3ODOA

Crystal structure of the dh/ph domains of p115-rhogef
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
370
structure length
370
Chain Sequence
QTSPPGWRELVPPDTLHSLPKSQVKRQEVISELLVTEAAHVRMLRVLHDLFFQPMAECLFFPLEELQNIFPSLDELIEVHSLFLDRLMKRRQESGYLIEEIGDVLLARFDGAEGSWFQKISSRFCSRQSFALEQLKAKQRKDPRFCAFVQEAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEEPTEREKVELAAECCREILHHVNQAVRDMEDLLRLKDYQRRLDLSHLRQSSDPMLSEFKNLDITKKKLVHEGPLTWRVTKDKAVEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLRPVLRLTSAMTREVATDHKAFYVLFTWDQEAQIYELVAQTVSERKNWCALITETAGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Modulation of a GEF switch: Autoinhibition of the intrinsic guanine nucleotide exchange activity of p115-RhoREF
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Rho guanine nucleotide exchange factor 1
total genus 126
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00621 RhoGEF RhoGEF domain
A PF17838 PH_16 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 3odoA01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3odoA02
4HB0B 1V5PA 2CY4A 4D0NB 2J0MA 3M1IB 2YT1A 5FI0A 3A98B 4EKUA 2D9ZA 1WJ1A 2R09A 1MAIA 2DFKA 2CAYA 2I5FA 1U27A 4KHBB 1V89A 2IYBA 1DROA 4A6FA 4HAUB 5FI1A 4IFSA 1V5UA 5DI9B 1WGUA 1KZGA 2YSZA 4TKNA 1OMWA 3GYOA 4GZUA 3D8EA 2AEHA 1FAOA 2Z0QA 3HK0A 3ULCA 5D3XA 3A8QA 2UZSA 4HAXB 3ZDTA 1MKEA 5DHFB 1X86A 2YRYA 1XODA 1XX0A 1UEFA 1RJ2A 1ZC4B 4HB4B 1FHOA 3O96A 2L2IA 1QQGA 2J0KA 1P5TA 3NSUA 4F7UP 2VKIA 3V5WA 2ROZB 4IOYX 3EO2A 1EAZA 1J0WA 2RNRB 4HATB 3X23A 1BTNA 2COCA 5DIFB 4A6HA 2MFQA 3KZ1A 3PZDA 3DXCA 2D9XA 2LG1A 2I1JA 1H10A 1MIXA 1U2BA 5D3VA 3WA0A 4CHJA 2LULA 5JHGA 3GYPA 2D10A 1DBHA 4GMXB 3N7CA 2IFSA 4KAXB 3AU4A 3OANA 5EFXA 5KQ4A 1FHWA 3QIJA 1IRSA 4CHMA 1ZVRA 3G9WA 1P6SA 1K5DB 2Y7BA 1MK9B 5C5BB 3KRXA 5LOPB 2ROVA 2DKQA 1PMSA 2KUPA 1ISNA 3BJIA 4Z2MB 3SO6A 4XWXA 2LOZA 1X1GA 4KHAA 1XD4A 1UPRA 1U5FA 1AWEA 2MDXA 2RLOA 3T06A 1FHXA 2YT0A 5CLQB 1WGQA 2H7DA 3U8ZA 5JHHA 2Y8GA 3VIAA 1DDVA 1UNRA 4C0AA 1W1GA 2XQNM 1MPHA 2GCLA 2RVBB 3MDBC 3GF9A 1Y19B 5J3YA 3F0WA 2N0YA 1BTKA 5CLLB 2GJYA 3HW2B 4K2OA 1XCGA 1U29A 1B55A 3P6AA 1TXDA 2OQBA 3AJ4A 2D9YA 1X05A 4K17A 1TQZA 2W2XD 1FGYA 2K00A 2D2QA 2W2XC 3D8DA 4WVFB 1Y5OA 1UPQA 4MK0A 2ELBA 3ODWA 5HE0A 2I1KA 2EC1A 2YS5A 2J0JA 1XR0B 3D8FA 3DXDA 1MIZB 2YF0A 3BINA 1GG3A 3PP2A 3PVLA 2VSZA 3IVFA 1SGHA 2P8VA 4HAYB 1V88A 2KR9A 2M14A 5D27A 4PQ0A 2DHIA 1Q67A 4ZRIA 5HE2A 4HDOA 1WG7A 2DN6A 3PVUA 4HHVA 1DDWA 1GC6A 2Q13A 3SV1A 2P0DA 2P0FA 4GMVA 4K2PA 4ZRKA 1FB8A 2KGXB 4HAVB 2R0DA 5KCVA 3TO1A 2YS3A 3TW1A 4HDQA 3UZTA 5D3YA 1QC6A 2DHKA 2Z0PA 2DYQA 4PNKA 1PFJA 3CIKA 3JV3A 3ODOA 4A5KA 1UNQA 4DXAB 2I5CA 1KI1B 1X1FA 2COAA 2DLWA 1OQNA 2HE7A 3FM8C 1LW3A 4IAPA 2FJLA 3QBVB 2MKRA 3PVWA 1EF1A 1F5XA 2EJ8A 5C5BA 2EMSA 2ADZA 3PG7A 2VRWB 3SUZA 2OTXA 2DX5A 1BAKA 1RRPB 4Z2NA 4YL8A 4Y94A 4HB3B 1H4RA 1J19A 2GS0A 2YVCA 5JP4A 4MT7A 5C79A 4MY6A 2D4QA 3ML4A 4L6EA 4KVGB 2D11A 4GXBA 5GOWB 1M7EA 4NSWA 1ZM0A 4DX90 2DX1A 3FSSA 1Z87A 1ZC3B 2RSGA 5D3WA 