3ODOA

Crystal structure of the dh/ph domains of p115-rhogef
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
370
structure length
370
Chain Sequence
QTSPPGWRELVPPDTLHSLPKSQVKRQEVISELLVTEAAHVRMLRVLHDLFFQPMAECLFFPLEELQNIFPSLDELIEVHSLFLDRLMKRRQESGYLIEEIGDVLLARFDGAEGSWFQKISSRFCSRQSFALEQLKAKQRKDPRFCAFVQEAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEEPTEREKVELAAECCREILHHVNQAVRDMEDLLRLKDYQRRLDLSHLRQSSDPMLSEFKNLDITKKKLVHEGPLTWRVTKDKAVEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLRPVLRLTSAMTREVATDHKAFYVLFTWDQEAQIYELVAQTVSERKNWCALITETAGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Rho guanine nucleotide exchange factor 1
publication title Modulation of a GEF switch: Autoinhibition of the intrinsic guanine nucleotide exchange activity of p115-RhoREF
rcsb
source organism Homo sapiens
total genus 126
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00621 RhoGEF RhoGEF domain
A PF17838 PH_16 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 3odoA01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3odoA02
5JHGA 3KSYA 1W1DA 1UNPA 2DHKA 4YONA 1ZC3B 4MT7A 5D3WA 2LKOA 1WVHA 4F7UP 4XWXA 1U29A 1ZVRA 2VRWB 2W2XD 4TKNA 3BJIA 2UZSA 2MWNB 3LJUX 2P8VA 2R0DA 2Y7BA 3DXCA 3ZDTA 2GCLA 5J3QA 2IFSA 1BY1A 3AJ4A 2D4QA 2Z0PA 4F7GA 2PZ1A 5C5BB 4HB4B 3KZ1A 2Y8FA 3D8EA 2YS3A 2Z0OA 1BAKA 2D2QA 1LB1A 5CLLB 4HAYB 3KY9A 1X05A 3RCPA 1XR0B 3OANA 1NTYA 1P5TA 5JLJB 2RNRB 2KCJA 2AEHA 1WGUA 4DBBA 1E5WA 2D9WA 2I5FA 2ELBA 2H7EA 3VOQA 3UZTA 1WJ1A 2L2IA 4ZRIA 1H10A 2LOZA 2EC1A 1DBHA 4HAVB 4HB0B 4B6HA 1DDMA 1TQZA 3PVWA 4KVGB 2G35A 4CHJA 3ODOA 1ZC4B 3MPXA 4GYVA 4K81A 4HHVA 1FHXA 2DKQA 3VIAA 3FM8C 3BINA 4WJ7A 2LULA 2MFQA 4IAPA 1PLSA 2OQBA 4GMXB 4GMVA 2W2XC 2D9YA 2K00A 1V5PA 4HAXB 5FI1A 3TO1A 1P3RA 3ZVRA 3IVFA 5D3VA 1DROA 1RJ2A 4IOYX 4K2OA 1V89A 3PSCA 2P0HA 3GYPA 3QIJA 1X1FA 1ZM0A 2J0MA 1SHCA 3X23A 4GXBA 1AQCA 2DX1A 3F5RA 2CODA 2COAA 2HTHB 1FHWA 1X86A 3SYXA 3DXEA 4GN1A 3FEHA 1U27A 2QKMA 1MPHA 2CRFA 2ZPYA 4D0OA 2D9XA 2EMSA 2KR9A 1IRSA 5JHHA 5KQ1A 2Z0QA 5DH9B 2RSGA 1UPRA 2GS0A 5CLQB 5DHFB 2YS1A 2J59M 5HE2A 2QKLA 1UPQA 2YSZA 2I1KA 2VKIA 1GC6A 5GOWB 3P7ZA 2P0DA 2FJLA 5C79A 2COFA 1DDVA 2KUPA 3JV3A 1ISNA 1U5GA 4DX90 1NU2A 4TYZA 4GOUA 2DX5A 1WGQA 1Z87A 2DYNA 1MK7B 1P6SA 5D3XA 2DA0A 1OY2A 5C16A 3A8PA 2EMTA 1TJ6A 1XODA 1UNQA 2I5CA 3PEGA 4P7IA 5HE1A 3TCAA 1FHOA 4YL8A 3AU5A 4GZUA 3QWMA 4K17A 3PP2A 5DHAB 4A6FB 1OMWA 1FGYA 4EKUA 5C5BA 1M7EA 4HDOA 5JP4A 2D10A 2YT1A 2UVMA 5DI9B 1RRPB 4KAXB 2YVCA 5D3YA 4A6FA 2P0FA 2ROVA 1N3HA 3WYFB 4C0AA 2NZ8B 2DN6A 1FB8A 1NI2A 3F0WA 5L81A 4A6HA 1KZ7A 1SGHA 2COCA 4HDQA 1KI1B 2CY5A 1KZGA 2LYDA 4CHMA 4EMOA 2RUKB 1XX0A 2YT0A 3ULBA 1NTVA 4H8SA 2J0KA 1QQGA 3HK0A 2DHIA 1UNRA 3QBVB 3SUZA 2GJYA 3AU4A 3PZDA 1Q67A 2VSZA 3N7CA 3DXDA 2RVBB 2LOXA 3HQCA 1WI1A 2K2UA 1FOEA 2NMBA 4WSFA 1EF1A 2YRYA 1K5DB 1K5GB 1ZSQA 5KQ4A 3GYOA 3CIKA 2AL6A 3HW2B 2D9VA 1BTKA 2KGXB 3T06A 2L1CA 3ODXA 3WA0A 5C6RA 1U2BA 2K2JA 1FGZA 4NSWA 2R09A 3EO2A 1WG7A 2D9ZA 4ZRJA 3FSSA 1DYNA 