3ODOA

Crystal structure of the dh/ph domains of p115-rhogef
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
370
structure length
370
Chain Sequence
QTSPPGWRELVPPDTLHSLPKSQVKRQEVISELLVTEAAHVRMLRVLHDLFFQPMAECLFFPLEELQNIFPSLDELIEVHSLFLDRLMKRRQESGYLIEEIGDVLLARFDGAEGSWFQKISSRFCSRQSFALEQLKAKQRKDPRFCAFVQEAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEEPTEREKVELAAECCREILHHVNQAVRDMEDLLRLKDYQRRLDLSHLRQSSDPMLSEFKNLDITKKKLVHEGPLTWRVTKDKAVEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLRPVLRLTSAMTREVATDHKAFYVLFTWDQEAQIYELVAQTVSERKNWCALITETAGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rho guanine nucleotide exchange factor 1
publication title Modulation of a GEF switch: Autoinhibition of the intrinsic guanine nucleotide exchange activity of p115-RhoREF
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 126
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00621 RhoGEF RhoGEF domain
A PF17838 PH_16 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 3odoA01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3odoA02
2COCA 4YONA 3PVLA 1DYNA 2LKOA 3FSSA 1FOEA 3GYPA 4A6KA 4MK0A 3ULCA 1U5EA 2E2XA 1U27A 3AU5A 3SYXA 1E5WA 2KR9A 4HHVA 4A6FB 3ODOA 2X18A 5DH9B 2CODA 4A5KA 3FM8C 2UZSA 2H7DA 1BAKA 2ADZA 2YS3A 1W1DA 5DI9B 2VKIA 3F5RA 2ROZB 1Y5OA 3DXEA 3PZDA 4TYZA 2MDXA 3ML4A 4NY0A 5C79A 2RVBB 1TQZA 1OMWA 3D8FA 4HAVB 2Z0OA 1I2HA 3AJ4A 4HB2B 2DTCA 2D9WA 2DX5A 5JHHA 1TXDA 1WVHA 2YSZA 2QKLA 4Z2NA 5DIFB 4HDOA 2R0DA 2EMTA 1M7EA 5JHGA 3AU4A 1BTNA 1FGYA 1M7RA 2LG1A 2LOZA 4HAYB 5KCVA 4DBBA 1MK7B 1GC6A 4KHAA 3TFMA 1WG7A 5JLJB 5HE2A 2EMSA 1GG3A 2KCJA 3ULBA 1DROA 1ZSQA 4XWXA 4F7UP 4WJ7A 3U8ZA 2COFA 2DHIA 1MK9B 2RGNB 1NTVA 1X1GA 4TKNA 4HAZB 3TVVA 4EJNA 3GYOA 1WI1A 3BJIA 5J3TA 2D10A 2GS0A 5CLQB 3KZ1A 1U29A 2K00A 2ROVA 2I5FA 3P7ZA 1P5TA 1Z87A 4A6HA 1K5GB 1P6SA 4IFSA 4K81A 4IOYX 2AL6A 1V5MA 5LOPB 2I5CA 3ZDTA 2DKQA 1I7AA 3HK0A 3KRWA 2DFKA 1KZGA 4GMVA 3FEHA 1UEFA 3TW1A 3V5WA 5DHFB 1UNRA 3KRXA 4IAPA 2J0MA 1EF1A 2YRYA 1U5GA 1EVHA 3IVFA 5GOWB 2YT1A 2EC1A 2DX1A 3TCAA 4NSWA 2CRFA 1OQNA 3SNHA 5D3YA 2RNRB 2R09A 4PQ0A 2UVMA 2UZRA 2IFSA 1BTKA 1Q67A 3U7DA 2D9XA 2EJ8A 3VIAA 1LB1A 4DX90 2LULA 2OQBA 1RRPB 2J59M 2D9ZA 1MPHA 1UNPA 2J0JA 1MKEA 1W1HA 1MAIA 1WGUA 2L1CA 2ELBA 1W1GA 2Z0QA 2GCJA 5C5BB 3TO1A 1FGZA 2Q13A 3D8DA 1U5DA 1V5UA 2KGXB 3PVUA 5JP4A 4K2OA 2I1KA 3DXCA 1V61A 4HB4B 2CAYA 4K2PA 4HAXB 2DN6A 2RSGA 2P0FA 5EFXA 2W2XD 2J0KA 4C0AA 5J3QA 4MY6A 5HE1A 4CHJA 4D0NB 5J3YA 4GOUA 3HW2B 2DA0A 3O96A 4HAWB 1FHWA 3DXDA 1UNQA 5KQ4A 1LW3A 1J0WA 2JP2A 2Y8FA 2P0HA 2K2UA 2D4QA 1V5PA 3T06A 1XX0A 3M1IB 1H4RA 2K2JA 1J19A 4ZRKA 2P0DA 2Z0PA 1RJ2A 2XQNM 1TJ6A 3ZVRA 4CHMA 1XCGA 4H8SA 5D3WA 1EAZA 2Y8GA 4HB3B 4MT7A 3PP2A 2DLWA 1PLSA 1FHXA 4D0OA 4HB0B 1U5FA 2M38A 5HE0A 1XR0B 4KHOA 3A8QA 1V89A 3JV3A 1N3HA 5DHAB 2DKPA 3PSCA 4A6FA 1ZM0A 3SV1A 2GCLA 3EO2A 1XODA 2D9VA 2N23A 2I1JA 1NU2A 2PZ1A 1ISNA 2IYBA 2H7EA 2YVCA 3HQCA 4P7IA 1ZC4B 3F0WA 3QWMA 4EMOA 4ZRJA 3MPXA 1PFJA 5HE3A 3CXBB 1X86A 2GJYA 