1IRSA

Irs-1 ptb domain complexed with a il-4 receptor phosphopeptide, nmr, minimized average structure
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
112
structure length
112
Chain Sequence
MGPAFKEVWQVILKPKGLGQTKNLIGIYRLCLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGEFWMQVDDSVVAQNMHETILEAMRAMSDEFRPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for IL-4 receptor phosphopeptide recognition by the IRS-1 PTB domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (signal transduction/peptide)
molecule keywords IRS-1
total genus 17
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 1996-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02174 IRS PTB domain (IRS-1 type)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1irsA00
1RJ2A 1XR0B 1QQGA 5HE1A 3TCAA 2DYNA 1U2BA 4HDOA 2CRFA 1V5MA 3HQCA 1FB8A 3TO1A 1I2HA 3U8ZA 1FGYA 2H7DA 2Z0PA 1MAIA 2KCJA 5CLQB 1BTNA 3X23A 2D9ZA 3SO6A 2M14A 5J3YA 3AU5A 1XX0A 2GJYA 3N7CA 2J0JA 1AQCA 5C5BB 2K00A 4KAXB 1X11A 2R0DA 2VKIA 4XWXA 3PZDA 2DLWA 4IAPA 1FHOA 2ADZA 3G9WA 1DDMA 2LOXA 1U5EA 2RGNB 2BCJA 2YS3A 4HB3B 2DKQA 4F7UP 1V61A 1KI1B 3RCPA 1Z87A 4ZRJA 2VRWB 1BTKA 1EF1A 1WJMA 1U5FA 5DH9B 4DX8A 1FHXA 2YVCA 5DHAB 1EVHA 1H10A 1PFJA 3ODOA 2GCLA 1WGUA 1X1FA 3P6AA 2GS0A 3PSCA 1SHCA 2W2XC 1UPQA 2P8VA 3ODXA 4HAZB 2R09A 5DIFB 2COFA 3U7DA 2J59M 2G35A 3SUZA 1N3HA 2D9WA 4GN1A 4ZRKA 1J0WA 4A6FB 5HE2A 3D8FA 4TYZA 4A6FA 4DXAB 4TKNA 1V88A 1MK9B 2OTXA 2MWNB 2Z0QA 1FAOA 4PNKA 1DROA 2DHJA 1PMSA 1M7EA 2I5CA 1X05A 1NU2A 2W2XD 2I5FA 3DXDA 4HB2B 2YF0A 4HAUB 3ODWA 4A6KA 1P6SA 4HB4B 2EC1A 5LONB 1TJ6A 2RNRB 4YONA 1LB1A 2K2UA 2COAA 4F7GA 5D3WA 2ELBA 5EFXA 4YL8A 1MPHA 1Q67A 4H8SA 5DI9B 3PVWA 2N23A 4HDQA 2EJ8A 2HE7A 1DYNA 4KHAA 1XODA 3QWMA 5HE0A 5KCVA 2V76A 1U29A 4K81A 1WJ1A 1ZVRA 3A98B 2YT1A 3ZDTA 1DDVA 1GG3A 2JP2A 1FGZA 1XD4A 2MDXA 3AJ4A 2CY4A 2D10A 3D8DA 2CODA 2MKRA 1ISNA 2UZSA 3TW1A 2NZ8B 2I1JA 2DYQA 4F7HA 1J19A 4GMXB 1EAZA 5C5BA 3F5RA 5D3YA 5HE3A 4KHBB 1MK7B 4P7IA 1M7RA 1U5GA 3OANA 4WSFA 5D27A 2Y7BA 2XQNM 3VIAA 2DFKA 1K5DB 4Y94A 1P5TA 2UVMA 3AU4A 2P0DA 1MKEA 3PVLA 3SYXA 5C79A 4ZRIA 5JP4A 3DXEA 1WVHA 2DX5A 2LKOA 3WYFB 3A8QA 2RSGA 2DTCA 2YT0A 4D0NB 4C0AA 4B6HA 2D9YA 5J3TA 1FHWA 1RRPB 3KRWA 3ZVRA 3MDBC 4HHVA 3HK0A 2HTHB 1IRSA 2KUPA 3KY9A 2J0MA 2ELAA 4IOYX 2ROZB 4Z2NA 1XCGA 4MK0A 2W2WA 2AL6A 2COCA 2LYDA 3VOQA 4A5KA 1ZC3B 1B55A 1DBHA 2D2QA 3FSSA 1KZ7A 1DDWA 3FM8C 2EMTA 4KHOA 3CIKA 4HAXB 4EJNA 2QKMA 3WA0A 1ZM0A 2D9XA 1I7AA 1K5GB 1OQNA 2UZRA 2EMSA 4EKUA 3O96A 5GOWB 4DBBA 2Q13A 1QC6A 4KVGB 1BAKA 5C6RA 3PG7A 2RVBB 3NSUA 3PVUA 5JLJB 4NSWA 2E2XA 1UEFA 5FI0A 3HW2B 2MFQA 2YSZA 5L81A 4HAVB 4GZUA 2QKLA 2RLOA 4HATB 2H7EA 4K2OA 2LULA 3PP2A 3F0WA 3KRXA 4IFSA 1H4RA 1OY2A 2K2JA 4PQ0A 5J3QA 1P3RA 3TVVA 2YS1A 3BJIA 4K17A 4K2PA 4CYEA 4A6HA 1NTYA 1MIZB 2DHIA 2KGXB 3M1IB 2CY5A 3QBVB 2FJLA 3SNHA 2DX1A 3ML4A 2LOZA 3KSYA 3GYOA 2M38A 4WJ7A 1V5UA 2X18A 3V5WA 2Z0OA 