A;  2GS0 A;  4F7G A;  1V5P A;  3FEH A;  5DHF B;  5J3Y A;  3TFM A;  1KZG A;  5KCV A;  4EKU A;  3PEG A;  1ZVR A;  3HW2 B;  5FI1 A;  3BJI A;  5HE0 A;  1U5E A;  2DA0 A;  3QIJ A;  3NWF A;  1UEF A;  1DYN A;  5LG4 B;  4QJ3 B;  2KR0 A;  3P7Z A;  4HAU B;  1DDW A;  2P0D A;  1U2B A;  3F5R A;  2HE7 A;  1DDM A;  3MPX A;  1M7R A;  4OSN A;  1NI2 A;  4K81 A;  3KRW A;  4CHJ A;  2DFK A;  2K8E A;  1I7A A;  3QBV B;  1TXD A;  1V88 A;  3AU4 A;  4WJ7 A;  5HE2 A;  4A6F A;  2ADZ A;  1FAO A;  1DBH A;  2HTH B;  2KUQ A;  2L1C A;  3NWD A;  1U5D A;  3T06 A;  4PNK A;  3BIN A;  4ZRK A;  4ZRJ A;  4GNK B;  1UNQ A;  3ML4 A;  2BCJ A;  2ELB A;  2Q13 A;  3FSS A;  2YT2 A;  2GCL A;  2LOZ A;  5DIF B;  3KZ1 A;  4D6W A;  1LB1 A;  2XQN M;  4QJ5 B;  3OAN A;  4GXB A;  3HIE A;  1V61 A;  1ZC3 B;  4KHO A;  4H8S A;  1ISN A;  3O96 A;  2DTC A;  2KCJ A;  2W2X D;  3AJ4 A;  2Z0O A;  3D8D A;  1EF1 A;  2IFS A;  4DIX A;  2NBV A;  3FVC A;  1Q67 A;  1TJ6 A;  3V5W A;  3D8F A;  2I1J A;  1GG3 A;  1RRP B;  2N23 A;  2CAY A;  2KIE A;  2QKL A;  1WI1 A;  4PQ0 A;  1M7E A;  4HAY B;  2D2Q A;  3SV1 A;  3GYP A;  1V5M A;  2R09 A;  2DKP A;  2LKO A;  3ULB A;  2YF0 A;  3D8E A;  3M1I B;  2DHK A;  1EGX A;  1WGQ A;  1XR0 B;  2KGX B;  3HQC A;  3DCX A;  1J0W A;  1WGU A;  4HB0 B;  4F7H A;  5J3T A;  2QKM A;  2J0K A;  5HE1 A;  3PSC A;  4HAZ B;  4WSF A;  1Z87 A;  1MIZ B;  2RSG A;  3PVU A;  2EC1 A;  2D11 A;  3CIK A;  4HB3 B;  5CLL B;  2D9Z A;  2DX5 A;  4GMV A;  3A98 B;  2M14 A;  2ZPY A;  4CSQ A;  3NW8 A;  2GUM A;  4EMO A;  4P7I A;  2Z0Q A;  4KHA A;  1MK7 B;  2I5C A;  2YRY A;  2GCJ A;  2RNR B;  3X23 A;  5D3X A;  1ZSQ A;  1B55 A;  2P0F A;  4HAW B;  5HE3 A;  5IRS A;  4IFS A;  2DLW A;  2ZKM X;  2AEH A;  2ELA A;  1WJ1 A;  3ZDT A;  2N0Y A;  1BWN A;  1MIX A;  4YON A;  5D3W A;  1FGZ A;  2D10 A;  1RJ2 A;  2YSZ A;  3SNH A;  2Y7B A;  3PP2 A;  1FHO A;  5J3Q A;  2IYB A;  5C5B B;  1SHC A;  5JLJ B;  2R2Y A;  1NTY A;  4XWX A;  5GOW B;  3DXC A;  2MDX A;  2CY4 A;  1MKE A;  1TQZ A;  2LG1 A;  2D9W A;  4B6H A;  5DH9 B;  4L6E