1SHCA 1UPQA 3VOQA 2MKRA 3UZTA 1P3RA 4GPTB 4CYEA 4DX8A 3ODWA 1X1FA 2CY4A 5LONB 1F5XA 4F7GA 5C16A 4ZRIA 2D2QA 1WGQA 2YF0A 1KI1B 2MWNB 3CIKA 4F7HA 1AWEA 1OY2A 1MIZB 2BCJA 2RUKB 1SGHA 2D9YA 2YT0A 2DYQA 4KVGB 2VSZA 1GC7A 1QC6A 3OANA 3X23A 3BINA 2D11A 4GMXB 3WYFB 3MDBC 2VRWB 4DXAB 1DDVA 1B55A 1Y19B 1IRSA 4EKUA 2P8VA 3N7CA 5CLLB 1H10A 1FHOA 5D27A 3GF9A 1EGXA 1PMSA 3KSYA 2ELAA 3A8PA 2LOXA 2M14A 2DHKA 1QQGA 2W2XC 2L2IA 1UPRA 2NZ8B 2ZPYA 3WA0A 1X11A 2HE7A 2CY5A 2W2WA 3LJUX 1DDWA 3PVWA 2AEHA 2COAA 3QIJA 2DYNA 2YS5A 4B6HA 3A98B 4GZUA 5FI1A 1DDMA 1AQCA 4WSFA 2OTXA 1DBHA 4GXBA 3P6AA 1WJMA 4GYVA 1FB8A 1XKEA 1NI2A 4BBKA 1X05A 2YS1A 4HATB 2HTHB 1NTYA 1FAOA 1K5DB 1V88A 3SO6A 1ZVRA 4YL8A 2V76A 1U2BA 5D3XA 2FJLA 4KHBB 5C6RA 2RLOA 2MFQA 2N0YA 1BWNA 3NSUA 3QBVB 3SUZA 4HAUB 4Z2MB 5C5BA 2LYDA 4K17A 4GN1A 2QKMA 5L81A 1WJ1A 1XD4A 2KUPA 3PG7A 3KY9A 2Y7BA 1KZ7A 2NMBA 4L6EA 4PNKA 1MIXA 3D8EA 1BY1A 1ZC3B 5FI0A 4HDQA 2G35A 3PEGA 2DHJA 3ODXA 4KAXB 5KQ1A 4WVFB 4Y94A 5D3VA 3RCPA 3G9WA
chains in the Genus database with same CATH superfamily
2COCA 4YONA 3PVLA 1DYNA 2LKOA 3FSSA 1FOEA 3GYPA 4A6KA 4MK0A 3ULCA 1U5EA 2E2XA 1U27A 3AU5A 3SYXA 1E5WA 1T77A 2KR9A 4HHVA 4A6FB 3ODOA 5IRSA 2X18A 5DH9B 2CODA 4A5KA 3OHMB 3FM8C 4QJ4B 2UZSA 2H7DA 1BAKA 2ADZA 2YS3A 2YT2A 1W1DA 5DI9B 2VKIA 3F5RA 2ROZB 1Y5OA 3DXEA 3PZDA 4TYZA 2MDXA 3ML4A 4NY0A 5C79A 2RVBB 1TQZA 1OMWA 3D8FA 4HAVB 2Z0OA 1I2HA 1ZYIA 3AJ4A 4HB2B 2DTCA 2D9WA 4DIXA 5M4YB 2DX5A 5JHHA 3DCXA 1TXDA 1WVHA 2YSZA 2QKLA 4Z2NA 5DIFB 2K49A 4HDOA 2R0DA 2EMTA 1M7EA 5JHGA 3AU4A 1BTNA 1FGYA 1M7RA 2LG1A 2LOZA 4HAYB 5KCVA 4DBBA 1MK7B 1GC6A 4KHAA 3TFMA 1WG7A 5JLJB 5HE2A 3B77A 2EMSA 1GG3A 2KCJA 3ULBA 1DROA 1ZSQA 4XWXA 4F7UP 4WJ7A 3U8ZA 2COFA 2DHIA 1MK9B 2RGNB 1NTVA 1X1GA 4TKNA 4HAZB 3TVVA 4EJNA 3GYOA 1WI1A 3BJIA 5J3TA 2D10A 2GS0A 5CLQB 3KZ1A 1U29A 2K00A 2ROVA 2I5FA 3P7ZA 1P5TA 1Z87A 4A6HA 4GNKB 1K5GB 1P6SA 4IFSA 4K81A 4IOYX 2AL6A 1V5MA 5LOPB 2I5CA 3ZDTA 4D6WA 2DKQA 3U12A 1I7AA 3FVCA 3HK0A 3KRWA 2DFKA 1KZGA 4GMVA 3FEHA 1UEFA 3TW1A 3V5WA 2KUQA 5DHFB 1UNRA 3KRXA 4IAPA 2J0MA 1EF1A 2YRYA 1U5GA 1EVHA 3IVFA 3NWFA 5GOWB 2YT1A 2EC1A 2DX1A 3TCAA 4NSWA 2CRFA 1OQNA 2Z13A 3SNHA 5D3YA 2RNRB 2R09A 4PQ0A 2UVMA 2UZRA 2IFSA 2Z14A 1BTKA 1Q67A 3U7DA 2D9XA 2EJ8A 3VIAA 1LB1A 4DX90 2LULA 2OQBA 1RRPB 2J59M 2D9ZA 1MPHA 1UNPA 2J0JA 1MKEA 1W1HA 1MAIA 1WGUA 2L1CA 2ELBA 1W1GA 2Z0QA 2GCJA 5C5BB 3TO1A 4CSQA 1FGZA 2Q13A 3D8DA 1U5DA 1V5UA 2KGXB 3PVUA 5JP4A 4K2OA 2I1KA 3DXCA 1V61A 2FJUB 4HB4B 2CAYA 4K2PA 4HAXB 2DN6A 2RSGA 2P0FA 5I2MA 5EFXA 2R2YA 2W2XD 2J0KA 4C0AA 5J3QA 4MY6A 5HE1A 2KIGA 4CHJA 4D0NB 2KR0A 5J3YA 4GOUA 3HW2B 2DA0A 3O96A 4HAWB 1FHWA 3DXDA 1UNQA 5KQ4A 2RRFA 1LW3A 1J0WA 2JP2A 2Y8FA 2P0HA 2K2UA 2K8EA 2D4QA 1V5PA 3T06A 1XX0A 3M1IB 1H4RA 2K2JA 1J19A 4ZRKA 2P0DA 2Z0PA 1RJ2A 2XQNM 1TJ6A 3ZVRA 3NW8A 3NWDA 4CHMA 1XCGA 4H8SA 5D3WA 1EAZA 4QJ3B 4OSNA 2Y8GA 4HB3B 4MT7A 3PP2A 2DLWA 1PLSA 1FHXA 4D0OA 4HB0B 1U5FA 2M38A 5HE0A 1XR0B 4KHOA 3A8QA 1V89A 3JV3A 1N3HA 5DHAB 2DKPA 3PSCA 4A6FA 1ZM0A 3SV1A 