3SV1A 1U27A 2P0FA 3A8PA 2OQBA 2YS5A 1X86A 1EGXA 5D3VA 4GPTB 1V89A 4NY0A 5D3XA 4DX90 5DHFB 1XKEA 4BBKA 1WI1A 1UNPA 3PEGA 1AWEA 5C16A 2YRYA 2NMBA 4GXBA 1GC6A 1E5WA 2ROVA 2GCJA 2LG1A 3FEHA 2P0HA 2DHKA 1X1GA 3T06A 1UPRA 3IVFA 4HAYB 5JHHA 2D4QA 2DKPA 4HAWB 2L2IA 1UNQA 3MPXA 1SGHA 2D11A 1Y19B 1WGQA 3QIJA 4EMOA 1Y5OA 1W1GA 3ULCA 1V5PA 5KQ1A 1ZC4B 1WG7A 3DXCA 3UZTA 4WVFB 2IFSA 2L1CA 1LW3A 5CLLB 4Z2MB 1UNRA 2VSZA 4L6EA 2Y8GA 4MY6A 1U5DA 2I1KA 1KZGA 2IYBA 1W1HA 3TFMA 3KZ1A 5LOPB 5KQ4A 2ZPYA 1FOEA 2N0YA 4HB0B 1OMWA 3D8EA 3ULBA 1PLSA 2PZ1A 3GYPA 1GC7A 2D9VA 5JHGA 1ZSQA 2CAYA 2AEHA 3CXBB 1TQZA 2DA0A 4CHMA 5FI1A 3LJUX 2Y8FA 4CHJA 1TXDA 2DN6A 2J0KA 1NTVA 1W1DA 4GMVA 1NI2A 3BINA 2RUKB 1MIXA 1BWNA 3P7ZA 4MT7A
chains in the Genus database with same CATH superfamily
1RJ2A 4QXAB 1XR0B 1QQGA 5HE1A 3TCAA 2DYNA 1U2BA 4HDOA 2CRFA 2ZKMX 1V5MA 3HQCA 1FB8A 3TO1A 1I2HA 3U8ZA 1FGYA 2H7DA 2Z0PA 1MAIA 2KCJA 5CLQB 1BTNA 3X23A 2D9ZA 3SO6A 2M14A 5J3YA 3AU5A 1XX0A 2GJYA 3N7CA 2J0JA 1AQCA 5C5BB 3U12A 2K00A 4KAXB 1X11A 2R0DA 2VKIA 4XWXA 3PZDA 2DLWA 4IAPA 4L1RA 1FHOA 2ADZA 3G9WA 2GUMA 1DDMA 1MI1A 2LOXA 1U5EA 2RGNB 2BCJA 2YS3A 4HB3B 2DKQA 4F7UP 1V61A 1KI1B 3RCPA 1Z87A 4ZRJA 2VRWB 1BTKA 1EF1A 1WJMA 1U5FA 5DH9B 4DX8A 1FHXA 2YVCA 2KR0A 5DHAB 1EVHA 2R2YA 1H10A 1PFJA 3ODOA 2GCLA 1WGUA 1X1FA 3P6AA 2GS0A 3PSCA 2KUQA 1SHCA 2W2XC 3NWAA 1UPQA 2P8VA 3ODXA 4HAZB 2R09A 5DIFB 2COFA 3U7DA 2J59M 2G35A 3SUZA 1N3HA 2D9WA 4GN1A 4ZRKA 1J0WA 4A6FB 5HE2A 3NW8A 3D8FA 4TYZA 4A6FA 4DXAB 4TKNA 1V88A 4GNKB 1MK9B 2OTXA 2MWNB 2Z0QA 1FAOA 4PNKA 1DROA 2DHJA 1PMSA 2Z59A 1M7EA 2I5CA 1X05A 2K49A 1NU2A 2W2XD 2I5FA 3DXDA 4HB2B 2YF0A 4HAUB 3ODWA 4A6KA 1P6SA 4HB4B 2EC1A 5LONB 1TJ6A 2RNRB 4YONA 1LB1A 2K2UA 2COAA 4F7GA 5D3WA 2ELBA 5EFXA 2YT2A 4YL8A 1MPHA 1T77A 1Q67A 4H8SA 5DI9B 3PVWA 2N23A 4HDQA 3OHMB 2EJ8A 2HE7A 1DYNA 4KHAA 1XODA 3QWMA 5HE0A 5KCVA 2V76A 1U29A 4K81A 1WJ1A 1ZVRA 3A98B 2YT1A 3HIEA 4CSQA 3ZDTA 1DDVA 1GG3A 2RRFA 2JP2A 1FGZA 1XD4A 2MDXA 3AJ4A 2CY4A 2D10A 3D8DA 2CODA 2MKRA 1ISNA 2UZSA 3TW1A 2NZ8B 2KIEA 2I1JA 2DYQA 4F7HA 1J19A 4GMXB 1EAZA 5C5BA 3F5RA 5D3YA 5HE3A 3DCXA 4QJ4B 4KHBB 1MK7B 4P7IA 1M7RA 1U5GA 3OANA 4WSFA 5D27A 2Y7BA 2XQNM 3VIAA 2DFKA 1K5DB 4Y94A 1P5TA 2UVMA 3AU4A 2P0DA 2NBVA 1MKEA 3PVLA 3SYXA 5C79A 4QJ3B 4ZRIA 5JP4A 3DXEA 2K8EA 1WVHA 2DX5A 2LKOA 3WYFB 3A8QA 2RSGA 2DTCA 2YT0A 4D0NB 4C0AA 4B6HA 2D9YA 5J3TA 1FHWA 1RRPB 3KRWA 3ZVRA 3MDBC 4HHVA 3HK0A 2HTHB 1IRSA 2KUPA 3KY9A 2J0MA 2ELAA 4IOYX 2ROZB 4Z2NA 1XCGA 4MK0A 2W2WA 2AL6A 2COCA 2LYDA 3VOQA 2KIGA 4A5KA 1ZC3B 1B55A 1DBHA 2D2QA 3FSSA 1KZ7A 1DDWA 3FM8C 2Z13A 2EMTA 4KHOA 3CIKA 4HAXB 4EJNA 4KHBA 3A58A 2QKMA 3WA0A 1ZM0A 2D9XA 1I7AA 1K5GB 1OQNA 4QJ5B 2UZRA 2EMSA 4EKUA 3O96A 5GOWB 4DBBA 2Q13A 1QC6A 4KVGB 1BAKA 5C6RA 3PG7A 2RVBB 3NSUA 3PVUA 5JLJB 4NSWA 2E2XA 1UEFA 1ZYIA 5FI0A 4D6WA 3HW2B 2MFQA 2YSZA 5L81A 4HAVB 2Z4DA 4GZUA 2QKLA 2RLOA 4HATB 2H7EA 4K2OA 2LULA 3PP2A 3F0WA 3KRXA 