1IRSA

Irs-1 ptb domain complexed with a il-4 receptor phosphopeptide, nmr, minimized average structure
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
112
structure length
112
Chain Sequence
MGPAFKEVWQVILKPKGLGQTKNLIGIYRLCLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGEFWMQVDDSVVAQNMHETILEAMRAMSDEFRPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords IRS-1
publication title Structural basis for IL-4 receptor phosphopeptide recognition by the IRS-1 PTB domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (signal transduction/peptide)
total genus 17
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 1996-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02174 IRS PTB domain (IRS-1 type)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1irsA00
4HDQA 4MY6A 1P6SA 3VOQA 4YONA 2VRWB 2D9ZA 1Y5OA 1I2HA 4K17A 3SYXA 1LW3A 5J3QA 3ZDTA 3GYPA 1WVHA 2Y8FA 4Z2MB 1X05A 2YT1A 2M38A 1GG3A 2RNRB 1W1DA 1K5DB 1FHOA 2DX5A 3CXBB 1X1FA 2IYBA 5HE0A 1TQZA 4A6FA 1WGQA 5D3VA 3F5RA 1ZC4B 4EMOA 3MPXA 2ROZB 4HDOA 2Y8GA 5HE3A 2L2IA 1XR0B 1DDMA 2N0YA 3N7CA 4IOYX 4YL8A 1EAZA 1Y19B 2J0MA 1XODA 1M7RA 1V88A 3TFMA 3KZ1A 1OY2A 1B55A 2J59M 3P7ZA 1WJ1A 3IVFA 1J0WA 1FB8A 1U5FA 4GXBA 2EMTA 2KCJA 5HE1A 3ULBA 2YS1A 3KY9A 1QC6A 4HAVB 1EF1A 1XKEA 2EJ8A 3SNHA 2NZ8B 2YS5A 2MDXA 3WYFB 3AJ4A 3BJIA 2P0FA 2L1CA 3BINA 5JHHA 2YVCA 2CAYA 3PVWA 3PZDA 1M7EA 3P6AA 2BCJA 3PP2A 1MK7B 2I5CA 3WA0A 1UNPA 2KUPA 2LKOA 1V5PA 3O96A 1AQCA 1FHWA 2P0DA 1TJ6A 1E5WA 1PMSA 3A8PA 2J0KA 1UEFA 1V5MA 2UZSA 2E2XA 2IFSA 5EFXA 4DX8A 4D0NB 3SUZA 1NU2A 3ODXA 1V61A 2D9WA 3HW2B 3DXDA 4GPTB 3G9WA 2JP2A 1W1HA 3M1IB 1FOEA 1W1GA 4K81A 1LB1A 5D3YA 1H4RA 4HAWB 4ZRIA 2XQNM 5D3WA 2LYDA 4DXAB 2YS3A 2I1JA 3TW1A 5KQ1A 1RJ2A 1MKEA 1X1GA 3HQCA 4CYEA 4PNKA 5CLQB 2W2XC 2CRFA 2X18A 1XX0A 4KHAA 4MK0A 2RLOA 3HK0A 2UVMA 5DIFB 2RSGA 1J19A 5LOPB 2ADZA 3QBVB 3VIAA 2MWNB 2DHJA 5J3YA 5L81A 1AWEA 3U8ZA 2H7DA 3PG7A 2ROVA 1MPHA 2VSZA 2RGNB 2DYNA 4CHJA 1MK9B 2R09A 2KGXB 2RUKB 1V89A 4GMVA 3ODWA 2DX1A 2D9YA 4A5KA 3DXEA 2Q13A 3LJUX 5DH9B 2DYQA 4KHOA 1X11A 1ISNA 4KAXB 5LONB 1BAKA 1BWNA 2ELBA 2DTCA 5C16A 2YSZA 2I1KA 5CLLB 4KVGB 2AEHA 1NI2A 2FJLA 5D3XA 1KI1B 2YF0A 2K2UA 1MAIA 4K2PA 3ML4A 1XCGA 4B6HA 1FGZA 2LOZA 1WGUA 3F0WA 2G35A 3SO6A 4EJNA 1U27A 2D11A 4TKNA 3AU4A 3CIKA 1DBHA 4K2OA 4Y94A 3D8FA 2UZRA 2D4QA 2D2QA 3KSYA 1BTNA 1Q67A 3V5WA 4F7UP 5C5BB 2D10A 4HAZB 2PZ1A 2V76A 5HE2A 5J3TA 2COAA 1NTVA 1PLSA 5KCVA 3PSCA 1DDVA 1ZM0A 4C0AA 5C6RA 3QIJA 1DYNA 1V5UA 4ZRJA 2YT0A 4Z2NA 3DXCA 1QQGA 2CODA 2P8VA 4HAYB 2LULA 3MDBC 1P5TA 2GS0A 1WG7A 4KHBB 2QKLA 1NTYA 4HATB 4HB4B 4NY0A 5C5BA 5JP4A 1EGXA 5DHFB 2P0HA 3QWMA 4A6FB 1UNQA 5JLJB 2N23A 3D8EA 4IAPA 2Z0OA 1IRSA 2Z0QA 3PVLA 4HB0B 1MIXA 2CY4A 3U7DA 2HTHB 2MFQA 1WJMA 4P7IA 5FI0A 3D8DA 2OTXA 3FM8C 4PQ0A 1BTKA 1K5GB 2QKMA 4GN1A 2ELAA 1H10A 1ZSQA 4A6HA 3PEGA 5D27A 3KRWA 4EKUA 2K00A 1KZ7A 1WI1A 1MIZB 1U5EA 1N3HA 2GCLA 4GZUA 