2GCLA 3EO2A 1XODA 2D9VA 2N23A 2I1JA 1NU2A 2PZ1A 1ISNA 2IYBA 2H7EA 2YVCA 3HQCA 4P7IA 1ZC4B 3F0WA 3QWMA 4EMOA 4ZRJA 3MPXA 1PFJA 5HE3A 1MI1A 1X86A 3CXBB 2GJYA 1SHCA 1UPQA 5I2SA 3VOQA 2MKRA 3UZTA 1P3RA 4GPTB 4CYEA 2GUMA 4DX8A 3ODWA 1X1FA 3HIEA 2CY4A 5LONB 1F5XA 2NBVA 4F7GA 5C16A 4ZRIA 2D2QA 1WGQA 2YF0A 1KI1B 2MWNB 3CIKA 4F7HA 1AWEA 1OY2A 1MIZB 4HSIA 2BCJA 2RUKB 1SGHA 2D9YA 2YT0A 2DYQA 4KVGB 2VSZA 1GC7A 1QC6A 3OANA 3X23A 3BINA 2D11A 4GMXB 3WYFB 3MDBC 2VRWB 4DXAB 1DDVA 1B55A 1Y19B 1IRSA 4EKUA 2P8VA 3N7CA 5CLLB 1H10A 1FHOA 4KHBA 5D27A 3GF9A 1EGXA 1PMSA 3KSYA 2ELAA 3A8PA 2LOXA 2M14A 2DHKA 4L1RA 1QQGA 2W2XC 2L2IA 1UPRA 2NZ8B 2ZPYA 3WA0A 1X11A 2HE7A 2CY5A 2W2WA 2Z59A 3LJUX 1DDWA 3PVWA 2AEHA 5LG4B 2COAA 3QIJA 2DYNA 2YS5A 4B6HA 3A98B 4GZUA 5FI1A 3NWAA 1DDMA 1AQCA 4WSFA 2OTXA 1DBHA 4GXBA 3P6AA 1WJMA 4GYVA 1FB8A 1XKEA 1NI2A 2KIEA 4BBKA 1X05A 2YS1A 4HATB 3HSAA 2HTHB 1NTYA 1FAOA 4OT1A 1K5DB 1V88A 3SO6A 1ZVRA 4YL8A 2V76A 1U2BA 2Z4DA 5D3XA 4QJ5B 2FJLA 4KHBB 5C6RA 2RLOA 2MFQA 2N0YA 1BWNA 3NSUA 3QBVB 3SUZA 4HAUB 4Z2MB 5C5BA 2LYDA 4K17A 4GN1A 3A58A 2QKMA 5L81A 1WJ1A 1XD4A 2KUPA 3PG7A 3KY9A 2Y7BA 1KZ7A 2NMBA 4L6EA 4PNKA 1MIXA 3D8EA 1BY1A 1ZC3B 5FI0A 4HDQA 2G35A 3PEGA 4QXAB 2DHJA 3ODXA 4KAXB 5KQ1A 4WVFB 4Y94A 5D3VA 3RCPA 2ZKMX 3G9WA
chains in the Genus database with same CATH topology
2COCA 4YONA 3PVLA 1DYNA 2LKOA 3FSSA 1FOEA 3GYPA 4A6KA 4MK0A 3ULCA 1U5EA 2E2XA 1U27A 3AU5A 3SYXA 1E5WA 2KR9A 4HHVA 4A6FB 3ODOA 2X18A 5DH9B 2CODA 4A5KA 3FM8C 2UZSA 2H7DA 1BAKA 2ADZA 2YS3A 1W1DA 5DI9B 2VKIA 3F5RA 2ROZB 1Y5OA 3DXEA 3PZDA 4TYZA 2MDXA 3ML4A 4NY0A 5C79A 2RVBB 1TQZA 1OMWA 3D8FA 4HAVB 2Z0OA 1I2HA 3AJ4A 4HB2B 2DTCA 2D9WA 2DX5A 5JHHA 1TXDA 1WVHA 2YSZA 2QKLA 4Z2NA 5DIFB 4HDOA 2R0DA 2EMTA 1M7EA 5JHGA 3AU4A 1BTNA 1FGYA 1M7RA 2LG1A 2LOZA 4HAYB 5KCVA 4DBBA 1MK7B 1GC6A 4KHAA 3TFMA 1WG7A 5JLJB 5HE2A 2EMSA 1GG3A 2KCJA 3ULBA 1DROA 1ZSQA 4XWXA 4F7UP 4WJ7A 3U8ZA 2COFA 2DHIA 1MK9B 2RGNB 1NTVA 1X1GA 4TKNA 4HAZB 3TVVA 4EJNA 3GYOA 1WI1A 3BJIA 5J3TA 2D10A 2GS0A 5CLQB 3KZ1A 1U29A 2K00A 2ROVA 2I5FA 3P7ZA 1P5TA 1Z87A 4A6HA 1K5GB 1P6SA 4IFSA 4K81A 4IOYX 2AL6A 1V5MA 5LOPB 2I5CA 3ZDTA 2DKQA 1I7AA 3HK0A 3KRWA 2DFKA 1KZGA 4GMVA 3FEHA 1UEFA 3TW1A 3V5WA 5DHFB 1UNRA 3KRXA 4IAPA 2J0MA 1EF1A 2YRYA 1U5GA 1EVHA 3IVFA 5GOWB 2YT1A 2EC1A 2DX1A 3TCAA 4NSWA 2CRFA 1OQNA 3SNHA 5D3YA 2RNRB 2R09A 4PQ0A 2UVMA 2UZRA 2IFSA 1BTKA 1Q67A 3U7DA 2D9XA 2EJ8A 3VIAA 1LB1A 4DX90 2LULA 2OQBA 1RRPB 2J59M 2D9ZA 1MPHA 1UNPA 2J0JA 1MKEA 1W1HA 1MAIA 1WGUA 2L1CA 2ELBA 1W1GA 2Z0QA 2GCJA 5C5BB 3TO1A 1FGZA 2Q13A 3D8DA 1U5DA 1V5UA 2KGXB 3PVUA 5JP4A 4K2OA 2I1KA 3DXCA 1V61A 4HB4B 2CAYA 4K2PA 4HAXB 2DN6A 2RSGA 2P0FA 5EFXA 2W2XD 2J0KA 4C0AA 5J3QA 4MY6A 5HE1A 4CHJA 4D0NB 5J3YA 4GOUA 3HW2B 2DA0A 3O96A 4HAWB 1FHWA 3DXDA 1UNQA 5KQ4A 1LW3A 1J0WA 2JP2A 2Y8FA 2P0HA 2K2UA 2D4QA 1V5PA 3T06A 1XX0A 3M1IB 1H4RA 2K2JA 1J19A 4ZRKA 2P0DA 2Z0PA 1RJ2A 2XQNM 1TJ6A 3ZVRA 4CHMA 1XCGA 4H8SA 5D3WA 1EAZA 2Y8GA 4HB3B 4MT7A 3PP2A 2DLWA 1PLSA 1FHXA 4D0OA 4HB0B 1U5FA 2M38A 