3ODOA

Crystal structure of the dh/ph domains of p115-rhogef
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
370
structure length
370
Chain Sequence
QTSPPGWRELVPPDTLHSLPKSQVKRQEVISELLVTEAAHVRMLRVLHDLFFQPMAECLFFPLEELQNIFPSLDELIEVHSLFLDRLMKRRQESGYLIEEIGDVLLARFDGAEGSWFQKISSRFCSRQSFALEQLKAKQRKDPRFCAFVQEAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEEPTEREKVELAAECCREILHHVNQAVRDMEDLLRLKDYQRRLDLSHLRQSSDPMLSEFKNLDITKKKLVHEGPLTWRVTKDKAVEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLRPVLRLTSAMTREVATDHKAFYVLFTWDQEAQIYELVAQTVSERKNWCALITETAGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rho guanine nucleotide exchange factor 1
publication title Modulation of a GEF switch: Autoinhibition of the intrinsic guanine nucleotide exchange activity of p115-RhoREF
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 126
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00621 RhoGEF RhoGEF domain
A PF17838 PH_16 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 3odoA01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3odoA02
2Z0OA 5DH9B 1ZVRA 3U7DA 2COCA 4MT7A 2QKLA 2LOXA 4HHVA 2N0YA 5C5BB 5DIFB 5C5BA 1XR0B 1X05A 2ELBA 2UZRA 2YT0A 2ADZA 5FI0A 1KI1B 2DX1A 1NU2A 3KZ1A 3UZTA 2K2UA 4KHAA 1V88A 2Y7BA 4K17A 2I5CA 4IOYX 3V5WA 1GC6A 2RUKB 2DKQA 2ELAA 1SGHA 3MDBC 4K2OA 2D10A 1FAOA 4C0AA 1QC6A 2KR9A 2DTCA 1ZC3B 5J3TA 1N3HA 1BAKA 1U2BA 1GC7A 1FGYA 4H8SA 2UVMA 4F7UP 1GG3A 1OMWA 2NMBA 1WGUA 2XQNM 2EJ8A 2GCJA 4Y94A 4P7IA 4HDOA 3FEHA 3ODWA 4A6HA 2X18A 2LYDA 3ODOA 3O96A 2VRWB 2D2QA 2BCJA 2H7EA 1PMSA 4XWXA 1UPRA 2MFQA 4K81A 2LKOA 2D4QA 4EJNA 5DI9B 4GN1A 2D9VA 1MKEA 3WYFB 1AWEA 1ZM0A 2DKPA 3ZDTA 4Z2MB 2AL6A 1XX0A 2MDXA 2QKMA 2CAYA 5CLQB 2D9ZA 3SUZA 2R0DA 3KY9A 5J3YA 5JP4A 3ULBA 1DYNA 1FOEA 2Y8FA 3DXCA 2YVCA 3U8ZA 4DX90 1LB1A 5JHGA 2L2IA 2IYBA 2W2XC 3WA0A 3GYPA 2KUPA 1P3RA 3G9WA 1F5XA 2YS5A 1EF1A 3DXDA 4TKNA 3GF9A 4GPTB 4B6HA 1DBHA 1ISNA 4PQ0A 1V5PA 4EKUA 3CIKA 4KVGB 4CYEA 2VSZA 2HTHB 2P8VA 4MY6A 1TXDA 3PVLA 4A5KA 3BJIA 3GYOA 5C79A 2MKRA 1V5UA 4HB4B 1ZC4B 4HAYB 1WG7A 2DX5A 2GJYA 4HB0B 2N23A 2RNRB 3JV3A 3HQCA 1BTNA 2ROZB 2LG1A 4HDQA 4BBKA 2FJLA 2CODA 2YS1A 1Y5OA 2D9YA 2Z0PA 1Z87A 5EFXA 4ZRIA 2M38A 1EGXA 1DDWA 4NSWA 2EMTA 4DBBA 3FM8C 2YT1A 1X1GA 3IVFA 1PLSA 2J0MA 2W2WA 1BTKA 4ZRKA 4YL8A 3VOQA 1ZSQA 2I1JA 2P0DA 2V76A 2K00A 1EAZA 3A8PA 2I1KA 1P5TA 4HB2B 3MPXA 3PP2A 2LULA 4EMOA 1FB8A 3PVUA 5J3QA 4HAUB 2D9WA 3PVWA 4CHJA 2YF0A 1EVHA 2CY4A 1OQNA 5D3VA 2J59M 5KQ1A 4K2PA 1RRPB 1WJMA 1TQZA 1Y19B 2YRYA 3D8EA 4GOUA 1MAIA 1X86A 1FHOA 4HAVB 1U27A 3PEGA 4GYVA 1DDMA 4F7HA 2ZPYA 4KAXB 4WVFB 2D11A 2D9XA 4Z2NA 5D3WA 4CHMA 4GMVA 1NTVA 2I5FA 4YONA 2GCLA 1X11A 5HE0A 4GXBA 2J0JA 1KZ7A 2DYNA 1FHXA 2Y8GA 3AJ4A 3TFMA 2IFSA 3ZVRA 4DXAB 1K5GB 1M7EA 1DROA 1WI1A 2P0FA 3AU5A 1U5EA 2W2XD 1J19A 2K2JA 2KCJA 5D27A 3NSUA 5JHHA 1LW3A 3D8DA 4IFSA 4DX8A 1QQGA 2CRFA 3OANA 3BINA 2OQBA 3QWMA 3F5RA 3TCAA 3ML4A 5DHAB 3HK0A 3PZDA 3RCPA 3SO6A 4PNKA 5C6RA 3ODXA 4ZRJA 5KCVA 2AEHA 5HE2A 2M14A 1B55A 