3ODOA

Crystal structure of the dh/ph domains of p115-rhogef
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
370
structure length
370
Chain Sequence
b'QTSPPGWRELVPPDTLHSLPKSQVKRQEVISELLVTEAAHVRMLRVLHDLFFQPMAECLFFPLEELQNIFPSLDELIEVHSLFLDRLMKRRQESGYLIEEIGDVLLARFDGAEGSWFQKISSRFCSRQSFALEQLKAKQRKDPRFCAFVQEAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEEPTEREKVELAAECCREILHHVNQAVRDMEDLLRLKDYQRRLDLSHLRQSSDPMLSEFKNLDITKKKLVHEGPLTWRVTKDKAVEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLRPVLRLTSAMTREVATDHKAFYVLFTWDQEAQIYELVAQTVSERKNWCALITETAGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rho guanine nucleotide exchange factor 1
publication title Modulation of a GEF switch: Autoinhibition of the intrinsic guanine nucleotide exchange activity of p115-RhoREF
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 126
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00621 RhoGEF RhoGEF domain
A PF17838 PH_16 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 3odoA01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3odoA02
1TQZA 1DDMA 1FGYA 2JP2A 3PSCA 2LULA 1B55A 1ISNA 2Q13A 1M7EA 3HQCA 1RRPB 2CAYA 2K00A 1UEFA 2D9ZA 2RLOA 1WVHA 4CHMA 2COAA 2ELBA 1XX0A 1PFJA 4ZRJA 1WJ1A 4GMVA 2AEHA 2MWNB 2I1KA 1UPRA 4HHVA 1KZGA 4K2OA 3A8QA 3KRWA 2VSZA 5CLLB 4C0AA 2I5FA 2W2XD 2AL6A 4EKUA 4GN1A 4A6FA 4GYVA 4HAZB 5C16A 1SGHA 4CHJA 3SYXA 1P3RA 3PZDA 3NSUA 1FAOA 2L2IA 2D9YA 1EVHA 5J3YA 2QKLA 2COCA 1DDVA 1I2HA 2HTHB 5C6RA 2H7EA 3N7CA 1FOEA 4L6EA 2IFSA 5C5BA 2ELAA 2N0YA 4HATB 1U5DA 4CYEA 5CLQB 2ADZA 4HB0B 1WI1A 4Z2NA 1V5UA 1DBHA 2DFKA 4GPTB 3PVUA 1BAKA 5HE1A 1MPHA 4KAXB 3TVVA 3DXCA 1XR0B 4HAUB 4YL8A 4Y94A 3TFMA 1X05A 3SV1A 2J0JA 2MKRA 1FHXA 2G35A 1UNPA 5LOPB 2MFQA 3U7DA 1U27A 1MKEA 1BWNA 4WJ7A 2D9WA 1UNQA 2RUKB 3CXBB 2Z0PA 2NMBA 3D8EA 3GYPA 1AQCA 4KVGB 1OMWA 1MAIA 1TJ6A 1W1HA 2FJLA 2CRFA 2DKQA 3VOQA 3UZTA 2P0HA 4DXAB 3JV3A 4GOUA 5JP4A 3TO1A 2Z0QA 5FI1A 4HAVB 5FI0A 1FHWA 2YT1A 1P6SA 2EC1A 3G9WA 1W1GA 3KRXA 4K2PA 2H7DA 1DYNA 2DX1A 2D10A 1GC6A 2LOZA 1DROA 3T06A 4HAWB 4D0NB 2EMTA 1GC7A 3MPXA 4HB2B 1F5XA 1U29A 3OANA 3TW1A 2VRWB 5L81A 2PZ1A 2LOXA 4YONA 3ODXA 2Y8GA 1V61A 3F5RA 2LG1A 1MK7B 3TCAA 2J0MA 4K81A 2ZPYA 1QC6A 1UPQA 2Y8FA 1PMSA 3A8PA 1ZM0A 3D8FA 5J3TA 1NTYA 4MT7A 5DH9B 4ZRIA 4NSWA 5HE0A 1N3HA 2DHIA 1LW3A 1P5TA 2RVBB 4HDQA 1Y19B 3PG7A 4B6HA 4PNKA 1QQGA 1W1DA 3IVFA 2DYQA 3RCPA 3WA0A 2D11A 1UNRA 1NI2A 4WSFA 1AWEA 4KHBB 4A6FB 2DKPA 5DHFB 1X86A 1MIXA 2D9VA 5HE3A 1U5FA 2OQBA 3AJ4A 3PEGA 1DDWA 1ZC3B 1ZSQA 2KUPA 4F7GA 4A5KA 3FSSA 3O96A 4DX8A 2XQNM 3ZVRA 5C5BB 1BTKA 1NU2A 3ODOA 5EFXA 4IOYX 5KCVA 1FHOA 4TYZA 1U5EA 2K2UA 1Q67A 1I7AA 3ML4A 1V88A 2QKMA 3FM8C 2MDXA 2UVMA 1EGXA 1XCGA 1V5MA 1X1FA 4PQ0A 2RSGA 5D27A 3SNHA 3FEHA 2EMSA 1V89A 2YF0A 1J19A 2D4QA 3ODWA 3AU4A 2YT0A 2KR9A 4A6KA 1MK9B 2VKIA 2R09A 2YVCA 2YRYA 2COFA 1KI1B 3DXEA 4DBBA 3KSYA 3MDBC 3CIKA 3HK0A 2CODA 2V76A 4MK0A 2M14A 3P6AA 2N23A 1TXDA 2ROVA 2YS3A 1XODA 5KQ1A 4IFSA 2GCLA 2P8VA 1RJ2A 5D3WA 4GMXB 5HE2A 