2H7DA 2X18A 2E2XA 1B55A 2N0YA 1J0WA 2DTCA 3ULCA 3G9WA 3U8ZA 1V61A 1MAIA 2Y8GA 2ELAA 2DHJA 4PNKA 4KHAA 5HE0A 1WJMA 1PFJA 2ROZB 3KRWA 1V88A 4HB2B 5HE3A 1X1GA 2CY4A 2BCJA 2W2WA 1TXDA 1U5DA 4F7HA 1V5UA 3M1IB 2RLOA 1I2HA 4CYEA 2UZRA 4DX8A 1BTNA 3ODWA 1J19A 2EJ8A 4HB3B 2XQNM 4MK0A 2J0JA 2YF0A 3GF9A 1OQNA 1U5EA 2M38A 2DKPA 5KCVA 5EFXA 1M7RA 1BWNA 2LG1A 3SNHA 1QC6A 4HAUB 2I1JA 1XCGA 5J3YA 4HAWB 4HAZB 4ZRKA 3D8DA 2IYBA 3TVVA 1H4RA 1Y5OA 4IFSA 2GCJA 4PQ0A 2OTXA 3SO6A 2DLWA 3CXBB 2JP2A 4WVFB 2MKRA 3PVLA 1F5XA 2HE7A 1MIXA 4BBKA 4Z2MB 4KHBB 1XKEA 2RGNB 4Z2NA 4HATB 3TFMA 3ML4A 1W1HA 5FI0A 1EVHA 3PVUA 3O96A 4EJNA 1X11A 4K2PA 4Y94A 3SV1A 1XD4A 1FAOA 3PG7A 4L6EA 3U7DA 1EAZA 4DXAB 2ADZA 3D8FA 1GG3A 1EGXA 2V76A 1GC7A 5LOPB 3NSUA 2MDXA 1Y19B 1UEFA 2CAYA 1MKEA 2N23A 1MIZB 2DYQA 4A6KA 1U5FA 1V5MA 3V5WA 3A98B 3KRXA 1I7AA 5J3TA 4GPTB 1W1GA 2DFKA 5DIFB 4KHOA 2M14A 4MY6A 3P6AA 4NY0A 1DDWA 1AWEA 1LW3A 3MDBC 3TW1A 4D0NB 1MK9B 4A5KA 5D27A 5LONB 2YS5A 3A8QA 2D11A 1PMSA 2Q13A
chains in the Genus database with same CATH superfamily
5JHGA 3KSYA 1W1DA 1UNPA 2DHKA 4YONA 1ZC3B 4MT7A 5D3WA 2LKOA 1WVHA 4F7UP 4XWXA 1U29A 1ZVRA 2VRWB 2W2XD 4QJ5B 4TKNA 1T77A 3BJIA 2UZSA 2MWNB 3LJUX 2P8VA 2R0DA 2Y7BA 3DXCA 2ZKMX 3ZDTA 2GCLA 3HIEA 5J3QA 2IFSA 1BY1A 3NWAA 3AJ4A 2D4QA 2Z0PA 4F7GA 3HSAA 3B77A 2PZ1A 5C5BB 4HB4B 3KZ1A 2Y8FA 3D8EA 2YS3A 2Z0OA 1BAKA 2D2QA 1LB1A 4OSNA 5CLLB 4HAYB 3KY9A 1X05A 3RCPA 1XR0B 3OANA 1NTYA 1P5TA 5JLJB 2RNRB 2KCJA 2AEHA 1WGUA 4DBBA 1E5WA 2D9WA 2I5FA 2ELBA 2GUMA 2H7EA 3VOQA 1WJ1A 3UZTA 2L2IA 4ZRIA 1H10A 4KHBA 2LOZA 2EC1A 1DBHA 4HAVB 4HB0B 4B6HA 1DDMA 1TQZA 3PVWA 4KVGB 2G35A 4CHJA 3ODOA 1ZC4B 3MPXA 4GYVA 4K81A 4HHVA 1FHXA 2DKQA 3VIAA 3FM8C 3BINA 4WJ7A 5LG4B 2LULA 2MFQA 4IAPA 1PLSA 2OQBA 4GMXB 4GMVA 2W2XC 2D9YA 2K00A 1V5PA 4HAXB 5FI1A 4QJ4B 3U12A 3TO1A 1MI1A 1P3RA 3ZVRA 3IVFA 5D3VA 1DROA 1RJ2A 4IOYX 4K2OA 1V89A 3PSCA 2P0HA 3GYPA 3QIJA 1X1FA 1ZM0A 2J0MA 1SHCA 3X23A 4GXBA 1AQCA 2DX1A 3F5RA 2CODA 2COAA 4CSQA 2HTHB 1FHWA 1X86A 3SYXA 3DXEA 4GN1A 2KIEA 3FEHA 2FJUB 1U27A 2QKMA 1MPHA 2CRFA 2ZPYA 4D0OA 2D9XA 2EMSA 2KR9A 1IRSA 4DIXA 5JHHA 5KQ1A 2Z0QA 5DH9B 2RSGA 1UPRA 2GS0A 5CLQB 5DHFB 2YT2A 2K49A 2YS1A 2J59M 5HE2A 2QKLA 1UPQA 2YSZA 2I1KA 2VKIA 1GC6A 5GOWB 3P7ZA 2P0DA 2FJLA 5C79A 2COFA 1DDVA 2KUPA 3JV3A 1ISNA 3NWFA 1U5GA 4DX90 1NU2A 2Z14A 4TYZA 4GOUA 2DX5A 1WGQA 1Z87A 2DYNA 1MK7B 1P6SA 5D3XA 2DA0A 1OY2A 5C16A 3A8PA 2EMTA 1TJ6A 1XODA 1UNQA 2I5CA 3PEGA 4P7IA 5HE1A 3TCAA 1FHOA 4YL8A 3AU5A 4GZUA 3QWMA 4K17A 3PP2A 5DHAB 4A6FB 1OMWA 1FGYA 4EKUA 5C5BA 1M7EA 4HDOA 5JP4A 1ZYIA 2D10A 2YT1A 2UVMA 5DI9B 1RRPB 4KAXB 2YVCA 5D3YA 4D6WA 4A6FA 2P0FA 4HSIA 2ROVA 1N3HA 3WYFB 4C0AA 2NZ8B 2DN6A 1FB8A 1NI2A 3F0WA 5L81A 4A6HA 1KZ7A 1SGHA 2COCA 4HDQA 1KI1B 2CY5A 1KZGA 2LYDA 4CHMA 4EMOA 2RUKB 1XX0A 2YT0A 3ULBA 1NTVA 4H8SA 2J0KA 1QQGA 3HK0A 3A58A 4QXAB 2DHIA 1UNRA 3QBVB 2KUQA 3SUZA 2GJYA 3AU4A 3PZDA 1Q67A 2VSZA 3N7CA 3DXDA 2RVBB 2LOXA 3HQCA 1WI1A 2K2UA 1FOEA 2NMBA 4WSFA 1EF1A 2YRYA 1K5DB 1K5GB 1ZSQA 5KQ4A 3OHMB 