4GZUA 1UEFA 1U5DA 2CY5A 3EO2A 5LOPB 2RSGA 2HE7A 2Z0QA 5L81A 2H7DA 3SYXA 1MK7B 1WJ1A 1WGQA 3PG7A 1U5FA 3QIJA 2DN6A 2DYQA 3P6AA 1FGZA 1H4RA 5GOWB 1NI2A 4HAXB 3LJUX 1V61A 3X23A 2P0HA 2DFKA 4GMXB 1XCGA 2ROVA 5C16A 3HW2B 1NTYA 5HE1A 3TO1A 2YSZA 1RJ2A 1UNPA 5FI1A 1OY2A 3PSCA 4HAZB 5KQ4A 2YS3A 1IRSA 4MK0A 1MK9B 1KZGA 3FSSA 4NY0A 1W1GA 2PZ1A 3TW1A 5CLLB 4HAWB 1WVHA 1FHWA 4F7GA 2DA0A 1K5DB 1Q67A 3A98B 2J0KA 3KSYA 4IAPA 2LOZA 1DDVA 3KRXA 3SV1A 3P7ZA 1W1HA 3ULCA 2RGNB 2RVBB 1I7AA 1P6SA 4WJ7A 1XODA 2GS0A 5DHFB 1SHCA 2DHJA 2KGXB 3SNHA 3M1IB 3N7CA 1XKEA 1I2HA 2E2XA 2COAA 2Q13A 1AQCA 2RLOA 2OTXA 1MIXA 1UNRA 2EMSA 5JLJB 4D0OA 1H10A 2DHKA 1MPHA 3CXBB 3TVVA 4L6EA 3F0WA 1TJ6A 1U29A 5HE3A 4HATB 2EC1A 3DXEA 4HB3B 1E5WA 3A8QA 5LONB 2MWNB 1PFJA 2COFA 1X1FA 4TYZA 1XD4A 3VIAA 3QBVB 4KHOA 2DLWA 4WSFA 2R09A 2VKIA 2UZSA 4KHBB 4A6KA 1U5GA 3AU4A 2G35A 2L1CA 1W1DA 1BY1A 5D3XA 1V5MA 4A6FB 4A6FA 3T06A 2DHIA 2JP2A 4D0NB 1M7RA 1MIZB 1UNQA 1UPQA 3KRWA 5D3YA 3D8FA 1V89A 1J0WA 1BWNA 2NZ8B
chains in the Genus database with same CATH superfamily
2Z0OA 5DH9B 1ZVRA 3U7DA 2COCA 4MT7A 2QKLA 2LOXA 4HHVA 4OSNA 2N0YA 5C5BB 5DIFB 5C5BA 1XR0B 1X05A 2ELBA 2UZRA 2YT0A 3NW8A 4QJ4B 2ADZA 5FI0A 1KI1B 2DX1A 1NU2A 3KZ1A 3UZTA 2K2UA 4KHAA 1V88A 2Y7BA 4K17A 2I5CA 4IOYX 3V5WA 1GC6A 2RUKB 2DKQA 2ELAA 1SGHA 3MDBC 4K2OA 2D10A 1FAOA 4C0AA 4L1RA 1QC6A 2KR9A 2DTCA 1ZC3B 5J3TA 1N3HA 1BAKA 1U2BA 1GC7A 1FGYA 4H8SA 2UVMA 4F7UP 1GG3A 1OMWA 2NMBA 1WGUA 2XQNM 2EJ8A 2GCJA 4Y94A 4P7IA 4DIXA 5I2SA 4HDOA 3FEHA 3ODWA 3OHMB 2Z59A 4A6HA 2X18A 2LYDA 3ODOA 3O96A 2VRWB 2D2QA 2BCJA 2H7EA 1PMSA 4XWXA 1UPRA 2MFQA 4K81A 2LKOA 2D4QA 4EJNA 5DI9B 4GN1A 2D9VA 1MKEA 3WYFB 1AWEA 1MI1A 1ZM0A 2DKPA 2YT2A 3ZDTA 4Z2MB 2AL6A 1XX0A 2MDXA 2QKMA 2CAYA 3FVCA 5CLQB 2D9ZA 3SUZA 2R0DA 3KY9A 5J3YA 5JP4A 3ULBA 1DYNA 4QJ5B 1FOEA 2Y8FA 3DXCA 2YVCA 3U8ZA 4DX90 1LB1A 2KUQA 5JHGA 2L2IA 4GNKB 3NWAA 2IYBA 2W2XC 3WA0A 3GYPA 2KUPA 1P3RA 3G9WA 1F5XA 2YS5A 1EF1A 3DXDA 4TKNA 3GF9A 4GPTB 4B6HA 1DBHA 1ISNA 4PQ0A 1V5PA 4EKUA 3CIKA 4KVGB 4CYEA 2VSZA 5M4YB 2HTHB 2P8VA 4MY6A 1TXDA 3PVLA 4CSQA 4A5KA 3BJIA 2RRFA 3GYOA 5C79A 2MKRA 1V5UA 4HB4B 2Z4DA 1ZC4B 4HAYB 1WG7A 2DX5A 4QXAB 2GJYA 4HB0B 2N23A 2RNRB 3JV3A 3HQCA 1BTNA 2ROZB 2LG1A 4HDQA 4BBKA 2FJLA 2CODA 2YS1A 1Y5OA 2D9YA 2Z0PA 1Z87A 5EFXA 4ZRIA 2M38A 1EGXA 1DDWA 4NSWA 1ZYIA 2EMTA 4DBBA 3FM8C 2YT1A 5IRSA 2FJUB 1X1GA 3IVFA 1PLSA 2J0MA 2W2WA 1BTKA 4ZRKA 4YL8A 3VOQA 1ZSQA 2I1JA 2P0DA 2V76A 2K00A 3A8PA 1EAZA 2I1KA 1P5TA 4HB2B 3MPXA 3PP2A 2GUMA 2LULA 4EMOA 1FB8A 3PVUA 5J3QA 4HAUB 2D9WA 3PVWA 4CHJA 2YF0A 1EVHA 2CY4A 2ZKMX 1OQNA 5D3VA 2J59M 5KQ1A 4K2PA 1RRPB 1WJMA 1TQZA 1Y19B 2YRYA 3D8EA 4GOUA 1MAIA 1X86A 1FHOA 4HSIA 4HAVB 1U27A 2KIGA 4D6WA 3PEGA 4GYVA 1DDMA 4F7HA 2ZPYA 4KAXB 4WVFB 2D11A 2D9XA 4Z2NA 5D3WA 2NBVA 4CHMA 4GMVA 1NTVA 2I5FA 4YONA 2GCLA 1X11A 5HE0A 4GXBA 2J0JA 1KZ7A 2DYNA 1FHXA 2Y8GA 2R2YA 3AJ4A 3TFMA 2IFSA 3ZVRA 4DXAB 1K5GB 1M7EA 1DROA 1WI1A 2P0FA 3AU5A 1U5EA 2W2XD 1J19A 2K2JA 2KCJA 5D27A 5I2MA 3U12A 3NSUA 5JHHA 1LW3A 