4IFSA 4H8SA 1Z87A 3KRXA 1DDWA 4F7HA 2J0JA 2OQBA 3ODOA 1X86A 2R0DA 2DHKA 1EVHA 1I7AA 4CHMA 1OQNA 2NMBA 1TXDA 2COFA 4BBKA 3A8QA 4DX90 2Y7BA 2M14A 2COCA 2D9VA 4HAXB 5GOWB 4GMXB 2CY5A 4WVFB 1OMWA 3UZTA 2W2XD 5FI1A 1PFJA 4HB2B 5DHAB 1U5GA 1SHCA 2ZPYA 5DI9B 2LOXA 1UPRA 3T06A 1KZGA 2MKRA 3ZVRA 1P3RA 2LG1A 4DBBA 4HB3B 1RRPB 2DHIA 1SGHA 2DKQA 3TO1A 3OANA 4HHVA 2K2JA 4L6EA 1U2BA 3TVVA 2Z0PA 4WSFA 3X23A 2AL6A 2DFKA 1ZVRA 2D9XA 5C79A 1FGYA 3TCAA 2RVBB 2YRYA 3GYOA 1U5DA 2W2WA 3AU5A 2GCJA 4MT7A 1DROA 1FAOA 4NSWA 3A98B 3FSSA 2DKPA 3RCPA 2DLWA 5JHGA 1UPQA 2EC1A 2HE7A 3FEHA 2GJYA 2H7EA 2DN6A 1ZC3B 3NSUA 4HAUB 4A6KA 4TYZA 3SV1A 1GC7A 1GC6A 2VKIA 2DA0A 1U29A 1XD4A 4XWXA 1UNRA 4ZRKA 2I5FA 3ULCA 2EMSA 5KQ4A 4WJ7A 4F7GA 1FHXA 3PVUA
chains in the Genus database with same CATH superfamily
4HDQA 4MY6A 1P6SA 3VOQA 4YONA 2VRWB 2D9ZA 1Y5OA 4HSIA 1I2HA 4K17A 3SYXA 1LW3A 5J3QA 4KHBA 3ZDTA 3GYPA 1WVHA 2Y8FA 4Z2MB 1X05A 2YT1A 2M38A 1GG3A 2RNRB 1W1DA 1K5DB 1FHOA 2DX5A 3CXBB 1X1FA 2ZKMX 2IYBA 5HE0A 1TQZA 4A6FA 1WGQA 4CSQA 5D3VA 3F5RA 1ZC4B 4EMOA 3MPXA 2ROZB 4HDOA 2Y8GA 5HE3A 2L2IA 1XR0B 1DDMA 2N0YA 3N7CA 4IOYX 4YL8A 1EAZA 1Y19B 2J0MA 1XODA 4OT1A 1M7RA 1V88A 4GOUA 3TFMA 2FJUB 3KZ1A 1OY2A 1B55A 2J59M 3P7ZA 1WJ1A 3IVFA 1J0WA 1FB8A 1U5FA 5IRSA 4GXBA 2EMTA 2KCJA 5HE1A 5LG4B 3ULBA 2YS1A 3KY9A 1QC6A 4HAVB 1EF1A 1XKEA 2EJ8A 3SNHA 2NZ8B 2YS5A 2MDXA 3WYFB 3AJ4A 3BJIA 3HIEA 2P0FA 2L1CA 3BINA 5I2MA 4QJ3B 5JHHA 2YVCA 2CAYA 3PVWA 3PZDA 1M7EA 3P6AA 2BCJA 3PP2A 1MK7B 2I5CA 3WA0A 1UNPA 2KUPA 2LKOA 1V5PA 3O96A 1AQCA 1FHWA 2RRFA 2P0DA 3HSAA 1TJ6A 1E5WA 1PMSA 3A8PA 2J0KA 1UEFA 1V5MA 2UZSA 2E2XA 2YT2A 3NWDA 2IFSA 3FVCA 5EFXA 4DX8A 4D0NB 3SUZA 1NU2A 3ODXA 1V61A 2D9WA 3HW2B 2Z13A 3DXDA 4GPTB 3G9WA 2JP2A 1W1HA 3M1IB 1FOEA 1W1GA 4K81A 1LB1A 5D3YA 1H4RA 4HAWB 4ZRIA 2XQNM 5D3WA 2LYDA 4DXAB 2YS3A 2I1JA 3TW1A 5KQ1A 1RJ2A 1MKEA 1X1GA 3HQCA 4CYEA 4PNKA 5CLQB 2W2XC 2CRFA 2X18A 3U12A 1XX0A 4KHAA 4MK0A 2RLOA 3HK0A 2Z14A 2UVMA 5DIFB 2RSGA 1J19A 5LOPB 2ADZA 3QBVB 2Z59A 3VIAA 2MWNB 2DHJA 5J3YA 5L81A 1AWEA 3U8ZA 2H7DA 3PG7A 4QXAB 2ROVA 1MPHA 1ZYIA 2VSZA 2RGNB 2DYNA 4CHJA 1MK9B 2R09A 2KGXB 2RUKB 1V89A 4GMVA 3ODWA 2DX1A 2D9YA 4A5KA 3DXEA 2Q13A 2Z4DA 3LJUX 5DH9B 2DYQA 4KHOA 2GUMA 1X11A 1ISNA 4KAXB 5LONB 1BAKA 1BWNA 2ELBA 2DTCA 5C16A 2YSZA 2I1KA 5CLLB 4KVGB 2AEHA 1NI2A 2FJLA 5D3XA 1KI1B 2YF0A 4L1RA 2K2UA 1MAIA 4K2PA 3ML4A 1XCGA 4B6HA 1FGZA 2LOZA 1WGUA 3F0WA 2G35A 3SO6A 4EJNA 1U27A 2D11A 4TKNA 3AU4A 3CIKA 1DBHA 4K2OA 5I2SA 2KIGA 4Y94A 3D8FA 2UZRA 3NWFA 2D4QA 3NW8A 2D2QA 3KSYA 2NBVA 3A58A 1BTNA 1Q67A 3V5WA 4F7UP 4GNKB 5C5BB 2D10A 4HAZB 2PZ1A 2V76A 5HE2A 5J3TA 2COAA 1NTVA 1PLSA 5KCVA 3PSCA 1DDVA 1ZM0A 4C0AA 5C6RA 3QIJA 1DYNA 1V5UA 4ZRJA 2YT0A 4Z2NA 3DXCA 2KR0A 1QQGA 4QJ4B 2CODA 2P8VA 4HAYB 2LULA 3MDBC 1T77A 3OHMB 1P5TA 2GS0A 2K49A 1WG7A 4KHBB 2QKLA 1NTYA 4HATB 4HB4B 4NY0A 5C5BA 5JP4A 1EGXA 5DHFB 2P0HA 3QWMA 4A6FB 1UNQA 5JLJB 2N23A 3D8EA 