5C6RA

Crystal structure of ph domain of asap1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
110
structure length
110
Chain Sequence
QLQGNKEYGSEKKGFLLKKSDGIRKVWQRRKCAVKNGILTISHATSNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYIAWISVLTNSKEEALTMAFRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Arf-GAP
publication title Molecular Basis for Cooperative Binding of Anionic Phospholipids to the PH Domain of the Arf GAP ASAP1.
pubmed doi rcsb
source organism Mus musculus
total genus 28
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5c6rA00
1K5DB 4GMVA 2DKPA 1ISNA 4K81A 3FSSA 4Y94A 3TCAA 3ZVRA 2RSGA 4DXAB 1WVHA 5DIFB 2GJYA 3SYXA 1DBHA 3G9WA 1IRSA 4A5KA 4DX90 2MWNB 2COAA 2DKQA 2DHIA 1Q67A 2GCJA 4WSFA 2P0HA 5HE0A 1RJ2A 1NU2A 2E2XA 1V89A 3WYFB 3HW2B 1XX0A 1QC6A 3NSUA 1U29A 1PFJA 1AWEA 1ZC3B 3QWMA 2QKLA 3UZTA 2Q13A 5CLQB 4A6FA 2R0DA 1EAZA 1U27A 4GMXB 4TKNA 2ZPYA 5LONB 2HTHB 1FHXA 3KSYA 1SHCA 2RLOA 4HAVB 1BTNA 2D10A 4KHBB 4HB4B 3HK0A 5D27A 1U2BA 3AJ4A 4HAUB 2K2JA 2LOZA 2J59M 1U5DA 5DI9B 5HE1A 4EMOA 1J0WA 2K00A 2CAYA 4Z2MB 1FHOA 1Y19B 2LYDA 2NZ8B 4PQ0A 5J3QA 2X18A 2Z0PA 1V5UA 1NTVA 2J0KA 1LB1A 3LJUX 1WJMA 1WGQA 5C6RA 1P6SA 2OTXA 4P7IA 1NTYA 4B6HA 1ZVRA 2J0JA 3FM8C 1FGYA 2P8VA 5J3TA 2YSZA 2XQNM 4GXBA 1U5GA 5DHFB 1MK7B 1I7AA 3KRXA 4A6FB 3MDBC 3SO6A 3WA0A 2COFA 1V5PA 3RCPA 4YONA 5KQ1A 4HAWB 3D8DA 2DN6A 3CXBB 3V5WA 2P0DA 3N7CA 3PG7A 2COCA 1XODA 4PNKA 2AL6A 3P6AA 2YS1A 2DA0A 2ADZA 3BJIA 4HB0B 3CIKA 2CRFA 1X05A 3X23A 2LOXA 1DDVA 4CHJA 2DYQA 1UNRA 4NSWA 3DXDA 5EFXA 1E5WA 4KAXB 2VSZA 2YS5A 1ZSQA 4HATB 2KGXB 3T06A 2AEHA 3A98B 1J19A 1EVHA 5D3YA 2D9WA 2DFKA 2D2QA 2GS0A 4KHOA 4K2PA 1TJ6A 1FGZA 1M7RA 3D8FA 2W2WA 1NI2A 4HAYB 1WG7A 2RUKB 1FB8A 2QKMA 1V88A 2KCJA 2K2UA 2UVMA 2I1JA 2L2IA 3SV1A 3VOQA 1V61A 1XD4A 2Y8GA 2DTCA 4WJ7A 2DYNA 1DROA 1DDWA 5D3VA 3OANA 3AU5A 3VIAA 1XKEA 2M14A 1PMSA 4GN1A 1K5GB 2YRYA 4Z2NA 4D0NB 2LG1A 5CLLB 2EMSA 3A8QA 1ZM0A 2FJLA 2I5CA 2UZRA 3A8PA 1W1GA 1U5FA 4CHMA 1X11A 1WJ1A 2DHKA 2V76A 4EKUA 1FHWA 2YT1A 3QIJA 1N3HA 1XR0B 5C16A 5JHHA 2YF0A 5HE3A 3ODXA 3F5RA 3PP2A 3DXCA 3SUZA 3DXEA 2CY5A 4NY0A 3O96A 3TVVA 3PZDA 1QQGA 2ELAA 1I2HA 1WGUA 2H7DA 2BCJA 2I5FA 4KVGB 4XWXA 2W2XD 2RNRB 2Z0OA 2YT0A 3SNHA 1BWNA 3KRWA 2EJ8A 2DLWA 1KI1B 1U5EA 2DX5A 1ZC4B 2N23A 3PEGA 5JLJB 2ROVA 2D11A 5LOPB 5DH9B 5D3WA 2RGNB 1OY2A 1Z87A 3PVLA 3U8ZA 2YS3A 1P3RA 4L6EA 2P0FA 2OQBA 2NMBA 3ODOA 3QBVB 2D9XA 3TFMA 1H4RA 1XCGA 5J3YA 4ZRKA 4YL8A 2I1KA 1LW3A 1SGHA 1UEFA 3IVFA 4ZRJA 2IYBA 3PSCA 4F7GA 1W1HA 4GPTB 3U7DA 2MFQA 2Y8FA 1FAOA 1MPHA 1W1DA 2IFSA 4A6HA 3GYPA 2YVCA 4HDQA 4F7UP 3ULBA 4MY6A 2EMTA 1GG3A 1X1GA 1FOEA 2KUPA 5FI0A 5FI1A 4A6KA 4HAZB 1UPQA 1P5TA 3KY9A 2D4QA 4ZRIA 2JP2A 