5HE0A 1XR0B 4KHOA 3A8QA 1V89A 3JV3A 1N3HA 5DHAB 2DKPA 3PSCA 4A6FA 1ZM0A 3SV1A 2GCLA 3EO2A 1XODA 2D9VA 2N23A 2I1JA 1NU2A 2PZ1A 1ISNA 2IYBA 2H7EA 2YVCA 3HQCA 4P7IA 1ZC4B 3F0WA 3QWMA 4EMOA 4ZRJA 3MPXA 1PFJA 5HE3A 3CXBB 1X86A 2GJYA 1SHCA 1UPQA 3VOQA 2MKRA 3UZTA 1P3RA 4GPTB 4CYEA 4DX8A 3ODWA 1X1FA 2CY4A 5LONB 1F5XA 4F7GA 5C16A 4ZRIA 2D2QA 1WGQA 2YF0A 1KI1B 2MWNB 3CIKA 4F7HA 1AWEA 1OY2A 1MIZB 2BCJA 2RUKB 1SGHA 2D9YA 2YT0A 2DYQA 4KVGB 2VSZA 1GC7A 1QC6A 3OANA 3X23A 3BINA 2D11A 4GMXB 3WYFB 3MDBC 2VRWB 4DXAB 1DDVA 1B55A 1Y19B 1IRSA 4EKUA 2P8VA 3N7CA 5CLLB 1H10A 1FHOA 5D27A 3GF9A 1EGXA 1PMSA 3KSYA 2ELAA 3A8PA 2LOXA 2M14A 2DHKA 1QQGA 2W2XC 2L2IA 1UPRA 2NZ8B 2ZPYA 3WA0A 1X11A 2HE7A 2CY5A 2W2WA 3LJUX 1DDWA 3PVWA 2AEHA 2COAA 3QIJA 2DYNA 2YS5A 4B6HA 3A98B 4GZUA 5FI1A 1DDMA 1AQCA 4WSFA 2OTXA 1DBHA 4GXBA 3P6AA 1WJMA 4GYVA 1FB8A 1XKEA 1NI2A 4BBKA 1X05A 2YS1A 4HATB 2HTHB 1NTYA 1FAOA 1K5DB 1V88A 3SO6A 1ZVRA 4YL8A 2V76A 1U2BA 5D3XA 2FJLA 4KHBB 5C6RA 2RLOA 2MFQA 2N0YA 1BWNA 3NSUA 3QBVB 3SUZA 4HAUB 4Z2MB 5C5BA 2LYDA 4K17A 4GN1A 2QKMA 5L81A 1WJ1A 1XD4A 2KUPA 3PG7A 3KY9A 2Y7BA 1KZ7A 2NMBA 4L6EA 4PNKA 1MIXA 3D8EA 1BY1A 1ZC3B 5FI0A 4HDQA 2G35A 3PEGA 2DHJA 3ODXA 4KAXB 5KQ1A 4WVFB 4Y94A 5D3VA 3RCPA 3G9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2COC A;  4YON A;  3PVL A;  1DYN A;  2LKO A;  3FSS A;  1FOE A;  3GYP A;  4A6K A;  4MK0 A;  3ULC A;  1U5E A;  2E2X A;  1U27 A;  3AU5 A;  3SYX A;  1E5W A;  2KR9 A;  4HHV A;  4A6F B;  3ODO A;  2X18 A;  5DH9 B;  2COD A;  4A5K A;  3FM8 C;  2UZS A;  2H7D A;  1BAK A;  2ADZ A;  2YS3 A;  1W1D A;  5DI9 B;  2VKI A;  3F5R A;  2ROZ B;  1Y5O A;  3DXE A;  3PZD A;  4TYZ A;  2MDX A;  3ML4 A;  4NY0 A;  5C79 A;  2RVB B;  1TQZ A;  1OMW A;  3D8F A;  4HAV B;  2Z0O A;  1I2H A;  3AJ4 A;  4HB2 B;  2DTC A;  2D9W A;  2DX5 A;  5JHH A;  1TXD A;  1WVH A;  2YSZ A;  2QKL A;  4Z2N A;  5DIF B;  4HDO A;  2R0D A;  2EMT A;  1M7E A;  5JHG A;  3AU4 A;  1BTN A;  1FGY A;  1M7R A;  2LG1 A;  2LOZ A;  4HAY B;  5KCV A;  4DBB A;  1MK7 B;  1GC6 A;  4KHA A;  3TFM A;  1WG7 A;  5JLJ B;  5HE2 A;  2EMS A;  1GG3 A;  2KCJ A;  3ULB A;  1DRO A;  1ZSQ A;  4XWX A;  4F7U P;  4WJ7 A;  3U8Z A;  2COF A;  2DHI A;  1MK9 B;  2RGN B;  1NTV A;  1X1G A;  4TKN A;  4HAZ B;  3TVV A;  4EJN A;  3GYO A;  1WI1 A;  3BJI A;  5J3T A;  2D10 A;  2GS0 A;  5CLQ B;  3KZ1 A;  1U29 A;  2K00 A;  2ROV A;  2I5F A;  3P7Z A;  1P5T A;  1Z87 A;  4A6H A;  1K5G B;  1P6S A;  4IFS A;  4K81 A;  4IOY X;  2AL6 A;  1V5M A;  5LOP B;  2I5C A;  3ZDT A;  2DKQ A;  1I7A A;  3HK0 A;  3KRW A;  2DFK A;  1KZG A;  4GMV A;  3FEH A;  1UEF A;  3TW1 A;  3V5W A;  5DHF B;  1UNR A;  3KRX A;  4IAP A;  2J0M A;  1EF1 A;  2YRY A;  1U5G A;  1EVH A;  3IVF A;  5GOW B;  2YT1 A;  2EC1 A;  2DX1 A;  3TCA A;  4NSW A;  2CRF A;  1OQN A;  3SNH A;  5D3Y A;  2RNR B;  2R09 A;  4PQ0 A;  2UVM A;  2UZR A;  2IFS A;  1BTK A;  1Q67 A;  3U7D A;  2D9X A;  2EJ8 A;  3VIA A;  1LB1 A;  4DX9 0;  2LUL A;  2OQB A;  1RRP B;  2J59 M;  2D9Z A;  1MPH A;  1UNP A;  2J0J A;  1MKE