4IAPA 2Z0OA 1IRSA 2Z0QA 3PVLA 4HB0B 1MIXA 2CY4A 3DCXA 3U7DA 2HTHB 2MFQA 1WJMA 4P7IA 5FI0A 3D8DA 2OTXA 3FM8C 4PQ0A 1BTKA 1K5GB 2QKMA 4GN1A 2ELAA 2KIEA 1H10A 1ZSQA 4A6HA 3PEGA 5D27A 3KRWA 4EKUA 2K00A 1KZ7A 1WI1A 1MIZB 1U5EA 1N3HA 2GCLA 4GZUA 4IFSA 4H8SA 1Z87A 3KRXA 1DDWA 4F7HA 2J0JA 3NWAA 2OQBA 3ODOA 1X86A 2R0DA 2DHKA 1EVHA 1I7AA 4CHMA 1OQNA 2NMBA 4DIXA 1TXDA 2COFA 4BBKA 3A8QA 4DX90 2Y7BA 2M14A 1MI1A 2COCA 2D9VA 4HAXB 5GOWB 4GMXB 2CY5A 2KUQA 4WVFB 1OMWA 3UZTA 2W2XD 5FI1A 1PFJA 4HB2B 5DHAB 1U5GA 1SHCA 2ZPYA 5DI9B 2LOXA 2R2YA 4D6WA 1UPRA 3T06A 1KZGA 2MKRA 3ZVRA 1P3RA 2LG1A 4DBBA 4HB3B 1RRPB 2DHIA 1SGHA 2DKQA 3TO1A 4QJ5B 3OANA 4HHVA 2K2JA 4L6EA 1U2BA 3TVVA 2Z0PA 4WSFA 3X23A 2AL6A 2DFKA 1ZVRA 2D9XA 5C79A 1FGYA 3TCAA 2RVBB 2YRYA 3GYOA 1U5DA 2W2WA 3AU5A 2GCJA 4MT7A 1DROA 1FAOA 2K8EA 4NSWA 5M4YB 3A98B 3FSSA 2DKPA 3RCPA 2DLWA 5JHGA 1UPQA 2EC1A 2HE7A 3FEHA 2GJYA 2H7EA 2DN6A 1ZC3B 3NSUA 4HAUB 4A6KA 4TYZA 3B77A 3SV1A 1GC7A 4OSNA 1GC6A 2VKIA 2DA0A 1U29A 1XD4A 4XWXA 1UNRA 4ZRKA 2I5FA 3ULCA 2EMSA 5KQ4A 4WJ7A 4F7GA 1FHXA 3PVUA
chains in the Genus database with same CATH topology
4HDQA 4MY6A 1P6SA 3VOQA 4YONA 2VRWB 2D9ZA 1Y5OA 1I2HA 4K17A 3SYXA 1LW3A 5J3QA 3ZDTA 3GYPA 1WVHA 2Y8FA 4Z2MB 1X05A 2YT1A 2M38A 1GG3A 2RNRB 1W1DA 1K5DB 1FHOA 2DX5A 3CXBB 1X1FA 2IYBA 5HE0A 1TQZA 4A6FA 1WGQA 5D3VA 3F5RA 1ZC4B 4EMOA 3MPXA 2ROZB 4HDOA 2Y8GA 5HE3A 2L2IA 1XR0B 1DDMA 2N0YA 3N7CA 4IOYX 4YL8A 1EAZA 1Y19B 2J0MA 1XODA 1M7RA 1V88A 3TFMA 3KZ1A 1OY2A 1B55A 2J59M 3P7ZA 1WJ1A 3IVFA 1J0WA 1FB8A 1U5FA 4GXBA 2EMTA 2KCJA 5HE1A 3ULBA 2YS1A 3KY9A 1QC6A 4HAVB 1EF1A 1XKEA 2EJ8A 3SNHA 2NZ8B 2YS5A 2MDXA 3WYFB 3AJ4A 3BJIA 2P0FA 2L1CA 3BINA 5JHHA 2YVCA 2CAYA 3PVWA 3PZDA 1M7EA 3P6AA 2BCJA 3PP2A 1MK7B 2I5CA 3WA0A 1UNPA 2KUPA 2LKOA 1V5PA 3O96A 1AQCA 1FHWA 2P0DA 1TJ6A 1E5WA 1PMSA 3A8PA 2J0KA 1UEFA 1V5MA 2UZSA 2E2XA 2IFSA 5EFXA 4DX8A 4D0NB 3SUZA 1NU2A 3ODXA 1V61A 2D9WA 3HW2B 3DXDA 4GPTB 3G9WA 2JP2A 1W1HA 3M1IB 1FOEA 1W1GA 4K81A 1LB1A 5D3YA 1H4RA 4HAWB 4ZRIA 2XQNM 5D3WA 2LYDA 4DXAB 2YS3A 2I1JA 3TW1A 5KQ1A 1RJ2A 1MKEA 1X1GA 3HQCA 4CYEA 4PNKA 5CLQB 2W2XC 2CRFA 2X18A 1XX0A 4KHAA 4MK0A 2RLOA 3HK0A 2UVMA 5DIFB 2RSGA 1J19A 5LOPB 2ADZA 3QBVB 3VIAA 2MWNB 2DHJA 5J3YA 5L81A 1AWEA 3U8ZA 2H7DA 3PG7A 2ROVA 1MPHA 2VSZA 2RGNB 2DYNA 4CHJA 1MK9B 2R09A 2KGXB 2RUKB 1V89A 4GMVA 3ODWA 2DX1A 2D9YA 4A5KA 3DXEA 2Q13A 3LJUX 5DH9B 2DYQA 4KHOA 1X11A 1ISNA 4KAXB 5LONB 1BAKA 1BWNA 2ELBA 2DTCA 5C16A 2YSZA 2I1KA 5CLLB 4KVGB 2AEHA 1NI2A 2FJLA 5D3XA 1KI1B 2YF0A 2K2UA 1MAIA 4K2PA 3ML4A 1XCGA 4B6HA 1FGZA 2LOZA 1WGUA 3F0WA 2G35A 3SO6A 4EJNA 1U27A 2D11A 4TKNA 3AU4A 3CIKA 1DBHA 4K2OA 4Y94A 3D8FA 2UZRA 2D4QA 2D2QA 3KSYA 1BTNA 1Q67A 3V5WA 4F7UP 5C5BB 2D10A 4HAZB 2PZ1A 2V76A 5HE2A 5J3TA 2COAA 1NTVA 1PLSA 5KCVA 3PSCA 1DDVA 1ZM0A 4C0AA 5C6RA 3QIJA 1DYNA 1V5UA 4ZRJA 2YT0A 4Z2NA 3DXCA 1QQGA 2CODA 2P8VA 4HAYB 2LULA 3MDBC 1P5TA 2GS0A 1WG7A 4KHBB 2QKLA 1NTYA 4HATB 4HB4B 4NY0A 