4WVFB 5GOWB 1M7EA 4HDOA 3F0WA 2PZ1A 1MK9B 3P7ZA 2ELBA 1MAIA 4F7HA 3D8EA 4CYEA 1EGXA 4TYZA 5C5BB 1GC7A 3KZ1A 5DHAB 1TQZA 1H10A 1RRPB 2H7EA 2UZSA 1X86A 2D9ZA 3BINA 2G35A 4IAPA 4EJNA 5KCVA 5HE2A 4IOYX 3TO1A 2VKIA 1MIZB 2Y7BA 1KZGA 2GCLA 4DX8A 2CY4A 1WI1A 4DBBA 3PVUA 2N0YA 1BTKA 1Y5OA 3FEHA 4BBKA 2J0MA 2RVBB 1OMWA 2W2XC 3GYOA 3ULCA 1GC6A 4C0AA 4HB3B 2D9YA 2ROZB 1KZ7A 2EC1A 3PVWA 1V5MA 1OQNA 4HAXB 3ZDTA 1UPRA 4IFSA 1UNQA 4HHVA 3MPXA 3M1IB 3ODWA 3TW1A 4MT7A 2HE7A 4K17A 1MIXA 4MK0A 2DHJA 4GZUA 2VRWB 1EF1A 5JP4A 3AU4A 1MKEA 3ML4A 2M38A 1DYNA 2LKOA 1TXDA 2Z0QA 2R09A 2MKRA 5C5BA 3HQCA 1BAKA 1DDMA 4KHAA 2MDXA 4HB2B 1AQCA 5D3XA 2CODA 1B55A 5L81A 5C79A 1X1FA 2LULA 2DX1A 1PLSA 5JHGA 1UNPA 2L1CA 2D9VA 4H8SA 5KQ4A 4K2OA
chains in the Genus database with same CATH superfamily
1K5DB 4GMVA 2DKPA 1ISNA 4K81A 3FSSA 4Y94A 2Z4DA 3TCAA 3ZVRA 2RSGA 4DXAB 1WVHA 5DIFB 2GJYA 3SYXA 1DBHA 3G9WA 1IRSA 4A5KA 4DX90 2MWNB 2COAA 2DKQA 2DHIA 1Q67A 2GCJA 4WSFA 2P0HA 5HE0A 1RJ2A 1NU2A 2E2XA 1V89A 3WYFB 3HW2B 1XX0A 1QC6A 3NSUA 1U29A 1PFJA 1AWEA 1ZC3B 3QWMA 4GOUA 2QKLA 3UZTA 2Q13A 5CLQB 2YT2A 4A6FA 2R0DA 1EAZA 2Z13A 1U27A 4GMXB 4TKNA 2ZPYA 5LONB 2HTHB 2KR0A 1FHXA 3KSYA 1SHCA 2RLOA 4HAVB 5I2MA 1BTNA 2D10A 4KHBB 3NWDA 4HB4B 3HK0A 5D27A 1U2BA 3AJ4A 4HAUB 2K2JA 2LOZA 2J59M 1U5DA 5DI9B 5HE1A 2NBVA 4EMOA 1J0WA 2K00A 2CAYA 4Z2MB 1FHOA 1Y19B 2LYDA 2NZ8B 4PQ0A 3NW8A 5J3QA 2X18A 2Z0PA 1V5UA 1NTVA 2J0KA 2R2YA 1LB1A 3LJUX 1WJMA 1WGQA 5C6RA 3HSAA 1P6SA 2OTXA 4P7IA 1NTYA 4B6HA 1ZVRA 2J0JA 3FM8C 1FGYA 2P8VA 4DIXA 5J3TA 2YSZA 3A58A 2XQNM 4GXBA 1U5GA 5DHFB 1MK7B 1I7AA 3KRXA 4A6FB 3MDBC 3SO6A 3WA0A 2COFA 1V5PA 2ZKMX 3RCPA 4QJ3B 4YONA 5KQ1A 4HAWB 4L1RA 3D8DA 2DN6A 2KUQA 3CXBB 4OT1A 2P0DA 3N7CA 3PG7A 3V5WA 3FVCA 2COCA 1XODA 4PNKA 2AL6A 3P6AA 2YS1A 3HIEA 2DA0A 2ADZA 3BJIA 4HB0B 3CIKA 2CRFA 1X05A 3X23A 2LOXA 1DDVA 4CHJA 2DYQA 1UNRA 4NSWA 3DXDA 5EFXA 1E5WA 4KAXB 2VSZA 2YS5A 1ZSQA 3B77A 4HATB 2KGXB 3T06A 2AEHA 3A98B 1J19A 1EVHA 3NWFA 4OSNA 5D3YA 2D9WA 2DFKA 2D2QA 2GS0A 4KHOA 4K2PA 1TJ6A 1FGZA 1M7RA 3D8FA 2W2WA 1NI2A 4HAYB 1WG7A 2RUKB 1FB8A 2QKMA 1V88A 2KCJA 2K2UA 2UVMA 2I1JA 2L2IA 3SV1A 3VOQA 1V61A 1XD4A 2Y8GA 2DTCA 4WJ7A 2DYNA 1DROA 1DDWA 4QJ4B 5D3VA 3OANA 3AU5A 3VIAA 1XKEA 2M14A 1PMSA 4GN1A 1K5GB 2YRYA 4Z2NA 4D0NB 2LG1A 5CLLB 2EMSA 3A8QA 1ZM0A 2K49A 2FJLA 2I5CA 2UZRA 3A8PA 1W1GA 1U5FA 4CHMA 1X11A 3OHMB 1WJ1A 2DHKA 5LG4B 2V76A 4EKUA 1FHWA 2YT1A 3QIJA 4GNKB 1N3HA 1XR0B 5C16A 5JHHA 2YF0A 5HE3A 3ODXA 2KIEA 3F5RA 5IRSA 3PP2A 1MI1A 3DXCA 3SUZA 3DXEA 2CY5A 4NY0A 3O96A 3TVVA 3PZDA 1QQGA 2ELAA 2GUMA 1I2HA 1WGUA 2H7DA 2BCJA 2I5FA 4KVGB 4XWXA 2W2XD 2RNRB 2Z0OA 2YT0A 3SNHA 1BWNA 3KRWA 2EJ8A 2DLWA 1KI1B 1U5EA 2DX5A 1ZC4B 2K8EA 2N23A 