4IFSA 1H4RA 1OY2A 2K2JA 4PQ0A 5J3QA 1P3RA 3TVVA 2YS1A 3NWFA 3BJIA 4K17A 4K2PA 4CYEA 4A6HA 1NTYA 1MIZB 2DHIA 2KGXB 3M1IB 2CY5A 3QBVB 2FJLA 3SNHA 2DX1A 3ML4A 2LOZA 5M4YB 3KSYA 3GYOA 2M38A 4WJ7A 1V5UA 3NWDA 2X18A 3V5WA 2Z0OA 3SV1A 1U27A 2P0FA 3A8PA 2OQBA 2YS5A 1X86A 2FJUB 1EGXA 5D3VA 4GPTB 1V89A 4NY0A 5D3XA 3FVCA 4DX90 5DHFB 1XKEA 2Z14A 4BBKA 1WI1A 1UNPA 3PEGA 1AWEA 4DIXA 5C16A 2YRYA 2NMBA 4GXBA 1GC6A 1E5WA 2ROVA 4OSNA 2GCJA 2LG1A 3FEHA 2P0HA 2DHKA 3HSAA 1X1GA 3T06A 5I2SA 1UPRA 3IVFA 4HAYB 5JHHA 2D4QA 3B77A 2DKPA 4HAWB 2L2IA 1UNQA 3MPXA 5LG4B 1SGHA 2D11A 1Y19B 1WGQA 3QIJA 4EMOA 1Y5OA 1W1GA 3ULCA 1V5PA 5KQ1A 1ZC4B 4HSIA 1WG7A 3DXCA 3UZTA 4WVFB 2IFSA 2L1CA 1LW3A 5CLLB 4Z2MB 1UNRA 2VSZA 4L6EA 2Y8GA 4MY6A 1U5DA 2I1KA 1KZGA 2IYBA 1W1HA 3TFMA 3KZ1A 5LOPB 5KQ4A 4OT1A 2ZPYA 1FOEA 2N0YA 4HB0B 5IRSA 5I2MA 1OMWA 3D8EA 3ULBA 1PLSA 2PZ1A 3GYPA 1GC7A 2D9VA 5JHGA 1ZSQA 2CAYA 2AEHA 3CXBB 1TQZA 2DA0A 4CHMA 5FI1A 3LJUX 2Y8FA 4CHJA 1TXDA 2DN6A 2J0KA 1NTVA 1W1DA 4GOUA 4GMVA 1NI2A 3BINA 2RUKB 1MIXA 1BWNA 3P7ZA 4MT7A
chains in the Genus database with same CATH topology
1RJ2A 1XR0B 1QQGA 5HE1A 3TCAA 2DYNA 1U2BA 4HDOA 2CRFA 1V5MA 3HQCA 1FB8A 3TO1A 1I2HA 3U8ZA 1FGYA 2H7DA 2Z0PA 1MAIA 2KCJA 5CLQB 1BTNA 3X23A 2D9ZA 3SO6A 2M14A 5J3YA 3AU5A 1XX0A 2GJYA 3N7CA 2J0JA 1AQCA 5C5BB 2K00A 4KAXB 1X11A 2R0DA 2VKIA 4XWXA 3PZDA 2DLWA 4IAPA 1FHOA 2ADZA 3G9WA 1DDMA 2LOXA 1U5EA 2RGNB 2BCJA 2YS3A 4HB3B 2DKQA 4F7UP 1V61A 1KI1B 3RCPA 1Z87A 4ZRJA 2VRWB 1BTKA 1EF1A 1WJMA 1U5FA 5DH9B 4DX8A 1FHXA 2YVCA 5DHAB 1EVHA 1H10A 1PFJA 3ODOA 2GCLA 1WGUA 1X1FA 3P6AA 2GS0A 3PSCA 1SHCA 2W2XC 1UPQA 2P8VA 3ODXA 4HAZB 2R09A 5DIFB 2COFA 3U7DA 2J59M 2G35A 3SUZA 1N3HA 2D9WA 4GN1A 4ZRKA 1J0WA 4A6FB 5HE2A 3D8FA 4TYZA 4A6FA 4DXAB 4TKNA 1V88A 1MK9B 2OTXA 2MWNB 2Z0QA 1FAOA 4PNKA 1DROA 2DHJA 1PMSA 1M7EA 2I5CA 1X05A 1NU2A 2W2XD 2I5FA 3DXDA 4HB2B 2YF0A 4HAUB 3ODWA 4A6KA 1P6SA 4HB4B 2EC1A 5LONB 1TJ6A 2RNRB 4YONA 1LB1A 2K2UA 2COAA 4F7GA 5D3WA 2ELBA 5EFXA 4YL8A 1MPHA 1Q67A 4H8SA 5DI9B 3PVWA 2N23A 4HDQA 2EJ8A 2HE7A 1DYNA 4KHAA 1XODA 3QWMA 5HE0A 5KCVA 2V76A 1U29A 4K81A 1WJ1A 1ZVRA 3A98B 2YT1A 3ZDTA 1DDVA 1GG3A 2JP2A 1FGZA 1XD4A 2MDXA 3AJ4A 2CY4A 2D10A 3D8DA 2CODA 2MKRA 1ISNA 2UZSA 3TW1A 2NZ8B 2I1JA 2DYQA 4F7HA 1J19A 4GMXB 1EAZA 5C5BA 3F5RA 5D3YA 5HE3A 4KHBB 1MK7B 4P7IA 1M7RA 1U5GA 3OANA 4WSFA 5D27A 2Y7BA 2XQNM 3VIAA 2DFKA 1K5DB 4Y94A 1P5TA 2UVMA 3AU4A 2P0DA 1MKEA 3PVLA 3SYXA 5C79A 4ZRIA 5JP4A 3DXEA 1WVHA 2DX5A 2LKOA 3WYFB 3A8QA 2RSGA 2DTCA 2YT0A 4D0NB 4C0AA 4B6HA 2D9YA 5J3TA 1FHWA 1RRPB 3KRWA 3ZVRA 3MDBC 4HHVA 3HK0A 2HTHB 1IRSA 2KUPA 3KY9A 2J0MA 2ELAA 4IOYX 2ROZB 4Z2NA 1XCGA 4MK0A 2W2WA 2AL6A 2COCA 2LYDA 3VOQA 4A5KA 1ZC3B 1B55A 1DBHA 2D2QA 3FSSA 1KZ7A 1DDWA 3FM8C 2EMTA 4KHOA 3CIKA 4HAXB 4EJNA 2QKMA 3WA0A 1ZM0A 2D9XA 1I7AA 1K5GB 1OQNA 2UZRA 2EMSA 4EKUA 3O96A 5GOWB 4DBBA 2Q13A 1QC6A 4KVGB 1BAKA 5C6RA 3PG7A 2RVBB 3NSUA 3PVUA 5JLJB 4NSWA 2E2XA 1UEFA 