3GYOA 3CIKA 2AL6A 3HW2B 2D9VA 1BTKA 2KGXB 3T06A 2L1CA 3ODXA 3WA0A 5C6RA 1U2BA 2K2JA 2R2YA 1FGZA 4NSWA 2R09A 3EO2A 1WG7A 2D9ZA 4ZRJA 3FSSA 1DYNA 2H7DA 2X18A 2E2XA 5IRSA 1B55A 2N0YA 1J0WA 2DTCA 3ULCA 3G9WA 3U8ZA 1V61A 1MAIA 2Y8GA 2ELAA 2DHJA 4PNKA 4KHAA 5HE0A 5I2MA 1WJMA 1PFJA 2ROZB 4GNKB 3KRWA 1V88A 4HB2B 5HE3A 1X1GA 2CY4A 2BCJA 2W2WA 1TXDA 1U5DA 4F7HA 1V5UA 3M1IB 2RLOA 1I2HA 4CYEA 2UZRA 4DX8A 1BTNA 3ODWA 1J19A 2EJ8A 3NWDA 4HB3B 2XQNM 4MK0A 2J0JA 2YF0A 3GF9A 1OQNA 1U5EA 2M38A 2KIGA 2DKPA 4OT1A 5KCVA 5EFXA 1M7RA 2Z4DA 1BWNA 2K8EA 2LG1A 3SNHA 1QC6A 4HAUB 2I1JA 1XCGA 5J3YA 4HAWB 4HAZB 4ZRKA 3D8DA 4L1RA 2IYBA 3TVVA 2Z59A 1H4RA 1Y5OA 4IFSA 2GCJA 4PQ0A 2OTXA 3SO6A 2DLWA 3CXBB 2JP2A 4WVFB 2MKRA 3NW8A 3PVLA 1F5XA 2HE7A 1MIXA 4BBKA 4Z2MB 4KHBB 1XKEA 2RGNB 4QJ3B 4Z2NA 4HATB 5I2SA 3TFMA 3ML4A 1W1HA 5FI0A 1EVHA 3PVUA 3O96A 4EJNA 1X11A 4K2PA 4Y94A 3DCXA 3SV1A 1XD4A 5M4YB 1FAOA 3PG7A 4L6EA 3U7DA 1EAZA 4DXAB 2ADZA 3D8FA 1GG3A 1EGXA 2V76A 1GC7A 2Z13A 5LOPB 3NSUA 2MDXA 2NBVA 1Y19B 1UEFA 2CAYA 1MKEA 2N23A 1MIZB 2DYQA 4A6KA 1U5FA 1V5MA 3V5WA 3A98B 2RRFA 3KRXA 1I7AA 5J3TA 4GPTB 1W1GA 2DFKA 5DIFB 4KHOA 2M14A 3FVCA 3P6AA 4MY6A 4NY0A 1DDWA 1AWEA 1LW3A 3MDBC 3TW1A 4D0NB 2KR0A 1MK9B 4A5KA 5D27A 5LONB 2YS5A 3A8QA 2D11A 1PMSA 2Q13A
chains in the Genus database with same CATH topology
5JHGA 3KSYA 1W1DA 1UNPA 2DHKA 4YONA 1ZC3B 4MT7A 5D3WA 2LKOA 1WVHA 4F7UP 4XWXA 1U29A 1ZVRA 2VRWB 2W2XD 4TKNA 3BJIA 2UZSA 2MWNB 3LJUX 2P8VA 2R0DA 2Y7BA 3DXCA 3ZDTA 2GCLA 5J3QA 2IFSA 1BY1A 3AJ4A 2D4QA 2Z0PA 4F7GA 2PZ1A 5C5BB 4HB4B 3KZ1A 2Y8FA 3D8EA 2YS3A 2Z0OA 1BAKA 2D2QA 1LB1A 5CLLB 4HAYB 3KY9A 1X05A 3RCPA 1XR0B 3OANA 1NTYA 1P5TA 5JLJB 2RNRB 2KCJA 2AEHA 1WGUA 4DBBA 1E5WA 2D9WA 2I5FA 2ELBA 2H7EA 3VOQA 3UZTA 1WJ1A 2L2IA 4ZRIA 1H10A 2LOZA 2EC1A 1DBHA 4HAVB 4HB0B 4B6HA 1DDMA 1TQZA 3PVWA 4KVGB 2G35A 4CHJA 3ODOA 1ZC4B 3MPXA 4GYVA 4K81A 4HHVA 1FHXA 2DKQA 3VIAA 3FM8C 3BINA 4WJ7A 2LULA 2MFQA 4IAPA 1PLSA 2OQBA 4GMXB 4GMVA 2W2XC 2D9YA 2K00A 1V5PA 4HAXB 5FI1A 3TO1A 1P3RA 3ZVRA 3IVFA 5D3VA 1DROA 1RJ2A 4IOYX 4K2OA 1V89A 3PSCA 2P0HA 3GYPA 3QIJA 1X1FA 1ZM0A 2J0MA 1SHCA 3X23A 4GXBA 1AQCA 2DX1A 3F5RA 2CODA 2COAA 2HTHB 1FHWA 1X86A 3SYXA 3DXEA 4GN1A 3FEHA 1U27A 2QKMA 1MPHA 2CRFA 2ZPYA 4D0OA 2D9XA 2EMSA 2KR9A 1IRSA 5JHHA 5KQ1A 2Z0QA 5DH9B 2RSGA 1UPRA 2GS0A 5CLQB 5DHFB 2YS1A 2J59M 5HE2A 2QKLA 1UPQA 2YSZA 2I1KA 2VKIA 1GC6A 5GOWB 3P7ZA 2P0DA 2FJLA 5C79A 2COFA 1DDVA 2KUPA 3JV3A 1ISNA 1U5GA 4DX90 1NU2A 4TYZA 4GOUA 2DX5A 1WGQA 1Z87A 2DYNA 1MK7B 1P6SA 5D3XA 2DA0A 1OY2A 5C16A 3A8PA 2EMTA 1TJ6A 1XODA 1UNQA 2I5CA 3PEGA 4P7IA 5HE1A 3TCAA 1FHOA 4YL8A 3AU5A 4GZUA 3QWMA 4K17A 3PP2A 5DHAB 4A6FB 1OMWA 1FGYA 4EKUA 5C5BA 1M7EA 4HDOA 5JP4A 2D10A 2YT1A 2UVMA 5DI9B 1RRPB 4KAXB 2YVCA 5D3YA 4A6FA 2P0FA 2ROVA 1N3HA 3WYFB 4C0AA 2NZ8B 2DN6A 1FB8A 1NI2A 3F0WA 5L81A 4A6HA 1KZ7A 1SGHA 2COCA 4HDQA 1KI1B 2CY5A 1KZGA 2LYDA 4CHMA 4EMOA 2RUKB 1XX0A 2YT0A 3ULBA 1NTVA 4H8SA 2J0KA 1QQGA 3HK0A 2DHIA 1UNRA 3QBVB 3SUZA 2GJYA 3AU4A 3PZDA 1Q67A 2VSZA 3N7CA 