3D8DA 4IFSA 4DX8A 1QQGA 2CRFA 3OANA 3BINA 2OQBA 3QWMA 3HIEA 3F5RA 3HSAA 3TCAA 3ML4A 5DHAB 3HK0A 3PZDA 3RCPA 3SO6A 4PNKA 5C6RA 3ODXA 4ZRJA 5KCVA 2AEHA 5HE2A 2M14A 1B55A 4GZUA 1UEFA 1U5DA 2CY5A 3EO2A 5LOPB 2RSGA 2HE7A 2Z0QA 5L81A 2H7DA 3SYXA 1MK7B 1WJ1A 3DCXA 1WGQA 3PG7A 1U5FA 3QIJA 2DN6A 2DYQA 3P6AA 1FGZA 1H4RA 5GOWB 1NI2A 4HAXB 3LJUX 1V61A 3X23A 2P0HA 2DFKA 2Z14A 4GMXB 1XCGA 2ROVA 2Z13A 5C16A 3HW2B 1NTYA 5HE1A 3TO1A 2YSZA 1RJ2A 1UNPA 5FI1A 1OY2A 3PSCA 4HAZB 5KQ4A 2YS3A 1IRSA 4MK0A 5LG4B 1MK9B 1KZGA 4OT1A 3FSSA 4NY0A 1W1GA 2PZ1A 3TW1A 5CLLB 4HAWB 1WVHA 1FHWA 4F7GA 2DA0A 1K5DB 1Q67A 3A98B 2J0KA 3KSYA 4IAPA 2LOZA 1DDVA 3KRXA 3SV1A 3P7ZA 3NWDA 1W1HA 3ULCA 2RGNB 2RVBB 1I7AA 1P6SA 4WJ7A 1XODA 3B77A 2GS0A 2KR0A 5DHFB 1SHCA 2DHJA 2KGXB 3SNHA 3M1IB 3N7CA 1XKEA 1I2HA 2E2XA 2COAA 2Q13A 1AQCA 2RLOA 2OTXA 1MIXA 1UNRA 2EMSA 5JLJB 4D0OA 3NWFA 1H10A 2DHKA 1MPHA 3CXBB 3TVVA 4L6EA 3F0WA 1TJ6A 1U29A 5HE3A 4HATB 2EC1A 3DXEA 4HB3B 1E5WA 2K8EA 3A8QA 5LONB 2MWNB 1PFJA 2COFA 1X1FA 4TYZA 1XD4A 1T77A 3VIAA 3QBVB 4KHOA 2DLWA 4WSFA 2R09A 2VKIA 2UZSA 4KHBB 2K49A 1U5GA 3AU4A 4KHBA 2G35A 4A6KA 2L1CA 1W1DA 1BY1A 5D3XA 1V5MA 3A58A 4QJ3B 4A6FB 4A6FA 3T06A 2DHIA 2JP2A 4D0NB 1M7RA 1MIZB 2KIEA 1UNQA 1UPQA 3KRWA 5D3YA 3D8FA 1V89A 1J0WA 1BWNA 2NZ8B
chains in the Genus database with same CATH topology
2Z0OA 5DH9B 1ZVRA 3U7DA 2COCA 4MT7A 2QKLA 2LOXA 4HHVA 2N0YA 5C5BB 5DIFB 5C5BA 1XR0B 1X05A 2ELBA 2UZRA 2YT0A 2ADZA 5FI0A 1KI1B 2DX1A 1NU2A 3KZ1A 3UZTA 2K2UA 4KHAA 1V88A 2Y7BA 4K17A 2I5CA 4IOYX 3V5WA 1GC6A 2RUKB 2DKQA 2ELAA 1SGHA 3MDBC 4K2OA 2D10A 1FAOA 4C0AA 1QC6A 2KR9A 2DTCA 1ZC3B 5J3TA 1N3HA 1BAKA 1U2BA 1GC7A 1FGYA 4H8SA 2UVMA 4F7UP 1GG3A 1OMWA 2NMBA 1WGUA 2XQNM 2EJ8A 2GCJA 4Y94A 4P7IA 4HDOA 3FEHA 3ODWA 4A6HA 2X18A 2LYDA 3ODOA 3O96A 2VRWB 2D2QA 2BCJA 2H7EA 1PMSA 4XWXA 1UPRA 2MFQA 4K81A 2LKOA 2D4QA 4EJNA 5DI9B 4GN1A 2D9VA 1MKEA 3WYFB 1AWEA 1ZM0A 2DKPA 3ZDTA 4Z2MB 2AL6A 1XX0A 2MDXA 2QKMA 2CAYA 5CLQB 2D9ZA 3SUZA 2R0DA 3KY9A 5J3YA 5JP4A 3ULBA 1DYNA 1FOEA 2Y8FA 3DXCA 2YVCA 3U8ZA 4DX90 1LB1A 5JHGA 2L2IA 2IYBA 2W2XC 3WA0A 3GYPA 2KUPA 1P3RA 3G9WA 1F5XA 2YS5A 1EF1A 3DXDA 4TKNA 3GF9A 4GPTB 4B6HA 1DBHA 1ISNA 4PQ0A 1V5PA 4EKUA 3CIKA 4KVGB 4CYEA 2VSZA 2HTHB 2P8VA 4MY6A 1TXDA 3PVLA 4A5KA 3BJIA 3GYOA 5C79A 2MKRA 1V5UA 4HB4B 1ZC4B 4HAYB 1WG7A 2DX5A 2GJYA 4HB0B 2N23A 2RNRB 3JV3A 3HQCA 1BTNA 2ROZB 2LG1A 4HDQA 4BBKA 2FJLA 2CODA 2YS1A 1Y5OA 2D9YA 2Z0PA 1Z87A 5EFXA 4ZRIA 2M38A 1EGXA 1DDWA 4NSWA 2EMTA 4DBBA 3FM8C 2YT1A 1X1GA 3IVFA 1PLSA 2J0MA 2W2WA 1BTKA 4ZRKA 4YL8A 3VOQA 1ZSQA 2I1JA 2P0DA 2V76A 2K00A 1EAZA 3A8PA 2I1KA 1P5TA 4HB2B 3MPXA 3PP2A 2LULA 4EMOA 1FB8A 3PVUA 5J3QA 4HAUB 2D9WA 3PVWA 4CHJA 2YF0A 1EVHA 2CY4A 1OQNA 5D3VA 2J59M 5KQ1A 4K2PA 1RRPB 1WJMA 1TQZA 1Y19B 2YRYA 3D8EA 4GOUA 1MAIA 1X86A 1FHOA 4HAVB 1U27A 3PEGA 4GYVA 1DDMA 4F7HA 2ZPYA 4KAXB 4WVFB 2D11A 2D9XA 4Z2NA 5D3WA 4CHMA 4GMVA 1NTVA 2I5FA 4YONA 2GCLA 1X11A 5HE0A 4GXBA 2J0JA 1KZ7A 2DYNA 1FHXA 2Y8GA 3AJ4A 3TFMA 2IFSA 3ZVRA 4DXAB 1K5GB 1M7EA 1DROA 