A;  4KHB A;  4A6K A;  5LON B;  1DDV A;  5CLQ B;  2KUP A;  3VIA A;  3U7D A;  4F7U P;  1J19 A;  1AQC A;  2P0H A;  5JHG A;  2UZR A;  4K2P A;  1LW3 A;  2D9Y A;  3ODO A;  1XOD A;  2COF A;  2D9X A;  1K5G B;  1H10 A;  4OT1 A;  4A5K A;  1K5D B;  3FM8 C;  4GMX B;  2LUL A;  2DYQ A;  2COC A;  2J0M A;  4HDQ A;  1NU2 A;  1X1F A;  3SYX A;  5L81 A;  1Y19 B;  1P3R A;  1V5U A;  4MY6 A;  4Z2M B;  4KAX B;  3ODW A;  1W1H A;  2ROZ B;  2K2J A;  2DN6 A;  4GOU A;  4HSI A;  3B77 A;  2MWN B;  1UPQ A;  3QWM A;  2Z59 A;  2K00 A;  1UNR A;  1ZYI A;  3F0W A;  2D9V A;  2COD A;  1GC7 A;  2CRF A;  1GC6 A;  1U29 A;  2OQB A;  2AL6 A;  3IVF A;  5D3Y A;  2KIG A;  4TKN A;  5M4Y B;  2JP2 A;  4DXA B;  2RUK B;  5FI0 A;  1MAI A;  1ZM0 A;  4DBB A;  4QXA B;  2W2X C;  4KVG B;  1FB8 A;  3PVL A;  3U12 A;  1QQG A;  5JHH A;  2Z0P A;  4TYZ A;  2RGN B;  3TO1 A;  2EMT A;  1XCG A;  3TVV A;  1P6S A;  3HK0 A;  1PFJ A;  5KQ4 A;  2PZ1 A;  4IAP A;  2LOX A;  1X1G A;  4Y94 A;  1XKE A;  2H7D A;  1IRS A;  3MDB C;  4HAT B;  3ODX A;  3KY9 A;  1U5G A;  3ULC A;  4GN1 A;  4HB4 B;  4L1R A;  4Z2N A;  4HAV B;  3PZD A;  5C79 A;  1EAZ A;  2CY5 A;  3A58 A;  1MI1 A;  5I2M A;  3WA0 A;  2G35 A;  2COA A;  1T77 A;  4K2O A;  5C6R A;  4GZU A;  1OQN A;  2J59 M;  2RLO A;  1KZ7 A;  1FGY A;  3A8P A;  3DXE A;  1V89 A;  2UVM A;  1BTN A;  1BTK A;  3AU5 A;  2YT1 A;  4HB2 B;  2K49 A;  4MK0 A;  4CYE A;  1XD4 A;  1MPH A;  4WVF B;  1WG7 A;  4DX9 0;  2DHI A;  1PLS A;  3CXB B;  3SO6 A;  4KHB B;  1WVH A;  1FHW A;  1OY2 A;  1FHX A;  5D3V A;  3A8Q A;  1U5F A;  1W1D A;  2L2I A;  2MFQ A;  4A6H A;  2MKR A;  3WYF B;  4HHV A;  1EVH A;  2YVC A;  2W2W A;  1DRO A;  2Z4D A;  4CHM A;  3NWA A;  2YS1 A; 
#chains in the Genus database with same CATH homology