5D3XA 1J0WA 1PLSA 5LONB 2GCJA 1K5DB 1WJMA 4BBKA 1WG7A 3GF9A 2P0DA 2RGNB 2CY4A 5KQ4A 2KCJA 2YSZA 2OTXA 1IRSA 2Z0OA 1H4RA 3D8DA 3PVLA 3QIJA 2J59M 5C79A 3X23A 4KHAA 2ROZB 2R0DA 2KGXB 3QWMA 2K2JA 3BJIA 1E5WA 5DI9B 1BY1A 2DA0A 4HAYB 4A6HA 4HDOA 3DXDA 3V5WA 1BTNA 3LJUX 2W2WA 4KHOA 5DIFB 2UZSA 1EF1A 1H10A 4F7UP 3GYOA 2RNRB 1OY2A 1U2BA 1Y5OA 2DHJA 2DHKA 5J3QA 3PP2A 1SHCA 3ULCA 2J0KA 2IYBA 2GS0A 1ZC4B 4WVFB 1ZVRA 2LYDA 1FGZA 4P7IA 1X11A 2HE7A 4GZUA 2DYNA 5D3VA 2NZ8B 4NY0A 1X1GA 3ZDTA 1OQNA 1Z87A 1KZ7A 1M7RA 5JLJB 2DTCA 5JHHA 4IAPA 2Y7BA 4K17A 1U5GA 3A98B 3VIAA 2X18A 2L1CA 1XKEA 1WGQA 1K5GB 2D2QA 4Z2MB 1GG3A 2BCJA 4H8SA 4HAXB 4EMOA 4MY6A 2E2XA 2I1JA 1XD4A 1NTVA 2EJ8A 1WGUA 3SO6A 4D0OA 2D9XA 3KY9A 4GXBA 4HB3B 4DX90 3ULBA 2P0FA 4XWXA 4HB4B 5GOWB 2GJYA 3WYFB 3QBVB 5JHGA 2YS5A 2M38A 2YS1A 3BINA 4ZRKA 3U8ZA 2DLWA 1LB1A 3EO2A 3AU5A 1MIZB 1V5PA 3PVWA 2DX5A 2I5CA 2DN6A 4F7HA 2LKOA 1FB8A 2W2XC 4EJNA 3F0WA 3M1IB 2CY5A 3KZ1A 5DHAB 1EAZA 3HW2B 3P7ZA 2UZRA 4TKNA 3SUZA 5D3YA
chains in the Genus database with same CATH superfamily
1TQZA 1DDMA 1FGYA 2JP2A 3PSCA 2LULA 1B55A 1ISNA 2Q13A 1M7EA 3HQCA 1RRPB 2CAYA 2K00A 1UEFA 2D9ZA 2RLOA 1WVHA 4CHMA 2COAA 2ELBA 3HIEA 1XX0A 1PFJA 4ZRJA 1WJ1A 4GMVA 2AEHA 2MWNB 2I1KA 1UPRA 4HHVA 1KZGA 4K2OA 3A8QA 3KRWA 2KIEA 2VSZA 5CLLB 4C0AA 2I5FA 5I2SA 1ZYIA 2W2XD 4KHBA 2AL6A 4EKUA 4GN1A 4A6FA 4GYVA 4HAZB 5C16A 4QJ5B 1SGHA 4CHJA 3SYXA 1P3RA 3PZDA 3NSUA 1FAOA 2L2IA 2D9YA 1EVHA 5J3YA 2QKLA 2COCA 1DDVA 1I2HA 2HTHB 5C6RA 2H7EA 4QXAB 3N7CA 3NWDA 1FOEA 4L6EA 2IFSA 2Z59A 5C5BA 2ELAA 2N0YA 4HATB 1U5DA 4CYEA 5CLQB 2ADZA 3B77A 4HB0B 4CSQA 1WI1A 4Z2NA 2KIGA 1V5UA 1DBHA 2DFKA 4GPTB 3PVUA 1BAKA 5HE1A 1MPHA 4KAXB 3TVVA 3DXCA 2NBVA 1XR0B 4HAUB 4YL8A 4Y94A 3TFMA 1X05A 3SV1A 2J0JA 2MKRA 1FHXA 2G35A 1UNPA 5LOPB 2MFQA 3U7DA 1U27A 1MKEA 1BWNA 4WJ7A 2D9WA 1UNQA 2RUKB 3CXBB 2Z0PA 3DCXA 2NMBA 3D8EA 3GYPA 4D6WA 1AQCA 4KVGB 1OMWA 2KR0A 1MAIA 1TJ6A 1W1HA 2FJLA 2CRFA 2DKQA 3A58A 3VOQA 3UZTA 2P0HA 4DXAB 5I2MA 3JV3A 4GOUA 5JP4A 3TO1A 5IRSA 2Z0QA 5FI1A 4HAVB 5FI0A 1FHWA 2YT1A 1P6SA 2EC1A 3G9WA 1W1GA 3KRXA 4K2PA 2H7DA 1DYNA 2DX1A 2D10A 1GC6A 2LOZA 1DROA 3T06A 4HAWB 4D0NB 2EMTA 1GC7A 3MPXA 4HB2B 1F5XA 1U29A 3OANA 3TW1A 2VRWB 5L81A 2PZ1A 2LOXA 4YONA 3ODXA 2Y8GA 1V61A 3F5RA 2LG1A 1MK7B 3TCAA 2J0MA 4K81A 2ZPYA 1QC6A 1UPQA 2Y8FA 1PMSA 3A8PA 1ZM0A 3D8FA 5J3TA 1NTYA 4MT7A 5DH9B 4ZRIA 4NSWA 5HE0A 2RRFA 1N3HA 2DHIA 1LW3A 1P5TA 2RVBB 4HDQA 1Y19B 3PG7A 4B6HA 4PNKA 1QQGA 1W1DA 3IVFA 2DYQA 3RCPA 3WA0A 2D11A 1UNRA 1NI2A 4WSFA 1AWEA 4KHBB 4QJ4B 4A6FB 2DKPA 5DHFB 1X86A 1MIXA 2D9VA 5HE3A 1U5FA 2OQBA 3AJ4A 4GNKB 3PEGA 1DDWA 1ZC3B 1ZSQA 2KUPA 4L1RA 4F7GA 4A5KA 3FSSA 3O96A 3FVCA 4DX8A 2XQNM 3ZVRA 5C5BB 1BTKA 1NU2A 3ODOA 5EFXA 4IOYX 5KCVA 1FHOA 2ZKMX 4TYZA 1U5EA 2K2UA 1Q67A 1I7AA 4HSIA 3ML4A 1V88A 2QKMA 3FM8C 2MDXA 2UVMA 2FJUB 1EGXA 1XCGA 1V5MA 1X1FA 4PQ0A 2RSGA 5D27A 3SNHA 3U12A 3FEHA 2EMSA 1V89A 2YF0A 1J19A 2D4QA 3ODWA 3AU4A 2YT0A 2KR9A 4A6KA 1MK9B 2VKIA 2R09A 5M4YB 2YVCA 2YRYA 2COFA 1KI1B 