5FI0A 3HW2B 2MFQA 2YSZA 5L81A 4HAVB 4GZUA 2QKLA 2RLOA 4HATB 2H7EA 4K2OA 2LULA 3PP2A 3F0WA 3KRXA 4IFSA 1H4RA 1OY2A 2K2JA 4PQ0A 5J3QA 1P3RA 3TVVA 2YS1A 3BJIA 4K17A 4K2PA 4CYEA 4A6HA 1NTYA 1MIZB 2DHIA 2KGXB 3M1IB 2CY5A 3QBVB 2FJLA 3SNHA 2DX1A 3ML4A 2LOZA 3KSYA 3GYOA 2M38A 4WJ7A 1V5UA 2X18A 3V5WA 2Z0OA 3SV1A 1U27A 2P0FA 3A8PA 2OQBA 2YS5A 1X86A 1EGXA 5D3VA 4GPTB 1V89A 4NY0A 5D3XA 4DX90 5DHFB 1XKEA 4BBKA 1WI1A 1UNPA 3PEGA 1AWEA 5C16A 2YRYA 2NMBA 4GXBA 1GC6A 1E5WA 2ROVA 2GCJA 2LG1A 3FEHA 2P0HA 2DHKA 1X1GA 3T06A 1UPRA 3IVFA 4HAYB 5JHHA 2D4QA 2DKPA 4HAWB 2L2IA 1UNQA 3MPXA 1SGHA 2D11A 1Y19B 1WGQA 3QIJA 4EMOA 1Y5OA 1W1GA 3ULCA 1V5PA 5KQ1A 1ZC4B 1WG7A 3DXCA 3UZTA 4WVFB 2IFSA 2L1CA 1LW3A 5CLLB 4Z2MB 1UNRA 2VSZA 4L6EA 2Y8GA 4MY6A 1U5DA 2I1KA 1KZGA 2IYBA 1W1HA 3TFMA 3KZ1A 5LOPB 5KQ4A 2ZPYA 1FOEA 2N0YA 4HB0B 1OMWA 3D8EA 3ULBA 1PLSA 2PZ1A 3GYPA 1GC7A 2D9VA 5JHGA 1ZSQA 2CAYA 2AEHA 3CXBB 1TQZA 2DA0A 4CHMA 5FI1A 3LJUX 2Y8FA 4CHJA 1TXDA 2DN6A 2J0KA 1NTVA 1W1DA 4GMVA 1NI2A 3BINA 2RUKB 1MIXA 1BWNA 3P7ZA 4MT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RJ2 A;  1XR0 B;  1QQG A;  5HE1 A;  3TCA A;  2DYN A;  1U2B A;  4HDO A;  2CRF A;  1V5M A;  3HQC A;  1FB8 A;  3TO1 A;  1I2H A;  3U8Z A;  1FGY A;  2H7D A;  2Z0P A;  1MAI A;  2KCJ A;  5CLQ B;  1BTN A;  3X23 A;  2D9Z A;  3SO6 A;  2M14 A;  5J3Y A;  3AU5 A;  1XX0 A;  2GJY A;  3N7C A;  2J0J A;  1AQC A;  5C5B B;  2K00 A;  4KAX B;  1X11 A;  2R0D A;  2VKI A;  4XWX A;  3PZD A;  2DLW A;  4IAP A;  1FHO A;  2ADZ A;  3G9W A;  1DDM A;  2LOX A;  1U5E A;  2RGN B;  2BCJ A;  2YS3 A;  4HB3 B;  2DKQ A;  4F7U P;  1V61 A;  1KI1 B;  3RCP A;  1Z87 A;  4ZRJ A;  2VRW B;  1BTK A;  1EF1 A;  1WJM A;  1U5F A;  5DH9 B;  4DX8 A;  1FHX A;  2YVC A;  5DHA B;  1EVH A;  1H10 A;  1PFJ A;  3ODO A;  2GCL A;  1WGU A;  1X1F A;  3P6A A;  2GS0 A;  3PSC A;  1SHC A;  2W2X C;  1UPQ A;  2P8V A;  3ODX A;  4HAZ B;  2R09 A;  5DIF B;  2COF A;  3U7D A;  2J59 M;  2G35 A;  3SUZ A;  1N3H A;  2D9W A;  4GN1 A;  4ZRK A;  1J0W A;  4A6F B;  5HE2 A;  3D8F A;  4TYZ A;  4A6F A;  4DXA B;  4TKN A;  1V88 A;  1MK9 B;  2OTX A;  2MWN B;  2Z0Q A;  1FAO A;  4PNK A;  1DRO A;  2DHJ A;  1PMS A;  1M7E A;  2I5C A;  1X05 A;  1NU2 A;  2W2X D;  2I5F A;  3DXD A;  4HB2 B;  2YF0 A;  4HAU B;  3ODW A;  4A6K A;  1P6S A;  4HB4 B;  2EC1 A;  5LON B;  1TJ6 A;  2RNR B;  4YON A;  1LB1 A;  2K2U A;  2COA A;  4F7G A;  5D3W A;  2ELB A;  5EFX A;  4YL8 A;  1MPH A;  1Q67 A;  4H8S A;  5DI9 B;  3PVW A;  2N23 A;  4HDQ A;  2EJ8 A;  2HE7 A;  1DYN A;  4KHA A;  1XOD A;  3QWM A;  5HE0 A;  5KCV A;  2V76 A;  1U29 A;  4K81 A;  1WJ1 A;  1ZVR A;  3A98 B;  2YT1 A;  3ZDT A;  1DDV A;  1GG3 A;  2JP2 A;  1FGZ A;  1XD4 A;  2MDX A;  3AJ4 A;  2CY4 A;  2D10 A;  3D8D A;  2COD A;  2MKR A;  1ISN A;  2UZS A;  3TW1 A;  2NZ8 B;  2I1J A;  2DYQ A;  4F7H A;  1J19 A;  4GMX B;  1EAZ A;  5C5B A;  3F5R A;  5D3Y A;  5HE3 A;  4KHB B;  1MK7 B;  4P7I A;  1M7R A;  1U5G