5HE1A 2K2JA 3FEHA 4GYVA 1EVHA 2J59M 3HQCA 3P7ZA 3DXEA 1E5WA 2AL6A 2QKMA 2CRFA 1M7RA 1SHCA 1U5EA 1N3HA 4HB2B 4P7IA 2KCJA 2DA0A 3F5RA 3MPXA 2UVMA 5J3QA 1UNPA 1WI1A 3KY9A 1OY2A 3A8PA 5C6RA 1BWNA 1DYNA 3ZVRA 1WVHA 1XKEA 2K2UA 4GOUA 3VOQA 1V61A 2UZRA 1BY1A 3TVVA 3TCAA 3CXBB 2DYNA 2RUKB 2LKOA 2QKLA 3TFMA 3RCPA 2GCJA 1WJMA 4KHOA 4EJNA 4YONA 4A6KA 1FGZA 2DTCA 4GPTB 1PLSA 1K5GB 1I2HA 2NZ8B 4F7HA 4D0OA 1LB1A 3PEGA 5KQ1A 1GC7A 2M38A 2P0HA 3AU5A 4BBKA 3KSYA 1KZ7A 3PSCA 4H8SA 2D9WA 5LONB 1AQCA 4ZRJA 2DHJA 2NMBA 4WJ7A 2RGNB 5C16A 4CYEA 2H7EA 2N23A 4HAZB 2COFA 5L81A 2L1CA 3KRWA 2E2XA 1I7AA 2ZPYA 2CODA 2W2WA 2V76A 1EGXA 1ZSQA 1V5MA 2ELAA 1DDMA 4A6FB 4K81A 2DKPA 1W1DA 2Y8FA 2JP2A 1NU2A 2LYDA 3U7DA 2EMTA 5DHAB 2CY5A 2PZ1A 2X18A 3ODXA 1NI2A 1X11A 1NTYA 2G35A 4DBBA 1FOEA 4GN1A 1U5GA 1W1HA 3LJUX 2D9VA 1NTVA 3SYXA 4WSFA 2HTHB 1U5DA 2BCJA 3SNHA 2MWNB 3WYFB 1P3RA 4B6HA 4HAWB 4NY0A 4DX8A 5HE3A 2Z0OA 2LOXA 1TJ6A 3QWMA 4EMOA 4F7GA 5JLJB 4TYZA 5J3TA 5DH9B 3ULBA 2YS1A 1MK7B
chains in the Genus database with same CATH superfamily
4HB0B 1V5PA 2CY4A 4D0NB 2J0MA 3M1IB 2YT1A 5FI0A 3A98B 4EKUA 2D9ZA 1WJ1A 2R09A 1MAIA 2KIEA 2DFKA 2CAYA 2I5FA 1U27A 4KHBB 1V89A 2IYBA 1DROA 3OHMB 4A6FA 4HAUB 5FI1A 4IFSA 1V5UA 5DI9B 1WGUA 1KZGA 2YSZA 4TKNA 1OMWA 3GYOA 4GZUA 3D8EA 2AEHA 1FAOA 2Z0QA 3HK0A 3NW8A 3ULCA 5D3XA 3A8QA 2UZSA 4HAXB 5LG4B 3ZDTA 1MKEA 5DHFB 1X86A 2YRYA 1XODA 1XX0A 1UEFA 1RJ2A 1ZC4B 4HB4B 1FHOA 2FJUB 3O96A 2L2IA 1QQGA 2J0KA 1P5TA 3NSUA 4F7UP 2VKIA 2Z14A 3V5WA 2ROZB 4IOYX 3EO2A 1EAZA 5I2MA 1J0WA 2RNRB 4HATB 3X23A 1BTNA 2COCA 5DIFB 4A6HA 4GNKB 2MFQA 3KZ1A 3PZDA 3DXCA 2D9XA 2LG1A 3FVCA 2I1JA 1H10A 1MIXA 1U2BA 5IRSA 5D3VA 3WA0A 4CHJA 2LULA 3HSAA 5JHGA 3GYPA 2D10A 1DBHA 4GMXB 3N7CA 2IFSA 4KAXB 4OSNA 3AU4A 3OANA 5EFXA 5KQ4A 1FHWA 3QIJA 1IRSA 4CHMA 1ZVRA 3G9WA 1P6SA 1K5DB 2Y7BA 1MK9B 5C5BB 3KRXA 5LOPB 2ROVA 2NBVA 2DKQA 1PMSA 2KUPA 1ISNA 3BJIA 4Z2MB 3SO6A 4XWXA 2LOZA 1X1GA 4KHAA 1XD4A 1UPRA 1U5FA 1AWEA 2MDXA 2RLOA 3T06A 4QJ5B 1FHXA 2YT0A 5CLQB 1WGQA 2H7DA 3U8ZA 5JHHA 2Y8GA 3VIAA 1DDVA 1UNRA 4C0AA 1W1GA 2XQNM 1MPHA 2GCLA 2RVBB 3MDBC 3GF9A 1Y19B 5J3YA 3F0WA 2N0YA 2K49A 1BTKA 5CLLB 2GJYA 3HW2B 4K2OA 1XCGA 1U29A 2GUMA 1B55A 3P6AA 1TXDA 2OQBA 3AJ4A 2D9YA 1X05A 4K17A 1TQZA 2W2XD 1FGYA 2K00A 2D2QA 2W2XC 3D8DA 4WVFB 1Y5OA 1UPQA 2R2YA 4MK0A 2ELBA 3ODWA 5HE0A 2I1KA 2EC1A 2YS5A 2J0JA 1XR0B 3D8FA 3DXDA 1MIZB 2YF0A 3BINA 1GG3A 3PP2A 3PVLA 5M4YB 2VSZA 3IVFA 1SGHA 2P8VA 4HAYB 1V88A 2KR9A 2M14A 5D27A 4PQ0A 2DHIA 1Q67A 4ZRIA 5HE2A 4HDOA 1WG7A 2DN6A 3PVUA 4HHVA 1DDWA 1GC6A 2Q13A 3SV1A 2P0DA 2P0FA 4GMVA 4K2PA 4ZRKA 1FB8A 2KGXB 4HAVB 2R0DA 5KCVA 3TO1A 2YS3A 3U12A 3TW1A 4HDQA 3UZTA 5D3YA 4CSQA 2RRFA 1QC6A 2DHKA 2Z0PA 2DYQA 4PNKA 1PFJA 3CIKA 3JV3A 3ODOA 4A5KA 1UNQA 4DXAB 2I5CA 1KI1B 3NWAA 1ZYIA 1X1FA 2COAA 2DLWA 1OQNA 2HE7A 3FM8C 1LW3A 4IAPA 2FJLA 2KIGA 3QBVB 2MKRA 3PVWA 1EF1A 2ZKMX 1F5XA 2EJ8A 5C5BA 2EMSA 2ADZA 3PG7A 2VRWB 3DCXA 3SUZA 2OTXA 2DX5A 1BAKA 1RRPB 4Z2NA 4YL8A 4Y94A 4HB3B 1H4RA 1J19A 2GS0A 2YVCA 4HSIA 