A;  1W1H A;  1MAI A;  1WGU A;  2L1C A;  2ELB A;  1W1G A;  2Z0Q A;  2GCJ A;  5C5B B;  3TO1 A;  1FGZ A;  2Q13 A;  3D8D A;  1U5D A;  1V5U A;  2KGX B;  3PVU A;  5JP4 A;  4K2O A;  2I1K A;  3DXC A;  1V61 A;  4HB4 B;  2CAY A;  4K2P A;  4HAX B;  2DN6 A;  2RSG A;  2P0F A;  5EFX A;  2W2X D;  2J0K A;  4C0A A;  5J3Q A;  4MY6 A;  5HE1 A;  4CHJ A;  4D0N B;  5J3Y A;  4GOU A;  3HW2 B;  2DA0 A;  3O96 A;  4HAW B;  1FHW A;  3DXD A;  1UNQ A;  5KQ4 A;  1LW3 A;  1J0W A;  2JP2 A;  2Y8F A;  2P0H A;  2K2U A;  2D4Q A;  1V5P A;  3T06 A;  1XX0 A;  3M1I B;  1H4R A;  2K2J A;  1J19 A;  4ZRK A;  2P0D A;  2Z0P A;  1RJ2 A;  2XQN M;  1TJ6 A;  3ZVR A;  4CHM A;  1XCG A;  4H8S A;  5D3W A;  1EAZ A;  2Y8G A;  4HB3 B;  4MT7 A;  3PP2 A;  2DLW A;  1PLS A;  1FHX A;  4D0O A;  4HB0 B;  1U5F A;  2M38 A;  5HE0 A;  1XR0 B;  4KHO A;  3A8Q A;  1V89 A;  3JV3 A;  1N3H A;  5DHA B;  2DKP A;  3PSC A;  4A6F A;  1ZM0 A;  3SV1 A;  2GCL A;  3EO2 A;  1XOD A;  2D9V A;  2N23 A;  2I1J A;  1NU2 A;  2PZ1 A;  1ISN A;  2IYB A;  2H7E A;  2YVC A;  3HQC A;  4P7I A;  1ZC4 B;  3F0W A;  3QWM A;  4EMO A;  4ZRJ A;  3MPX A;  1PFJ A;  5HE3 A;  3CXB B;  1X86 A;  2GJY A;  1SHC A;  1UPQ A;  3VOQ A;  2MKR A;  3UZT A;  1P3R A;  4GPT B;  4CYE A;  4DX8 A;  3ODW A;  1X1F A;  2CY4 A;  5LON B;  1F5X A;  4F7G A;  5C16 A;  4ZRI A;  2D2Q A;  1WGQ A;  2YF0 A;  1KI1 B;  2MWN B;  3CIK A;  4F7H A;  1AWE A;  1OY2 A;  1MIZ B;  2BCJ A;  2RUK B;  1SGH A;  2D9Y A;  2YT0 A;  2DYQ A;  4KVG B;  2VSZ A;  1GC7 A;  1QC6 A;  3OAN A;  3X23 A;  3BIN A;  2D11 A;  4GMX B;  3WYF B;  3MDB C;  2VRW B;  4DXA B;  1DDV A;  1B55 A;  1Y19 B;  1IRS A;  4EKU A;  2P8V A;  3N7C A;  5CLL B;  1H10 A;  1FHO A;  5D27 A;  3GF9 A;  1EGX A;  1PMS A;  3KSY A;  2ELA A;  3A8P A;  2LOX A;  2M14 A;  2DHK A;  1QQG A;  2W2X C;  2L2I A;  1UPR A;  2NZ8 B;  2ZPY A;  3WA0 A;  1X11 A;  2HE7 A;  2CY5 A;  2W2W A;  3LJU X;  1DDW A;  3PVW A;  2AEH A;  2COA A;  3QIJ A;  2DYN A;  2YS5 A;  4B6H A;  3A98 B;  4GZU A;  5FI1 A;  1DDM A;  1AQC A;  4WSF A;  2OTX A;  1DBH A;  4GXB A;  3P6A A;  1WJM A;  4GYV A;  1FB8 A;  1XKE A;  1NI2 A;  4BBK A;  1X05 A;  2YS1 A;  4HAT B;  2HTH B;  1NTY A;  1FAO A;  1K5D B;  1V88 A;  3SO6 A;  1ZVR A;  4YL8 A;  2V76 A;  1U2B A;  5D3X A;  2FJL A;  4KHB B;  5C6R A;  2RLO A;  2MFQ A;  2N0Y A;  1BWN A;  3NSU A;  3QBV B;  3SUZ A;  4HAU B;  4Z2M B;  5C5B A;  2LYD A;  4K17 A;  4GN1 A;  2QKM A;  5L81 A;  1WJ1 A;  1XD4 A;  2KUP A;  3PG7 A;  3KY9 A;  2Y7B A;  1KZ7 A;  2NMB A;  4L6E A;  4PNK A;  1MIX A;  3D8E A;  1BY1 A;  1ZC3 B;  5FI0 A;  4HDQ A;  2G35 A;  3PEG A;  2DHJ A;  3ODX A;  4KAX B;  5KQ1 A;  4WVF B;  4Y94 A;  5D3V A;  3RCP A;  3G9W A; 
#chains in the Genus database with same CATH topology