2KIGA 3PEGA 5JLJB 2ROVA 4QXAB 2D11A 5LOPB 5DH9B 5D3WA 2RGNB 3NWAA 1OY2A 1Z87A 3PVLA 3U8ZA 2YS3A 1P3RA 4L6EA 2P0FA 2OQBA 2NMBA 3ODOA 3QBVB 2D9XA 3TFMA 1H4RA 1XCGA 5J3YA 4ZRKA 4YL8A 2I1KA 1LW3A 1SGHA 1UEFA 3IVFA 4ZRJA 2IYBA 3PSCA 4F7GA 1W1HA 4GPTB 3U7DA 2MFQA 2Y8FA 1FAOA 1MPHA 1W1DA 2IFSA 5M4YB 4A6HA 3GYPA 2YVCA 4HDQA 4F7UP 3ULBA 4MY6A 4CSQA 2EMTA 1GG3A 1X1GA 1FOEA 2KUPA 5FI0A 5FI1A 4A6KA 4HAZB 1UPQA 1P5TA 3KY9A 2D4QA 4ZRIA 2JP2A 4WVFB 4D6WA 5GOWB 1M7EA 4HDOA 3F0WA 2PZ1A 1MK9B 3P7ZA 2ELBA 1MAIA 2RRFA 4F7HA 3D8EA 4CYEA 1EGXA 4TYZA 5C5BB 1GC7A 3KZ1A 5DHAB 1TQZA 2Z59A 1H10A 1RRPB 2H7EA 2UZSA 1X86A 2D9ZA 2FJUB 3BINA 2G35A 2Z14A 4IAPA 4EJNA 5KCVA 5HE2A 4IOYX 3TO1A 2VKIA 1MIZB 2Y7BA 1KZGA 2GCLA 4DX8A 2CY4A 1T77A 1WI1A 4DBBA 3PVUA 2N0YA 1BTKA 1Y5OA 3FEHA 4BBKA 2J0MA 5I2SA 3U12A 2RVBB 3DCXA 1OMWA 2W2XC 3GYOA 3ULCA 1GC6A 4C0AA 4HB3B 2D9YA 2ROZB 1KZ7A 2EC1A 3PVWA 1V5MA 1OQNA 1ZYIA 4HAXB 3ZDTA 1UPRA 4IFSA 1UNQA 4HHVA 4HSIA 3MPXA 3M1IB 3ODWA 3TW1A 4MT7A 2HE7A 4K17A 1MIXA 4MK0A 2DHJA 4GZUA 2VRWB 1EF1A 5JP4A 3AU4A 1MKEA 3ML4A 2M38A 4QJ5B 1DYNA 2LKOA 1TXDA 2Z0QA 2R09A 2MKRA 5C5BA 3HQCA 1BAKA 1DDMA 4KHAA 2MDXA 4HB2B 1AQCA 5D3XA 2CODA 1B55A 5L81A 5C79A 1X1FA 2LULA 2DX1A 1PLSA 5JHGA 1UNPA 2L1CA 2D9VA 4KHBA 4H8SA 5KQ4A 4K2OA
chains in the Genus database with same CATH topology
1K5DB 4GMVA 2DKPA 1ISNA 4K81A 3FSSA 4Y94A 3TCAA 3ZVRA 2RSGA 4DXAB 1WVHA 5DIFB 2GJYA 3SYXA 1DBHA 3G9WA 1IRSA 4A5KA 4DX90 2MWNB 2COAA 2DKQA 2DHIA 1Q67A 2GCJA 4WSFA 2P0HA 5HE0A 1RJ2A 1NU2A 2E2XA 1V89A 3WYFB 3HW2B 1XX0A 1QC6A 3NSUA 1U29A 1PFJA 1AWEA 1ZC3B 3QWMA 2QKLA 3UZTA 2Q13A 5CLQB 4A6FA 2R0DA 1EAZA 1U27A 4GMXB 4TKNA 2ZPYA 5LONB 2HTHB 1FHXA 3KSYA 1SHCA 2RLOA 4HAVB 1BTNA 2D10A 4KHBB 4HB4B 3HK0A 5D27A 1U2BA 3AJ4A 4HAUB 2K2JA 2LOZA 2J59M 1U5DA 5DI9B 5HE1A 4EMOA 1J0WA 2K00A 2CAYA 4Z2MB 1FHOA 1Y19B 2LYDA 2NZ8B 4PQ0A 5J3QA 2X18A 2Z0PA 1V5UA 1NTVA 2J0KA 1LB1A 3LJUX 1WJMA 1WGQA 5C6RA 1P6SA 2OTXA 4P7IA 1NTYA 4B6HA 1ZVRA 2J0JA 3FM8C 1FGYA 2P8VA 5J3TA 2YSZA 2XQNM 4GXBA 1U5GA 5DHFB 1MK7B 1I7AA 3KRXA 4A6FB 3MDBC 3SO6A 3WA0A 2COFA 1V5PA 3RCPA 4YONA 5KQ1A 4HAWB 3D8DA 2DN6A 3CXBB 3V5WA 2P0DA 3N7CA 3PG7A 2COCA 1XODA 4PNKA 2AL6A 3P6AA 2YS1A 2DA0A 2ADZA 3BJIA 4HB0B 3CIKA 2CRFA 1X05A 3X23A 2LOXA 1DDVA 4CHJA 2DYQA 1UNRA 4NSWA 3DXDA 5EFXA 1E5WA 4KAXB 2VSZA 2YS5A 1ZSQA 4HATB 2KGXB 3T06A 2AEHA 3A98B 1J19A 1EVHA 5D3YA 2D9WA 2DFKA 2D2QA 2GS0A 4KHOA 4K2PA 1TJ6A 1FGZA 1M7RA 3D8FA 2W2WA 1NI2A 4HAYB 1WG7A 2RUKB 1FB8A 2QKMA 1V88A 2KCJA 2K2UA 2UVMA 2I1JA 2L2IA 3SV1A 3VOQA 1V61A 1XD4A 2Y8GA 2DTCA 4WJ7A 2DYNA 1DROA 1DDWA 5D3VA 3OANA 3AU5A 3VIAA 1XKEA 2M14A 1PMSA 4GN1A 1K5GB 2YRYA 4Z2NA 4D0NB 2LG1A 5CLLB 2EMSA 3A8QA 1ZM0A 2FJLA 2I5CA 2UZRA 