1WI1A 2P0FA 3AU5A 1U5EA 2W2XD 1J19A 2K2JA 2KCJA 5D27A 3NSUA 5JHHA 1LW3A 3D8DA 4IFSA 4DX8A 1QQGA 2CRFA 3OANA 3BINA 2OQBA 3QWMA 3F5RA 3TCAA 3ML4A 5DHAB 3HK0A 3PZDA 3RCPA 3SO6A 4PNKA 5C6RA 3ODXA 4ZRJA 5KCVA 2AEHA 5HE2A 2M14A 1B55A 4GZUA 1UEFA 1U5DA 2CY5A 3EO2A 5LOPB 2RSGA 2HE7A 2Z0QA 5L81A 2H7DA 3SYXA 1MK7B 1WJ1A 1WGQA 3PG7A 1U5FA 3QIJA 2DN6A 2DYQA 3P6AA 1FGZA 1H4RA 5GOWB 1NI2A 4HAXB 3LJUX 1V61A 3X23A 2P0HA 2DFKA 4GMXB 1XCGA 2ROVA 5C16A 3HW2B 1NTYA 5HE1A 3TO1A 2YSZA 1RJ2A 1UNPA 5FI1A 1OY2A 3PSCA 4HAZB 5KQ4A 2YS3A 1IRSA 4MK0A 1MK9B 1KZGA 3FSSA 4NY0A 1W1GA 2PZ1A 3TW1A 5CLLB 4HAWB 1WVHA 1FHWA 4F7GA 2DA0A 1K5DB 1Q67A 3A98B 2J0KA 3KSYA 4IAPA 2LOZA 1DDVA 3KRXA 3SV1A 3P7ZA 1W1HA 3ULCA 2RGNB 2RVBB 1I7AA 1P6SA 4WJ7A 1XODA 2GS0A 5DHFB 1SHCA 2DHJA 2KGXB 3SNHA 3M1IB 3N7CA 1XKEA 1I2HA 2E2XA 2COAA 2Q13A 1AQCA 2RLOA 2OTXA 1MIXA 1UNRA 2EMSA 5JLJB 4D0OA 1H10A 2DHKA 1MPHA 3CXBB 3TVVA 4L6EA 3F0WA 1TJ6A 1U29A 5HE3A 4HATB 2EC1A 3DXEA 4HB3B 1E5WA 3A8QA 5LONB 2MWNB 1PFJA 2COFA 1X1FA 4TYZA 1XD4A 3VIAA 3QBVB 4KHOA 2DLWA 4WSFA 2R09A 2VKIA 2UZSA 4KHBB 4A6KA 1U5GA 3AU4A 2G35A 2L1CA 1W1DA 1BY1A 5D3XA 1V5MA 4A6FB 4A6FA 3T06A 2DHIA 2JP2A 4D0NB 1M7RA 1MIZB 1UNQA 1UPQA 3KRWA 5D3YA 3D8FA 1V89A 1J0WA 1BWNA 2NZ8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z0O A;  5DH9 B;  1ZVR A;  3U7D A;  2COC A;  4MT7 A;  2QKL A;  2LOX A;  4HHV A;  2N0Y A;  5C5B B;  5DIF B;  5C5B A;  1XR0 B;  1X05 A;  2ELB A;  2UZR A;  2YT0 A;  2ADZ A;  5FI0 A;  1KI1 B;  2DX1 A;  1NU2 A;  3KZ1 A;  3UZT A;  2K2U A;  4KHA A;  1V88 A;  2Y7B A;  4K17 A;  2I5C A;  4IOY X;  3V5W A;  1GC6 A;  2RUK B;  2DKQ A;  2ELA A;  1SGH A;  3MDB C;  4K2O A;  2D10 A;  1FAO A;  4C0A A;  1QC6 A;  2KR9 A;  2DTC A;  1ZC3 B;  5J3T A;  1N3H A;  1BAK A;  1U2B A;  1GC7 A;  1FGY A;  4H8S A;  2UVM A;  4F7U P;  1GG3 A;  1OMW A;  2NMB A;  1WGU A;  2XQN M;  2EJ8 A;  2GCJ A;  4Y94 A;  4P7I A;  4HDO A;  3FEH A;  3ODW A;  4A6H A;  2X18 A;  2LYD A;  3ODO A;  3O96 A;  2VRW B;  2D2Q A;  2BCJ A;  2H7E A;  1PMS A;  4XWX A;  1UPR A;  2MFQ A;  4K81 A;  2LKO A;  2D4Q A;  4EJN A;  5DI9 B;  4GN1 A;  2D9V A;  1MKE A;  3WYF B;  1AWE A;  1ZM0 A;  2DKP A;  3ZDT A;  4Z2M B;  2AL6 A;  1XX0 A;  2MDX A;  2QKM A;  2CAY A;  5CLQ B;  2D9Z A;  3SUZ A;  2R0D A;  3KY9 A;  5J3Y A;  5JP4 A;  3ULB A;  1DYN A;  1FOE A;  2Y8F A;  3DXC A;  2YVC A;  3U8Z A;  4DX9 0;  1LB1 A;  5JHG A;  2L2I A;  2IYB A;  2W2X C;  3WA0 A;  3GYP A;  2KUP A;  1P3R A;  3G9W A;  1F5X A;  2YS5 A;  1EF1 A;  3DXD A;  4TKN A;  3GF9 A;  4GPT B;  4B6H A;  1DBH A;  1ISN A;  4PQ0 A;  1V5P A;  4EKU A;  3CIK A;  4KVG B;  4CYE A;  2VSZ A;  2HTH B;  2P8V A;  4MY6 A;  1TXD A;  3PVL A;  4A5K A;  3BJI A;  3GYO A;  5C79 A;  2MKR A;  1V5U A;  4HB4 B;  1ZC4 B;  4HAY B;  1WG7 A;  2DX5 A;  2GJY A;  4HB0 B;  2N23 A;  2RNR B;  3JV3 A;  3HQC A;  1BTN A;  2ROZ B;  2LG1 A;  4HDQ A;  4BBK A;  2FJL A;  2COD A;  2YS1 A;  1Y5O A;  2D9Y A;  2Z0P A;  1Z87 A;  5EFX A;  4ZRI A;  2M38 A;  1EGX A;  1DDW A;  4NSW A;  2EMT A;  4DBB