3DXDA 2RVBB 2LOXA 3HQCA 1WI1A 2K2UA 1FOEA 2NMBA 4WSFA 1EF1A 2YRYA 1K5DB 1K5GB 1ZSQA 5KQ4A 3GYOA 3CIKA 2AL6A 3HW2B 2D9VA 1BTKA 2KGXB 3T06A 2L1CA 3ODXA 3WA0A 5C6RA 1U2BA 2K2JA 1FGZA 4NSWA 2R09A 3EO2A 1WG7A 2D9ZA 4ZRJA 3FSSA 1DYNA 2H7DA 2X18A 2E2XA 1B55A 2N0YA 1J0WA 2DTCA 3ULCA 3G9WA 3U8ZA 1V61A 1MAIA 2Y8GA 2ELAA 2DHJA 4PNKA 4KHAA 5HE0A 1WJMA 1PFJA 2ROZB 3KRWA 1V88A 4HB2B 5HE3A 1X1GA 2CY4A 2BCJA 2W2WA 1TXDA 1U5DA 4F7HA 1V5UA 3M1IB 2RLOA 1I2HA 4CYEA 2UZRA 4DX8A 1BTNA 3ODWA 1J19A 2EJ8A 4HB3B 2XQNM 4MK0A 2J0JA 2YF0A 3GF9A 1OQNA 1U5EA 2M38A 2DKPA 5KCVA 5EFXA 1M7RA 1BWNA 2LG1A 3SNHA 1QC6A 4HAUB 2I1JA 1XCGA 5J3YA 4HAWB 4HAZB 4ZRKA 3D8DA 2IYBA 3TVVA 1H4RA 1Y5OA 4IFSA 2GCJA 4PQ0A 2OTXA 3SO6A 2DLWA 3CXBB 2JP2A 4WVFB 2MKRA 3PVLA 1F5XA 2HE7A 1MIXA 4BBKA 4Z2MB 4KHBB 1XKEA 2RGNB 4Z2NA 4HATB 3TFMA 3ML4A 1W1HA 5FI0A 1EVHA 3PVUA 3O96A 4EJNA 1X11A 4K2PA 4Y94A 3SV1A 1XD4A 1FAOA 3PG7A 4L6EA 3U7DA 1EAZA 4DXAB 2ADZA 3D8FA 1GG3A 1EGXA 2V76A 1GC7A 5LOPB 3NSUA 2MDXA 1Y19B 1UEFA 2CAYA 1MKEA 2N23A 1MIZB 2DYQA 4A6KA 1U5FA 1V5MA 3V5WA 3A98B 3KRXA 1I7AA 5J3TA 4GPTB 1W1GA 2DFKA 5DIFB 4KHOA 2M14A 4MY6A 3P6AA 4NY0A 1DDWA 1AWEA 1LW3A 3MDBC 3TW1A 4D0NB 1MK9B 4A5KA 5D27A 5LONB 2YS5A 3A8QA 2D11A 1PMSA 2Q13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JHG A;  3KSY A;  1W1D A;  1UNP A;  2DHK A;  4YON A;  1ZC3 B;  4MT7 A;  5D3W A;  2LKO A;  1WVH A;  4F7U P;  4XWX A;  1U29 A;  1ZVR A;  2VRW B;  2W2X D;  4TKN A;  3BJI A;  2UZS A;  2MWN B;  3LJU X;  2P8V A;  2R0D A;  2Y7B A;  3DXC A;  3ZDT A;  2GCL A;  5J3Q A;  2IFS A;  1BY1 A;  3AJ4 A;  2D4Q A;  2Z0P A;  4F7G A;  2PZ1 A;  5C5B B;  4HB4 B;  3KZ1 A;  2Y8F A;  3D8E A;  2YS3 A;  2Z0O A;  1BAK A;  2D2Q A;  1LB1 A;  5CLL B;  4HAY B;  3KY9 A;  1X05 A;  3RCP A;  1XR0 B;  3OAN A;  1NTY A;  1P5T A;  5JLJ B;  2RNR B;  2KCJ A;  2AEH A;  1WGU A;  4DBB A;  1E5W A;  2D9W A;  2I5F A;  2ELB A;  2H7E A;  3VOQ A;  3UZT A;  1WJ1 A;  2L2I A;  4ZRI A;  1H10 A;  2LOZ A;  2EC1 A;  1DBH A;  4HAV B;  4HB0 B;  4B6H A;  1DDM A;  1TQZ A;  3PVW A;  4KVG B;  2G35 A;  4CHJ A;  3ODO A;  1ZC4 B;  3MPX A;  4GYV A;  4K81 A;  4HHV A;  1FHX A;  2DKQ A;  3VIA A;  3FM8 C;  3BIN A;  4WJ7 A;  2LUL A;  2MFQ A;  4IAP A;  1PLS A;  2OQB A;  4GMX B;  4GMV A;  2W2X C;  2D9Y A;  2K00 A;  1V5P A;  4HAX B;  5FI1 A;  3TO1 A;  1P3R A;  3ZVR A;  3IVF A;  5D3V A;  1DRO A;  1RJ2 A;  4IOY X;  4K2O A;  1V89 A;  3PSC A;  2P0H A;  3GYP A;  3QIJ A;  1X1F A;  1ZM0 A;  2J0M A;  1SHC A;  3X23 A;  4GXB A;  1AQC A;  2DX1 A;  3F5R A;  2COD A;  2COA A;  2HTH B;  1FHW A;  1X86 A;  3SYX A;  3DXE A;  4GN1 A;  3FEH A;  1U27 A;  2QKM A;  1MPH A;  2CRF A;  2ZPY A;  4D0O A;  2D9X A;  2EMS A;  2KR9 A;  1IRS A;  5JHH A;  5KQ1 A;  2Z0Q A;  5DH9 B;  2RSG A;  1UPR A;  2GS0 A;  5CLQ B;  5DHF B;  2YS1 A;  2J59 M;  5HE2 A;  2QKL A;  1UPQ A;  2YSZ A;  2I1K A;  2VKI A;  1GC6 A;  5GOW B;  3P7Z A;  2P0D A;  2FJL A;  5C79 A;  2COF A;  1DDV A;  2KUP A;  3JV3 A;  1ISN A;  1U5G A;  4DX9 0;  1NU2 A;  4TYZ A;  4GOU A;  