3A8PA 1W1GA 1U5FA 4CHMA 1X11A 1WJ1A 2DHKA 2V76A 4EKUA 1FHWA 2YT1A 3QIJA 1N3HA 1XR0B 5C16A 5JHHA 2YF0A 5HE3A 3ODXA 3F5RA 3PP2A 3DXCA 3SUZA 3DXEA 2CY5A 4NY0A 3O96A 3TVVA 3PZDA 1QQGA 2ELAA 1I2HA 1WGUA 2H7DA 2BCJA 2I5FA 4KVGB 4XWXA 2W2XD 2RNRB 2Z0OA 2YT0A 3SNHA 1BWNA 3KRWA 2EJ8A 2DLWA 1KI1B 1U5EA 2DX5A 1ZC4B 2N23A 3PEGA 5JLJB 2ROVA 2D11A 5LOPB 5DH9B 5D3WA 2RGNB 1OY2A 1Z87A 3PVLA 3U8ZA 2YS3A 1P3RA 4L6EA 2P0FA 2OQBA 2NMBA 3ODOA 3QBVB 2D9XA 3TFMA 1H4RA 1XCGA 5J3YA 4ZRKA 4YL8A 2I1KA 1LW3A 1SGHA 1UEFA 3IVFA 4ZRJA 2IYBA 3PSCA 4F7GA 1W1HA 4GPTB 3U7DA 2MFQA 2Y8FA 1FAOA 1MPHA 1W1DA 2IFSA 4A6HA 3GYPA 2YVCA 4HDQA 4F7UP 3ULBA 4MY6A 2EMTA 1GG3A 1X1GA 1FOEA 2KUPA 5FI0A 5FI1A 4A6KA 4HAZB 1UPQA 1P5TA 3KY9A 2D4QA 4ZRIA 2JP2A 4WVFB 5GOWB 1M7EA 4HDOA 3F0WA 2PZ1A 1MK9B 3P7ZA 2ELBA 1MAIA 4F7HA 3D8EA 4CYEA 1EGXA 4TYZA 5C5BB 1GC7A 3KZ1A 5DHAB 1TQZA 1H10A 1RRPB 2H7EA 2UZSA 1X86A 2D9ZA 3BINA 2G35A 4IAPA 4EJNA 5KCVA 5HE2A 4IOYX 3TO1A 2VKIA 1MIZB 2Y7BA 1KZGA 2GCLA 4DX8A 2CY4A 1WI1A 4DBBA 3PVUA 2N0YA 1BTKA 1Y5OA 3FEHA 4BBKA 2J0MA 2RVBB 1OMWA 2W2XC 3GYOA 3ULCA 1GC6A 4C0AA 4HB3B 2D9YA 2ROZB 1KZ7A 2EC1A 3PVWA 1V5MA 1OQNA 4HAXB 3ZDTA 1UPRA 4IFSA 1UNQA 4HHVA 3MPXA 3M1IB 3ODWA 3TW1A 4MT7A 2HE7A 4K17A 1MIXA 4MK0A 2DHJA 4GZUA 2VRWB 1EF1A 5JP4A 3AU4A 1MKEA 3ML4A 2M38A 1DYNA 2LKOA 1TXDA 2Z0QA 2R09A 2MKRA 5C5BA 3HQCA 1BAKA 1DDMA 4KHAA 2MDXA 4HB2B 1AQCA 5D3XA 2CODA 1B55A 5L81A 5C79A 1X1FA 2LULA 2DX1A 1PLSA 5JHGA 1UNPA 2L1CA 2D9VA 4H8SA 5KQ4A 4K2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K5D B;  4GMV A;  2DKP A;  1ISN A;  4K81 A;  3FSS A;  4Y94 A;  3TCA A;  3ZVR A;  2RSG A;  4DXA B;  1WVH A;  5DIF B;  2GJY A;  3SYX A;  1DBH A;  3G9W A;  1IRS A;  4A5K A;  4DX9 0;  2MWN B;  2COA A;  2DKQ A;  2DHI A;  1Q67 A;  2GCJ A;  4WSF A;  2P0H A;  5HE0 A;  1RJ2 A;  1NU2 A;  2E2X A;  1V89 A;  3WYF B;  3HW2 B;  1XX0 A;  1QC6 A;  3NSU A;  1U29 A;  1PFJ A;  1AWE A;  1ZC3 B;  3QWM A;  2QKL A;  3UZT A;  2Q13 A;  5CLQ B;  4A6F A;  2R0D A;  1EAZ A;  1U27 A;  4GMX B;  4TKN A;  2ZPY A;  5LON B;  2HTH B;  1FHX A;  3KSY A;  1SHC A;  2RLO A;  4HAV B;  1BTN A;  2D10 A;  4KHB B;  4HB4 B;  3HK0 A;  5D27 A;  1U2B A;  3AJ4 A;  4HAU B;  2K2J A;  2LOZ A;  2J59 M;  1U5D A;  5DI9 B;  5HE1 A;  4EMO A;  1J0W A;  2K00 A;  2CAY A;  4Z2M B;  1FHO A;  1Y19 B;  2LYD A;  2NZ8 B;  4PQ0 A;  5J3Q A;  2X18 A;  2Z0P A;  1V5U A;  1NTV A;  2J0K A;  1LB1 A;  3LJU X;  1WJM A;  1WGQ A;  5C6R A;  1P6S A;  2OTX A;  4P7I A;  1NTY A;  4B6H A;  1ZVR A;  2J0J A;  3FM8 C;  1FGY A;  2P8V A;  5J3T A;  2YSZ A;  2XQN M;  4GXB A;  1U5G A;  5DHF B;  1MK7 B;  1I7A A;  3KRX A;  4A6F B;  3MDB C;  3SO6 A;  3WA0 A;  2COF A;  1V5P A;  3RCP A;  4YON A;  5KQ1 A;  4HAW