A;  3FM8 C;  2YT1 A;  1X1G A;  3IVF A;  1PLS A;  2J0M A;  2W2W A;  1BTK A;  4ZRK A;  4YL8 A;  3VOQ A;  1ZSQ A;  2I1J A;  2P0D A;  2V76 A;  2K00 A;  1EAZ A;  3A8P A;  2I1K A;  1P5T A;  4HB2 B;  3MPX A;  3PP2 A;  2LUL A;  4EMO A;  1FB8 A;  3PVU A;  5J3Q A;  4HAU B;  2D9W A;  3PVW A;  4CHJ A;  2YF0 A;  1EVH A;  2CY4 A;  1OQN A;  5D3V A;  2J59 M;  5KQ1 A;  4K2P A;  1RRP B;  1WJM A;  1TQZ A;  1Y19 B;  2YRY A;  3D8E A;  4GOU A;  1MAI A;  1X86 A;  1FHO A;  4HAV B;  1U27 A;  3PEG A;  4GYV A;  1DDM A;  4F7H A;  2ZPY A;  4KAX B;  4WVF B;  2D11 A;  2D9X A;  4Z2N A;  5D3W A;  4CHM A;  4GMV A;  1NTV A;  2I5F A;  4YON A;  2GCL A;  1X11 A;  5HE0 A;  4GXB A;  2J0J A;  1KZ7 A;  2DYN A;  1FHX A;  2Y8G A;  3AJ4 A;  3TFM A;  2IFS A;  3ZVR A;  4DXA B;  1K5G B;  1M7E A;  1DRO A;  1WI1 A;  2P0F A;  3AU5 A;  1U5E A;  2W2X D;  1J19 A;  2K2J A;  2KCJ A;  5D27 A;  3NSU A;  5JHH A;  1LW3 A;  3D8D A;  4IFS A;  4DX8 A;  1QQG A;  2CRF A;  3OAN A;  3BIN A;  2OQB A;  3QWM A;  3F5R A;  3TCA A;  3ML4 A;  5DHA B;  3HK0 A;  3PZD A;  3RCP A;  3SO6 A;  4PNK A;  5C6R A;  3ODX A;  4ZRJ A;  5KCV A;  2AEH A;  5HE2 A;  2M14 A;  1B55 A;  4GZU A;  1UEF A;  1U5D A;  2CY5 A;  3EO2 A;  5LOP B;  2RSG A;  2HE7 A;  2Z0Q A;  5L81 A;  2H7D A;  3SYX A;  1MK7 B;  1WJ1 A;  1WGQ A;  3PG7 A;  1U5F A;  3QIJ A;  2DN6 A;  2DYQ A;  3P6A A;  1FGZ A;  1H4R A;  5GOW B;  1NI2 A;  4HAX B;  3LJU X;  1V61 A;  3X23 A;  2P0H A;  2DFK A;  4GMX B;  1XCG A;  2ROV A;  5C16 A;  3HW2 B;  1NTY A;  5HE1 A;  3TO1 A;  2YSZ A;  1RJ2 A;  1UNP A;  5FI1 A;  1OY2 A;  3PSC A;  4HAZ B;  5KQ4 A;  2YS3 A;  1IRS A;  4MK0 A;  1MK9 B;  1KZG A;  3FSS A;  4NY0 A;  1W1G A;  2PZ1 A;  3TW1 A;  5CLL B;  4HAW B;  1WVH A;  1FHW A;  4F7G A;  2DA0 A;  1K5D B;  1Q67 A;  3A98 B;  2J0K A;  3KSY A;  4IAP A;  2LOZ A;  1DDV A;  3KRX A;  3SV1 A;  3P7Z A;  1W1H A;  3ULC A;  2RGN B;  2RVB B;  1I7A A;  1P6S A;  4WJ7 A;  1XOD A;  2GS0 A;  5DHF B;  1SHC A;  2DHJ A;  2KGX B;  3SNH A;  3M1I B;  3N7C A;  1XKE A;  1I2H A;  2E2X A;  2COA A;  2Q13 A;  1AQC A;  2RLO A;  2OTX A;  1MIX A;  1UNR A;  2EMS A;  5JLJ B;  4D0O A;  1H10 A;  2DHK A;  1MPH A;  3CXB B;  3TVV A;  4L6E A;  3F0W A;  1TJ6 A;  1U29 A;  5HE3 A;  4HAT B;  2EC1 A;  3DXE A;  4HB3 B;  1E5W A;  3A8Q A;  5LON B;  2MWN B;  1PFJ A;  2COF A;  1X1F A;  4TYZ A;  1XD4 A;  3VIA A;  3QBV B;  4KHO A;  2DLW A;  4WSF A;  2R09 A;  2VKI A;  2UZS A;  4KHB B;  4A6K A;  1U5G A;  3AU4 A;  2G35 A;  2L1C A;  1W1D A;  1BY1 A;  5D3X A;  1V5M A;  4A6F B;  4A6F A;  3T06 A;  2DHI A;  2JP2 A;  4D0N B;  1M7R A;  1MIZ B;  1UNQ A;  1UPQ A;  3KRW A;  5D3Y A;  3D8F A;  1V89 A;  1J0W A;  1BWN A;  2NZ8 B; 
#chains in the Genus database with same CATH topology