 3KRX A;  1UPR A;  1P5T A;  4IOY X;  1NTV A;  2R0D A;  4YL8 A;  5JP4 A;  1W1G A;  2EMS A;  4ZRI A;  2UZS A;  4GPT B;  2YS3 A;  2D4Q A;  3PG7 A;  2ROV A;  1ZC4 B;  5DI9 B;  3KSY A;  1SGH A;  3DXD A;  4A6F B;  2M38 A;  2DHJ A;  2VSZ A;  3GYO A;  4NSW A;  2VKI A;  1KI1 B;  4NY0 A;  5DHA B;  3LJU X;  5KQ1 A;  3P6A A;  5C16 A;  3ZVR A;  1QC6 A;  1PMS A;  4MT7 A;  2GJY A;  1N3H A;  1X05 A;  3U8Z A;  1X11 A;  4K17 A;  3NSU A;  2E2X A;  1AWE A;  2DYN A;  1MK9 B;  5LOP B;  1X86 A;  2DX1 A;  2NZ8 B;  2NMB A;  4HDO A;  2J0J A;  5D27 A;  2I5F A;  3RCP A;  4C0A A;  1I2H A;  2X18 A;  2EJ8 A;  4D0N B;  2P8V A;  1U27 A;  2OTX A;  1WJM A;  3SUZ A;  1BAK A;  2H7E A;  1Y5O A;  1H4R A;  2V76 A;  5C5B A;  2RVB B;  3N7C A;  3PVW A;  3TCA A;  2LYD A;  4HAX B;  1UNP A;  2K2U A;  2DKQ A;  4BBK A;  1E5W A;  3G9W A;  1OMW A;  2Y8F A;  2VRW B;  4EJN A;  2YT0 A;  1FOE A;  2YS5 A;  2I1K A;  5EFX A;  3VOQ A;  4DX8 A;  2Y8G A;  3UZT A;  1XX0 A;  2FJL A;  3TW1 A;  2GS0 A;  4F7G A;  1V5P A;  3FEH A;  5DHF B;  5J3Y A;  3TFM A;  1KZG A;  5KCV A;  4EKU A;  3PEG A;  1ZVR A;  3HW2 B;  5FI1 A;  3BJI A;  5HE0 A;  1U5E A;  2DA0 A;  3QIJ A;  1UEF A;  1DYN A;  3P7Z A;  4HAU B;  1DDW A;  2P0D A;  1U2B A;  3F5R A;  2HE7 A;  1DDM A;  3MPX A;  1M7R A;  1NI2 A;  4K81 A;  3KRW A;  4CHJ A;  2DFK A;  1I7A A;  3QBV B;  1TXD A;  1V88 A;  3AU4 A;  4WJ7 A;  5HE2 A;  4A6F A;  2ADZ A;  1FAO A;  1DBH A;  2HTH B;  2L1C A;  1U5D A;  3T06 A;  4PNK A;  3BIN A;  4ZRK A;  4ZRJ A;  1UNQ A;  3ML4 A;  2BCJ A;  2ELB A;  2Q13 A;  3FSS A;  2GCL A;  2LOZ A;  5DIF B;  3KZ1 A;  1LB1 A;  2XQN M;  3OAN A;  4GXB A;  1V61 A;  1ZC3 B;  4KHO A;  4H8S A;  1ISN A;  3O96 A;  2DTC A;  2KCJ A;  2W2X D;  3AJ4 A;  2Z0O A;  3D8D A;  1EF1 A;  2IFS A;  1Q67 A;  1TJ6 A;  3V5W A;  3D8F A;  2I1J A;  1GG3 A;  1RRP B;  2N23 A;  2CAY A;  2QKL A;  1WI1 A;  4PQ0 A;  1M7E A;  4HAY B;  2D2Q A;  3SV1 A;  3GYP A;  1V5M A;  2R09 A;  2DKP A;  2LKO A;  3ULB A;  2YF0 A;  3D8E A;  3M1I B;  2DHK A;  1EGX A;  1WGQ A;  1XR0 B;  2KGX B;  3HQC A;  4HB0 B;  1J0W A;  1WGU A;  4F7H A;  5J3T A;  2QKM A;  2J0K A;  5HE1 A;  3PSC A;  4HAZ B;  4WSF A;  1Z87 A;  1MIZ B;  2RSG A;  3PVU A;  2EC1 A;  2D11 A;  3CIK A;  4HB3 B;  5CLL B;  2D9Z A;  2DX5 A;  4GMV A;  3A98 B;  2M14 A;  2ZPY A;  4EMO A;  4P7I A;  2Z0Q