B;  3D8D A;  2DN6 A;  3CXB B;  3V5W A;  2P0D A;  3N7C A;  3PG7 A;  2COC A;  1XOD A;  4PNK A;  2AL6 A;  3P6A A;  2YS1 A;  2DA0 A;  2ADZ A;  3BJI A;  4HB0 B;  3CIK A;  2CRF A;  1X05 A;  3X23 A;  2LOX A;  1DDV A;  4CHJ A;  2DYQ A;  1UNR A;  4NSW A;  3DXD A;  5EFX A;  1E5W A;  4KAX B;  2VSZ A;  2YS5 A;  1ZSQ A;  4HAT B;  2KGX B;  3T06 A;  2AEH A;  3A98 B;  1J19 A;  1EVH A;  5D3Y A;  2D9W A;  2DFK A;  2D2Q A;  2GS0 A;  4KHO A;  4K2P A;  1TJ6 A;  1FGZ A;  1M7R A;  3D8F A;  2W2W A;  1NI2 A;  4HAY B;  1WG7 A;  2RUK B;  1FB8 A;  2QKM A;  1V88 A;  2KCJ A;  2K2U A;  2UVM A;  2I1J A;  2L2I A;  3SV1 A;  3VOQ A;  1V61 A;  1XD4 A;  2Y8G A;  2DTC A;  4WJ7 A;  2DYN A;  1DRO A;  1DDW A;  5D3V A;  3OAN A;  3AU5 A;  3VIA A;  1XKE A;  2M14 A;  1PMS A;  4GN1 A;  1K5G B;  2YRY A;  4Z2N A;  4D0N B;  2LG1 A;  5CLL B;  2EMS A;  3A8Q A;  1ZM0 A;  2FJL A;  2I5C A;  2UZR A;  3A8P A;  1W1G A;  1U5F A;  4CHM A;  1X11 A;  1WJ1 A;  2DHK A;  2V76 A;  4EKU A;  1FHW A;  2YT1 A;  3QIJ A;  1N3H A;  1XR0 B;  5C16 A;  5JHH A;  2YF0 A;  5HE3 A;  3ODX A;  3F5R A;  3PP2 A;  3DXC A;  3SUZ A;  3DXE A;  2CY5 A;  4NY0 A;  3O96 A;  3TVV A;  3PZD A;  1QQG A;  2ELA A;  1I2H A;  1WGU A;  2H7D A;  2BCJ A;  2I5F A;  4KVG B;  4XWX A;  2W2X D;  2RNR B;  2Z0O A;  2YT0 A;  3SNH A;  1BWN A;  3KRW A;  2EJ8 A;  2DLW A;  1KI1 B;  1U5E A;  2DX5 A;  1ZC4 B;  2N23 A;  3PEG A;  5JLJ B;  2ROV A;  2D11 A;  5LOP B;  5DH9 B;  5D3W A;  2RGN B;  1OY2 A;  1Z87 A;  3PVL A;  3U8Z A;  2YS3 A;  1P3R A;  4L6E A;  2P0F A;  2OQB A;  2NMB A;  3ODO A;  3QBV B;  2D9X A;  3TFM A;  1H4R A;  1XCG A;  5J3Y A;  4ZRK A;  4YL8 A;  2I1K A;  1LW3 A;  1SGH A;  1UEF A;  3IVF A;  4ZRJ A;  2IYB A;  3PSC A;  4F7G A;  1W1H A;  4GPT B;  3U7D A;  2MFQ A;  2Y8F A;  1FAO A;  1MPH A;  1W1D A;  2IFS A;  4A6H A;  3GYP A;  2YVC A;  4HDQ A;  4F7U P;  3ULB A;  4MY6 A;  2EMT A;  1GG3 A;  1X1G A;  1FOE A;  2KUP A;  5FI0 A;  5FI1 A;  4A6K A;  4HAZ B;  1UPQ A;  1P5T A;  3KY9 A;  2D4Q A;  4ZRI A;  2JP2 A;  4WVF B;  5GOW B;  1M7E A;  4HDO A;  3F0W A;  2PZ1 A;  1MK9 B;  3P7Z A;  2ELB A;  1MAI A;  4F7H A;  3D8E A;  4CYE A;  1EGX A;  4TYZ A;  5C5B B;  1GC7 A;  3KZ1 A;  5DHA B;  1TQZ A;  1H10 A;  1RRP B;  2H7E A;  2UZS A;  1X86 A;  2D9Z A;  3BIN A;  2G35 A;  4IAP A;  4EJN A;  5KCV A;  5HE2 A;  4IOY X;  3TO1 A;  2VKI A;  1MIZ B;  2Y7B A;  1KZG A;  2GCL A;  4DX8 A;  2CY4 A;  1WI1 A;  4DBB A;  3PVU A;  2N0Y A;  1BTK A;  1Y5O A;  3FEH A;  4BBK A;  2J0M A;  2RVB B;  1OMW A;  2W2X C;  3GYO A;  3ULC A;  1GC6 A;  4C0A A;  4HB3 B;  2D9Y A;  2ROZ B;  1KZ7 A;  2EC1 A;  3PVW A;  1V5M A;  1OQN A;  4HAX B;  3ZDT A;  1UPR A;  4IFS A;  1UNQ A;  4HHV A;  3MPX A;  3M1I B;  3ODW A;  3TW1 