A;  3OAN A;  4WSF A;  5D27 A;  2Y7B A;  2XQN M;  3VIA A;  2DFK A;  1K5D B;  4Y94 A;  1P5T A;  2UVM A;  3AU4 A;  2P0D A;  1MKE A;  3PVL A;  3SYX A;  5C79 A;  4ZRI A;  5JP4 A;  3DXE A;  1WVH A;  2DX5 A;  2LKO A;  3WYF B;  3A8Q A;  2RSG A;  2DTC A;  2YT0 A;  4D0N B;  4C0A A;  4B6H A;  2D9Y A;  5J3T A;  1FHW A;  1RRP B;  3KRW A;  3ZVR A;  3MDB C;  4HHV A;  3HK0 A;  2HTH B;  1IRS A;  2KUP A;  3KY9 A;  2J0M A;  2ELA A;  4IOY X;  2ROZ B;  4Z2N A;  1XCG A;  4MK0 A;  2W2W A;  2AL6 A;  2COC A;  2LYD A;  3VOQ A;  4A5K A;  1ZC3 B;  1B55 A;  1DBH A;  2D2Q A;  3FSS A;  1KZ7 A;  1DDW A;  3FM8 C;  2EMT A;  4KHO A;  3CIK A;  4HAX B;  4EJN A;  2QKM A;  3WA0 A;  1ZM0 A;  2D9X A;  1I7A A;  1K5G B;  1OQN A;  2UZR A;  2EMS A;  4EKU A;  3O96 A;  5GOW B;  4DBB A;  2Q13 A;  1QC6 A;  4KVG B;  1BAK A;  5C6R A;  3PG7 A;  2RVB B;  3NSU A;  3PVU A;  5JLJ B;  4NSW A;  2E2X A;  1UEF A;  5FI0 A;  3HW2 B;  2MFQ A;  2YSZ A;  5L81 A;  4HAV B;  4GZU A;  2QKL A;  2RLO A;  4HAT B;  2H7E A;  4K2O A;  2LUL A;  3PP2 A;  3F0W A;  3KRX A;  4IFS A;  1H4R A;  1OY2 A;  2K2J A;  4PQ0 A;  5J3Q A;  1P3R A;  3TVV A;  2YS1 A;  3BJI A;  4K17 A;  4K2P A;  4CYE A;  4A6H A;  1NTY A;  1MIZ B;  2DHI A;  2KGX B;  3M1I B;  2CY5 A;  3QBV B;  2FJL A;  3SNH A;  2DX1 A;  3ML4 A;  2LOZ A;  3KSY A;  3GYO A;  2M38 A;  4WJ7 A;  1V5U A;  2X18 A;  3V5W A;  2Z0O A;  3SV1 A;  1U27 A;  2P0F A;  3A8P A;  2OQB A;  2YS5 A;  1X86 A;  1EGX A;  5D3V A;  4GPT B;  1V89 A;  4NY0 A;  5D3X A;  4DX9 0;  5DHF B;  1XKE A;  4BBK A;  1WI1 A;  1UNP A;  3PEG A;  1AWE A;  5C16 A;  2YRY A;  2NMB A;  4GXB A;  1GC6 A;  1E5W A;  2ROV A;  2GCJ A;  2LG1 A;  3FEH A;  2P0H A;  2DHK A;  1X1G A;  3T06 A;  1UPR A;  3IVF A;  4HAY B;  5JHH A;  2D4Q A;  2DKP A;  4HAW B;  2L2I A;  1UNQ A;  3MPX A;  1SGH A;  2D11 A;  1Y19 B;  1WGQ A;  3QIJ A;  4EMO A;  1Y5O A;  1W1G A;  3ULC A;  1V5P A;  5KQ1 A;  1ZC4 B;  1WG7 A;  3DXC A;  3UZT A;  4WVF B;  2IFS A;  2L1C A;  1LW3 A;  5CLL B;  4Z2M B;  1UNR A;  2VSZ A;  4L6E A;  2Y8G A;  4MY6 A;  1U5D A;  2I1K A;  1KZG A;  2IYB A;  1W1H A;  3TFM A;  3KZ1 A;  5LOP B;  5KQ4 A;  2ZPY A;  1FOE A;  2N0Y A;  4HB0 B;  1OMW A;  3D8E A;  3ULB A;  1PLS A;  2PZ1 A;  3GYP A;  1GC7 A;  2D9V A;  5JHG A;  1ZSQ A;  2CAY A;  2AEH A;  3CXB B;  1TQZ A;  2DA0 A;  4CHM A;  5FI1 A;  3LJU X;  2Y8F A;  4CHJ A;  1TXD A;  2DN6 A;  2J0K A;  1NTV A;  1W1D A;  4GMV A;  1NI2 A;  3BIN A;  2RUK B;  1MIX A;  1BWN A;  3P7Z A;  4MT7 A; 
#chains in the Genus database with same CATH topology