5C5BA 5JP4A 1EGXA 5DHFB 2P0HA 3QWMA 4A6FB 1UNQA 5JLJB 2N23A 3D8EA 4IAPA 2Z0OA 1IRSA 2Z0QA 3PVLA 4HB0B 1MIXA 2CY4A 3U7DA 2HTHB 2MFQA 1WJMA 4P7IA 5FI0A 3D8DA 2OTXA 3FM8C 4PQ0A 1BTKA 1K5GB 2QKMA 4GN1A 2ELAA 1H10A 1ZSQA 4A6HA 3PEGA 5D27A 3KRWA 4EKUA 2K00A 1KZ7A 1WI1A 1MIZB 1U5EA 1N3HA 2GCLA 4GZUA 4IFSA 4H8SA 1Z87A 3KRXA 1DDWA 4F7HA 2J0JA 2OQBA 3ODOA 1X86A 2R0DA 2DHKA 1EVHA 1I7AA 4CHMA 1OQNA 2NMBA 1TXDA 2COFA 4BBKA 3A8QA 4DX90 2Y7BA 2M14A 2COCA 2D9VA 4HAXB 5GOWB 4GMXB 2CY5A 4WVFB 1OMWA 3UZTA 2W2XD 5FI1A 1PFJA 4HB2B 5DHAB 1U5GA 1SHCA 2ZPYA 5DI9B 2LOXA 1UPRA 3T06A 1KZGA 2MKRA 3ZVRA 1P3RA 2LG1A 4DBBA 4HB3B 1RRPB 2DHIA 1SGHA 2DKQA 3TO1A 3OANA 4HHVA 2K2JA 4L6EA 1U2BA 3TVVA 2Z0PA 4WSFA 3X23A 2AL6A 2DFKA 1ZVRA 2D9XA 5C79A 1FGYA 3TCAA 2RVBB 2YRYA 3GYOA 1U5DA 2W2WA 3AU5A 2GCJA 4MT7A 1DROA 1FAOA 4NSWA 3A98B 3FSSA 2DKPA 3RCPA 2DLWA 5JHGA 1UPQA 2EC1A 2HE7A 3FEHA 2GJYA 2H7EA 2DN6A 1ZC3B 3NSUA 4HAUB 4A6KA 4TYZA 3SV1A 1GC7A 1GC6A 2VKIA 2DA0A 1U29A 1XD4A 4XWXA 1UNRA 4ZRKA 2I5FA 3ULCA 2EMSA 5KQ4A 4WJ7A 4F7GA 1FHXA 3PVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HDQ A;  4MY6 A;  1P6S A;  3VOQ A;  4YON A;  2VRW B;  2D9Z A;  1Y5O A;  1I2H A;  4K17 A;  3SYX A;  1LW3 A;  5J3Q A;  3ZDT A;  3GYP A;  1WVH A;  2Y8F A;  4Z2M B;  1X05 A;  2YT1 A;  2M38 A;  1GG3 A;  2RNR B;  1W1D A;  1K5D B;  1FHO A;  2DX5 A;  3CXB B;  1X1F A;  2IYB A;  5HE0 A;  1TQZ A;  4A6F A;  1WGQ A;  5D3V A;  3F5R A;  1ZC4 B;  4EMO A;  3MPX A;  2ROZ B;  4HDO A;  2Y8G A;  5HE3 A;  2L2I A;  1XR0 B;  1DDM A;  2N0Y A;  3N7C A;  4IOY X;  4YL8 A;  1EAZ A;  1Y19 B;  2J0M A;  1XOD A;  1M7R A;  1V88 A;  3TFM A;  3KZ1 A;  1OY2 A;  1B55 A;  2J59 M;  3P7Z A;  1WJ1 A;  3IVF A;  1J0W A;  1FB8 A;  1U5F A;  4GXB A;  2EMT A;  2KCJ A;  5HE1 A;  3ULB A;  2YS1 A;  3KY9 A;  1QC6 A;  4HAV B;  1EF1 A;  1XKE A;  2EJ8 A;  3SNH A;  2NZ8 B;  2YS5 A;  2MDX A;  3WYF B;  3AJ4 A;  3BJI A;  2P0F A;  2L1C A;  3BIN A;  5JHH A;  2YVC A;  2CAY A;  3PVW A;  3PZD A;  1M7E A;  3P6A A;  2BCJ A;  3PP2 A;  1MK7 B;  2I5C A;  3WA0 A;  1UNP A;  2KUP A;  2LKO A;  1V5P A;  3O96 A;  1AQC A;  1FHW A;  2P0D A;  1TJ6 A;  1E5W A;  1PMS A;  3A8P A;  2J0K A;  1UEF A;  1V5M A;  2UZS A;  2E2X A;  2IFS A;  5EFX A;  4DX8 A;  4D0N B;  3SUZ A;  1NU2 A;  3ODX A;  1V61 A;  2D9W A;  3HW2 B;  3DXD A;  4GPT B;  3G9W A;  2JP2 A;  1W1H A;  3M1I B;  1FOE A;  1W1G A;  4K81 A;  1LB1 A;  5D3Y A;  1H4R A;  4HAW B;  4ZRI A;  2XQN M;  5D3W A;  2LYD A;  4DXA B;  2YS3 A;  2I1J A;  3TW1 A;  5KQ1 A;  1RJ2 A;  1MKE A;  1X1G A;  3HQC A;  4CYE A;  4PNK A;  5CLQ B;  2W2X C;  2CRF A;  2X18 A;  1XX0 A;  4KHA A;  4MK0 A;  2RLO A;  3HK0 A;  2UVM A;  5DIF B;  2RSG A;  1J19 A;  5LOP B;  2ADZ A;  3QBV B;  3VIA A;  2MWN B;  2DHJ A;  5J3Y A;  5L81 A;  1AWE A;  3U8Z A;  2H7D A;  3PG7 A;  2ROV A;  1MPH A;  2VSZ A;  2RGN B;  2DYN A;  4CHJ A;  1MK9 B;  2R09 A;  2KGX B;  2RUK B;  1V89 A;  4GMV A;  3ODW A;  2DX1 