A;  4MT7 A;  2HE7 A;  4K17 A;  1MIX A;  4MK0 A;  2DHJ A;  4GZU A;  2VRW B;  1EF1 A;  5JP4 A;  3AU4 A;  1MKE A;  3ML4 A;  2M38 A;  1DYN A;  2LKO A;  1TXD A;  2Z0Q A;  2R09 A;  2MKR A;  5C5B A;  3HQC A;  1BAK A;  1DDM A;  4KHA A;  2MDX A;  4HB2 B;  1AQC A;  5D3X A;  2COD A;  1B55 A;  5L81 A;  5C79 A;  1X1F A;  2LUL A;  2DX1 A;  1PLS A;  5JHG A;  1UNP A;  2L1C A;  2D9V A;  4H8S A;  5KQ4 A;  4K2O A; 
#chains in the Genus database with same CATH topology
 1K5D B;  4GMV A;  2DKP A;  1ISN A;  4K81 A;  3FSS A;  4Y94 A;  2Z4D A;  3TCA A;  3ZVR A;  2RSG A;  4DXA B;  1WVH A;  5DIF B;  2GJY A;  3SYX A;  1DBH A;  3G9W A;  1IRS A;  4A5K A;  4DX9 0;  2MWN B;  2COA A;  2DKQ A;  2DHI A;  1Q67 A;  2GCJ A;  4WSF A;  2P0H A;  5HE0 A;  1RJ2 A;  1NU2 A;  2E2X A;  1V89 A;  3WYF B;  3HW2 B;  1XX0 A;  1QC6 A;  3NSU A;  1U29 A;  1PFJ A;  1AWE A;  1ZC3 B;  3QWM A;  4GOU A;  2QKL A;  3UZT A;  2Q13 A;  5CLQ B;  2YT2 A;  4A6F A;  2R0D A;  1EAZ A;  2Z13 A;  1U27 A;  4GMX B;  4TKN A;  2ZPY A;  5LON B;  2HTH B;  2KR0 A;  1FHX A;  3KSY A;  1SHC A;  2RLO A;  4HAV B;  5I2M A;  1BTN A;  2D10 A;  4KHB B;  3NWD A;  4HB4 B;  3HK0 A;  5D27 A;  1U2B A;  3AJ4 A;  4HAU B;  2K2J A;  2LOZ A;  2J59 M;  1U5D A;  5DI9 B;  5HE1 A;  2NBV A;  4EMO A;  1J0W A;  2K00 A;  2CAY A;  4Z2M B;  1FHO A;  1Y19 B;  2LYD A;  2NZ8 B;  4PQ0 A;  3NW8 A;  5J3Q A;  2X18 A;  2Z0P A;  1V5U A;  1NTV A;  2J0K A;  2R2Y A;  1LB1 A;  3LJU X;  1WJM A;  1WGQ A;  5C6R A;  3HSA A;  1P6S A;  2OTX A;  4P7I A;  1NTY A;  4B6H A;  1ZVR A;  2J0J A;  3FM8 C;  1FGY A;  2P8V A;  4DIX A;  5J3T A;  2YSZ A;  3A58 A;  2XQN M;  4GXB A;  1U5G A;  5DHF B;  1MK7 B;  1I7A A;  3KRX A;  4A6F B;  3MDB C;  3SO6 A;  3WA0 A;  2COF A;  1V5P A;  2ZKM X;  3RCP A;  4QJ3 B;  4YON A;  5KQ1 A;  4HAW B;  4L1R A;  3D8D A;  2DN6 A;  2KUQ A;  3CXB B;  4OT1 A;  2P0D A;  3N7C A;  3PG7 A;  3V5W A;  3FVC A;  2COC A;  1XOD A;  4PNK A;  2AL6 A;  3P6A A;  2YS1 A;  3HIE A;  2DA0 A;  2ADZ A;  3BJI A;  4HB0 B;  3CIK A;  2CRF A;  1X05 A;  3X23 A;  2LOX A;  1DDV A;  4CHJ A;  2DYQ A;  1UNR A;  4NSW A;  3DXD A;  5EFX A;  1E5W A;  4KAX B;  2VSZ A;  2YS5 A;  1ZSQ A;  3B77 A;  4HAT B;  2KGX B;  3T06 A;  2AEH A;  3A98 B;  1J19 A;  1EVH A;  3NWF A;  4OSN A;  5D3Y A;  2D9W A;  2DFK A;  2D2Q A;  2GS0 A;  4KHO A;  4K2P A;  1TJ6 A;  1FGZ A;  1M7R A;  3D8F A;  2W2W A;  1NI2 A;  4HAY B;  1WG7 A;  2RUK B;  1FB8 A;  2QKM A;  1V88 A;  2KCJ A;  2K2U A;  2UVM A;  2I1J A;  2L2I A;  3SV1 A;  3VOQ A;  1V61 A;  1XD4 A;  2Y8G A;  2DTC A;  4WJ7 A;  2DYN A;  1DRO A;  1DDW A;  4QJ4 B;  5D3V A;  3OAN A;  3AU5 A;  3VIA A;  1XKE A;  2M14 A;  1PMS A;  4GN1 A;  1K5G B;  2YRY A;  4Z2N A;  4D0N B;  2LG1 A;  5CLL B;  