 1RJ2 A;  4QXA B;  1XR0 B;  1QQG A;  5HE1 A;  3TCA A;  2DYN A;  1U2B A;  4HDO A;  2CRF A;  2ZKM X;  1V5M A;  3HQC A;  1FB8 A;  3TO1 A;  1I2H A;  3U8Z A;  1FGY A;  2H7D A;  2Z0P A;  1MAI A;  2KCJ A;  5CLQ B;  1BTN A;  3X23 A;  2D9Z A;  3SO6 A;  2M14 A;  5J3Y A;  3AU5 A;  1XX0 A;  2GJY A;  3N7C A;  2J0J A;  1AQC A;  5C5B B;  3U12 A;  2K00 A;  4KAX B;  1X11 A;  2R0D A;  2VKI A;  4XWX A;  3PZD A;  2DLW A;  4IAP A;  4L1R A;  1FHO A;  2ADZ A;  3G9W A;  2GUM A;  1DDM A;  1MI1 A;  2LOX A;  1U5E A;  2RGN B;  2BCJ A;  2YS3 A;  4HB3 B;  2DKQ A;  4F7U P;  1V61 A;  1KI1 B;  3RCP A;  1Z87 A;  4ZRJ A;  2VRW B;  1BTK A;  1EF1 A;  1WJM A;  1U5F A;  5DH9 B;  4DX8 A;  1FHX A;  2YVC A;  2KR0 A;  5DHA B;  1EVH A;  2R2Y A;  1H10 A;  1PFJ A;  3ODO A;  2GCL A;  1WGU A;  1X1F A;  3P6A A;  2GS0 A;  3PSC A;  2KUQ A;  1SHC A;  2W2X C;  3NWA A;  1UPQ A;  2P8V A;  3ODX A;  4HAZ B;  2R09 A;  5DIF B;  2COF A;  3U7D A;  2J59 M;  2G35 A;  3SUZ A;  1N3H A;  2D9W A;  4GN1 A;  4ZRK A;  1J0W A;  4A6F B;  5HE2 A;  3NW8 A;  3D8F A;  4TYZ A;  4A6F A;  4DXA B;  4TKN A;  1V88 A;  4GNK B;  1MK9 B;  2OTX A;  2MWN B;  2Z0Q A;  1FAO A;  4PNK A;  1DRO A;  2DHJ A;  1PMS A;  2Z59 A;  1M7E A;  2I5C A;  1X05 A;  2K49 A;  1NU2 A;  2W2X D;  2I5F A;  3DXD A;  4HB2 B;  2YF0 A;  4HAU B;  3ODW A;  4A6K A;  1P6S A;  4HB4 B;  2EC1 A;  5LON B;  1TJ6 A;  2RNR B;  4YON A;  1LB1 A;  2K2U A;  2COA A;  4F7G A;  5D3W A;  2ELB A;  5EFX A;  2YT2 A;  4YL8 A;  1MPH A;  1T77 A;  1Q67 A;  4H8S A;  5DI9 B;  3PVW A;  2N23 A;  4HDQ A;  3OHM B;  2EJ8 A;  2HE7 A;  1DYN A;  4KHA A;  1XOD A;  3QWM A;  5HE0 A;  5KCV A;  2V76 A;  1U29 A;  4K81 A;  1WJ1 A;  1ZVR A;  3A98 B;  2YT1 A;  3HIE A;  4CSQ A;  3ZDT A;  1DDV A;  1GG3 A;  2RRF A;  2JP2 A;  1FGZ A;  1XD4 A;  2MDX A;  3AJ4 A;  2CY4 A;  2D10 A;  3D8D A;  2COD A;  2MKR A;  1ISN A;  2UZS A;  3TW1 A;  2NZ8 B;  2KIE A;  2I1J A;  2DYQ A;  4F7H A;  1J19 A;  4GMX B;  1EAZ A;  5C5B A;  3F5R A;  5D3Y A;  5HE3 A;  3DCX A;  4QJ4 B;  4KHB B;  1MK7 B;  4P7I A;  1M7R A;  1U5G A;  3OAN A;  4WSF A;  5D27 A;  2Y7B A;  2XQN M;  3VIA A;  2DFK A;  1K5D B;  4Y94 A;  1P5T A;  2UVM A;  3AU4 A;  2P0D A;  2NBV A;  1MKE A;  3PVL A;  3SYX A;  5C79 A;  4QJ3 B;  4ZRI A;  5JP4 A;  3DXE A;  2K8E A;  1WVH A;  2DX5 A;  2LKO A;  3WYF B;  3A8Q A;  2RSG A;  2DTC A;  2YT0 A;  4D0N B;  4C0A A;  4B6H A;  2D9Y A;  5J3T A;  1FHW A;  1RRP B;  3KRW A;  3ZVR A;  3MDB C;  4HHV A;  3HK0 A;  2HTH B;  1IRS A;  2KUP A;  3KY9 A;  2J0M A;  2ELA A;  4IOY X;  2ROZ B;  4Z2N A;  1XCG A;  4MK0 A;  2W2W A;  2AL6 A;  2COC A;  2LYD A;  3VOQ A;  2KIG A;  4A5K A;  1ZC3 B;  1B55 A;  1DBH A;  2D2Q A;  3FSS A;  1KZ7 A;  1DDW A;  3FM8 C;  2Z13 A;  2EMT A;  4KHO A;  3CIK A;  4HAX B;  4EJN A;  4KHB A;  3A58 A;  2QKM A;  3WA0 A;  1ZM0 A;  2D9X A;  1I7A A;  1K5G B;  1OQN A;  4QJ5 B;  2UZR A;  2EMS A;  4EKU A;  3O96 A;  5GOW B;  4DBB A;  2Q13 A;  1QC6 A;  4KVG B;  1BAK A;  5C6R A;  3PG7 A;  2RVB B;  3NSU A;  3PVU A;  5JLJ B;  4NSW A;  2E2X A;  1UEF A;  1ZYI A;  5FI0 A;  4D6W A;  3HW2 B;  2MFQ A;  2YSZ A;  5L81 A;  4HAV B;  2Z4D A;  4GZU A;  2QKL A;  2RLO A;  4HAT B;  2H7E A;  4K2O A;  2LUL A;  3PP2 A;  3F0W A;  3KRX A;  4IFS A;  1H4R A;  1OY2 A;  2K2J A;  4PQ0 A;  5J3Q A;  1P3R A;  3TVV A;  2YS1 A;  3NWF A;  3BJI A;  4K17 A;  4K2P A;  4CYE