3DXEA 4DBBA 3KSYA 3MDBC 3CIKA 3HK0A 2CODA 2V76A 4MK0A 2M14A 3P6AA 2N23A 1TXDA 2ROVA 2YS3A 1XODA 5KQ1A 4IFSA 4QJ3B 2GCLA 2P8VA 1RJ2A 5D3WA 4GMXB 5HE2A 5D3XA 1J0WA 1PLSA 5LONB 2GCJA 1K5DB 2K8EA 1WJMA 4BBKA 1WG7A 3GF9A 2P0DA 2RGNB 2CY4A 5KQ4A 2KCJA 2YSZA 2OTXA 1IRSA 2Z0OA 1H4RA 3D8DA 3PVLA 3QIJA 2J59M 3NWAA 5C79A 3X23A 4KHAA 2ROZB 2R0DA 2KGXB 3QWMA 2K2JA 3BJIA 1E5WA 5DI9B 1BY1A 2DA0A 4HAYB 4A6HA 4HDOA 3DXDA 3V5WA 1BTNA 3LJUX 2W2WA 4KHOA 5DIFB 2UZSA 1EF1A 1H10A 4F7UP 3GYOA 2RNRB 1OY2A 3OHMB 1U2BA 1Y5OA 2DHJA 2K49A 2DHKA 2YT2A 5J3QA 3PP2A 1SHCA 3ULCA 2J0KA 2IYBA 2GS0A 1ZC4B 4WVFB 1ZVRA 2LYDA 1FGZA 4P7IA 2Z13A 1X11A 2HE7A 4GZUA 2DYNA 5D3VA 2NZ8B 4NY0A 1X1GA 3ZDTA 1OQNA 1Z87A 1KZ7A 1M7RA 5JLJB 1MI1A 2DTCA 2R2YA 5JHHA 5LG4B 4IAPA 1T77A 2Y7BA 4K17A 1U5GA 3A98B 3VIAA 2X18A 2L1CA 1XKEA 2GUMA 1WGQA 2Z14A 1K5GB 2D2QA 4Z2MB 1GG3A 2BCJA 4H8SA 4HAXB 4EMOA 4MY6A 2E2XA 2I1JA 1XD4A 1NTVA 2EJ8A 1WGUA 3SO6A 2KUQA 4D0OA 2D9XA 3KY9A 4GXBA 4HB3B 4DX90 3ULBA 2P0FA 4XWXA 4HB4B 5GOWB 2GJYA 3WYFB 3QBVB 5JHGA 3NW8A 2Z4DA 2YS5A 2M38A 2YS1A 4DIXA 3NWFA 3BINA 4ZRKA 3U8ZA 2DLWA 4OT1A 1LB1A 3EO2A 3AU5A 1MIZB 1V5PA 3PVWA 2DX5A 2I5CA 2DN6A 4F7HA 2LKOA 1FB8A 2W2XC 4EJNA 3F0WA 3M1IB 2CY5A 3KZ1A 5DHAB 1EAZA 3HW2B 3P7ZA 2UZRA 3HSAA 4TKNA 3SUZA 5D3YA 4OSNA
chains in the Genus database with same CATH topology
1TQZA 1DDMA 1FGYA 2JP2A 3PSCA 2LULA 1B55A 1ISNA 2Q13A 1M7EA 3HQCA 1RRPB 2CAYA 2K00A 1UEFA 2D9ZA 2RLOA 1WVHA 4CHMA 2COAA 2ELBA 1XX0A 1PFJA 4ZRJA 1WJ1A 4GMVA 2AEHA 2MWNB 2I1KA 1UPRA 4HHVA 1KZGA 4K2OA 3A8QA 3KRWA 2VSZA 5CLLB 4C0AA 2I5FA 2W2XD 2AL6A 4EKUA 4GN1A 4A6FA 4GYVA 4HAZB 5C16A 1SGHA 4CHJA 3SYXA 1P3RA 3PZDA 3NSUA 1FAOA 2L2IA 2D9YA 1EVHA 5J3YA 2QKLA 2COCA 1DDVA 1I2HA 2HTHB 5C6RA 2H7EA 3N7CA 1FOEA 4L6EA 2IFSA 5C5BA 2ELAA 2N0YA 4HATB 1U5DA 4CYEA 5CLQB 2ADZA 4HB0B 1WI1A 4Z2NA 1V5UA 1DBHA 2DFKA 4GPTB 3PVUA 1BAKA 5HE1A 1MPHA 4KAXB 3TVVA 3DXCA 1XR0B 4HAUB 4YL8A 4Y94A 3TFMA 1X05A 3SV1A 2J0JA 2MKRA 1FHXA 2G35A 1UNPA 5LOPB 2MFQA 3U7DA 1U27A 1MKEA 1BWNA 4WJ7A 2D9WA 1UNQA 2RUKB 3CXBB 2Z0PA 2NMBA 3D8EA 3GYPA 1AQCA 4KVGB 1OMWA 1MAIA 1TJ6A 1W1HA 2FJLA 2CRFA 2DKQA 3VOQA 3UZTA 2P0HA 4DXAB 3JV3A 4GOUA 5JP4A 3TO1A 2Z0QA 5FI1A 4HAVB 5FI0A 1FHWA 2YT1A 1P6SA 2EC1A 3G9WA 1W1GA 3KRXA 4K2PA 2H7DA 1DYNA 2DX1A 2D10A 1GC6A 2LOZA 1DROA 3T06A 4HAWB 4D0NB 2EMTA 1GC7A 3MPXA 4HB2B 1F5XA 1U29A 3OANA 3TW1A 2VRWB 5L81A 2PZ1A 2LOXA 4YONA 3ODXA 2Y8GA 1V61A 3F5RA 2LG1A 1MK7B 3TCAA 2J0MA 4K81A 2ZPYA 1QC6A 1UPQA 2Y8FA 1PMSA 3A8PA 1ZM0A 3D8FA 5J3TA 1NTYA 4MT7A 5DH9B 4ZRIA 4NSWA 5HE0A 1N3HA 2DHIA 1LW3A 1P5TA 2RVBB 4HDQA 1Y19B 3PG7A 4B6HA 4PNKA 1QQGA 1W1DA 3IVFA 2DYQA 3RCPA 3WA0A 2D11A 1UNRA 1NI2A 4WSFA 1AWEA 4KHBB 4A6FB 2DKPA 5DHFB 1X86A 1MIXA 2D9VA 5HE3A 1U5FA 2OQBA 3AJ4A 3PEGA 1DDWA 1ZC3B 1ZSQA 2KUPA 4F7GA 4A5KA 3FSSA 3O96A 4DX8A 2XQNM 3ZVRA 5C5BB 1BTKA 1NU2A 3ODOA 5EFXA 4IOYX 5KCVA 1FHOA 4TYZA 1U5EA 2K2UA 1Q67A 1I7AA 3ML4A 1V88A 2QKMA 3FM8C 2MDXA 2UVMA 1EGXA 1XCGA 1V5MA 1X1FA 4PQ0A 2RSGA 5D27A 3SNHA 3FEHA 2EMSA 1V89A 2YF0A 