 2Z0O A;  5DH9 B;  1ZVR A;  3U7D A;  2COC A;  4MT7 A;  2QKL A;  2LOX A;  4HHV A;  4OSN A;  2N0Y A;  5C5B B;  5DIF B;  5C5B A;  1XR0 B;  1X05 A;  2ELB A;  2UZR A;  2YT0 A;  3NW8 A;  4QJ4 B;  2ADZ A;  5FI0 A;  1KI1 B;  2DX1 A;  1NU2 A;  3KZ1 A;  3UZT A;  2K2U A;  4KHA A;  1V88 A;  2Y7B A;  4K17 A;  2I5C A;  4IOY X;  3V5W A;  1GC6 A;  2RUK B;  2DKQ A;  2ELA A;  1SGH A;  3MDB C;  4K2O A;  2D10 A;  1FAO A;  4C0A A;  4L1R A;  1QC6 A;  2KR9 A;  2DTC A;  1ZC3 B;  5J3T A;  1N3H A;  1BAK A;  1U2B A;  1GC7 A;  1FGY A;  4H8S A;  2UVM A;  4F7U P;  1GG3 A;  1OMW A;  2NMB A;  1WGU A;  2XQN M;  2EJ8 A;  2GCJ A;  4Y94 A;  4P7I A;  4DIX A;  5I2S A;  4HDO A;  3FEH A;  3ODW A;  3OHM B;  2Z59 A;  4A6H A;  2X18 A;  2LYD A;  3ODO A;  3O96 A;  2VRW B;  2D2Q A;  2BCJ A;  2H7E A;  1PMS A;  4XWX A;  1UPR A;  2MFQ A;  4K81 A;  2LKO A;  2D4Q A;  4EJN A;  5DI9 B;  4GN1 A;  2D9V A;  1MKE A;  3WYF B;  1AWE A;  1MI1 A;  1ZM0 A;  2DKP A;  2YT2 A;  3ZDT A;  4Z2M B;  2AL6 A;  1XX0 A;  2MDX A;  2QKM A;  2CAY A;  3FVC A;  5CLQ B;  2D9Z A;  3SUZ A;  2R0D A;  3KY9 A;  5J3Y A;  5JP4 A;  3ULB A;  1DYN A;  4QJ5 B;  1FOE A;  2Y8F A;  3DXC A;  2YVC A;  3U8Z A;  4DX9 0;  1LB1 A;  2KUQ A;  5JHG A;  2L2I A;  4GNK B;  3NWA A;  2IYB A;  2W2X C;  3WA0 A;  3GYP A;  2KUP A;  1P3R A;  3G9W A;  1F5X A;  2YS5 A;  1EF1 A;  3DXD A;  4TKN A;  3GF9 A;  4GPT B;  4B6H A;  1DBH A;  1ISN A;  4PQ0 A;  1V5P A;  4EKU A;  3CIK A;  4KVG B;  4CYE A;  2VSZ A;  5M4Y B;  2HTH B;  2P8V A;  4MY6 A;  1TXD A;  3PVL A;  4CSQ A;  4A5K A;  3BJI A;  2RRF A;  3GYO A;  5C79 A;  2MKR A;  1V5U A;  4HB4 B;  2Z4D A;  1ZC4 B;  4HAY B;  1WG7 A;  2DX5 A;  4QXA B;  2GJY A;  4HB0 B;  2N23 A;  2RNR B;  3JV3 A;  3HQC A;  1BTN A;  2ROZ B;  2LG1 A;  4HDQ A;  4BBK A;  2FJL A;  2COD A;  2YS1 A;  1Y5O A;  2D9Y A;  2Z0P A;  1Z87 A;  5EFX A;  4ZRI A;  2M38 A;  1EGX A;  1DDW A;  4NSW A;  1ZYI A;  2EMT A;  4DBB A;  3FM8 C;  2YT1 A;  5IRS A;  2FJU B;  1X1G A;  3IVF A;  1PLS A;  2J0M A;  2W2W A;  1BTK A;  4ZRK A;  4YL8 A;  3VOQ A;  1ZSQ A;  2I1J A;  2P0D A;  2V76 A;  2K00 A;  3A8P A;  1EAZ A;  2I1K A;  1P5T A;  4HB2 B;  3MPX A;  3PP2 A;  2GUM A;  2LUL A;  4EMO A;  1FB8 A;  3PVU A;  5J3Q A;  4HAU B;  2D9W A;  3PVW A;  4CHJ A;  2YF0 A;  1EVH A;  2CY4 A;  2ZKM X;  1OQN A;  5D3V A;  2J59 M;  5KQ1 A;  4K2P A;  1RRP B;  1WJM A;  1TQZ A;  1Y19 B;  2YRY A;  3D8E A;  4GOU A;  1MAI A;  1X86 A;  1FHO A;  4HSI A;  4HAV B;  1U27 A;  2KIG A;  4D6W A;  3PEG A;  4GYV A;  1DDM A;  4F7H A;  2ZPY A;  4KAX B;  4WVF B;  2D11 A;  2D9X A;  4Z2N A;  5D3W A;  2NBV A;  4CHM A;  4GMV A;  1NTV A;  2I5F A;  4YON A;  2GCL A;  1X11 A;  5HE0 A;  4GXB A;  2J0J A;  1KZ7 A;  2DYN A;  1FHX A;  2Y8G A;  2R2Y A;  3AJ4 A;  3TFM A;  2IFS A;  3ZVR A;  4DXA B;  1K5G B;  1M7E A;  1DRO A;  1WI1 A;  2P0F A;  3AU5 A;  1U5E A;  2W2X D;  1J19 A;  2K2J A;  2KCJ A;  5D27 A;  5I2M A;  3U12 A;  3NSU A;  5JHH A;  1LW3 A;  3D8D A;  4IFS A;  4DX8 A;  1QQG A;  2CRF A;  3OAN A;  3BIN A;  2OQB A;  3QWM A;  3HIE A;  3F5R A;  3HSA A;  3TCA A;  3ML4 A;  5DHA B;  3HK0 A;  3PZD A;  3RCP A;  3SO6 A;  4PNK A;  5C6R A;  3ODX A;  4ZRJ A;  5KCV A;  2AEH A;  5HE2 A;  2M14 A;  1B55 A;  4GZU A;  1UEF A;  1U5D A;  2CY5 A;  3EO2 A;  5LOP B;  2RSG A;  2HE7 A;  2Z0Q A;  5L81 A;  2H7D A;  3SYX A;  1MK7 