2DX5 A;  1WGQ A;  1Z87 A;  2DYN A;  1MK7 B;  1P6S A;  5D3X A;  2DA0 A;  1OY2 A;  5C16 A;  3A8P A;  2EMT A;  1TJ6 A;  1XOD A;  1UNQ A;  2I5C A;  3PEG A;  4P7I A;  5HE1 A;  3TCA A;  1FHO A;  4YL8 A;  3AU5 A;  4GZU A;  3QWM A;  4K17 A;  3PP2 A;  5DHA B;  4A6F B;  1OMW A;  1FGY A;  4EKU A;  5C5B A;  1M7E A;  4HDO A;  5JP4 A;  2D10 A;  2YT1 A;  2UVM A;  5DI9 B;  1RRP B;  4KAX B;  2YVC A;  5D3Y A;  4A6F A;  2P0F A;  2ROV A;  1N3H A;  3WYF B;  4C0A A;  2NZ8 B;  2DN6 A;  1FB8 A;  1NI2 A;  3F0W A;  5L81 A;  4A6H A;  1KZ7 A;  1SGH A;  2COC A;  4HDQ A;  1KI1 B;  2CY5 A;  1KZG A;  2LYD A;  4CHM A;  4EMO A;  2RUK B;  1XX0 A;  2YT0 A;  3ULB A;  1NTV A;  4H8S A;  2J0K A;  1QQG A;  3HK0 A;  2DHI A;  1UNR A;  3QBV B;  3SUZ A;  2GJY A;  3AU4 A;  3PZD A;  1Q67 A;  2VSZ A;  3N7C A;  3DXD A;  2RVB B;  2LOX A;  3HQC A;  1WI1 A;  2K2U A;  1FOE A;  2NMB A;  4WSF A;  1EF1 A;  2YRY A;  1K5D B;  1K5G B;  1ZSQ A;  5KQ4 A;  3GYO A;  3CIK A;  2AL6 A;  3HW2 B;  2D9V A;  1BTK A;  2KGX B;  3T06 A;  2L1C A;  3ODX A;  3WA0 A;  5C6R A;  1U2B A;  2K2J A;  1FGZ A;  4NSW A;  2R09 A;  3EO2 A;  1WG7 A;  2D9Z A;  4ZRJ A;  3FSS A;  1DYN A;  2H7D A;  2X18 A;  2E2X A;  1B55 A;  2N0Y A;  1J0W A;  2DTC A;  3ULC A;  3G9W A;  3U8Z A;  1V61 A;  1MAI A;  2Y8G A;  2ELA A;  2DHJ A;  4PNK A;  4KHA A;  5HE0 A;  1WJM A;  1PFJ A;  2ROZ B;  3KRW A;  1V88 A;  4HB2 B;  5HE3 A;  1X1G A;  2CY4 A;  2BCJ A;  2W2W A;  1TXD A;  1U5D A;  4F7H A;  1V5U A;  3M1I B;  2RLO A;  1I2H A;  4CYE A;  2UZR A;  4DX8 A;  1BTN A;  3ODW A;  1J19 A;  2EJ8 A;  4HB3 B;  2XQN M;  4MK0 A;  2J0J A;  2YF0 A;  3GF9 A;  1OQN A;  1U5E A;  2M38 A;  2DKP A;  5KCV A;  5EFX A;  1M7R A;  1BWN A;  2LG1 A;  3SNH A;  1QC6 A;  4HAU B;  2I1J A;  1XCG A;  5J3Y A;  4HAW B;  4HAZ B;  4ZRK A;  3D8D A;  2IYB A;  3TVV A;  1H4R A;  1Y5O A;  4IFS A;  2GCJ A;  4PQ0 A;  2OTX A;  3SO6 A;  2DLW A;  3CXB B;  2JP2 A;  4WVF B;  2MKR A;  3PVL A;  1F5X A;  2HE7 A;  1MIX A;  4BBK A;  4Z2M B;  4KHB B;  1XKE A;  2RGN B;  4Z2N A;  4HAT B;  3TFM A;  3ML4 A;  1W1H A;  5FI0 A;  1EVH A;  3PVU A;  3O96 A;  4EJN A;  1X11 A;  4K2P A;  4Y94 A;  3SV1 A;  1XD4 A;  1FAO A;  3PG7 A;  4L6E A;  3U7D A;  1EAZ A;  4DXA B;  2ADZ A;  3D8F A;  1GG3 A;  1EGX A;  2V76 A;  1GC7 A;  5LOP B;  3NSU A;  2MDX A;  1Y19 B;  1UEF A;  2CAY A;  1MKE A;  2N23 A;  1MIZ B;  2DYQ A;  4A6K A;  1U5F A;  1V5M A;  3V5W A;  3A98 B;  3KRX A;  1I7A A;  5J3T A;  4GPT B;  1W1G A;  2DFK A;  5DIF B;  4KHO A;  2M14 A;  4MY6 A;  3P6A A;  4NY0 A;  1DDW A;  1AWE A;  1LW3 A;  3MDB C;  3TW1 A;  4D0N B;  1MK9 B;  4A5K A;  5D27 A;  5LON B;  2YS5 A;  3A8Q A;  2D11 A;  1PMS A;  2Q13 A; 
#chains in the Genus database with same CATH topology