1J19A 2D4QA 3ODWA 3AU4A 2YT0A 2KR9A 4A6KA 1MK9B 2VKIA 2R09A 2YVCA 2YRYA 2COFA 1KI1B 3DXEA 4DBBA 3KSYA 3MDBC 3CIKA 3HK0A 2CODA 2V76A 4MK0A 2M14A 3P6AA 2N23A 1TXDA 2ROVA 2YS3A 1XODA 5KQ1A 4IFSA 2GCLA 2P8VA 1RJ2A 5D3WA 4GMXB 5HE2A 5D3XA 1J0WA 1PLSA 5LONB 2GCJA 1K5DB 1WJMA 4BBKA 1WG7A 3GF9A 2P0DA 2RGNB 2CY4A 5KQ4A 2KCJA 2YSZA 2OTXA 1IRSA 2Z0OA 1H4RA 3D8DA 3PVLA 3QIJA 2J59M 5C79A 3X23A 4KHAA 2ROZB 2R0DA 2KGXB 3QWMA 2K2JA 3BJIA 1E5WA 5DI9B 1BY1A 2DA0A 4HAYB 4A6HA 4HDOA 3DXDA 3V5WA 1BTNA 3LJUX 2W2WA 4KHOA 5DIFB 2UZSA 1EF1A 1H10A 4F7UP 3GYOA 2RNRB 1OY2A 1U2BA 1Y5OA 2DHJA 2DHKA 5J3QA 3PP2A 1SHCA 3ULCA 2J0KA 2IYBA 2GS0A 1ZC4B 4WVFB 1ZVRA 2LYDA 1FGZA 4P7IA 1X11A 2HE7A 4GZUA 2DYNA 5D3VA 2NZ8B 4NY0A 1X1GA 3ZDTA 1OQNA 1Z87A 1KZ7A 1M7RA 5JLJB 2DTCA 5JHHA 4IAPA 2Y7BA 4K17A 1U5GA 3A98B 3VIAA 2X18A 2L1CA 1XKEA 1WGQA 1K5GB 2D2QA 4Z2MB 1GG3A 2BCJA 4H8SA 4HAXB 4EMOA 4MY6A 2E2XA 2I1JA 1XD4A 1NTVA 2EJ8A 1WGUA 3SO6A 4D0OA 2D9XA 3KY9A 4GXBA 4HB3B 4DX90 3ULBA 2P0FA 4XWXA 4HB4B 5GOWB 2GJYA 3WYFB 3QBVB 5JHGA 2YS5A 2M38A 2YS1A 3BINA 4ZRKA 3U8ZA 2DLWA 1LB1A 3EO2A 3AU5A 1MIZB 1V5PA 3PVWA 2DX5A 2I5CA 2DN6A 4F7HA 2LKOA 1FB8A 2W2XC 4EJNA 3F0WA 3M1IB 2CY5A 3KZ1A 5DHAB 1EAZA 3HW2B 3P7ZA 2UZRA 4TKNA 3SUZA 5D3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TQZ A;  1DDM A;  1FGY A;  2JP2 A;  3PSC A;  2LUL A;  1B55 A;  1ISN A;  2Q13 A;  1M7E A;  3HQC A;  1RRP B;  2CAY A;  2K00 A;  1UEF A;  2D9Z A;  2RLO A;  1WVH A;  4CHM A;  2COA A;  2ELB A;  1XX0 A;  1PFJ A;  4ZRJ A;  1WJ1 A;  4GMV A;  2AEH A;  2MWN B;  2I1K A;  1UPR A;  4HHV A;  1KZG A;  4K2O A;  3A8Q A;  3KRW A;  2VSZ A;  5CLL B;  4C0A A;  2I5F A;  2W2X D;  2AL6 A;  4EKU A;  4GN1 A;  4A6F A;  4GYV A;  4HAZ B;  5C16 A;  1SGH A;  4CHJ A;  3SYX A;  1P3R A;  3PZD A;  3NSU A;  1FAO A;  2L2I A;  2D9Y A;  1EVH A;  5J3Y A;  2QKL A;  2COC A;  1DDV A;  1I2H A;  2HTH B;  5C6R A;  2H7E A;  3N7C A;  1FOE A;  4L6E A;  2IFS A;  5C5B A;  2ELA A;  2N0Y A;  4HAT B;  1U5D A;  4CYE A;  5CLQ B;  2ADZ A;  4HB0 B;  1WI1 A;  4Z2N A;  1V5U A;  1DBH A;  2DFK A;  4GPT B;  3PVU A;  1BAK A;  5HE1 A;  1MPH A;  4KAX B;  3TVV A;  3DXC A;  1XR0 B;  4HAU B;  4YL8 A;  4Y94 A;  3TFM A;  1X05 A;  3SV1 A;  2J0J A;  2MKR A;  1FHX A;  2G35 A;  1UNP A;  5LOP B;  2MFQ A;  3U7D A;  1U27 A;  1MKE A;  1BWN A;  4WJ7 A;  2D9W A;  1UNQ A;  2RUK B;  3CXB B;  2Z0P A;  2NMB A;  3D8E A;  3GYP A;  1AQC A;  4KVG B;  1OMW A;  1MAI A;  1TJ6 A;  1W1H A;  2FJL A;  2CRF A;  2DKQ A;  3VOQ A;  3UZT A;  2P0H A;  4DXA B;  3JV3 A;  4GOU A;  5JP4 A;  3TO1 A;  2Z0Q A;  5FI1 A;  4HAV B;  5FI0 A;  1FHW A;  2YT1 A;  1P6S A;  2EC1 A;  3G9W A;  1W1G A;  3KRX A;  4K2P A;  2H7D A;  1DYN A;  2DX1 A;  2D10 A;  1GC6 A;  2LOZ A;  1DRO A;  3T06 A;  4HAW B;  4D0N B;  2EMT A;  1GC7 A;  3MPX A;  4HB2 B;  1F5X A;  1U29 A;  3OAN A;  3TW1 A;  2VRW B;  5L81 A;  2PZ1 A;  2LOX A;  4YON A;  3ODX A;  2Y8G A;  1V61 A;  3F5R A;  2LG1 A;  1MK7 B;  3TCA A;  2J0M A;  4K81 A;  2ZPY A;  1QC6 A;  1UPQ A;  2Y8F A;  1PMS