B;  1WJ1 A;  3DCX A;  1WGQ A;  3PG7 A;  1U5F A;  3QIJ A;  2DN6 A;  2DYQ A;  3P6A A;  1FGZ A;  1H4R A;  5GOW B;  1NI2 A;  4HAX B;  3LJU X;  1V61 A;  3X23 A;  2P0H A;  2DFK A;  2Z14 A;  4GMX B;  1XCG A;  2ROV A;  2Z13 A;  5C16 A;  3HW2 B;  1NTY A;  5HE1 A;  3TO1 A;  2YSZ A;  1RJ2 A;  1UNP A;  5FI1 A;  1OY2 A;  3PSC A;  4HAZ B;  5KQ4 A;  2YS3 A;  1IRS A;  4MK0 A;  5LG4 B;  1MK9 B;  1KZG A;  4OT1 A;  3FSS A;  4NY0 A;  1W1G A;  2PZ1 A;  3TW1 A;  5CLL B;  4HAW B;  1WVH A;  1FHW A;  4F7G A;  2DA0 A;  1K5D B;  1Q67 A;  3A98 B;  2J0K A;  3KSY A;  4IAP A;  2LOZ A;  1DDV A;  3KRX A;  3SV1 A;  3P7Z A;  3NWD A;  1W1H A;  3ULC A;  2RGN B;  2RVB B;  1I7A A;  1P6S A;  4WJ7 A;  1XOD A;  3B77 A;  2GS0 A;  2KR0 A;  5DHF B;  1SHC A;  2DHJ A;  2KGX B;  3SNH A;  3M1I B;  3N7C A;  1XKE A;  1I2H A;  2E2X A;  2COA A;  2Q13 A;  1AQC A;  2RLO A;  2OTX A;  1MIX A;  1UNR A;  2EMS A;  5JLJ B;  4D0O A;  3NWF A;  1H10 A;  2DHK A;  1MPH A;  3CXB B;  3TVV A;  4L6E A;  3F0W A;  1TJ6 A;  1U29 A;  5HE3 A;  4HAT B;  2EC1 A;  3DXE A;  4HB3 B;  1E5W A;  2K8E A;  3A8Q A;  5LON B;  2MWN B;  1PFJ A;  2COF A;  1X1F A;  4TYZ A;  1XD4 A;  1T77 A;  3VIA A;  3QBV B;  4KHO A;  2DLW A;  4WSF A;  2R09 A;  2VKI A;  2UZS A;  4KHB B;  2K49 A;  1U5G A;  3AU4 A;  4KHB A;  2G35 A;  4A6K A;  2L1C A;  1W1D A;  1BY1 A;  5D3X A;  1V5M A;  3A58 A;  4QJ3 B;  4A6F B;  4A6F A;  3T06 A;  2DHI A;  2JP2 A;  4D0N B;  1M7R A;  1MIZ B;  2KIE A;  1UNQ A;  1UPQ A;  3KRW A;  5D3Y A;  3D8F A;  1V89 A;  1J0W A;  1BWN A;  2NZ8 B; 
#chains in the Genus database with same CATH homology
 2Z0O A;  5DH9 B;  1ZVR A;  3U7D A;  2COC A;  4MT7 A;  2QKL A;  2LOX A;  4HHV A;  2N0Y A;  5C5B B;  5DIF B;  5C5B A;  1XR0 B;  1X05 A;  2ELB A;  2UZR A;  2YT0 A;  2ADZ A;  5FI0 A;  1KI1 B;  2DX1 A;  1NU2 A;  3KZ1 A;  3UZT A;  2K2U A;  4KHA A;  1V88 A;  2Y7B A;  4K17 A;  2I5C A;  4IOY X;  3V5W A;  1GC6 A;  2RUK B;  2DKQ A;  2ELA A;  1SGH A;  3MDB C;  4K2O A;  2D10 A;  1FAO A;  4C0A A;  1QC6 A;  2KR9 A;  2DTC A;  1ZC3 B;  5J3T A;  1N3H A;  1BAK A;  1U2B A;  1GC7 A;  1FGY A;  4H8S A;  2UVM A;  4F7U P;  1GG3 A;  1OMW A;  2NMB A;  1WGU A;  2XQN M;  2EJ8 A;  2GCJ A;  4Y94 A;  4P7I A;  4HDO A;  3FEH A;  3ODW A;  4A6H A;  2X18 A;  2LYD A;  3ODO A;  3O96 A;  2VRW B;  2D2Q A;  2BCJ A;  2H7E A;  1PMS A;  4XWX A;  1UPR A;  2MFQ A;  4K81 A;  2LKO A;  2D4Q A;  4EJN A;  5DI9 B;  4GN1 A;  2D9V A;  1MKE A;  3WYF B;  1AWE A;  1ZM0 A;  2DKP A;  3ZDT A;  4Z2M B;  2AL6 A;  1XX0 A;  2MDX A;  2QKM A;  2CAY A;  5CLQ B;  2D9Z A;  3SUZ A;  2R0D A;  3KY9 A;  5J3Y A;  5JP4 A;  3ULB A;  1DYN A;  1FOE A;  2Y8F A;  3DXC A;  2YVC A;  3U8Z A;  4DX9 0;  1LB1 A;  5JHG A;  2L2I A;  2IYB A;  2W2X C;  3WA0 A;  3GYP A;  2KUP A;  1P3R A;  3G9W A;  1F5X A;  2YS5 A;  1EF1 A;  3DXD A;  4TKN A;  3GF9 A;  4GPT B;  4B6H A;  1DBH A;  1ISN A;  4PQ0 A;  1V5P A;  4EKU A;  3CIK A;  4KVG B;  4CYE A;  2VSZ A;  2HTH B;  2P8V A;  4MY6 A;  1TXD A;  3PVL A;  4A5K A;  3BJI A;  3GYO A;  5C79 A;  2MKR