5JP4A 3B77A 4MT7A 5C79A 4MY6A 2D4QA 3ML4A 4L6EA 4KVGB 2D11A 4GXBA 5GOWB 1M7EA 4NSWA 5I2SA 3NWDA 1ZM0A 4DX90 2DX1A 3FSSA 1T77A 1Z87A 1ZC3B 3HIEA 2RSGA 2Z59A 5D3WA 5HE1A 4QXAB 2K2JA 4QJ3B 3FEHA 4GYVA 1EVHA 2J59M 3HQCA 3P7ZA 3DXEA 1E5WA 1MI1A 2AL6A 2QKMA 2CRFA 1M7RA 1SHCA 1U5EA 2Z13A 1N3HA 4HB2B 4P7IA 2KCJA 2DA0A 3F5RA 3MPXA 2UVMA 5J3QA 1UNPA 1WI1A 3KY9A 1OY2A 3A8PA 5C6RA 1BWNA 1DYNA 3ZVRA 1WVHA 1XKEA 2K2UA 4GOUA 3VOQA 2Z4DA 1V61A 2UZRA 1BY1A 3TVVA 3TCAA 2YT2A 3CXBB 2DYNA 2RUKB 2LKOA 2QKLA 3TFMA 3RCPA 2GCJA 1WJMA 4KHOA 4EJNA 4YONA 4A6KA 1FGZA 2DTCA 4GPTB 1PLSA 1K5GB 1I2HA 2NZ8B 4F7HA 4D0OA 1LB1A 3PEGA 5KQ1A 1GC7A 2M38A 2P0HA 3AU5A 4BBKA 3KSYA 1KZ7A 3PSCA 4QJ4B 4H8SA 2D9WA 5LONB 1AQCA 4ZRJA 2DHJA 4OT1A 2NMBA 4WJ7A 2RGNB 5C16A 4CYEA 2H7EA 3A58A 2N23A 4HAZB 2COFA 5L81A 2L1CA 2KR0A 3KRWA 2KUQA 2E2XA 1I7AA 4KHBA 2ZPYA 2K8EA 2CODA 2W2WA 2V76A 1EGXA 1ZSQA 1V5MA 2ELAA 1DDMA 4A6FB 4K81A 2DKPA 1W1DA 2Y8FA 2JP2A 1NU2A 2LYDA 3U7DA 2EMTA 4D6WA 5DHAB 2CY5A 2PZ1A 2X18A 3ODXA 4L1RA 1NI2A 1X11A 1NTYA 2G35A 4DBBA 1FOEA 4GN1A 1U5GA 1W1HA 3LJUX 2D9VA 1NTVA 3SYXA 4WSFA 2HTHB 1U5DA 2BCJA 3SNHA 2MWNB 3WYFB 1P3RA 4B6HA 4HAWB 4NY0A 4DX8A 4DIXA 5HE3A 2Z0OA 2LOXA 1TJ6A 3QWMA 4EMOA 4F7GA 5JLJB 4TYZA 5J3TA 5DH9B 3ULBA 2YS1A 3NWFA 1MK7B
chains in the Genus database with same CATH topology
4HB0B 1V5PA 2CY4A 4D0NB 2J0MA 3M1IB 2YT1A 5FI0A 3A98B 4EKUA 2D9ZA 1WJ1A 2R09A 1MAIA 2DFKA 2CAYA 2I5FA 1U27A 4KHBB 1V89A 2IYBA 1DROA 4A6FA 4HAUB 5FI1A 4IFSA 1V5UA 5DI9B 1WGUA 1KZGA 2YSZA 4TKNA 1OMWA 3GYOA 4GZUA 3D8EA 2AEHA 1FAOA 2Z0QA 3HK0A 3ULCA 5D3XA 3A8QA 2UZSA 4HAXB 3ZDTA 1MKEA 5DHFB 1X86A 2YRYA 1XODA 1XX0A 1UEFA 1RJ2A 1ZC4B 4HB4B 1FHOA 3O96A 2L2IA 1QQGA 2J0KA 1P5TA 3NSUA 4F7UP 2VKIA 3V5WA 2ROZB 4IOYX 3EO2A 1EAZA 1J0WA 2RNRB 4HATB 3X23A 1BTNA 2COCA 5DIFB 4A6HA 2MFQA 3KZ1A 3PZDA 3DXCA 2D9XA 2LG1A 2I1JA 1H10A 1MIXA 1U2BA 5D3VA 3WA0A 4CHJA 2LULA 5JHGA 3GYPA 2D10A 1DBHA 4GMXB 3N7CA 2IFSA 4KAXB 3AU4A 3OANA 5EFXA 5KQ4A 1FHWA 3QIJA 1IRSA 4CHMA 1ZVRA 3G9WA 1P6SA 1K5DB 2Y7BA 1MK9B 5C5BB 3KRXA 5LOPB 2ROVA 2DKQA 1PMSA 2KUPA 1ISNA 3BJIA 4Z2MB 3SO6A 4XWXA 2LOZA 1X1GA 4KHAA 1XD4A 1UPRA 1U5FA 1AWEA 2MDXA 2RLOA 3T06A 1FHXA 2YT0A 5CLQB 1WGQA 2H7DA 3U8ZA 5JHHA 2Y8GA 3VIAA 1DDVA 1UNRA 4C0AA 1W1GA 2XQNM 1MPHA 2GCLA 2RVBB 3MDBC 3GF9A 1Y19B 5J3YA 3F0WA 2N0YA 1BTKA 5CLLB 2GJYA 3HW2B 4K2OA 1XCGA 1U29A 1B55A 3P6AA 1TXDA 2OQBA 3AJ4A 2D9YA 1X05A 4K17A 1TQZA 2W2XD 1FGYA 2K00A 2D2QA 2W2XC 3D8DA 4WVFB 1Y5OA 1UPQA 4MK0A 2ELBA 3ODWA 5HE0A 2I1KA 2EC1A 2YS5A 2J0JA 1XR0B 3D8FA 3DXDA 1MIZB 2YF0A 3BINA 1GG3A 3PP2A 3PVLA 2VSZA 3IVFA 1SGHA 2P8VA 4HAYB 1V88A 2KR9A 2M14A 5D27A 4PQ0A 2DHIA 1Q67A 4ZRIA 5HE2A 4HDOA 1WG7A 2DN6A 3PVUA 4HHVA 1DDWA 1GC6A 2Q13A 3SV1A 2P0DA 2P0FA 4GMVA 4K2PA 4ZRKA 1FB8A 2KGXB 4HAVB 2R0DA 5KCVA 3TO1A 2YS3A 3TW1A 4HDQA 3UZTA 5D3YA 1QC6A 2DHKA 2Z0PA 2DYQA 4PNKA 1PFJA 3CIKA 3JV3A 3ODOA 4A5KA 1UNQA 4DXAB 2I5CA 1KI1B 1X1FA 2COAA 2DLWA 1OQNA 2HE7A 3FM8C 1LW3A 4IAPA 2FJLA 3QBVB 2MKRA 3PVWA 1EF1A 1F5XA 2EJ8A 5C5BA 