A;  2D9Y A;  4A5K A;  3DXE A;  2Q13 A;  3LJU X;  5DH9 B;  2DYQ A;  4KHO A;  1X11 A;  1ISN A;  4KAX B;  5LON B;  1BAK A;  1BWN A;  2ELB A;  2DTC A;  5C16 A;  2YSZ A;  2I1K A;  5CLL B;  4KVG B;  2AEH A;  1NI2 A;  2FJL A;  5D3X A;  1KI1 B;  2YF0 A;  2K2U A;  1MAI A;  4K2P A;  3ML4 A;  1XCG A;  4B6H A;  1FGZ A;  2LOZ A;  1WGU A;  3F0W A;  2G35 A;  3SO6 A;  4EJN A;  1U27 A;  2D11 A;  4TKN A;  3AU4 A;  3CIK A;  1DBH A;  4K2O A;  4Y94 A;  3D8F A;  2UZR A;  2D4Q A;  2D2Q A;  3KSY A;  1BTN A;  1Q67 A;  3V5W A;  4F7U P;  5C5B B;  2D10 A;  4HAZ B;  2PZ1 A;  2V76 A;  5HE2 A;  5J3T A;  2COA A;  1NTV A;  1PLS A;  5KCV A;  3PSC A;  1DDV A;  1ZM0 A;  4C0A A;  5C6R A;  3QIJ A;  1DYN A;  1V5U A;  4ZRJ A;  2YT0 A;  4Z2N A;  3DXC A;  1QQG A;  2COD A;  2P8V A;  4HAY B;  2LUL A;  3MDB C;  1P5T A;  2GS0 A;  1WG7 A;  4KHB B;  2QKL A;  1NTY A;  4HAT B;  4HB4 B;  4NY0 A;  5C5B A;  5JP4 A;  1EGX A;  5DHF B;  2P0H A;  3QWM A;  4A6F B;  1UNQ A;  5JLJ B;  2N23 A;  3D8E A;  4IAP A;  2Z0O A;  1IRS A;  2Z0Q A;  3PVL A;  4HB0 B;  1MIX A;  2CY4 A;  3U7D A;  2HTH B;  2MFQ A;  1WJM A;  4P7I A;  5FI0 A;  3D8D A;  2OTX A;  3FM8 C;  4PQ0 A;  1BTK A;  1K5G B;  2QKM A;  4GN1 A;  2ELA A;  1H10 A;  1ZSQ A;  4A6H A;  3PEG A;  5D27 A;  3KRW A;  4EKU A;  2K00 A;  1KZ7 A;  1WI1 A;  1MIZ B;  1U5E A;  1N3H A;  2GCL A;  4GZU A;  4IFS A;  4H8S A;  1Z87 A;  3KRX A;  1DDW A;  4F7H A;  2J0J A;  2OQB A;  3ODO A;  1X86 A;  2R0D A;  2DHK A;  1EVH A;  1I7A A;  4CHM A;  1OQN A;  2NMB A;  1TXD A;  2COF A;  4BBK A;  3A8Q A;  4DX9 0;  2Y7B A;  2M14 A;  2COC A;  2D9V A;  4HAX B;  5GOW B;  4GMX B;  2CY5 A;  4WVF B;  1OMW A;  3UZT A;  2W2X D;  5FI1 A;  1PFJ A;  4HB2 B;  5DHA B;  1U5G A;  1SHC A;  2ZPY A;  5DI9 B;  2LOX A;  1UPR A;  3T06 A;  1KZG A;  2MKR A;  3ZVR A;  1P3R A;  2LG1 A;  4DBB A;  4HB3 B;  1RRP B;  2DHI A;  1SGH A;  2DKQ A;  3TO1 A;  3OAN A;  4HHV A;  2K2J A;  4L6E A;  1U2B A;  3TVV A;  2Z0P A;  4WSF A;  3X23 A;  2AL6 A;  2DFK A;  1ZVR A;  2D9X A;  5C79 A;  1FGY A;  3TCA A;  2RVB B;  2YRY A;  3GYO A;  1U5D A;  2W2W A;  3AU5 A;  2GCJ A;  4MT7 A;  1DRO A;  1FAO A;  4NSW A;  3A98 B;  3FSS A;  2DKP A;  3RCP A;  2DLW A;  5JHG A;  1UPQ A;  2EC1 A;  2HE7 A;  3FEH A;  2GJY A;  2H7E A;  2DN6 A;  1ZC3 B;  3NSU A;  4HAU B;  4A6K A;  4TYZ A;  3SV1 A;  1GC7 A;  1GC6 A;  2VKI A;  2DA0 A;  1U29 A;  1XD4 A;  4XWX A;  1UNR A;  4ZRK A;  2I5F A;  3ULC A;  2EMS A;  5KQ4 A;  4WJ7 A;  4F7G A;  1FHX A;  3PVU A; 
#chains in the Genus database with same CATH topology