 2COC A;  4YON A;  3PVL A;  1DYN A;  2LKO A;  3FSS A;  1FOE A;  3GYP A;  4A6K A;  4MK0 A;  3ULC A;  1U5E A;  2E2X A;  1U27 A;  3AU5 A;  3SYX A;  1E5W A;  1T77 A;  2KR9 A;  4HHV A;  4A6F B;  3ODO A;  5IRS A;  2X18 A;  5DH9 B;  2COD A;  4A5K A;  3OHM B;  3FM8 C;  4QJ4 B;  2UZS A;  2H7D A;  1BAK A;  2ADZ A;  2YS3 A;  2YT2 A;  1W1D A;  5DI9 B;  2VKI A;  3F5R A;  2ROZ B;  1Y5O A;  3DXE A;  3PZD A;  4TYZ A;  2MDX A;  3ML4 A;  4NY0 A;  5C79 A;  2RVB B;  1TQZ A;  1OMW A;  3D8F A;  4HAV B;  2Z0O A;  1I2H A;  1ZYI A;  3AJ4 A;  4HB2 B;  2DTC A;  2D9W A;  4DIX A;  5M4Y B;  2DX5 A;  5JHH A;  3DCX A;  1TXD A;  1WVH A;  2YSZ A;  2QKL A;  4Z2N A;  5DIF B;  2K49 A;  4HDO A;  2R0D A;  2EMT A;  1M7E A;  5JHG A;  3AU4 A;  1BTN A;  1FGY A;  1M7R A;  2LG1 A;  2LOZ A;  4HAY B;  5KCV A;  4DBB A;  1MK7 B;  1GC6 A;  4KHA A;  3TFM A;  1WG7 A;  5JLJ B;  5HE2 A;  3B77 A;  2EMS A;  1GG3 A;  2KCJ A;  3ULB A;  1DRO A;  1ZSQ A;  4XWX A;  4F7U P;  4WJ7 A;  3U8Z A;  2COF A;  2DHI A;  1MK9 B;  2RGN B;  1NTV A;  1X1G A;  4TKN A;  4HAZ B;  3TVV A;  4EJN A;  3GYO A;  1WI1 A;  3BJI A;  5J3T A;  2D10 A;  2GS0 A;  5CLQ B;  3KZ1 A;  1U29 A;  2K00 A;  2ROV A;  2I5F A;  3P7Z A;  1P5T A;  1Z87 A;  4A6H A;  4GNK B;  1K5G B;  1P6S A;  4IFS A;  4K81 A;  4IOY X;  2AL6 A;  1V5M A;  5LOP B;  2I5C A;  3ZDT A;  4D6W A;  2DKQ A;  3U12 A;  1I7A A;  3FVC A;  3HK0 A;  3KRW A;  2DFK A;  1KZG A;  4GMV A;  3FEH A;  1UEF A;  3TW1 A;  3V5W A;  2KUQ A;  5DHF B;  1UNR A;  3KRX A;  4IAP A;  2J0M A;  1EF1 A;  2YRY A;  1U5G A;  1EVH A;  3IVF A;  3NWF A;  5GOW B;  2YT1 A;  2EC1 A;  2DX1 A;  3TCA A;  4NSW A;  2CRF A;  1OQN A;  2Z13 A;  3SNH A;  5D3Y A;  2RNR B;  2R09 A;  4PQ0 A;  2UVM A;  2UZR A;  2IFS A;  2Z14 A;  1BTK A;  1Q67 A;  3U7D A;  2D9X A;  2EJ8 A;  3VIA A;  1LB1 A;  4DX9 0;  2LUL A;  2OQB A;  1RRP B;  2J59 M;  2D9Z A;  1MPH A;  1UNP A;  2J0J A;  1MKE A;  1W1H A;  1MAI A;  1WGU A;  2L1C A;  2ELB A;  1W1G A;  2Z0Q A;  2GCJ A;  5C5B B;  3TO1 A;  4CSQ A;  1FGZ A;  2Q13 A;  3D8D A;  1U5D A;  1V5U A;  2KGX B;  3PVU A;  5JP4 A;  4K2O A;  2I1K A;  3DXC A;  1V61 A;  2FJU B;  4HB4 B;  2CAY A;  4K2P A;  4HAX B;  2DN6 A;  2RSG A;  2P0F A;  5I2M A;  5EFX A;  2R2Y A;  2W2X D;  2J0K A;  4C0A A;  5J3Q A;  4MY6 A;  5HE1 A;  2KIG A;  4CHJ A;  4D0N B;  2KR0 A;  5J3Y A;  4GOU A;  3HW2 B;  2DA0 A;  3O96 A;  4HAW B;  1FHW A;  3DXD A;  1UNQ A;  5KQ4 A;  2RRF A;  1LW3 A;  1J0W A;  2JP2 A;  2Y8F A;  2P0H A;  2K2U A;  2K8E A;  2D4Q A;  1V5P A;  3T06 A;  1XX0 A;  3M1I B;  1H4R A;  2K2J A;  1J19 A;  4ZRK A;  2P0D A;  2Z0P A;  1RJ2 A;  2XQN M;  1TJ6 A;  3ZVR A;  3NW8 A;  3NWD A;  4CHM A;  1XCG A;  4H8S A;  5D3W A;  1EAZ A;  4QJ3 B;  4OSN A;  2Y8G A;  4HB3 B;  4MT7 A;  3PP2 A;  2DLW A;  1PLS A;  1FHX A;  4D0O A;  4HB0 B;  1U5F A;  2M38 A;  5HE0 A;  1XR0 B;  4KHO A;  3A8Q A;  1V89 A;  3JV3 A;  1N3H A;  5DHA B;  2DKP A;  3PSC A;  4A6F A;  1ZM0 A;  3SV1 A;  2GCL A;  3EO2 A;  1XOD A;  2D9V A;  2N23 A;  2I1J A;  1NU2 A;  2PZ1 A;  1ISN A;  2IYB A;  2H7E A;  2YVC A;  3HQC A;  4P7I A;  1ZC4 B;  3F0W A;  3QWM A;  4EMO A;  4ZRJ A;  3MPX A;  1PFJ A;  5HE3 A;  1MI1 A;  1X86 A;  3CXB B;  2GJY A;  1SHC A;  1UPQ A;  5I2S A;  3VOQ A;  2MKR A;  3UZT A;  1P3R A;  4GPT B;  4CYE A;  2GUM A;  4DX8 A;  3ODW A;  1X1F A;  3HIE A;  2CY4 