2EMSA 2ADZA 3PG7A 2VRWB 3SUZA 2OTXA 2DX5A 1BAKA 1RRPB 4Z2NA 4YL8A 4Y94A 4HB3B 1H4RA 1J19A 2GS0A 2YVCA 5JP4A 4MT7A 5C79A 4MY6A 2D4QA 3ML4A 4L6EA 4KVGB 2D11A 4GXBA 5GOWB 1M7EA 4NSWA 1ZM0A 4DX90 2DX1A 3FSSA 1Z87A 1ZC3B 2RSGA 5D3WA 5HE1A 2K2JA 3FEHA 4GYVA 1EVHA 2J59M 3HQCA 3P7ZA 3DXEA 1E5WA 2AL6A 2QKMA 2CRFA 1M7RA 1SHCA 1U5EA 1N3HA 4HB2B 4P7IA 2KCJA 2DA0A 3F5RA 3MPXA 2UVMA 5J3QA 1UNPA 1WI1A 3KY9A 1OY2A 3A8PA 5C6RA 1BWNA 1DYNA 3ZVRA 1WVHA 1XKEA 2K2UA 4GOUA 3VOQA 1V61A 2UZRA 1BY1A 3TVVA 3TCAA 3CXBB 2DYNA 2RUKB 2LKOA 2QKLA 3TFMA 3RCPA 2GCJA 1WJMA 4KHOA 4EJNA 4YONA 4A6KA 1FGZA 2DTCA 4GPTB 1PLSA 1K5GB 1I2HA 2NZ8B 4F7HA 4D0OA 1LB1A 3PEGA 5KQ1A 1GC7A 2M38A 2P0HA 3AU5A 4BBKA 3KSYA 1KZ7A 3PSCA 4H8SA 2D9WA 5LONB 1AQCA 4ZRJA 2DHJA 2NMBA 4WJ7A 2RGNB 5C16A 4CYEA 2H7EA 2N23A 4HAZB 2COFA 5L81A 2L1CA 3KRWA 2E2XA 1I7AA 2ZPYA 2CODA 2W2WA 2V76A 1EGXA 1ZSQA 1V5MA 2ELAA 1DDMA 4A6FB 4K81A 2DKPA 1W1DA 2Y8FA 2JP2A 1NU2A 2LYDA 3U7DA 2EMTA 5DHAB 2CY5A 2PZ1A 2X18A 3ODXA 1NI2A 1X11A 1NTYA 2G35A 4DBBA 1FOEA 4GN1A 1U5GA 1W1HA 3LJUX 2D9VA 1NTVA 3SYXA 4WSFA 2HTHB 1U5DA 2BCJA 3SNHA 2MWNB 3WYFB 1P3RA 4B6HA 4HAWB 4NY0A 4DX8A 5HE3A 2Z0OA 2LOXA 1TJ6A 3QWMA 4EMOA 4F7GA 5JLJB 4TYZA 5J3TA 5DH9B 3ULBA 2YS1A 1MK7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HB0 B;  1V5P A;  2CY4 A;  4D0N B;  2J0M A;  3M1I B;  2YT1 A;  5FI0 A;  3A98 B;  4EKU A;  2D9Z A;  1WJ1 A;  2R09 A;  1MAI A;  2DFK A;  2CAY A;  2I5F A;  1U27 A;  4KHB B;  1V89 A;  2IYB A;  1DRO A;  4A6F A;  4HAU B;  5FI1 A;  4IFS A;  1V5U A;  5DI9 B;  1WGU A;  1KZG A;  2YSZ A;  4TKN A;  1OMW A;  3GYO A;  4GZU A;  3D8E A;  2AEH A;  1FAO A;  2Z0Q A;  3HK0 A;  3ULC A;  5D3X A;  3A8Q A;  2UZS A;  4HAX B;  3ZDT A;  1MKE A;  5DHF B;  1X86 A;  2YRY A;  1XOD A;  1XX0 A;  1UEF A;  1RJ2 A;  1ZC4 B;  4HB4 B;  1FHO A;  3O96 A;  2L2I A;  1QQG A;  2J0K A;  1P5T A;  3NSU A;  4F7U P;  2VKI A;  3V5W A;  2ROZ B;  4IOY X;  3EO2 A;  1EAZ A;  1J0W A;  2RNR B;  4HAT B;  3X23 A;  1BTN A;  2COC A;  5DIF B;  4A6H A;  2MFQ A;  3KZ1 A;  3PZD A;  3DXC A;  2D9X A;  2LG1 A;  2I1J A;  1H10 A;  1MIX A;  1U2B A;  5D3V A;  3WA0 A;  4CHJ A;  2LUL A;  5JHG A;  3GYP A;  2D10 A;  1DBH A;  4GMX B;  3N7C A;  2IFS A;  4KAX B;  3AU4 A;  3OAN A;  5EFX A;  5KQ4 A;  1FHW A;  3QIJ A;  1IRS A;  4CHM A;  1ZVR A;  3G9W A;  1P6S A;  1K5D B;  2Y7B A;  1MK9 B;  5C5B B;  3KRX A;  5LOP B;  2ROV A;  2DKQ A;  1PMS A;  2KUP A;  1ISN A;  3BJI A;  4Z2M B;  3SO6 A;  4XWX A;  2LOZ A;  1X1G A;  4KHA A;  1XD4 A;  1UPR A;  1U5F A;  1AWE A;  2MDX A;  2RLO A;  3T06 A;  1FHX A;  2YT0 A;  5CLQ B;  1WGQ A;  2H7D A;  3U8Z A;  5JHH A;  2Y8G A;  3VIA A;  1DDV A;  1UNR A;  4C0A A;  1W1G A;  2XQN M;  1MPH A;  2GCL A;  2RVB B;  3MDB C;  3GF9 A;  1Y19 B;  5J3Y A;  3F0W A;  2N0Y A;  1BTK A;  5CLL B;  2GJY A;  3HW2 B;  4K2O A;  1XCG A;  1U29 A;  1B55 A;  3P6A A;  1TXD A;  2OQB A;  3AJ4 A;  2D9Y A;  1X05 A;  4K17 A;  1TQZ A;  2W2X D;  1FGY A;  2K00 A;  2D2Q A;  2W2X C;  3D8D A;  4WVF B;  1Y5O A;  1UPQ A;  