A;  3A8P A;  1ZM0 A;  3D8F A;  5J3T A;  1NTY A;  4MT7 A;  5DH9 B;  4ZRI A;  4NSW A;  5HE0 A;  1N3H A;  2DHI A;  1LW3 A;  1P5T A;  2RVB B;  4HDQ A;  1Y19 B;  3PG7 A;  4B6H A;  4PNK A;  1QQG A;  1W1D A;  3IVF A;  2DYQ A;  3RCP A;  3WA0 A;  2D11 A;  1UNR A;  1NI2 A;  4WSF A;  1AWE A;  4KHB B;  4A6F B;  2DKP A;  5DHF B;  1X86 A;  1MIX A;  2D9V A;  5HE3 A;  1U5F A;  2OQB A;  3AJ4 A;  3PEG A;  1DDW A;  1ZC3 B;  1ZSQ A;  2KUP A;  4F7G A;  4A5K A;  3FSS A;  3O96 A;  4DX8 A;  2XQN M;  3ZVR A;  5C5B B;  1BTK A;  1NU2 A;  3ODO A;  5EFX A;  4IOY X;  5KCV A;  1FHO A;  4TYZ A;  1U5E A;  2K2U A;  1Q67 A;  1I7A A;  3ML4 A;  1V88 A;  2QKM A;  3FM8 C;  2MDX A;  2UVM A;  1EGX A;  1XCG A;  1V5M A;  1X1F A;  4PQ0 A;  2RSG A;  5D27 A;  3SNH A;  3FEH A;  2EMS A;  1V89 A;  2YF0 A;  1J19 A;  2D4Q A;  3ODW A;  3AU4 A;  2YT0 A;  2KR9 A;  4A6K A;  1MK9 B;  2VKI A;  2R09 A;  2YVC A;  2YRY A;  2COF A;  1KI1 B;  3DXE A;  4DBB A;  3KSY A;  3MDB C;  3CIK A;  3HK0 A;  2COD A;  2V76 A;  4MK0 A;  2M14 A;  3P6A A;  2N23 A;  1TXD A;  2ROV A;  2YS3 A;  1XOD A;  5KQ1 A;  4IFS A;  2GCL A;  2P8V A;  1RJ2 A;  5D3W A;  4GMX B;  5HE2 A;  5D3X A;  1J0W A;  1PLS A;  5LON B;  2GCJ A;  1K5D B;  1WJM A;  4BBK A;  1WG7 A;  3GF9 A;  2P0D A;  2RGN B;  2CY4 A;  5KQ4 A;  2KCJ A;  2YSZ A;  2OTX A;  1IRS A;  2Z0O A;  1H4R A;  3D8D A;  3PVL A;  3QIJ A;  2J59 M;  5C79 A;  3X23 A;  4KHA A;  2ROZ B;  2R0D A;  2KGX B;  3QWM A;  2K2J A;  3BJI A;  1E5W A;  5DI9 B;  1BY1 A;  2DA0 A;  4HAY B;  4A6H A;  4HDO A;  3DXD A;  3V5W A;  1BTN A;  3LJU X;  2W2W A;  4KHO A;  5DIF B;  2UZS A;  1EF1 A;  1H10 A;  4F7U P;  3GYO A;  2RNR B;  1OY2 A;  1U2B A;  1Y5O A;  2DHJ A;  2DHK A;  5J3Q A;  3PP2 A;  1SHC A;  3ULC A;  2J0K A;  2IYB A;  2GS0 A;  1ZC4 B;  4WVF B;  1ZVR A;  2LYD A;  1FGZ A;  4P7I A;  1X11 A;  2HE7 A;  4GZU A;  2DYN A;  5D3V A;  2NZ8 B;  4NY0 A;  1X1G A;  3ZDT A;  1OQN A;  1Z87 A;  1KZ7 A;  1M7R A;  5JLJ B;  2DTC A;  5JHH A;  4IAP A;  2Y7B A;  4K17 A;  1U5G A;  3A98 B;  3VIA A;  2X18 A;  2L1C A;  1XKE A;  1WGQ A;  1K5G B;  2D2Q A;  4Z2M B;  1GG3 A;  2BCJ A;  4H8S A;  4HAX B;  4EMO A;  4MY6 A;  2E2X A;  2I1J A;  1XD4 A;  1NTV A;  2EJ8 A;  1WGU A;  3SO6 A;  4D0O A;  2D9X A;  3KY9 A;  4GXB A;  4HB3 B;  4DX9 0;  3ULB A;  2P0F A;  4XWX A;  4HB4 B;  5GOW B;  2GJY A;  3WYF B;  3QBV B;  5JHG A;  2YS5 A;  2M38 A;  2YS1 A;  3BIN A;  4ZRK A;  3U8Z A;  2DLW A;  1LB1 A;  3EO2 A;  3AU5 A;  1MIZ B;  1V5P A;  3PVW A;  2DX5 A;  2I5C A;  2DN6 A;  4F7H A;  2LKO A;  1FB8 A;  2W2X C;  4EJN A;  3F0W A;  3M1I B;  2CY5 A;  3KZ1 A;  5DHA B;  1EAZ A;  3HW2 B;  3P7Z A;  2UZR A;  4TKN A;  3SUZ A;  5D3Y A; 
#chains in the Genus database with same CATH topology