A;  1V5U A;  4HB4 B;  1ZC4 B;  4HAY B;  1WG7 A;  2DX5 A;  2GJY A;  4HB0 B;  2N23 A;  2RNR B;  3JV3 A;  3HQC A;  1BTN A;  2ROZ B;  2LG1 A;  4HDQ A;  4BBK A;  2FJL A;  2COD A;  2YS1 A;  1Y5O A;  2D9Y A;  2Z0P A;  1Z87 A;  5EFX A;  4ZRI A;  2M38 A;  1EGX A;  1DDW A;  4NSW A;  2EMT A;  4DBB A;  3FM8 C;  2YT1 A;  1X1G A;  3IVF A;  1PLS A;  2J0M A;  2W2W A;  1BTK A;  4ZRK A;  4YL8 A;  3VOQ A;  1ZSQ A;  2I1J A;  2P0D A;  2V76 A;  2K00 A;  1EAZ A;  3A8P A;  2I1K A;  1P5T A;  4HB2 B;  3MPX A;  3PP2 A;  2LUL A;  4EMO A;  1FB8 A;  3PVU A;  5J3Q A;  4HAU B;  2D9W A;  3PVW A;  4CHJ A;  2YF0 A;  1EVH A;  2CY4 A;  1OQN A;  5D3V A;  2J59 M;  5KQ1 A;  4K2P A;  1RRP B;  1WJM A;  1TQZ A;  1Y19 B;  2YRY A;  3D8E A;  4GOU A;  1MAI A;  1X86 A;  1FHO A;  4HAV B;  1U27 A;  3PEG A;  4GYV A;  1DDM A;  4F7H A;  2ZPY A;  4KAX B;  4WVF B;  2D11 A;  2D9X A;  4Z2N A;  5D3W A;  4CHM A;  4GMV A;  1NTV A;  2I5F A;  4YON A;  2GCL A;  1X11 A;  5HE0 A;  4GXB A;  2J0J A;  1KZ7 A;  2DYN A;  1FHX A;  2Y8G A;  3AJ4 A;  3TFM A;  2IFS A;  3ZVR A;  4DXA B;  1K5G B;  1M7E A;  1DRO A;  1WI1 A;  2P0F A;  3AU5 A;  1U5E A;  2W2X D;  1J19 A;  2K2J A;  2KCJ A;  5D27 A;  3NSU A;  5JHH A;  1LW3 A;  3D8D A;  4IFS A;  4DX8 A;  1QQG A;  2CRF A;  3OAN A;  3BIN A;  2OQB A;  3QWM A;  3F5R A;  3TCA A;  3ML4 A;  5DHA B;  3HK0 A;  3PZD A;  3RCP A;  3SO6 A;  4PNK A;  5C6R A;  3ODX A;  4ZRJ A;  5KCV A;  2AEH A;  5HE2 A;  2M14 A;  1B55 A;  4GZU A;  1UEF A;  1U5D A;  2CY5 A;  3EO2 A;  5LOP B;  2RSG A;  2HE7 A;  2Z0Q A;  5L81 A;  2H7D A;  3SYX A;  1MK7 B;  1WJ1 A;  1WGQ A;  3PG7 A;  1U5F A;  3QIJ A;  2DN6 A;  2DYQ A;  3P6A A;  1FGZ A;  1H4R A;  5GOW B;  1NI2 A;  4HAX B;  3LJU X;  1V61 A;  3X23 A;  2P0H A;  2DFK A;  4GMX B;  1XCG A;  2ROV A;  5C16 A;  3HW2 B;  1NTY A;  5HE1 A;  3TO1 A;  2YSZ A;  1RJ2 A;  1UNP A;  5FI1 A;  1OY2 A;  3PSC A;  4HAZ B;  5KQ4 A;  2YS3 A;  1IRS A;  4MK0 A;  1MK9 B;  1KZG A;  3FSS A;  4NY0 A;  1W1G A;  2PZ1 A;  3TW1 A;  5CLL B;  4HAW B;  1WVH A;  1FHW A;  4F7G A;  2DA0 A;  1K5D B;  1Q67 A;  3A98 B;  2J0K A;  3KSY A;  4IAP A;  2LOZ A;  1DDV A;  3KRX A;  3SV1 A;  3P7Z A;  1W1H A;  3ULC A;  2RGN B;  2RVB B;  1I7A A;  1P6S A;  4WJ7 A;  1XOD A;  2GS0 A;  5DHF B;  1SHC A;  2DHJ A;  2KGX B;  3SNH A;  3M1I B;  3N7C A;  1XKE A;  1I2H A;  2E2X A;  2COA A;  2Q13 A;  1AQC A;  2RLO A;  2OTX A;  1MIX A;  1UNR A;  2EMS A;  5JLJ B;  4D0O A;  1H10 A;  2DHK A;  1MPH A;  3CXB B;  3TVV A;  4L6E A;  3F0W A;  1TJ6 A;  1U29 A;  5HE3 A;  4HAT B;  2EC1 A;  3DXE A;  4HB3 B;  1E5W A;  3A8Q A;  5LON B;  2MWN B;  1PFJ A;  2COF A;  1X1F A;  4TYZ A;  1XD4 A;  3VIA A;  3QBV B;  4KHO A;  2DLW A;  4WSF A;  2R09 A;  2VKI A;  2UZS A;  4KHB B;  4A6K A;  1U5G A;  3AU4 A;  2G35 A;  2L1C A;  1W1D A;  1BY1 A;  5D3X A;  1V5M A;  4A6F B;  4A6F A;  3T06 A;  2DHI A;  2JP2 A;  4D0N B;  1M7R A;  1MIZ B;  1UNQ A;  1UPQ A;  3KRW A;  5D3Y A;  3D8F A;  1V89 A;  1J0W A;  1BWN A;  2NZ8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...