4MK0 A;  2ELB A;  3ODW A;  5HE0 A;  2I1K A;  2EC1 A;  2YS5 A;  2J0J A;  1XR0 B;  3D8F A;  3DXD A;  1MIZ B;  2YF0 A;  3BIN A;  1GG3 A;  3PP2 A;  3PVL A;  2VSZ A;  3IVF A;  1SGH A;  2P8V A;  4HAY B;  1V88 A;  2KR9 A;  2M14 A;  5D27 A;  4PQ0 A;  2DHI A;  1Q67 A;  4ZRI A;  5HE2 A;  4HDO A;  1WG7 A;  2DN6 A;  3PVU A;  4HHV A;  1DDW A;  1GC6 A;  2Q13 A;  3SV1 A;  2P0D A;  2P0F A;  4GMV A;  4K2P A;  4ZRK A;  1FB8 A;  2KGX B;  4HAV B;  2R0D A;  5KCV A;  3TO1 A;  2YS3 A;  3TW1 A;  4HDQ A;  3UZT A;  5D3Y A;  1QC6 A;  2DHK A;  2Z0P A;  2DYQ A;  4PNK A;  1PFJ A;  3CIK A;  3JV3 A;  3ODO A;  4A5K A;  1UNQ A;  4DXA B;  2I5C A;  1KI1 B;  1X1F A;  2COA A;  2DLW A;  1OQN A;  2HE7 A;  3FM8 C;  1LW3 A;  4IAP A;  2FJL A;  3QBV B;  2MKR A;  3PVW A;  1EF1 A;  1F5X A;  2EJ8 A;  5C5B A;  2EMS A;  2ADZ A;  3PG7 A;  2VRW B;  3SUZ A;  2OTX A;  2DX5 A;  1BAK A;  1RRP B;  4Z2N A;  4YL8 A;  4Y94 A;  4HB3 B;  1H4R A;  1J19 A;  2GS0 A;  2YVC A;  5JP4 A;  4MT7 A;  5C79 A;  4MY6 A;  2D4Q A;  3ML4 A;  4L6E A;  4KVG B;  2D11 A;  4GXB A;  5GOW B;  1M7E A;  4NSW A;  1ZM0 A;  4DX9 0;  2DX1 A;  3FSS A;  1Z87 A;  1ZC3 B;  2RSG A;  5D3W A;  5HE1 A;  2K2J A;  3FEH A;  4GYV A;  1EVH A;  2J59 M;  3HQC A;  3P7Z A;  3DXE A;  1E5W A;  2AL6 A;  2QKM A;  2CRF A;  1M7R A;  1SHC A;  1U5E A;  1N3H A;  4HB2 B;  4P7I A;  2KCJ A;  2DA0 A;  3F5R A;  3MPX A;  2UVM A;  5J3Q A;  1UNP A;  1WI1 A;  3KY9 A;  1OY2 A;  3A8P A;  5C6R A;  1BWN A;  1DYN A;  3ZVR A;  1WVH A;  1XKE A;  2K2U A;  4GOU A;  3VOQ A;  1V61 A;  2UZR A;  1BY1 A;  3TVV A;  3TCA A;  3CXB B;  2DYN A;  2RUK B;  2LKO A;  2QKL A;  3TFM A;  3RCP A;  2GCJ A;  1WJM A;  4KHO A;  4EJN A;  4YON A;  4A6K A;  1FGZ A;  2DTC A;  4GPT B;  1PLS A;  1K5G B;  1I2H A;  2NZ8 B;  4F7H A;  4D0O A;  1LB1 A;  3PEG A;  5KQ1 A;  1GC7 A;  2M38 A;  2P0H A;  3AU5 A;  4BBK A;  3KSY A;  1KZ7 A;  3PSC A;  4H8S A;  2D9W A;  5LON B;  1AQC A;  4ZRJ A;  2DHJ A;  2NMB A;  4WJ7 A;  2RGN B;  5C16 A;  4CYE A;  2H7E A;  2N23 A;  4HAZ B;  2COF A;  5L81 A;  2L1C A;  3KRW A;  2E2X A;  1I7A A;  2ZPY A;  2COD A;  2W2W A;  2V76 A;  1EGX A;  1ZSQ A;  1V5M A;  2ELA A;  1DDM A;  4A6F B;  4K81 A;  2DKP A;  1W1D A;  2Y8F A;  2JP2 A;  1NU2 A;  2LYD A;  3U7D A;  2EMT A;  5DHA B;  2CY5 A;  2PZ1 A;  2X18 A;  3ODX A;  1NI2 A;  1X11 A;  1NTY A;  2G35 A;  4DBB A;  1FOE A;  4GN1 A;  1U5G A;  1W1H A;  3LJU X;  2D9V A;  1NTV A;  3SYX A;  4WSF A;  2HTH B;  1U5D A;  2BCJ A;  3SNH A;  2MWN B;  3WYF B;  1P3R A;  4B6H A;  4HAW B;  4NY0 A;  4DX8 A;  5HE3 A;  2Z0O A;  2LOX A;  1TJ6 A;  3QWM A;  4EMO A;  4F7G A;  5JLJ B;  4TYZ A;  5J3T A;  5DH9 B;  3ULB A;  2YS1 A;  1MK7 B; 
#chains in the Genus database with same CATH topology