2EMS A;  3A8Q A;  1ZM0 A;  2K49 A;  2FJL A;  2I5C A;  2UZR A;  3A8P A;  1W1G A;  1U5F A;  4CHM A;  1X11 A;  3OHM B;  1WJ1 A;  2DHK A;  5LG4 B;  2V76 A;  4EKU A;  1FHW A;  2YT1 A;  3QIJ A;  4GNK B;  1N3H A;  1XR0 B;  5C16 A;  5JHH A;  2YF0 A;  5HE3 A;  3ODX A;  2KIE A;  3F5R A;  5IRS A;  3PP2 A;  1MI1 A;  3DXC A;  3SUZ A;  3DXE A;  2CY5 A;  4NY0 A;  3O96 A;  3TVV A;  3PZD A;  1QQG A;  2ELA A;  2GUM A;  1I2H A;  1WGU A;  2H7D A;  2BCJ A;  2I5F A;  4KVG B;  4XWX A;  2W2X D;  2RNR B;  2Z0O A;  2YT0 A;  3SNH A;  1BWN A;  3KRW A;  2EJ8 A;  2DLW A;  1KI1 B;  1U5E A;  2DX5 A;  1ZC4 B;  2K8E A;  2N23 A;  2KIG A;  3PEG A;  5JLJ B;  2ROV A;  4QXA B;  2D11 A;  5LOP B;  5DH9 B;  5D3W A;  2RGN B;  3NWA A;  1OY2 A;  1Z87 A;  3PVL A;  3U8Z A;  2YS3 A;  1P3R A;  4L6E A;  2P0F A;  2OQB A;  2NMB A;  3ODO A;  3QBV B;  2D9X A;  3TFM A;  1H4R A;  1XCG A;  5J3Y A;  4ZRK A;  4YL8 A;  2I1K A;  1LW3 A;  1SGH A;  1UEF A;  3IVF A;  4ZRJ A;  2IYB A;  3PSC A;  4F7G A;  1W1H A;  4GPT B;  3U7D A;  2MFQ A;  2Y8F A;  1FAO A;  1MPH A;  1W1D A;  2IFS A;  5M4Y B;  4A6H A;  3GYP A;  2YVC A;  4HDQ A;  4F7U P;  3ULB A;  4MY6 A;  4CSQ A;  2EMT A;  1GG3 A;  1X1G A;  1FOE A;  2KUP A;  5FI0 A;  5FI1 A;  4A6K A;  4HAZ B;  1UPQ A;  1P5T A;  3KY9 A;  2D4Q A;  4ZRI A;  2JP2 A;  4WVF B;  4D6W A;  5GOW B;  1M7E A;  4HDO A;  3F0W A;  2PZ1 A;  1MK9 B;  3P7Z A;  2ELB A;  1MAI A;  2RRF A;  4F7H A;  3D8E A;  4CYE A;  1EGX A;  4TYZ A;  5C5B B;  1GC7 A;  3KZ1 A;  5DHA B;  1TQZ A;  2Z59 A;  1H10 A;  1RRP B;  2H7E A;  2UZS A;  1X86 A;  2D9Z A;  2FJU B;  3BIN A;  2G35 A;  2Z14 A;  4IAP A;  4EJN A;  5KCV A;  5HE2 A;  4IOY X;  3TO1 A;  2VKI A;  1MIZ B;  2Y7B A;  1KZG A;  2GCL A;  4DX8 A;  2CY4 A;  1T77 A;  1WI1 A;  4DBB A;  3PVU A;  2N0Y A;  1BTK A;  1Y5O A;  3FEH A;  4BBK A;  2J0M A;  5I2S A;  3U12 A;  2RVB B;  3DCX A;  1OMW A;  2W2X C;  3GYO A;  3ULC A;  1GC6 A;  4C0A A;  4HB3 B;  2D9Y A;  2ROZ B;  1KZ7 A;  2EC1 A;  3PVW A;  1V5M A;  1OQN A;  1ZYI A;  4HAX B;  3ZDT A;  1UPR A;  4IFS A;  1UNQ A;  4HHV A;  4HSI A;  3MPX A;  3M1I B;  3ODW A;  3TW1 A;  4MT7 A;  2HE7 A;  4K17 A;  1MIX A;  4MK0 A;  2DHJ A;  4GZU A;  2VRW B;  1EF1 A;  5JP4 A;  3AU4 A;  1MKE A;  3ML4 A;  2M38 A;  4QJ5 B;  1DYN A;  2LKO A;  1TXD A;  2Z0Q A;  2R09 A;  2MKR A;  5C5B A;  3HQC A;  1BAK A;  1DDM A;  4KHA A;  2MDX A;  4HB2 B;  1AQC A;  5D3X A;  2COD A;  1B55 A;  5L81 A;  5C79 A;  1X1F A;  2LUL A;  2DX1 A;  1PLS A;  5JHG A;  1UNP A;  2L1C A;  2D9V A;  4KHB A;  4H8S A;  5KQ4 A;  4K2O A; 
#chains in the Genus database with same CATH homology