A;  4KHA A;  1MK7 B;  2I5C A;  2YRY A;  2GCJ A;  2RNR B;  3X23 A;  5D3X A;  1ZSQ A;  1B55 A;  2P0F A;  4HAW B;  5HE3 A;  4IFS A;  2DLW A;  2AEH A;  2ELA A;  1WJ1 A;  3ZDT A;  2N0Y A;  1BWN A;  1MIX A;  4YON A;  5D3W A;  1FGZ A;  2D10 A;  1RJ2 A;  2YSZ A;  3SNH A;  2Y7B A;  3PP2 A;  1FHO A;  5J3Q A;  2IYB A;  5C5B B;  1SHC A;  5JLJ B;  1NTY A;  4XWX A;  5GOW B;  3DXC A;  2MDX A;  2CY4 A;  1MKE A;  1TQZ A;  2LG1 A;  2D9W A;  4B6H A;  5DH9 B;  4L6E A;  4A6K A;  5LON B;  1DDV A;  5CLQ B;  2KUP A;  3VIA A;  3U7D A;  4F7U P;  1J19 A;  1AQC A;  2P0H A;  5JHG A;  2UZR A;  4K2P A;  1LW3 A;  2D9Y A;  3ODO A;  1XOD A;  2COF A;  2D9X A;  1K5G B;  1H10 A;  4A5K A;  1K5D B;  3FM8 C;  4GMX B;  2LUL A;  2DYQ A;  2COC A;  2J0M A;  4HDQ A;  1NU2 A;  1X1F A;  3SYX A;  5L81 A;  1Y19 B;  1P3R A;  1V5U A;  4MY6 A;  4Z2M B;  4KAX B;  3ODW A;  1W1H A;  2ROZ B;  2K2J A;  2DN6 A;  2MWN B;  1UPQ A;  3QWM A;  2K00 A;  1UNR A;  3F0W A;  2D9V A;  2COD A;  1GC7 A;  2CRF A;  1GC6 A;  1U29 A;  2OQB A;  2AL6 A;  3IVF A;  5D3Y A;  4TKN A;  2JP2 A;  4DXA B;  2RUK B;  5FI0 A;  1MAI A;  1ZM0 A;  4DBB A;  2W2X C;  4KVG B;  1FB8 A;  3PVL A;  1QQG A;  5JHH A;  2Z0P A;  4TYZ A;  2RGN B;  3TO1 A;  2EMT A;  1XCG A;  3TVV A;  1P6S A;  3HK0 A;  1PFJ A;  5KQ4 A;  2PZ1 A;  4IAP A;  2LOX A;  1X1G A;  4Y94 A;  1XKE A;  2H7D A;  1IRS A;  3MDB C;  4HAT B;  3ODX A;  3KY9 A;  1U5G A;  3ULC A;  4GN1 A;  4HB4 B;  4Z2N A;  4HAV B;  3PZD A;  5C79 A;  1EAZ A;  2CY5 A;  3WA0 A;  2G35 A;  2COA A;  4K2O A;  5C6R A;  4GZU A;  1OQN A;  2J59 M;  2RLO A;  1KZ7 A;  1FGY A;  3A8P A;  3DXE A;  1V89 A;  2UVM A;  1BTN A;  1BTK A;  3AU5 A;  2YT1 A;  4HB2 B;  4MK0 A;  4CYE A;  1XD4 A;  1MPH A;  4WVF B;  1WG7 A;  4DX9 0;  2DHI A;  1PLS A;  3CXB B;  3SO6 A;  4KHB B;  1WVH A;  1FHW A;  1OY2 A;  1FHX A;  5D3V A;  3A8Q A;  1U5F A;  1W1D A;  2L2I A;  2MFQ A;  4A6H A;  2MKR A;  3WYF B;  4HHV A;  1EVH A;  2YVC A;  2W2W A;  1DRO A;  4CHM A;  2YS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...