 4HDQ A;  4MY6 A;  1P6S A;  3VOQ A;  4YON A;  2VRW B;  2D9Z A;  1Y5O A;  4HSI A;  1I2H A;  4K17 A;  3SYX A;  1LW3 A;  5J3Q A;  4KHB A;  3ZDT A;  3GYP A;  1WVH A;  2Y8F A;  4Z2M B;  1X05 A;  2YT1 A;  2M38 A;  1GG3 A;  2RNR B;  1W1D A;  1K5D B;  1FHO A;  2DX5 A;  3CXB B;  1X1F A;  2ZKM X;  2IYB A;  5HE0 A;  1TQZ A;  4A6F A;  1WGQ A;  4CSQ A;  5D3V A;  3F5R A;  1ZC4 B;  4EMO A;  3MPX A;  2ROZ B;  4HDO A;  2Y8G A;  5HE3 A;  2L2I A;  1XR0 B;  1DDM A;  2N0Y A;  3N7C A;  4IOY X;  4YL8 A;  1EAZ A;  1Y19 B;  2J0M A;  1XOD A;  4OT1 A;  1M7R A;  1V88 A;  4GOU A;  3TFM A;  2FJU B;  3KZ1 A;  1OY2 A;  1B55 A;  2J59 M;  3P7Z A;  1WJ1 A;  3IVF A;  1J0W A;  1FB8 A;  1U5F A;  5IRS A;  4GXB A;  2EMT A;  2KCJ A;  5HE1 A;  5LG4 B;  3ULB A;  2YS1 A;  3KY9 A;  1QC6 A;  4HAV B;  1EF1 A;  1XKE A;  2EJ8 A;  3SNH A;  2NZ8 B;  2YS5 A;  2MDX A;  3WYF B;  3AJ4 A;  3BJI A;  3HIE A;  2P0F A;  2L1C A;  3BIN A;  5I2M A;  4QJ3 B;  5JHH A;  2YVC A;  2CAY A;  3PVW A;  3PZD A;  1M7E A;  3P6A A;  2BCJ A;  3PP2 A;  1MK7 B;  2I5C A;  3WA0 A;  1UNP A;  2KUP A;  2LKO A;  1V5P A;  3O96 A;  1AQC A;  1FHW A;  2RRF A;  2P0D A;  3HSA A;  1TJ6 A;  1E5W A;  1PMS A;  3A8P A;  2J0K A;  1UEF A;  1V5M A;  2UZS A;  2E2X A;  2YT2 A;  3NWD A;  2IFS A;  3FVC A;  5EFX A;  4DX8 A;  4D0N B;  3SUZ A;  1NU2 A;  3ODX A;  1V61 A;  2D9W A;  3HW2 B;  2Z13 A;  3DXD A;  4GPT B;  3G9W A;  2JP2 A;  1W1H A;  3M1I B;  1FOE A;  1W1G A;  4K81 A;  1LB1 A;  5D3Y A;  1H4R A;  4HAW B;  4ZRI A;  2XQN M;  5D3W A;  2LYD A;  4DXA B;  2YS3 A;  2I1J A;  3TW1 A;  5KQ1 A;  1RJ2 A;  1MKE A;  1X1G A;  3HQC A;  4CYE A;  4PNK A;  5CLQ B;  2W2X C;  2CRF A;  2X18 A;  3U12 A;  1XX0 A;  4KHA A;  4MK0 A;  2RLO A;  3HK0 A;  2Z14 A;  2UVM A;  5DIF B;  2RSG A;  1J19 A;  5LOP B;  2ADZ A;  3QBV B;  2Z59 A;  3VIA A;  2MWN B;  2DHJ A;  5J3Y A;  5L81 A;  1AWE A;  3U8Z A;  2H7D A;  3PG7 A;  4QXA B;  2ROV A;  1MPH A;  1ZYI A;  2VSZ A;  2RGN B;  2DYN A;  4CHJ A;  1MK9 B;  2R09 A;  2KGX B;  2RUK B;  1V89 A;  4GMV A;  3ODW A;  2DX1 A;  2D9Y A;  4A5K A;  3DXE A;  2Q13 A;  2Z4D A;  3LJU X;  5DH9 B;  2DYQ A;  4KHO A;  2GUM A;  1X11 A;  1ISN A;  4KAX B;  5LON B;  1BAK A;  1BWN A;  2ELB A;  2DTC A;  5C16 A;  2YSZ A;  2I1K A;  5CLL B;  4KVG B;  2AEH A;  1NI2 A;  2FJL A;  5D3X A;  1KI1 B;  2YF0 A;  4L1R A;  2K2U A;  1MAI A;  4K2P A;  3ML4 A;  1XCG A;  4B6H A;  1FGZ A;  2LOZ A;  1WGU A;  3F0W A;  2G35 A;  3SO6 A;  4EJN A;  1U27 A;  2D11 A;  4TKN A;  3AU4 A;  3CIK A;  1DBH A;  4K2O A;  5I2S A;  2KIG A;  4Y94 A;  3D8F A;  2UZR A;  3NWF A;  2D4Q A;  3NW8 A;  2D2Q A;  3KSY A;  2NBV A;  3A58 A;  1BTN A;  1Q67 A;  3V5W A;  4F7U P;  4GNK B;  5C5B B;  2D10 A;  4HAZ B;  2PZ1 A;  2V76 A;  5HE2 A;  5J3T A;  2COA A;  1NTV A;  1PLS A;  5KCV A;  3PSC A;  1DDV A;  1ZM0 A;  4C0A A;  5C6R A;  3QIJ A;  1DYN A;  1V5U A;  4ZRJ A;  2YT0 A;  4Z2N A;  3DXC A;  2KR0 A;  1QQG A;  4QJ4 B;  2COD A;  2P8V A;  4HAY B;  2LUL A;  3MDB C;  1T77 A;  3OHM B;  1P5T A;  2GS0 A;  2K49 A;  1WG7 A;  4KHB B;  2QKL A;  1NTY A;  4HAT B;  4HB4 B;  4NY0 A;  5C5B A;  5JP4 A;  1EGX A;  5DHF B;  2P0H A;  3QWM A;  4A6F B;  1UNQ A;  5JLJ B;  2N23 A;  3D8E A;  4IAP A;  2Z0O A;  1IRS A;  2Z0Q A;  3PVL A;  4HB0 B;  1MIX A;  2CY4 A;  3DCX A;  3U7D A;  2HTH B;  2MFQ A;  1WJM A;  4P7I A;  5FI0 A;  3D8D A;  