A;  5LON B;  1F5X A;  2NBV A;  4F7G A;  5C16 A;  4ZRI A;  2D2Q A;  1WGQ A;  2YF0 A;  1KI1 B;  2MWN B;  3CIK A;  4F7H A;  1AWE A;  1OY2 A;  1MIZ B;  4HSI A;  2BCJ A;  2RUK B;  1SGH A;  2D9Y A;  2YT0 A;  2DYQ A;  4KVG B;  2VSZ A;  1GC7 A;  1QC6 A;  3OAN A;  3X23 A;  3BIN A;  2D11 A;  4GMX B;  3WYF B;  3MDB C;  2VRW B;  4DXA B;  1DDV A;  1B55 A;  1Y19 B;  1IRS A;  4EKU A;  2P8V A;  3N7C A;  5CLL B;  1H10 A;  1FHO A;  4KHB A;  5D27 A;  3GF9 A;  1EGX A;  1PMS A;  3KSY A;  2ELA A;  3A8P A;  2LOX A;  2M14 A;  2DHK A;  4L1R A;  1QQG A;  2W2X C;  2L2I A;  1UPR A;  2NZ8 B;  2ZPY A;  3WA0 A;  1X11 A;  2HE7 A;  2CY5 A;  2W2W A;  2Z59 A;  3LJU X;  1DDW A;  3PVW A;  2AEH A;  5LG4 B;  2COA A;  3QIJ A;  2DYN A;  2YS5 A;  4B6H A;  3A98 B;  4GZU A;  5FI1 A;  3NWA A;  1DDM A;  1AQC A;  4WSF A;  2OTX A;  1DBH A;  4GXB A;  3P6A A;  1WJM A;  4GYV A;  1FB8 A;  1XKE A;  1NI2 A;  2KIE A;  4BBK A;  1X05 A;  2YS1 A;  4HAT B;  3HSA A;  2HTH B;  1NTY A;  1FAO A;  4OT1 A;  1K5D B;  1V88 A;  3SO6 A;  1ZVR A;  4YL8 A;  2V76 A;  1U2B A;  2Z4D A;  5D3X A;  4QJ5 B;  2FJL A;  4KHB B;  5C6R A;  2RLO A;  2MFQ A;  2N0Y A;  1BWN A;  3NSU A;  3QBV B;  3SUZ A;  4HAU B;  4Z2M B;  5C5B A;  2LYD A;  4K17 A;  4GN1 A;  3A58 A;  2QKM A;  5L81 A;  1WJ1 A;  1XD4 A;  2KUP A;  3PG7 A;  3KY9 A;  2Y7B A;  1KZ7 A;  2NMB A;  4L6E A;  4PNK A;  1MIX A;  3D8E A;  1BY1 A;  1ZC3 B;  5FI0 A;  4HDQ A;  2G35 A;  3PEG A;  4QXA B;  2DHJ A;  3ODX A;  4KAX B;  5KQ1 A;  4WVF B;  4Y94 A;  5D3V A;  3RCP A;  2ZKM X;  3G9W A; 
#chains in the Genus database with same CATH homology
 2COC A;  4YON A;  3PVL A;  1DYN A;  2LKO A;  3FSS A;  1FOE A;  3GYP A;  4A6K A;  4MK0 A;  3ULC A;  1U5E A;  2E2X A;  1U27 A;  3AU5 A;  3SYX A;  1E5W A;  2KR9 A;  4HHV A;  4A6F B;  3ODO A;  2X18 A;  5DH9 B;  2COD A;  4A5K A;  3FM8 C;  2UZS A;  2H7D A;  1BAK A;  2ADZ A;  2YS3 A;  1W1D A;  5DI9 B;  2VKI A;  3F5R A;  2ROZ B;  1Y5O A;  3DXE A;  3PZD A;  4TYZ A;  2MDX A;  3ML4 A;  4NY0 A;  5C79 A;  2RVB B;  1TQZ A;  1OMW A;  3D8F A;  4HAV B;  2Z0O A;  1I2H A;  3AJ4 A;  4HB2 B;  2DTC A;  2D9W A;  2DX5 A;  5JHH A;  1TXD A;  1WVH A;  2YSZ A;  2QKL A;  4Z2N A;  5DIF B;  4HDO A;  2R0D A;  2EMT A;  1M7E A;  5JHG A;  3AU4 A;  1BTN A;  1FGY A;  1M7R A;  2LG1 A;  2LOZ A;  4HAY B;  5KCV A;  4DBB A;  1MK7 B;  1GC6 A;  4KHA A;  3TFM A;  1WG7 A;  5JLJ B;  5HE2 A;  2EMS A;  1GG3 A;  2KCJ A;  3ULB A;  1DRO A;  1ZSQ A;  4XWX A;  4F7U P;  4WJ7 A;  3U8Z A;  2COF A;  2DHI A;  1MK9 B;  2RGN B;  1NTV A;  1X1G A;  4TKN A;  4HAZ B;  3TVV A;  4EJN A;  3GYO A;  1WI1 A;  3BJI A;  5J3T A;  2D10 A;  2GS0 A;  5CLQ B;  3KZ1 A;  1U29 A;  2K00 A;  2ROV A;  2I5F A;  3P7Z A;  1P5T A;  1Z87 A;  4A6H A;  1K5G B;  1P6S A;  4IFS A;  4K81 A;  4IOY X;  2AL6 A;  1V5M A;  5LOP B;  2I5C A;  3ZDT A;  2DKQ A;  1I7A A;  3HK0 A;  3KRW A;  2DFK A;  1KZG A;  4GMV A;  3FEH A;  1UEF A;  3TW1 A;  3V5W A;  5DHF B;  1UNR A;  3KRX A;  4IAP A;  2J0M A;  1EF1 A;  2YRY A;  1U5G A;  1EVH A;  3IVF A;  5GOW