 4HB0 B;  1V5P A;  2CY4 A;  4D0N B;  2J0M A;  3M1I B;  2YT1 A;  5FI0 A;  3A98 B;  4EKU A;  2D9Z A;  1WJ1 A;  2R09 A;  1MAI A;  2KIE A;  2DFK A;  2CAY A;  2I5F A;  1U27 A;  4KHB B;  1V89 A;  2IYB A;  1DRO A;  3OHM B;  4A6F A;  4HAU B;  5FI1 A;  4IFS A;  1V5U A;  5DI9 B;  1WGU A;  1KZG A;  2YSZ A;  4TKN A;  1OMW A;  3GYO A;  4GZU A;  3D8E A;  2AEH A;  1FAO A;  2Z0Q A;  3HK0 A;  3NW8 A;  3ULC A;  5D3X A;  3A8Q A;  2UZS A;  4HAX B;  5LG4 B;  3ZDT A;  1MKE A;  5DHF B;  1X86 A;  2YRY A;  1XOD A;  1XX0 A;  1UEF A;  1RJ2 A;  1ZC4 B;  4HB4 B;  1FHO A;  2FJU B;  3O96 A;  2L2I A;  1QQG A;  2J0K A;  1P5T A;  3NSU A;  4F7U P;  2VKI A;  2Z14 A;  3V5W A;  2ROZ B;  4IOY X;  3EO2 A;  1EAZ A;  5I2M A;  1J0W A;  2RNR B;  4HAT B;  3X23 A;  1BTN A;  2COC A;  5DIF B;  4A6H A;  4GNK B;  2MFQ A;  3KZ1 A;  3PZD A;  3DXC A;  2D9X A;  2LG1 A;  3FVC A;  2I1J A;  1H10 A;  1MIX A;  1U2B A;  5IRS A;  5D3V A;  3WA0 A;  4CHJ A;  2LUL A;  3HSA A;  5JHG A;  3GYP A;  2D10 A;  1DBH A;  4GMX B;  3N7C A;  2IFS A;  4KAX B;  4OSN A;  3AU4 A;  3OAN A;  5EFX A;  5KQ4 A;  1FHW A;  3QIJ A;  1IRS A;  4CHM A;  1ZVR A;  3G9W A;  1P6S A;  1K5D B;  2Y7B A;  1MK9 B;  5C5B B;  3KRX A;  5LOP B;  2ROV A;  2NBV A;  2DKQ A;  1PMS A;  2KUP A;  1ISN A;  3BJI A;  4Z2M B;  3SO6 A;  4XWX A;  2LOZ A;  1X1G A;  4KHA A;  1XD4 A;  1UPR A;  1U5F A;  1AWE A;  2MDX A;  2RLO A;  3T06 A;  4QJ5 B;  1FHX A;  2YT0 A;  5CLQ B;  1WGQ A;  2H7D A;  3U8Z A;  5JHH A;  2Y8G A;  3VIA A;  1DDV A;  1UNR A;  4C0A A;  1W1G A;  2XQN M;  1MPH A;  2GCL A;  2RVB B;  3MDB C;  3GF9 A;  1Y19 B;  5J3Y A;  3F0W A;  2N0Y A;  2K49 A;  1BTK A;  5CLL B;  2GJY A;  3HW2 B;  4K2O A;  1XCG A;  1U29 A;  2GUM A;  1B55 A;  3P6A A;  1TXD A;  2OQB A;  3AJ4 A;  2D9Y A;  1X05 A;  4K17 A;  1TQZ A;  2W2X D;  1FGY A;  2K00 A;  2D2Q A;  2W2X C;  3D8D A;  4WVF B;  1Y5O A;  1UPQ A;  2R2Y A;  4MK0 A;  2ELB A;  3ODW A;  5HE0 A;  2I1K A;  2EC1 A;  2YS5 A;  2J0J A;  1XR0 B;  3D8F A;  3DXD A;  1MIZ B;  2YF0 A;  3BIN A;  1GG3 A;  3PP2 A;  3PVL A;  5M4Y B;  2VSZ A;  3IVF A;  1SGH A;  2P8V A;  4HAY B;  1V88 A;  2KR9 A;  2M14 A;  5D27 A;  4PQ0 A;  2DHI A;  1Q67 A;  4ZRI A;  5HE2 A;  4HDO A;  1WG7 A;  2DN6 A;  3PVU A;  4HHV A;  1DDW A;  1GC6 A;  2Q13 A;  3SV1 A;  2P0D A;  2P0F A;  4GMV A;  4K2P A;  4ZRK A;  1FB8 A;  2KGX B;  4HAV B;  2R0D A;  5KCV A;  3TO1 A;  2YS3 A;  3U12 A;  3TW1 A;  4HDQ A;  3UZT A;  5D3Y A;  4CSQ A;  2RRF A;  1QC6 A;  2DHK A;  2Z0P A;  2DYQ A;  4PNK A;  1PFJ A;  3CIK A;  3JV3 A;  3ODO A;  4A5K A;  1UNQ A;  4DXA B;  2I5C A;  1KI1 B;  3NWA A;  1ZYI A;  1X1F A;  2COA A;  2DLW A;  1OQN A;  2HE7 A;  3FM8 C;  1LW3 A;  4IAP A;  2FJL A;  2KIG A;  3QBV B;  2MKR A;  3PVW A;  1EF1 A;  2ZKM X;  1F5X A;  2EJ8 A;  5C5B A;  2EMS A;  2ADZ A;  3PG7 A;  2VRW B;  3DCX A;  3SUZ A;  2OTX A;  2DX5 A;  1BAK A;  1RRP B;  4Z2N A;  4YL8 A;  4Y94 A;  4HB3 B;  1H4R A;  1J19 A;  2GS0 A;  2YVC A;  4HSI A;  5JP4 A;  3B77 A;  4MT7 A;  5C79 A;  4MY6 A;  2D4Q A;  3ML4 A;  4L6E A;  4KVG B;  2D11 A;  4GXB A;  5GOW B;  1M7E A;  4NSW A;  5I2S A;  3NWD A;  1ZM0 A;  4DX9 0;  2DX1 A;  3FSS A;  1T77 A;  1Z87 A;  1ZC3 B;  3HIE A;  2RSG A;  2Z59 A;  5D3W A;  5HE1 A;  4QXA B;  2K2J A;  4QJ3 B;  3FEH A;  4GYV A;  1EVH A;  2J59 M;  3HQC A;  3P7Z A;  3DXE A;  1E5W A;  1MI1 A;  