A;  4A6H A;  1NTY A;  1MIZ B;  2DHI A;  2KGX B;  3M1I B;  2CY5 A;  3QBV B;  2FJL A;  3SNH A;  2DX1 A;  3ML4 A;  2LOZ A;  5M4Y B;  3KSY A;  3GYO A;  2M38 A;  4WJ7 A;  1V5U A;  3NWD A;  2X18 A;  3V5W A;  2Z0O A;  3SV1 A;  1U27 A;  2P0F A;  3A8P A;  2OQB A;  2YS5 A;  1X86 A;  2FJU B;  1EGX A;  5D3V A;  4GPT B;  1V89 A;  4NY0 A;  5D3X A;  3FVC A;  4DX9 0;  5DHF B;  1XKE A;  2Z14 A;  4BBK A;  1WI1 A;  1UNP A;  3PEG A;  1AWE A;  4DIX A;  5C16 A;  2YRY A;  2NMB A;  4GXB A;  1GC6 A;  1E5W A;  2ROV A;  4OSN A;  2GCJ A;  2LG1 A;  3FEH A;  2P0H A;  2DHK A;  3HSA A;  1X1G A;  3T06 A;  5I2S A;  1UPR A;  3IVF A;  4HAY B;  5JHH A;  2D4Q A;  3B77 A;  2DKP A;  4HAW B;  2L2I A;  1UNQ A;  3MPX A;  5LG4 B;  1SGH A;  2D11 A;  1Y19 B;  1WGQ A;  3QIJ A;  4EMO A;  1Y5O A;  1W1G A;  3ULC A;  1V5P A;  5KQ1 A;  1ZC4 B;  4HSI A;  1WG7 A;  3DXC A;  3UZT A;  4WVF B;  2IFS A;  2L1C A;  1LW3 A;  5CLL B;  4Z2M B;  1UNR A;  2VSZ A;  4L6E A;  2Y8G A;  4MY6 A;  1U5D A;  2I1K A;  1KZG A;  2IYB A;  1W1H A;  3TFM A;  3KZ1 A;  5LOP B;  5KQ4 A;  4OT1 A;  2ZPY A;  1FOE A;  2N0Y A;  4HB0 B;  5IRS A;  5I2M A;  1OMW A;  3D8E A;  3ULB A;  1PLS A;  2PZ1 A;  3GYP A;  1GC7 A;  2D9V A;  5JHG A;  1ZSQ A;  2CAY A;  2AEH A;  3CXB B;  1TQZ A;  2DA0 A;  4CHM A;  5FI1 A;  3LJU X;  2Y8F A;  4CHJ A;  1TXD A;  2DN6 A;  2J0K A;  1NTV A;  1W1D A;  4GOU A;  4GMV A;  1NI2 A;  3BIN A;  2RUK B;  1MIX A;  1BWN A;  3P7Z A;  4MT7 A; 
#chains in the Genus database with same CATH homology
 1RJ2 A;  1XR0 B;  1QQG A;  5HE1 A;  3TCA A;  2DYN A;  1U2B A;  4HDO A;  2CRF A;  1V5M A;  3HQC A;  1FB8 A;  3TO1 A;  1I2H A;  3U8Z A;  1FGY A;  2H7D A;  2Z0P A;  1MAI A;  2KCJ A;  5CLQ B;  1BTN A;  3X23 A;  2D9Z A;  3SO6 A;  2M14 A;  5J3Y A;  3AU5 A;  1XX0 A;  2GJY A;  3N7C A;  2J0J A;  1AQC A;  5C5B B;  2K00 A;  4KAX B;  1X11 A;  2R0D A;  2VKI A;  4XWX A;  3PZD A;  2DLW A;  4IAP A;  1FHO A;  2ADZ A;  3G9W A;  1DDM A;  2LOX A;  1U5E A;  2RGN B;  2BCJ A;  2YS3 A;  4HB3 B;  2DKQ A;  4F7U P;  1V61 A;  1KI1 B;  3RCP A;  1Z87 A;  4ZRJ A;  2VRW B;  1BTK A;  1EF1 A;  1WJM A;  1U5F A;  5DH9 B;  4DX8 A;  1FHX A;  2YVC A;  5DHA B;  1EVH A;  1H10 A;  1PFJ A;  3ODO A;  2GCL A;  1WGU A;  1X1F A;  3P6A A;  2GS0 A;  3PSC A;  1SHC A;  2W2X C;  1UPQ A;  2P8V A;  3ODX A;  4HAZ B;  2R09 A;  5DIF B;  2COF A;  3U7D A;  2J59 M;  2G35 A;  3SUZ A;  1N3H A;  2D9W A;  4GN1 A;  4ZRK A;  1J0W A;  4A6F B;  5HE2 A;  3D8F A;  4TYZ A;  4A6F A;  4DXA B;  4TKN A;  1V88 A;  1MK9 B;  2OTX A;  2MWN B;  2Z0Q A;  1FAO A;  4PNK A;  1DRO A;  2DHJ A;  1PMS A;  1M7E A;  2I5C A;  1X05 A;  1NU2 A;  2W2X D;  2I5F A;  3DXD A;  4HB2 B;  2YF0 A;  4HAU B;  3ODW A;  4A6K A;  1P6S A;  4HB4 B;  2EC1 A;  5LON B;  1TJ6 A;  2RNR B;  4YON A;  1LB1 A;  2K2U A;  2COA A;  4F7G A;  5D3W A;  2ELB A;  5EFX A;  4YL8 A;  1MPH A;  1Q67 A;  4H8S A;  5DI9 B;  3PVW A;  2N23 A;  4HDQ A;  2EJ8 A;  2HE7 A;  1DYN A;  