 1TQZ A;  1DDM A;  1FGY A;  2JP2 A;  3PSC A;  2LUL A;  1B55 A;  1ISN A;  2Q13 A;  1M7E A;  3HQC A;  1RRP B;  2CAY A;  2K00 A;  1UEF A;  2D9Z A;  2RLO A;  1WVH A;  4CHM A;  2COA A;  2ELB A;  3HIE A;  1XX0 A;  1PFJ A;  4ZRJ A;  1WJ1 A;  4GMV A;  2AEH A;  2MWN B;  2I1K A;  1UPR A;  4HHV A;  1KZG A;  4K2O A;  3A8Q A;  3KRW A;  2KIE A;  2VSZ A;  5CLL B;  4C0A A;  2I5F A;  5I2S A;  1ZYI A;  2W2X D;  4KHB A;  2AL6 A;  4EKU A;  4GN1 A;  4A6F A;  4GYV A;  4HAZ B;  5C16 A;  4QJ5 B;  1SGH A;  4CHJ A;  3SYX A;  1P3R A;  3PZD A;  3NSU A;  1FAO A;  2L2I A;  2D9Y A;  1EVH A;  5J3Y A;  2QKL A;  2COC A;  1DDV A;  1I2H A;  2HTH B;  5C6R A;  2H7E A;  4QXA B;  3N7C A;  3NWD A;  1FOE A;  4L6E A;  2IFS A;  2Z59 A;  5C5B A;  2ELA A;  2N0Y A;  4HAT B;  1U5D A;  4CYE A;  5CLQ B;  2ADZ A;  3B77 A;  4HB0 B;  4CSQ A;  1WI1 A;  4Z2N A;  2KIG A;  1V5U A;  1DBH A;  2DFK A;  4GPT B;  3PVU A;  1BAK A;  5HE1 A;  1MPH A;  4KAX B;  3TVV A;  3DXC A;  2NBV A;  1XR0 B;  4HAU B;  4YL8 A;  4Y94 A;  3TFM A;  1X05 A;  3SV1 A;  2J0J A;  2MKR A;  1FHX A;  2G35 A;  1UNP A;  5LOP B;  2MFQ A;  3U7D A;  1U27 A;  1MKE A;  1BWN A;  4WJ7 A;  2D9W A;  1UNQ A;  2RUK B;  3CXB B;  2Z0P A;  3DCX A;  2NMB A;  3D8E A;  3GYP A;  4D6W A;  1AQC A;  4KVG B;  1OMW A;  2KR0 A;  1MAI A;  1TJ6 A;  1W1H A;  2FJL A;  2CRF A;  2DKQ A;  3A58 A;  3VOQ A;  3UZT A;  2P0H A;  4DXA B;  5I2M A;  3JV3 A;  4GOU A;  5JP4 A;  3TO1 A;  5IRS A;  2Z0Q A;  5FI1 A;  4HAV B;  5FI0 A;  1FHW A;  2YT1 A;  1P6S A;  2EC1 A;  3G9W A;  1W1G A;  3KRX A;  4K2P A;  2H7D A;  1DYN A;  2DX1 A;  2D10 A;  1GC6 A;  2LOZ A;  1DRO A;  3T06 A;  4HAW B;  4D0N B;  2EMT A;  1GC7 A;  3MPX A;  4HB2 B;  1F5X A;  1U29 A;  3OAN A;  3TW1 A;  2VRW B;  5L81 A;  2PZ1 A;  2LOX A;  4YON A;  3ODX A;  2Y8G A;  1V61 A;  3F5R A;  2LG1 A;  1MK7 B;  3TCA A;  2J0M A;  4K81 A;  2ZPY A;  1QC6 A;  1UPQ A;  2Y8F A;  1PMS A;  3A8P A;  1ZM0 A;  3D8F A;  5J3T A;  1NTY A;  4MT7 A;  5DH9 B;  4ZRI A;  4NSW A;  5HE0 A;  2RRF A;  1N3H A;  2DHI A;  1LW3 A;  1P5T A;  2RVB B;  4HDQ A;  1Y19 B;  3PG7 A;  4B6H A;  4PNK A;  1QQG A;  1W1D A;  3IVF A;  2DYQ A;  3RCP A;  3WA0 A;  2D11 A;  1UNR A;  1NI2 A;  4WSF A;  1AWE A;  4KHB B;  4QJ4 B;  4A6F B;  2DKP A;  5DHF B;  1X86 A;  1MIX A;  2D9V A;  5HE3 A;  1U5F A;  2OQB A;  3AJ4 A;  4GNK B;  3PEG A;  1DDW A;  1ZC3 B;  1ZSQ A;  2KUP A;  4L1R A;  4F7G A;  4A5K A;  3FSS A;  3O96 A;  3FVC A;  4DX8 A;  2XQN M;  3ZVR A;  5C5B B;  1BTK A;  1NU2 A;  3ODO A;  5EFX A;  4IOY X;  5KCV A;  1FHO A;  2ZKM X;  4TYZ A;  1U5E A;  2K2U A;  1Q67 A;  1I7A A;  4HSI A;  3ML4 A;  1V88 A;  2QKM A;  3FM8 C;  2MDX A;  2UVM A;  2FJU B;  1EGX A;  1XCG A;  1V5M A;  1X1F A;  4PQ0 A;  2RSG A;  5D27 A;  3SNH A;  3U12 A;  3FEH A;  2EMS A;  1V89 A;  2YF0 A;  1J19 A;  2D4Q A;  3ODW A;  3AU4 A;  2YT0 A;  2KR9 A;  4A6K A;  1MK9 B;  2VKI A;  2R09 A;  5M4Y B;  2YVC A;  2YRY A;  2COF A;  1KI1 B;  3DXE A;  4DBB A;  3KSY A;  3MDB C;  3CIK A;  3HK0 A;  2COD A;  2V76 A;  4MK0 A;  2M14 A;  3P6A A;  2N23 A;  1TXD A;  2ROV A;  2YS3 A;  1XOD A;  5KQ1 A;  4IFS A;  4QJ3 B;  2GCL A;  2P8V A;  1RJ2 A;  5D3W A;  4GMX B;  5HE2 A;  5D3X A;  1J0W A;  1PLS A;  5LON B;  2GCJ A;  1K5D B;  2K8E A;  1WJM A;  4BBK A;  1WG7 A;  3GF9 A;  2P0D A;  2RGN B;  2CY4 A;  5KQ4 A;  2KCJ A;  2YSZ A;  2OTX A;  1IRS A;  2Z0O A;  1H4R A;  3D8D A;  3PVL A;  3QIJ A;  2J59 M;  3NWA A;  5C79 A;  3X23 A;  4KHA A;  2ROZ B;  2R0D A;  2KGX B;  3QWM A;  2K2J A;  3BJI A;  1E5W A;  5DI9 B;  1BY1 A;  2DA0 A;  4HAY B;  4A6H A;  4HDO A;  3DXD A;  3V5W A;  1BTN A;  3LJU X;  2W2W A;  4KHO A;  5DIF B;  2UZS A;  1EF1 A;  1H10 A;  4F7U P;  3GYO A;  2RNR B;  1OY2 A;  3OHM B;  1U2B A;  1Y5O A;  2DHJ A;  2K49 A;  2DHK A;  2YT2 A;  5J3Q A;  3PP2 A;  1SHC A;  3ULC A;  2J0K A;  2IYB A;  2GS0 A;  1ZC4 B;  4WVF B;  1ZVR A;  2LYD A;  1FGZ A;  4P7I A;  2Z13 A;  1X11 A;  2HE7 A;  4GZU A;  2DYN A;  5D3V A;  2NZ8 B;  4NY0 A;  1X1G A;  3ZDT A;  1OQN A;  1Z87 A;  1KZ7 A;  1M7R A;  5JLJ B;  1MI1 A;  2DTC A;  2R2Y A;  5JHH A;  5LG4 B;  4IAP A;  1T77 A;  2Y7B A;  4K17 A;  1U5G A;  3A98 B;  3VIA A;  2X18 A;  2L1C A;  1XKE A;  2GUM A;  1WGQ A;  2Z14 A;  1K5G B;  2D2Q A;  4Z2M B;  1GG3 A;  2BCJ A;  4H8S A;  4HAX B;  4EMO A;  4MY6 A;  2E2X A;  2I1J A;  1XD4 A;  1NTV A;  2EJ8 A;  1WGU A;  3SO6 A;  2KUQ A;  4D0O A;  2D9X A;  3KY9 A;  4GXB A;  4HB3 B;  4DX9 0;  3ULB A;  2P0F A;  4XWX A;  4HB4 B;  5GOW B;  2GJY A;  3WYF B;  3QBV B;  5JHG A;  3NW8 A;  2Z4D A;  2YS5 A;  2M38 A;  2YS1 A;  4DIX A;  3NWF A;  3BIN A;  4ZRK A;  3U8Z A;  2DLW A;  4OT1 A;  1LB1 A;  3EO2 A;  3AU5 A;  1MIZ B;  1V5P A;  3PVW A;  2DX5 A;  2I5C A;  2DN6 A;  4F7H A;  2LKO A;  1FB8 A;  2W2X C;  4EJN A;  3F0W A;  3M1I B;  2CY5 A;  3KZ1 A;  5DHA B;  1EAZ A;  3HW2 B;  3P7Z A;  2UZR A;  3HSA A;  4TKN A;  3SUZ A;  5D3Y A;  4OSN A; 
#chains in the Genus database with same CATH homology
 1TQZ A;  1DDM A;  1FGY A;  2JP2 A;  3PSC A;  2LUL A;  1B55 A;  1ISN A;  2Q13 A;  1M7E A;  3HQC A;  1RRP B;  2CAY A;  2K00 A;  1UEF A;  2D9Z A;  2RLO A;  1WVH A;  4CHM A;  2COA A;  2ELB A;  1XX0 A;  1PFJ A;  4ZRJ A;  1WJ1 A;  4GMV A;  2AEH A;  2MWN B;  2I1K A;  1UPR A;  4HHV A;  1KZG A;  4K2O A;  3A8Q A;  3KRW A;  2VSZ A;  5CLL B;  4C0A A;  2I5F A;  2W2X D;  2AL6 A;  4EKU A;  4GN1 A;  4A6F A;  4GYV A;  4HAZ B;  5C16 A;  1SGH A;  4CHJ A;  3SYX A;  1P3R A;  3PZD A;  3NSU A;  1FAO A;  2L2I A;  2D9Y A;  1EVH A;  5J3Y A;  2QKL A;  2COC A;  1DDV A;  1I2H A;  2HTH B;  5C6R A;  2H7E A;  3N7C A;  1FOE A;  4L6E A;  2IFS A;  5C5B A;  2ELA A;  2N0Y A;  4HAT B;  1U5D A;  4CYE A;  5CLQ B;  2ADZ A;  4HB0 B;  1WI1 A;  4Z2N A;  1V5U A;  1DBH A;  2DFK A;  4GPT B;  3PVU A;  1BAK A;  5HE1 A;  1MPH A;  4KAX B;  3TVV A;  3DXC A;  1XR0 B;  4HAU B;  4YL8 A;  4Y94 A;  3TFM A;  1X05 A;  3SV1 A;  2J0J A;  2MKR A;  1FHX A;  2G35 A;  1UNP A;  5LOP B;  2MFQ A;  3U7D A;  1U27 A;  1MKE A;  1BWN A;  4WJ7 A;  2D9W A;  1UNQ A;  2RUK B;  3CXB B;  2Z0P A;  2NMB A;  3D8E A;  3GYP A;  1AQC A;  4KVG B;  1OMW A;  1MAI A;  1TJ6 A;  1W1H A;  2FJL A;  2CRF A;  2DKQ A;  3VOQ A;  3UZT A;  2P0H A;  4DXA B;  3JV3 A;  4GOU A;  5JP4 A;  3TO1 A;  2Z0Q A;  5FI1 A;  4HAV B;  5FI0 A;  1FHW A;  2YT1 A;  1P6S A;  2EC1 A;  3G9W A;  1W1G A;  3KRX A;  4K2P A;  2H7D A;  1DYN A;  2DX1 A;  2D10 A;  1GC6 