2AL6 A;  2QKM A;  2CRF A;  1M7R A;  1SHC A;  1U5E A;  2Z13 A;  1N3H A;  4HB2 B;  4P7I A;  2KCJ A;  2DA0 A;  3F5R A;  3MPX A;  2UVM A;  5J3Q A;  1UNP A;  1WI1 A;  3KY9 A;  1OY2 A;  3A8P A;  5C6R A;  1BWN A;  1DYN A;  3ZVR A;  1WVH A;  1XKE A;  2K2U A;  4GOU A;  3VOQ A;  2Z4D A;  1V61 A;  2UZR A;  1BY1 A;  3TVV A;  3TCA A;  2YT2 A;  3CXB B;  2DYN A;  2RUK B;  2LKO A;  2QKL A;  3TFM A;  3RCP A;  2GCJ A;  1WJM A;  4KHO A;  4EJN A;  4YON A;  4A6K A;  1FGZ A;  2DTC A;  4GPT B;  1PLS A;  1K5G B;  1I2H A;  2NZ8 B;  4F7H A;  4D0O A;  1LB1 A;  3PEG A;  5KQ1 A;  1GC7 A;  2M38 A;  2P0H A;  3AU5 A;  4BBK A;  3KSY A;  1KZ7 A;  3PSC A;  4QJ4 B;  4H8S A;  2D9W A;  5LON B;  1AQC A;  4ZRJ A;  2DHJ A;  4OT1 A;  2NMB A;  4WJ7 A;  2RGN B;  5C16 A;  4CYE A;  2H7E A;  3A58 A;  2N23 A;  4HAZ B;  2COF A;  5L81 A;  2L1C A;  2KR0 A;  3KRW A;  2KUQ A;  2E2X A;  1I7A A;  4KHB A;  2ZPY A;  2K8E A;  2COD A;  2W2W A;  2V76 A;  1EGX A;  1ZSQ A;  1V5M A;  2ELA A;  1DDM A;  4A6F B;  4K81 A;  2DKP A;  1W1D A;  2Y8F A;  2JP2 A;  1NU2 A;  2LYD A;  3U7D A;  2EMT A;  4D6W A;  5DHA B;  2CY5 A;  2PZ1 A;  2X18 A;  3ODX A;  4L1R A;  1NI2 A;  1X11 A;  1NTY A;  2G35 A;  4DBB A;  1FOE A;  4GN1 A;  1U5G A;  1W1H A;  3LJU X;  2D9V A;  1NTV A;  3SYX A;  4WSF A;  2HTH B;  1U5D A;  2BCJ A;  3SNH A;  2MWN B;  3WYF B;  1P3R A;  4B6H A;  4HAW B;  4NY0 A;  4DX8 A;  4DIX A;  5HE3 A;  2Z0O A;  2LOX A;  1TJ6 A;  3QWM A;  4EMO A;  4F7G A;  5JLJ B;  4TYZ A;  5J3T A;  5DH9 B;  3ULB A;  2YS1 A;  3NWF A;  1MK7 B; 
#chains in the Genus database with same CATH homology
 4HB0 B;  1V5P A;  2CY4 A;  4D0N B;  2J0M A;  3M1I B;  2YT1 A;  5FI0 A;  3A98 B;  4EKU A;  2D9Z A;  1WJ1 A;  2R09 A;  1MAI A;  2DFK A;  2CAY A;  2I5F A;  1U27 A;  4KHB B;  1V89 A;  2IYB A;  1DRO A;  4A6F A;  4HAU B;  5FI1 A;  4IFS A;  1V5U A;  5DI9 B;  1WGU A;  1KZG A;  2YSZ A;  4TKN A;  1OMW A;  3GYO A;  4GZU A;  3D8E A;  2AEH A;  1FAO A;  2Z0Q A;  3HK0 A;  3ULC A;  5D3X A;  3A8Q A;  2UZS A;  4HAX B;  3ZDT A;  1MKE A;  5DHF B;  1X86 A;  2YRY A;  1XOD A;  1XX0 A;  1UEF A;  1RJ2 A;  1ZC4 B;  4HB4 B;  1FHO A;  3O96 A;  2L2I A;  1QQG A;  2J0K A;  1P5T A;  3NSU A;  4F7U P;  2VKI A;  3V5W A;  2ROZ B;  4IOY X;  3EO2 A;  1EAZ A;  1J0W A;  2RNR B;  4HAT B;  3X23 A;  1BTN A;  2COC A;  5DIF B;  4A6H A;  2MFQ A;  3KZ1 A;  3PZD A;  3DXC A;  2D9X A;  2LG1 A;  2I1J A;  1H10 A;  1MIX A;  1U2B A;  5D3V A;  3WA0 A;  4CHJ A;  2LUL A;  5JHG A;  3GYP A;  2D10 A;  1DBH A;  4GMX B;  3N7C A;  2IFS A;  4KAX B;  3AU4 A;  3OAN A;  5EFX A;  5KQ4 A;  1FHW A;  3QIJ A;  1IRS A;  4CHM A;  1ZVR A;  3G9W A;  1P6S A;  1K5D B;  2Y7B A;  1MK9 B;  5C5B B;  3KRX A;  5LOP B;  2ROV A;  2DKQ A;  1PMS A;  2KUP A;  1ISN A;  3BJI A;  4Z2M B;  3SO6 A;  4XWX A;  2LOZ A;  1X1G A;  4KHA A;  1XD4 A;  1UPR A;  1U5F A;  1AWE A;  2MDX A;  2RLO A;  3T06 A;  1FHX A;  2YT0 A;  5CLQ B;  1WGQ A;  2H7D A;  3U8Z A;  5JHH A;  2Y8G A;  3VIA A;  1DDV A;  1UNR A;  4C0A A;  1W1G A;  2XQN M;  1MPH A;  2GCL A;  2RVB B;  3MDB C;  3GF9 A;  1Y19 B;  5J3Y A;  3F0W A;  2N0Y A;  1BTK A;  5CLL B;  2GJY A;  3HW2 B;  4K2O A;  1XCG A;  1U29 A;  1B55 A;  3P6A A;  1TXD A;  2OQB A;  3AJ4 A;  2D9Y A;  1X05 A;  4K17 A;  1TQZ A;  2W2X D;  1FGY A;  2K00 A;  2D2Q A;  2W2X C;  3D8D A;  4WVF B;  1Y5O A;  1UPQ A;  4MK0 A;  2ELB A;  3ODW A;  5HE0 A;  2I1K A;  2EC1 A;  2YS5 A;  2J0J A;  1XR0 B;  3D8F A;  3DXD A;  1MIZ B;  2YF0 A;  3BIN A;  1GG3 A;  3PP2 A;  3PVL A;  2VSZ A;  3IVF A;  1SGH A;  2P8V A;  4HAY B;  1V88 A;  2KR9 A;  2M14 A;  5D27 A;  4PQ0 A;  2DHI A;  1Q67 A;  4ZRI A;  5HE2 A;  4HDO A;  1WG7 A;  2DN6 A;  3PVU A;  4HHV A;  1DDW A;  1GC6 A;  2Q13 A;  3SV1 A;  2P0D A;  2P0F A;  4GMV A;  4K2P A;  4ZRK A;  1FB8 A;  2KGX B;  4HAV B;  2R0D A;  5KCV A;  3TO1 A;  2YS3 A;  3TW1 A;  4HDQ A;  3UZT A;  5D3Y A;  1QC6 A;  2DHK A;  2Z0P A;  2DYQ A;  4PNK A;  1PFJ A;  3CIK A;  3JV3 A;  3ODO A;  4A5K A;  1UNQ A;  4DXA B;  2I5C A;  1KI1 B;  1X1F A;  2COA A;  2DLW A;  1OQN A;  2HE7 A;  3FM8 C;  1LW3 A;  4IAP A;  2FJL A;  3QBV B;  2MKR A;  3PVW A;  1EF1 A;  1F5X A;  2EJ8 A;  5C5B A;  2EMS A;  2ADZ A;  3PG7 A;  2VRW B;  3SUZ A;  2OTX A;  2DX5 A;  1BAK A;  1RRP B;  4Z2N A;  4YL8 A;  4Y94 A;  4HB3 B;  1H4R A;  1J19 A;  2GS0 A;  2YVC A;  5JP4 A;  4MT7 A;  5C79 A;  4MY6 A;  2D4Q A;  3ML4 A;  4L6E A;  4KVG B;  2D11 A;  4GXB A;  5GOW B;  1M7E A;  4NSW A;  1ZM0 A;  4DX9 0;  2DX1 A;  3FSS A;  1Z87 A;  1ZC3 B;  2RSG A;  5D3W A;  5HE1 A;  2K2J A;  3FEH A;  4GYV A;  1EVH A;  2J59 M;  3HQC A;  3P7Z A;  3DXE A;  1E5W A;  2AL6 A;  2QKM A;  2CRF A;  1M7R A;  1SHC A;  1U5E A;  1N3H A;  4HB2 B;  4P7I A;  2KCJ A;  2DA0 A;  3F5R A;  3MPX A;  2UVM A;  5J3Q A;  1UNP A;  1WI1 A;  3KY9 A;  1OY2 A;  3A8P A;  5C6R A;  1BWN A;  1DYN A;  3ZVR A;  1WVH A;  1XKE A;  2K2U A;  4GOU A;  3VOQ A;  1V61 A;  2UZR A;  1BY1 A;  3TVV A;  3TCA A;  3CXB B;  2DYN A;  2RUK B;  2LKO A;  2QKL A;  3TFM A;  3RCP A;  2GCJ A;  1WJM A;  4KHO A;  4EJN A;  4YON A;  4A6K A;  1FGZ A;  2DTC A;  4GPT B;  1PLS A;  1K5G B;  1I2H A;  2NZ8 B;  4F7H A;  4D0O A;  1LB1 A;  3PEG A;  5KQ1 A;  1GC7 A;  2M38 A;  2P0H A;  3AU5 A;  4BBK A;  3KSY A;  1KZ7 A;  3PSC A;  4H8S A;  2D9W A;  5LON B;  1AQC A;  4ZRJ A;  2DHJ A;  2NMB A;  4WJ7 A;  2RGN B;  5C16 A;  4CYE A;  2H7E A;  2N23 A;  4HAZ B;  2COF A;  5L81 A;  2L1C A;  3KRW A;  2E2X A;  1I7A A;  2ZPY A;  2COD A;  2W2W A;  2V76 A;  1EGX A;  1ZSQ A;  1V5M A;  2ELA A;  1DDM A;  4A6F B;  4K81 A;  2DKP A;  1W1D A;  2Y8F A;  2JP2 A;  1NU2 A;  2LYD A;  3U7D A;  2EMT A;  5DHA B;  2CY5 A;  2PZ1 A;  2X18 A;  3ODX A;  1NI2 A;  1X11 A;  1NTY A;  2G35 A;  4DBB A;  1FOE A;  4GN1 A;  1U5G A;  1W1H A;  3LJU X;  2D9V A;  1NTV A;  3SYX A;  4WSF A;  2HTH B;  1U5D A;  2BCJ A;  3SNH A;  2MWN B;  3WYF B;  1P3R A;  4B6H A;  4HAW B;  4NY0 A;  4DX8 A;  5HE3 A;  2Z0O A;  2LOX A;  1TJ6 A;  3QWM A;  4EMO A;  4F7G A;  5JLJ B;  4TYZ A;  5J3T A;  5DH9 B;  3ULB A;  2YS1 A;  1MK7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...