2OTX A;  3FM8 C;  4PQ0 A;  1BTK A;  1K5G B;  2QKM A;  4GN1 A;  2ELA A;  2KIE A;  1H10 A;  1ZSQ A;  4A6H A;  3PEG A;  5D27 A;  3KRW A;  4EKU A;  2K00 A;  1KZ7 A;  1WI1 A;  1MIZ B;  1U5E A;  1N3H A;  2GCL A;  4GZU A;  4IFS A;  4H8S A;  1Z87 A;  3KRX A;  1DDW A;  4F7H A;  2J0J A;  3NWA A;  2OQB A;  3ODO A;  1X86 A;  2R0D A;  2DHK A;  1EVH A;  1I7A A;  4CHM A;  1OQN A;  2NMB A;  4DIX A;  1TXD A;  2COF A;  4BBK A;  3A8Q A;  4DX9 0;  2Y7B A;  2M14 A;  1MI1 A;  2COC A;  2D9V A;  4HAX B;  5GOW B;  4GMX B;  2CY5 A;  2KUQ A;  4WVF B;  1OMW A;  3UZT A;  2W2X D;  5FI1 A;  1PFJ A;  4HB2 B;  5DHA B;  1U5G A;  1SHC A;  2ZPY A;  5DI9 B;  2LOX A;  2R2Y A;  4D6W A;  1UPR A;  3T06 A;  1KZG A;  2MKR A;  3ZVR A;  1P3R A;  2LG1 A;  4DBB A;  4HB3 B;  1RRP B;  2DHI A;  1SGH A;  2DKQ A;  3TO1 A;  4QJ5 B;  3OAN A;  4HHV A;  2K2J A;  4L6E A;  1U2B A;  3TVV A;  2Z0P A;  4WSF A;  3X23 A;  2AL6 A;  2DFK A;  1ZVR A;  2D9X A;  5C79 A;  1FGY A;  3TCA A;  2RVB B;  2YRY A;  3GYO A;  1U5D A;  2W2W A;  3AU5 A;  2GCJ A;  4MT7 A;  1DRO A;  1FAO A;  2K8E A;  4NSW A;  5M4Y B;  3A98 B;  3FSS A;  2DKP A;  3RCP A;  2DLW A;  5JHG A;  1UPQ A;  2EC1 A;  2HE7 A;  3FEH A;  2GJY A;  2H7E A;  2DN6 A;  1ZC3 B;  3NSU A;  4HAU B;  4A6K A;  4TYZ A;  3B77 A;  3SV1 A;  1GC7 A;  4OSN A;  1GC6 A;  2VKI A;  2DA0 A;  1U29 A;  1XD4 A;  4XWX A;  1UNR A;  4ZRK A;  2I5F A;  3ULC A;  2EMS A;  5KQ4 A;  4WJ7 A;  4F7G A;  1FHX A;  3PVU A; 
#chains in the Genus database with same CATH homology
 4HDQ A;  4MY6 A;  1P6S A;  3VOQ A;  4YON A;  2VRW B;  2D9Z A;  1Y5O A;  1I2H A;  4K17 A;  3SYX A;  1LW3 A;  5J3Q A;  3ZDT A;  3GYP A;  1WVH A;  2Y8F A;  4Z2M B;  1X05 A;  2YT1 A;  2M38 A;  1GG3 A;  2RNR B;  1W1D A;  1K5D B;  1FHO A;  2DX5 A;  3CXB B;  1X1F A;  2IYB A;  5HE0 A;  1TQZ A;  4A6F A;  1WGQ A;  5D3V A;  3F5R A;  1ZC4 B;  4EMO A;  3MPX A;  2ROZ B;  4HDO A;  2Y8G A;  5HE3 A;  2L2I A;  1XR0 B;  1DDM A;  2N0Y A;  3N7C A;  4IOY X;  4YL8 A;  1EAZ A;  1Y19 B;  2J0M A;  1XOD A;  1M7R A;  1V88 A;  3TFM A;  3KZ1 A;  1OY2 A;  1B55 A;  2J59 M;  3P7Z A;  1WJ1 A;  3IVF A;  1J0W A;  1FB8 A;  1U5F A;  4GXB A;  2EMT A;  2KCJ A;  5HE1 A;  3ULB A;  2YS1 A;  3KY9 A;  1QC6 A;  4HAV B;  1EF1 A;  1XKE A;  2EJ8 A;  3SNH A;  2NZ8 B;  2YS5 A;  2MDX A;  3WYF B;  3AJ4 A;  3BJI A;  2P0F A;  2L1C A;  3BIN A;  5JHH A;  2YVC A;  2CAY A;  3PVW A;  3PZD A;  1M7E A;  3P6A A;  2BCJ A;  3PP2 A;  1MK7 B;  2I5C A;  3WA0 A;  1UNP A;  2KUP A;  2LKO A;  1V5P A;  3O96 A;  1AQC A;  1FHW A;  2P0D A;  1TJ6 A;  1E5W A;  1PMS A;  3A8P A;  2J0K A;  1UEF A;  1V5M A;  2UZS A;  2E2X A;  2IFS A;  5EFX A;  4DX8 A;  4D0N B;  3SUZ A;  1NU2 A;  3ODX A;  1V61 A;  2D9W A;  3HW2 B;  3DXD A;  4GPT B;  3G9W A;  2JP2 A;  1W1H A;  3M1I B;  1FOE A;  1W1G A;  4K81 A;  1LB1 A;  5D3Y A;  1H4R A;  4HAW B;  4ZRI A;  2XQN M;  5D3W A;  2LYD A;  4DXA B;  2YS3 A;  2I1J A;  3TW1 A;  5KQ1 A;  1RJ2 A;  1MKE