 5JHG A;  3KSY A;  1W1D A;  1UNP A;  2DHK A;  4YON A;  1ZC3 B;  4MT7 A;  5D3W A;  2LKO A;  1WVH A;  4F7U P;  4XWX A;  1U29 A;  1ZVR A;  2VRW B;  2W2X D;  4QJ5 B;  4TKN A;  1T77 A;  3BJI A;  2UZS A;  2MWN B;  3LJU X;  2P8V A;  2R0D A;  2Y7B A;  3DXC A;  2ZKM X;  3ZDT A;  2GCL A;  3HIE A;  5J3Q A;  2IFS A;  1BY1 A;  3NWA A;  3AJ4 A;  2D4Q A;  2Z0P A;  4F7G A;  3HSA A;  3B77 A;  2PZ1 A;  5C5B B;  4HB4 B;  3KZ1 A;  2Y8F A;  3D8E A;  2YS3 A;  2Z0O A;  1BAK A;  2D2Q A;  1LB1 A;  4OSN A;  5CLL B;  4HAY B;  3KY9 A;  1X05 A;  3RCP A;  1XR0 B;  3OAN A;  1NTY A;  1P5T A;  5JLJ B;  2RNR B;  2KCJ A;  2AEH A;  1WGU A;  4DBB A;  1E5W A;  2D9W A;  2I5F A;  2ELB A;  2GUM A;  2H7E A;  3VOQ A;  1WJ1 A;  3UZT A;  2L2I A;  4ZRI A;  1H10 A;  4KHB A;  2LOZ A;  2EC1 A;  1DBH A;  4HAV B;  4HB0 B;  4B6H A;  1DDM A;  1TQZ A;  3PVW A;  4KVG B;  2G35 A;  4CHJ A;  3ODO A;  1ZC4 B;  3MPX A;  4GYV A;  4K81 A;  4HHV A;  1FHX A;  2DKQ A;  3VIA A;  3FM8 C;  3BIN A;  4WJ7 A;  5LG4 B;  2LUL A;  2MFQ A;  4IAP A;  1PLS A;  2OQB A;  4GMX B;  4GMV A;  2W2X C;  2D9Y A;  2K00 A;  1V5P A;  4HAX B;  5FI1 A;  4QJ4 B;  3U12 A;  3TO1 A;  1MI1 A;  1P3R A;  3ZVR A;  3IVF A;  5D3V A;  1DRO A;  1RJ2 A;  4IOY X;  4K2O A;  1V89 A;  3PSC A;  2P0H A;  3GYP A;  3QIJ A;  1X1F A;  1ZM0 A;  2J0M A;  1SHC A;  3X23 A;  4GXB A;  1AQC A;  2DX1 A;  3F5R A;  2COD A;  2COA A;  4CSQ A;  2HTH B;  1FHW A;  1X86 A;  3SYX A;  3DXE A;  4GN1 A;  2KIE A;  3FEH A;  2FJU B;  1U27 A;  2QKM A;  1MPH A;  2CRF A;  2ZPY A;  4D0O A;  2D9X A;  2EMS A;  2KR9 A;  1IRS A;  4DIX A;  5JHH A;  5KQ1 A;  2Z0Q A;  5DH9 B;  2RSG A;  1UPR A;  2GS0 A;  5CLQ B;  5DHF B;  2YT2 A;  2K49 A;  2YS1 A;  2J59 M;  5HE2 A;  2QKL A;  1UPQ A;  2YSZ A;  2I1K A;  2VKI A;  1GC6 A;  5GOW B;  3P7Z A;  2P0D A;  2FJL A;  5C79 A;  2COF A;  1DDV A;  2KUP A;  3JV3 A;  1ISN A;  3NWF A;  1U5G A;  4DX9 0;  1NU2 A;  2Z14 A;  4TYZ A;  4GOU A;  2DX5 A;  1WGQ A;  1Z87 A;  2DYN A;  1MK7 B;  1P6S A;  5D3X A;  2DA0 A;  1OY2 A;  5C16 A;  3A8P A;  2EMT A;  1TJ6 A;  1XOD A;  1UNQ A;  2I5C A;  3PEG A;  4P7I A;  5HE1 A;  3TCA A;  1FHO A;  4YL8 A;  3AU5 A;  4GZU A;  3QWM A;  4K17 A;  3PP2 A;  5DHA B;  4A6F B;  1OMW A;  1FGY A;  4EKU A;  5C5B A;  1M7E A;  4HDO A;  5JP4 A;  1ZYI A;  2D10 A;  2YT1 A;  2UVM A;  5DI9 B;  1RRP B;  4KAX B;  2YVC A;  5D3Y A;  4D6W A;  4A6F A;  2P0F A;  4HSI A;  2ROV A;  1N3H A;  3WYF B;  4C0A A;  2NZ8 B;  2DN6 A;  1FB8 A;  1NI2 A;  3F0W A;  5L81 A;  4A6H A;  1KZ7 A;  1SGH A;  2COC A;  4HDQ A;  1KI1 B;  2CY5 A;  1KZG A;  2LYD A;  4CHM A;  4EMO A;  2RUK B;  1XX0 A;  2YT0 A;  3ULB A;  1NTV A;  4H8S A;  2J0K A;  1QQG A;  3HK0 A;  3A58 A;  4QXA B;  2DHI A;  1UNR A;  3QBV B;  2KUQ A;  3SUZ A;  2GJY A;  3AU4 A;  3PZD A;  1Q67 A;  2VSZ A;  3N7C A;  3DXD A;  2RVB B;  2LOX A;  3HQC A;  1WI1 A;  2K2U A;  1FOE A;  2NMB A;  4WSF A;  1EF1 A;  2YRY A;  1K5D B;  1K5G B;  1ZSQ A;  5KQ4 A;  3OHM B;  3GYO A;  3CIK A;  2AL6 A;  3HW2 B;  2D9V A;  1BTK A;  2KGX B;  3T06 A;  2L1C A;  3ODX A;  3WA0 A;  5C6R A;  1U2B A;  2K2J A;  2R2Y A;  1FGZ A;  4NSW A;  2R09 A;  3EO2 A;  1WG7 A;  2D9Z A;  4ZRJ A;  3FSS A;  1DYN A;  2H7D A;  2X18 A;  2E2X A;  5IRS A;  1B55 A;  2N0Y A;  1J0W A;  2DTC A;  3ULC A;  3G9W A;  3U8Z A;  1V61 A;  1MAI A;  2Y8G A;  2ELA A;  2DHJ A;  