A;  2LOZ A;  1DRO A;  3T06 A;  4HAW B;  4D0N B;  2EMT A;  1GC7 A;  3MPX A;  4HB2 B;  1F5X A;  1U29 A;  3OAN A;  3TW1 A;  2VRW B;  5L81 A;  2PZ1 A;  2LOX A;  4YON A;  3ODX A;  2Y8G A;  1V61 A;  3F5R A;  2LG1 A;  1MK7 B;  3TCA A;  2J0M A;  4K81 A;  2ZPY A;  1QC6 A;  1UPQ A;  2Y8F A;  1PMS A;  3A8P A;  1ZM0 A;  3D8F A;  5J3T A;  1NTY A;  4MT7 A;  5DH9 B;  4ZRI A;  4NSW A;  5HE0 A;  1N3H A;  2DHI A;  1LW3 A;  1P5T A;  2RVB B;  4HDQ A;  1Y19 B;  3PG7 A;  4B6H A;  4PNK A;  1QQG A;  1W1D A;  3IVF A;  2DYQ A;  3RCP A;  3WA0 A;  2D11 A;  1UNR A;  1NI2 A;  4WSF A;  1AWE A;  4KHB B;  4A6F B;  2DKP A;  5DHF B;  1X86 A;  1MIX A;  2D9V A;  5HE3 A;  1U5F A;  2OQB A;  3AJ4 A;  3PEG A;  1DDW A;  1ZC3 B;  1ZSQ A;  2KUP A;  4F7G A;  4A5K A;  3FSS A;  3O96 A;  4DX8 A;  2XQN M;  3ZVR A;  5C5B B;  1BTK A;  1NU2 A;  3ODO A;  5EFX A;  4IOY X;  5KCV A;  1FHO A;  4TYZ A;  1U5E A;  2K2U A;  1Q67 A;  1I7A A;  3ML4 A;  1V88 A;  2QKM A;  3FM8 C;  2MDX A;  2UVM A;  1EGX A;  1XCG A;  1V5M A;  1X1F A;  4PQ0 A;  2RSG A;  5D27 A;  3SNH A;  3FEH A;  2EMS A;  1V89 A;  2YF0 A;  1J19 A;  2D4Q A;  3ODW A;  3AU4 A;  2YT0 A;  2KR9 A;  4A6K A;  1MK9 B;  2VKI A;  2R09 A;  2YVC A;  2YRY A;  2COF A;  1KI1 B;  3DXE A;  4DBB A;  3KSY A;  3MDB C;  3CIK A;  3HK0 A;  2COD A;  2V76 A;  4MK0 A;  2M14 A;  3P6A A;  2N23 A;  1TXD A;  2ROV A;  2YS3 A;  1XOD A;  5KQ1 A;  4IFS A;  2GCL A;  2P8V A;  1RJ2 A;  5D3W A;  4GMX B;  5HE2 A;  5D3X A;  1J0W A;  1PLS A;  5LON B;  2GCJ A;  1K5D B;  1WJM A;  4BBK A;  1WG7 A;  3GF9 A;  2P0D A;  2RGN B;  2CY4 A;  5KQ4 A;  2KCJ A;  2YSZ A;  2OTX A;  1IRS A;  2Z0O A;  1H4R A;  3D8D A;  3PVL A;  3QIJ A;  2J59 M;  5C79 A;  3X23 A;  4KHA A;  2ROZ B;  2R0D A;  2KGX B;  3QWM A;  2K2J A;  3BJI A;  1E5W A;  5DI9 B;  1BY1 A;  2DA0 A;  4HAY B;  4A6H A;  4HDO A;  3DXD A;  3V5W A;  1BTN A;  3LJU X;  2W2W A;  4KHO A;  5DIF B;  2UZS A;  1EF1 A;  1H10 A;  4F7U P;  3GYO A;  2RNR B;  1OY2 A;  1U2B A;  1Y5O A;  2DHJ A;  2DHK A;  5J3Q A;  3PP2 A;  1SHC A;  3ULC A;  2J0K A;  2IYB A;  2GS0 A;  1ZC4 B;  4WVF B;  1ZVR A;  2LYD A;  1FGZ A;  4P7I A;  1X11 A;  2HE7 A;  4GZU A;  2DYN A;  5D3V A;  2NZ8 B;  4NY0 A;  1X1G A;  3ZDT A;  1OQN A;  1Z87 A;  1KZ7 A;  1M7R A;  5JLJ B;  2DTC A;  5JHH A;  4IAP A;  2Y7B A;  4K17 A;  1U5G A;  3A98 B;  3VIA A;  2X18 A;  2L1C A;  1XKE A;  1WGQ A;  1K5G B;  2D2Q A;  4Z2M B;  1GG3 A;  2BCJ A;  4H8S A;  4HAX B;  4EMO A;  4MY6 A;  2E2X A;  2I1J A;  1XD4 A;  1NTV A;  2EJ8 A;  1WGU A;  3SO6 A;  4D0O A;  2D9X A;  3KY9 A;  4GXB A;  4HB3 B;  4DX9 0;  3ULB A;  2P0F A;  4XWX A;  4HB4 B;  5GOW B;  2GJY A;  3WYF B;  3QBV B;  5JHG A;  2YS5 A;  2M38 A;  2YS1 A;  3BIN A;  4ZRK A;  3U8Z A;  2DLW A;  1LB1 A;  3EO2 A;  3AU5 A;  1MIZ B;  1V5P A;  3PVW A;  2DX5 A;  2I5C A;  2DN6 A;  4F7H A;  2LKO A;  1FB8 A;  2W2X C;  4EJN A;  3F0W A;  3M1I B;  2CY5 A;  3KZ1 A;  5DHA B;  1EAZ A;  3HW2 B;  3P7Z A;  2UZR A;  4TKN A;  3SUZ A;  5D3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...