A;  1X1G A;  3HQC A;  4CYE A;  4PNK A;  5CLQ B;  2W2X C;  2CRF A;  2X18 A;  1XX0 A;  4KHA A;  4MK0 A;  2RLO A;  3HK0 A;  2UVM A;  5DIF B;  2RSG A;  1J19 A;  5LOP B;  2ADZ A;  3QBV B;  3VIA A;  2MWN B;  2DHJ A;  5J3Y A;  5L81 A;  1AWE A;  3U8Z A;  2H7D A;  3PG7 A;  2ROV A;  1MPH A;  2VSZ A;  2RGN B;  2DYN A;  4CHJ A;  1MK9 B;  2R09 A;  2KGX B;  2RUK B;  1V89 A;  4GMV A;  3ODW A;  2DX1 A;  2D9Y A;  4A5K A;  3DXE A;  2Q13 A;  3LJU X;  5DH9 B;  2DYQ A;  4KHO A;  1X11 A;  1ISN A;  4KAX B;  5LON B;  1BAK A;  1BWN A;  2ELB A;  2DTC A;  5C16 A;  2YSZ A;  2I1K A;  5CLL B;  4KVG B;  2AEH A;  1NI2 A;  2FJL A;  5D3X A;  1KI1 B;  2YF0 A;  2K2U A;  1MAI A;  4K2P A;  3ML4 A;  1XCG A;  4B6H A;  1FGZ A;  2LOZ A;  1WGU A;  3F0W A;  2G35 A;  3SO6 A;  4EJN A;  1U27 A;  2D11 A;  4TKN A;  3AU4 A;  3CIK A;  1DBH A;  4K2O A;  4Y94 A;  3D8F A;  2UZR A;  2D4Q A;  2D2Q A;  3KSY A;  1BTN A;  1Q67 A;  3V5W A;  4F7U P;  5C5B B;  2D10 A;  4HAZ B;  2PZ1 A;  2V76 A;  5HE2 A;  5J3T A;  2COA A;  1NTV A;  1PLS A;  5KCV A;  3PSC A;  1DDV A;  1ZM0 A;  4C0A A;  5C6R A;  3QIJ A;  1DYN A;  1V5U A;  4ZRJ A;  2YT0 A;  4Z2N A;  3DXC A;  1QQG A;  2COD A;  2P8V A;  4HAY B;  2LUL A;  3MDB C;  1P5T A;  2GS0 A;  1WG7 A;  4KHB B;  2QKL A;  1NTY A;  4HAT B;  4HB4 B;  4NY0 A;  5C5B A;  5JP4 A;  1EGX A;  5DHF B;  2P0H A;  3QWM A;  4A6F B;  1UNQ A;  5JLJ B;  2N23 A;  3D8E A;  4IAP A;  2Z0O A;  1IRS A;  2Z0Q A;  3PVL A;  4HB0 B;  1MIX A;  2CY4 A;  3U7D A;  2HTH B;  2MFQ A;  1WJM A;  4P7I A;  5FI0 A;  3D8D A;  2OTX A;  3FM8 C;  4PQ0 A;  1BTK A;  1K5G B;  2QKM A;  4GN1 A;  2ELA A;  1H10 A;  1ZSQ A;  4A6H A;  3PEG A;  5D27 A;  3KRW A;  4EKU A;  2K00 A;  1KZ7 A;  1WI1 A;  1MIZ B;  1U5E A;  1N3H A;  2GCL A;  4GZU A;  4IFS A;  4H8S A;  1Z87 A;  3KRX A;  1DDW A;  4F7H A;  2J0J A;  2OQB A;  3ODO A;  1X86 A;  2R0D A;  2DHK A;  1EVH A;  1I7A A;  4CHM A;  1OQN A;  2NMB A;  1TXD A;  2COF A;  4BBK A;  3A8Q A;  4DX9 0;  2Y7B A;  2M14 A;  2COC A;  2D9V A;  4HAX B;  5GOW B;  4GMX B;  2CY5 A;  4WVF B;  1OMW A;  3UZT A;  2W2X D;  5FI1 A;  1PFJ A;  4HB2 B;  5DHA B;  1U5G A;  1SHC A;  2ZPY A;  5DI9 B;  2LOX A;  1UPR A;  3T06 A;  1KZG A;  2MKR A;  3ZVR A;  1P3R A;  2LG1 A;  4DBB A;  4HB3 B;  1RRP B;  2DHI A;  1SGH A;  2DKQ A;  3TO1 A;  3OAN A;  4HHV A;  2K2J A;  4L6E A;  1U2B A;  3TVV A;  2Z0P A;  4WSF A;  3X23 A;  2AL6 A;  2DFK A;  1ZVR A;  2D9X A;  5C79 A;  1FGY A;  3TCA A;  2RVB B;  2YRY A;  3GYO A;  1U5D A;  2W2W A;  3AU5 A;  2GCJ A;  4MT7 A;  1DRO A;  1FAO A;  4NSW A;  3A98 B;  3FSS A;  2DKP A;  3RCP A;  2DLW A;  5JHG A;  1UPQ A;  2EC1 A;  2HE7 A;  3FEH A;  2GJY A;  2H7E A;  2DN6 A;  1ZC3 B;  3NSU A;  4HAU B;  4A6K A;  4TYZ A;  3SV1 A;  1GC7 A;  1GC6 A;  2VKI A;  2DA0 A;  1U29 A;  1XD4 A;  4XWX A;  1UNR A;  4ZRK A;  2I5F A;  3ULC A;  2EMS A;  5KQ4 A;  4WJ7 A;  4F7G A;  1FHX A;  3PVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...