B;  2YT1 A;  2EC1 A;  2DX1 A;  3TCA A;  4NSW A;  2CRF A;  1OQN A;  3SNH A;  5D3Y A;  2RNR B;  2R09 A;  4PQ0 A;  2UVM A;  2UZR A;  2IFS A;  1BTK A;  1Q67 A;  3U7D A;  2D9X A;  2EJ8 A;  3VIA A;  1LB1 A;  4DX9 0;  2LUL A;  2OQB A;  1RRP B;  2J59 M;  2D9Z A;  1MPH A;  1UNP A;  2J0J A;  1MKE A;  1W1H A;  1MAI A;  1WGU A;  2L1C A;  2ELB A;  1W1G A;  2Z0Q A;  2GCJ A;  5C5B B;  3TO1 A;  1FGZ A;  2Q13 A;  3D8D A;  1U5D A;  1V5U A;  2KGX B;  3PVU A;  5JP4 A;  4K2O A;  2I1K A;  3DXC A;  1V61 A;  4HB4 B;  2CAY A;  4K2P A;  4HAX B;  2DN6 A;  2RSG A;  2P0F A;  5EFX A;  2W2X D;  2J0K A;  4C0A A;  5J3Q A;  4MY6 A;  5HE1 A;  4CHJ A;  4D0N B;  5J3Y A;  4GOU A;  3HW2 B;  2DA0 A;  3O96 A;  4HAW B;  1FHW A;  3DXD A;  1UNQ A;  5KQ4 A;  1LW3 A;  1J0W A;  2JP2 A;  2Y8F A;  2P0H A;  2K2U A;  2D4Q A;  1V5P A;  3T06 A;  1XX0 A;  3M1I B;  1H4R A;  2K2J A;  1J19 A;  4ZRK A;  2P0D A;  2Z0P A;  1RJ2 A;  2XQN M;  1TJ6 A;  3ZVR A;  4CHM A;  1XCG A;  4H8S A;  5D3W A;  1EAZ A;  2Y8G A;  4HB3 B;  4MT7 A;  3PP2 A;  2DLW A;  1PLS A;  1FHX A;  4D0O A;  4HB0 B;  1U5F A;  2M38 A;  5HE0 A;  1XR0 B;  4KHO A;  3A8Q A;  1V89 A;  3JV3 A;  1N3H A;  5DHA B;  2DKP A;  3PSC A;  4A6F A;  1ZM0 A;  3SV1 A;  2GCL A;  3EO2 A;  1XOD A;  2D9V A;  2N23 A;  2I1J A;  1NU2 A;  2PZ1 A;  1ISN A;  2IYB A;  2H7E A;  2YVC A;  3HQC A;  4P7I A;  1ZC4 B;  3F0W A;  3QWM A;  4EMO A;  4ZRJ A;  3MPX A;  1PFJ A;  5HE3 A;  3CXB B;  1X86 A;  2GJY A;  1SHC A;  1UPQ A;  3VOQ A;  2MKR A;  3UZT A;  1P3R A;  4GPT B;  4CYE A;  4DX8 A;  3ODW A;  1X1F A;  2CY4 A;  5LON B;  1F5X A;  4F7G A;  5C16 A;  4ZRI A;  2D2Q A;  1WGQ A;  2YF0 A;  1KI1 B;  2MWN B;  3CIK A;  4F7H A;  1AWE A;  1OY2 A;  1MIZ B;  2BCJ A;  2RUK B;  1SGH A;  2D9Y A;  2YT0 A;  2DYQ A;  4KVG B;  2VSZ A;  1GC7 A;  1QC6 A;  3OAN A;  3X23 A;  3BIN A;  2D11 A;  4GMX B;  3WYF B;  3MDB C;  2VRW B;  4DXA B;  1DDV A;  1B55 A;  1Y19 B;  1IRS A;  4EKU A;  2P8V A;  3N7C A;  5CLL B;  1H10 A;  1FHO A;  5D27 A;  3GF9 A;  1EGX A;  1PMS A;  3KSY A;  2ELA A;  3A8P A;  2LOX A;  2M14 A;  2DHK A;  1QQG A;  2W2X C;  2L2I A;  1UPR A;  2NZ8 B;  2ZPY A;  3WA0 A;  1X11 A;  2HE7 A;  2CY5 A;  2W2W A;  3LJU X;  1DDW A;  3PVW A;  2AEH A;  2COA A;  3QIJ A;  2DYN A;  2YS5 A;  4B6H A;  3A98 B;  4GZU A;  5FI1 A;  1DDM A;  1AQC A;  4WSF A;  2OTX A;  1DBH A;  4GXB A;  3P6A A;  1WJM A;  4GYV A;  1FB8 A;  1XKE A;  1NI2 A;  4BBK A;  1X05 A;  2YS1 A;  4HAT B;  2HTH B;  1NTY A;  1FAO A;  1K5D B;  1V88 A;  3SO6 A;  1ZVR A;  4YL8 A;  2V76 A;  1U2B A;  5D3X A;  2FJL A;  4KHB B;  5C6R A;  2RLO A;  2MFQ A;  2N0Y A;  1BWN A;  3NSU A;  3QBV B;  3SUZ A;  4HAU B;  4Z2M B;  5C5B A;  2LYD A;  4K17 A;  4GN1 A;  2QKM A;  5L81 A;  1WJ1 A;  1XD4 A;  2KUP A;  3PG7 A;  3KY9 A;  2Y7B A;  1KZ7 A;  2NMB A;  4L6E A;  4PNK A;  1MIX A;  3D8E A;  1BY1 A;  1ZC3 B;  5FI0 A;  4HDQ A;  2G35 A;  3PEG A;  2DHJ A;  3ODX A;  4KAX B;  5KQ1 A;  4WVF B;  4Y94 A;  5D3V A;  3RCP A;  3G9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...