4PNK A;  4KHA A;  5HE0 A;  5I2M A;  1WJM A;  1PFJ A;  2ROZ B;  4GNK B;  3KRW A;  1V88 A;  4HB2 B;  5HE3 A;  1X1G A;  2CY4 A;  2BCJ A;  2W2W A;  1TXD A;  1U5D A;  4F7H A;  1V5U A;  3M1I B;  2RLO A;  1I2H A;  4CYE A;  2UZR A;  4DX8 A;  1BTN A;  3ODW A;  1J19 A;  2EJ8 A;  3NWD A;  4HB3 B;  2XQN M;  4MK0 A;  2J0J A;  2YF0 A;  3GF9 A;  1OQN A;  1U5E A;  2M38 A;  2KIG A;  2DKP A;  4OT1 A;  5KCV A;  5EFX A;  1M7R A;  2Z4D A;  1BWN A;  2K8E A;  2LG1 A;  3SNH A;  1QC6 A;  4HAU B;  2I1J A;  1XCG A;  5J3Y A;  4HAW B;  4HAZ B;  4ZRK A;  3D8D A;  4L1R A;  2IYB A;  3TVV A;  2Z59 A;  1H4R A;  1Y5O A;  4IFS A;  2GCJ A;  4PQ0 A;  2OTX A;  3SO6 A;  2DLW A;  3CXB B;  2JP2 A;  4WVF B;  2MKR A;  3NW8 A;  3PVL A;  1F5X A;  2HE7 A;  1MIX A;  4BBK A;  4Z2M B;  4KHB B;  1XKE A;  2RGN B;  4QJ3 B;  4Z2N A;  4HAT B;  5I2S A;  3TFM A;  3ML4 A;  1W1H A;  5FI0 A;  1EVH A;  3PVU A;  3O96 A;  4EJN A;  1X11 A;  4K2P A;  4Y94 A;  3DCX A;  3SV1 A;  1XD4 A;  5M4Y B;  1FAO A;  3PG7 A;  4L6E A;  3U7D A;  1EAZ A;  4DXA B;  2ADZ A;  3D8F A;  1GG3 A;  1EGX A;  2V76 A;  1GC7 A;  2Z13 A;  5LOP B;  3NSU A;  2MDX A;  2NBV A;  1Y19 B;  1UEF A;  2CAY A;  1MKE A;  2N23 A;  1MIZ B;  2DYQ A;  4A6K A;  1U5F A;  1V5M A;  3V5W A;  3A98 B;  2RRF A;  3KRX A;  1I7A A;  5J3T A;  4GPT B;  1W1G A;  2DFK A;  5DIF B;  4KHO A;  2M14 A;  3FVC A;  3P6A A;  4MY6 A;  4NY0 A;  1DDW A;  1AWE A;  1LW3 A;  3MDB C;  3TW1 A;  4D0N B;  2KR0 A;  1MK9 B;  4A5K A;  5D27 A;  5LON B;  2YS5 A;  3A8Q A;  2D11 A;  1PMS A;  2Q13 A; 
#chains in the Genus database with same CATH homology
 5JHG A;  3KSY A;  1W1D A;  1UNP A;  2DHK A;  4YON A;  1ZC3 B;  4MT7 A;  5D3W A;  2LKO A;  1WVH A;  4F7U P;  4XWX A;  1U29 A;  1ZVR A;  2VRW B;  2W2X D;  4TKN A;  3BJI A;  2UZS A;  2MWN B;  3LJU X;  2P8V A;  2R0D A;  2Y7B A;  3DXC A;  3ZDT A;  2GCL A;  5J3Q A;  2IFS A;  1BY1 A;  3AJ4 A;  2D4Q A;  2Z0P A;  4F7G A;  2PZ1 A;  5C5B B;  4HB4 B;  3KZ1 A;  2Y8F A;  3D8E A;  2YS3 A;  2Z0O A;  1BAK A;  2D2Q A;  1LB1 A;  5CLL B;  4HAY B;  3KY9 A;  1X05 A;  3RCP A;  1XR0 B;  3OAN A;  1NTY A;  1P5T A;  5JLJ B;  2RNR B;  2KCJ A;  2AEH A;  1WGU A;  4DBB A;  1E5W A;  2D9W A;  2I5F A;  2ELB A;  2H7E A;  3VOQ A;  3UZT A;  1WJ1 A;  2L2I A;  4ZRI A;  1H10 A;  2LOZ A;  2EC1 A;  1DBH A;  4HAV B;  4HB0 B;  4B6H A;  1DDM A;  1TQZ A;  3PVW A;  4KVG B;  2G35 A;  4CHJ A;  3ODO A;  1ZC4 B;  3MPX A;  4GYV A;  4K81 A;  4HHV A;  1FHX A;  2DKQ A;  3VIA A;  3FM8 C;  3BIN A;  4WJ7 A;  2LUL A;  2MFQ A;  4IAP A;  1PLS A;  2OQB A;  4GMX B;  4GMV A;  2W2X C;  2D9Y A;  2K00 A;  1V5P A;  4HAX B;  5FI1 A;  3TO1 A;  1P3R A;  3ZVR A;  3IVF A;  5D3V A;  1DRO A;  1RJ2 A;  4IOY X;  4K2O A;  1V89 A;  3PSC A;  2P0H A;  3GYP A;  3QIJ A;  1X1F A;  1ZM0 A;  2J0M A;  1SHC A;  3X23 A;  4GXB A;  1AQC A;  2DX1 A;  3F5R A;  2COD A;  2COA A;  2HTH B;  1FHW A;  1X86 A;  3SYX A;  3DXE A;  4GN1 A;  3FEH A;  1U27 A;  2QKM A;  1MPH A;  2CRF A;  2ZPY A;  4D0O A;  2D9X A;  2EMS A;  2KR9 A;  1IRS A;  5JHH