4KHA A;  1XOD A;  3QWM A;  5HE0 A;  5KCV A;  2V76 A;  1U29 A;  4K81 A;  1WJ1 A;  1ZVR A;  3A98 B;  2YT1 A;  3ZDT A;  1DDV A;  1GG3 A;  2JP2 A;  1FGZ A;  1XD4 A;  2MDX A;  3AJ4 A;  2CY4 A;  2D10 A;  3D8D A;  2COD A;  2MKR A;  1ISN A;  2UZS A;  3TW1 A;  2NZ8 B;  2I1J A;  2DYQ A;  4F7H A;  1J19 A;  4GMX B;  1EAZ A;  5C5B A;  3F5R A;  5D3Y A;  5HE3 A;  4KHB B;  1MK7 B;  4P7I A;  1M7R A;  1U5G A;  3OAN A;  4WSF A;  5D27 A;  2Y7B A;  2XQN M;  3VIA A;  2DFK A;  1K5D B;  4Y94 A;  1P5T A;  2UVM A;  3AU4 A;  2P0D A;  1MKE A;  3PVL A;  3SYX A;  5C79 A;  4ZRI A;  5JP4 A;  3DXE A;  1WVH A;  2DX5 A;  2LKO A;  3WYF B;  3A8Q A;  2RSG A;  2DTC A;  2YT0 A;  4D0N B;  4C0A A;  4B6H A;  2D9Y A;  5J3T A;  1FHW A;  1RRP B;  3KRW A;  3ZVR A;  3MDB C;  4HHV A;  3HK0 A;  2HTH B;  1IRS A;  2KUP A;  3KY9 A;  2J0M A;  2ELA A;  4IOY X;  2ROZ B;  4Z2N A;  1XCG A;  4MK0 A;  2W2W A;  2AL6 A;  2COC A;  2LYD A;  3VOQ A;  4A5K A;  1ZC3 B;  1B55 A;  1DBH A;  2D2Q A;  3FSS A;  1KZ7 A;  1DDW A;  3FM8 C;  2EMT A;  4KHO A;  3CIK A;  4HAX B;  4EJN A;  2QKM A;  3WA0 A;  1ZM0 A;  2D9X A;  1I7A A;  1K5G B;  1OQN A;  2UZR A;  2EMS A;  4EKU A;  3O96 A;  5GOW B;  4DBB A;  2Q13 A;  1QC6 A;  4KVG B;  1BAK A;  5C6R A;  3PG7 A;  2RVB B;  3NSU A;  3PVU A;  5JLJ B;  4NSW A;  2E2X A;  1UEF A;  5FI0 A;  3HW2 B;  2MFQ A;  2YSZ A;  5L81 A;  4HAV B;  4GZU A;  2QKL A;  2RLO A;  4HAT B;  2H7E A;  4K2O A;  2LUL A;  3PP2 A;  3F0W A;  3KRX A;  4IFS A;  1H4R A;  1OY2 A;  2K2J A;  4PQ0 A;  5J3Q A;  1P3R A;  3TVV A;  2YS1 A;  3BJI A;  4K17 A;  4K2P A;  4CYE A;  4A6H A;  1NTY A;  1MIZ B;  2DHI A;  2KGX B;  3M1I B;  2CY5 A;  3QBV B;  2FJL A;  3SNH A;  2DX1 A;  3ML4 A;  2LOZ A;  3KSY A;  3GYO A;  2M38 A;  4WJ7 A;  1V5U A;  2X18 A;  3V5W A;  2Z0O A;  3SV1 A;  1U27 A;  2P0F A;  3A8P A;  2OQB A;  2YS5 A;  1X86 A;  1EGX A;  5D3V A;  4GPT B;  1V89 A;  4NY0 A;  5D3X A;  4DX9 0;  5DHF B;  1XKE A;  4BBK A;  1WI1 A;  1UNP A;  3PEG A;  1AWE A;  5C16 A;  2YRY A;  2NMB A;  4GXB A;  1GC6 A;  1E5W A;  2ROV A;  2GCJ A;  2LG1 A;  3FEH A;  2P0H A;  2DHK A;  1X1G A;  3T06 A;  1UPR A;  3IVF A;  4HAY B;  5JHH A;  2D4Q A;  2DKP A;  4HAW B;  2L2I A;  1UNQ A;  3MPX A;  1SGH A;  2D11 A;  1Y19 B;  1WGQ A;  3QIJ A;  4EMO A;  1Y5O A;  1W1G A;  3ULC A;  1V5P A;  5KQ1 A;  1ZC4 B;  1WG7 A;  3DXC A;  3UZT A;  4WVF B;  2IFS A;  2L1C A;  1LW3 A;  5CLL B;  4Z2M B;  1UNR A;  2VSZ A;  4L6E A;  2Y8G A;  4MY6 A;  1U5D A;  2I1K A;  1KZG A;  2IYB A;  1W1H A;  3TFM A;  3KZ1 A;  5LOP B;  5KQ4 A;  2ZPY A;  1FOE A;  2N0Y A;  4HB0 B;  1OMW A;  3D8E A;  3ULB A;  1PLS A;  2PZ1 A;  3GYP A;  1GC7 A;  2D9V A;  5JHG A;  1ZSQ A;  2CAY A;  2AEH A;  3CXB B;  1TQZ A;  2DA0 A;  4CHM A;  5FI1 A;  3LJU X;  2Y8F A;  4CHJ A;  1TXD A;  2DN6 A;  2J0K A;  1NTV A;  1W1D A;  4GMV A;  1NI2 A;  3BIN A;  2RUK B;  1MIX A;  1BWN A;  3P7Z A;  4MT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...