A;  5KQ1 A;  2Z0Q A;  5DH9 B;  2RSG A;  1UPR A;  2GS0 A;  5CLQ B;  5DHF B;  2YS1 A;  2J59 M;  5HE2 A;  2QKL A;  1UPQ A;  2YSZ A;  2I1K A;  2VKI A;  1GC6 A;  5GOW B;  3P7Z A;  2P0D A;  2FJL A;  5C79 A;  2COF A;  1DDV A;  2KUP A;  3JV3 A;  1ISN A;  1U5G A;  4DX9 0;  1NU2 A;  4TYZ A;  4GOU A;  2DX5 A;  1WGQ A;  1Z87 A;  2DYN A;  1MK7 B;  1P6S A;  5D3X A;  2DA0 A;  1OY2 A;  5C16 A;  3A8P A;  2EMT A;  1TJ6 A;  1XOD A;  1UNQ A;  2I5C A;  3PEG A;  4P7I A;  5HE1 A;  3TCA A;  1FHO A;  4YL8 A;  3AU5 A;  4GZU A;  3QWM A;  4K17 A;  3PP2 A;  5DHA B;  4A6F B;  1OMW A;  1FGY A;  4EKU A;  5C5B A;  1M7E A;  4HDO A;  5JP4 A;  2D10 A;  2YT1 A;  2UVM A;  5DI9 B;  1RRP B;  4KAX B;  2YVC A;  5D3Y A;  4A6F A;  2P0F A;  2ROV A;  1N3H A;  3WYF B;  4C0A A;  2NZ8 B;  2DN6 A;  1FB8 A;  1NI2 A;  3F0W A;  5L81 A;  4A6H A;  1KZ7 A;  1SGH A;  2COC A;  4HDQ A;  1KI1 B;  2CY5 A;  1KZG A;  2LYD A;  4CHM A;  4EMO A;  2RUK B;  1XX0 A;  2YT0 A;  3ULB A;  1NTV A;  4H8S A;  2J0K A;  1QQG A;  3HK0 A;  2DHI A;  1UNR A;  3QBV B;  3SUZ A;  2GJY A;  3AU4 A;  3PZD A;  1Q67 A;  2VSZ A;  3N7C A;  3DXD A;  2RVB B;  2LOX A;  3HQC A;  1WI1 A;  2K2U A;  1FOE A;  2NMB A;  4WSF A;  1EF1 A;  2YRY A;  1K5D B;  1K5G B;  1ZSQ A;  5KQ4 A;  3GYO A;  3CIK A;  2AL6 A;  3HW2 B;  2D9V A;  1BTK A;  2KGX B;  3T06 A;  2L1C A;  3ODX A;  3WA0 A;  5C6R A;  1U2B A;  2K2J A;  1FGZ A;  4NSW A;  2R09 A;  3EO2 A;  1WG7 A;  2D9Z A;  4ZRJ A;  3FSS A;  1DYN A;  2H7D A;  2X18 A;  2E2X A;  1B55 A;  2N0Y A;  1J0W A;  2DTC A;  3ULC A;  3G9W A;  3U8Z A;  1V61 A;  1MAI A;  2Y8G A;  2ELA A;  2DHJ A;  4PNK A;  4KHA A;  5HE0 A;  1WJM A;  1PFJ A;  2ROZ B;  3KRW A;  1V88 A;  4HB2 B;  5HE3 A;  1X1G A;  2CY4 A;  2BCJ A;  2W2W A;  1TXD A;  1U5D A;  4F7H A;  1V5U A;  3M1I B;  2RLO A;  1I2H A;  4CYE A;  2UZR A;  4DX8 A;  1BTN A;  3ODW A;  1J19 A;  2EJ8 A;  4HB3 B;  2XQN M;  4MK0 A;  2J0J A;  2YF0 A;  3GF9 A;  1OQN A;  1U5E A;  2M38 A;  2DKP A;  5KCV A;  5EFX A;  1M7R A;  1BWN A;  2LG1 A;  3SNH A;  1QC6 A;  4HAU B;  2I1J A;  1XCG A;  5J3Y A;  4HAW B;  4HAZ B;  4ZRK A;  3D8D A;  2IYB A;  3TVV A;  1H4R A;  1Y5O A;  4IFS A;  2GCJ A;  4PQ0 A;  2OTX A;  3SO6 A;  2DLW A;  3CXB B;  2JP2 A;  4WVF B;  2MKR A;  3PVL A;  1F5X A;  2HE7 A;  1MIX A;  4BBK A;  4Z2M B;  4KHB B;  1XKE A;  2RGN B;  4Z2N A;  4HAT B;  3TFM A;  3ML4 A;  1W1H A;  5FI0 A;  1EVH A;  3PVU A;  3O96 A;  4EJN A;  1X11 A;  4K2P A;  4Y94 A;  3SV1 A;  1XD4 A;  1FAO A;  3PG7 A;  4L6E A;  3U7D A;  1EAZ A;  4DXA B;  2ADZ A;  3D8F A;  1GG3 A;  1EGX A;  2V76 A;  1GC7 A;  5LOP B;  3NSU A;  2MDX A;  1Y19 B;  1UEF A;  2CAY A;  1MKE A;  2N23 A;  1MIZ B;  2DYQ A;  4A6K A;  1U5F A;  1V5M A;  3V5W A;  3A98 B;  3KRX A;  1I7A A;  5J3T A;  4GPT B;  1W1G A;  2DFK A;  5DIF B;  4KHO A;  2M14 A;  4MY6 A;  3P6A A;  4NY0 A;  1DDW A;  1AWE A;  1LW3 A;  3MDB C;  3TW1 A;  4D0N B;  1MK9 B;  4A5K A;  5D27 A;  5LON B;  2YS5 A;  3A8Q A;  2D11 A;  1PMS A;  2Q13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...