 1K5D B;  4GMV A;  2DKP A;  1ISN A;  4K81 A;  3FSS A;  4Y94 A;  3TCA A;  3ZVR A;  2RSG A;  4DXA B;  1WVH A;  5DIF B;  2GJY A;  3SYX A;  1DBH A;  3G9W A;  1IRS A;  4A5K A;  4DX9 0;  2MWN B;  2COA A;  2DKQ A;  2DHI A;  1Q67 A;  2GCJ A;  4WSF A;  2P0H A;  5HE0 A;  1RJ2 A;  1NU2 A;  2E2X A;  1V89 A;  3WYF B;  3HW2 B;  1XX0 A;  1QC6 A;  3NSU A;  1U29 A;  1PFJ A;  1AWE A;  1ZC3 B;  3QWM A;  2QKL A;  3UZT A;  2Q13 A;  5CLQ B;  4A6F A;  2R0D A;  1EAZ A;  1U27 A;  4GMX B;  4TKN A;  2ZPY A;  5LON B;  2HTH B;  1FHX A;  3KSY A;  1SHC A;  2RLO A;  4HAV B;  1BTN A;  2D10 A;  4KHB B;  4HB4 B;  3HK0 A;  5D27 A;  1U2B A;  3AJ4 A;  4HAU B;  2K2J A;  2LOZ A;  2J59 M;  1U5D A;  5DI9 B;  5HE1 A;  4EMO A;  1J0W A;  2K00 A;  2CAY A;  4Z2M B;  1FHO A;  1Y19 B;  2LYD A;  2NZ8 B;  4PQ0 A;  5J3Q A;  2X18 A;  2Z0P A;  1V5U A;  1NTV A;  2J0K A;  1LB1 A;  3LJU X;  1WJM A;  1WGQ A;  5C6R A;  1P6S A;  2OTX A;  4P7I A;  1NTY A;  4B6H A;  1ZVR A;  2J0J A;  3FM8 C;  1FGY A;  2P8V A;  5J3T A;  2YSZ A;  2XQN M;  4GXB A;  1U5G A;  5DHF B;  1MK7 B;  1I7A A;  3KRX A;  4A6F B;  3MDB C;  3SO6 A;  3WA0 A;  2COF A;  1V5P A;  3RCP A;  4YON A;  5KQ1 A;  4HAW B;  3D8D A;  2DN6 A;  3CXB B;  3V5W A;  2P0D A;  3N7C A;  3PG7 A;  2COC A;  1XOD A;  4PNK A;  2AL6 A;  3P6A A;  2YS1 A;  2DA0 A;  2ADZ A;  3BJI A;  4HB0 B;  3CIK A;  2CRF A;  1X05 A;  3X23 A;  2LOX A;  1DDV A;  4CHJ A;  2DYQ A;  1UNR A;  4NSW A;  3DXD A;  5EFX A;  1E5W A;  4KAX B;  2VSZ A;  2YS5 A;  1ZSQ A;  4HAT B;  2KGX B;  3T06 A;  2AEH A;  3A98 B;  1J19 A;  1EVH A;  5D3Y A;  2D9W A;  2DFK A;  2D2Q A;  2GS0 A;  4KHO A;  4K2P A;  1TJ6 A;  1FGZ A;  1M7R A;  3D8F A;  2W2W A;  1NI2 A;  4HAY B;  1WG7 A;  2RUK B;  1FB8 A;  2QKM A;  1V88 A;  2KCJ A;  2K2U A;  2UVM A;  2I1J A;  2L2I A;  3SV1 A;  3VOQ A;  1V61 A;  1XD4 A;  2Y8G A;  2DTC A;  4WJ7 A;  2DYN A;  1DRO A;  1DDW A;  5D3V A;  3OAN A;  3AU5 A;  3VIA A;  1XKE A;  2M14 A;  1PMS A;  4GN1 A;  1K5G B;  2YRY A;  4Z2N A;  4D0N B;  2LG1 A;  5CLL B;  2EMS A;  3A8Q A;  1ZM0 A;  2FJL A;  2I5C A;  2UZR A;  3A8P A;  1W1G A;  1U5F A;  4CHM A;  1X11 A;  1WJ1 A;  2DHK A;  2V76 A;  4EKU A;  1FHW A;  2YT1 A;  3QIJ A;  1N3H A;  1XR0 B;  5C16 A;  5JHH A;  2YF0 A;  5HE3 A;  3ODX A;  3F5R A;  3PP2 A;  3DXC A;  3SUZ A;  3DXE A;  2CY5 A;  4NY0 A;  3O96 A;  3TVV A;  3PZD A;  1QQG A;  2ELA A;  1I2H A;  1WGU A;  2H7D A;  2BCJ A;  2I5F A;  4KVG B;  4XWX A;  2W2X D;  2RNR B;  2Z0O A;  2YT0 A;  3SNH A;  1BWN A;  3KRW A;  2EJ8 A;  2DLW A;  1KI1 B;  1U5E A;  2DX5 A;  1ZC4 B;  2N23 A;  3PEG A;  5JLJ B;  2ROV A;  2D11 A;  5LOP B;  5DH9 B;  5D3W A;  2RGN B;  1OY2 A;  1Z87 A;  3PVL A;  3U8Z A;  2YS3 A;  1P3R A;  4L6E A;  2P0F A;  2OQB A;  2NMB A;  3ODO A;  3QBV B;  2D9X A;  3TFM A;  1H4R A;  1XCG A;  5J3Y A;  4ZRK A;  4YL8 A;  2I1K A;  1LW3 A;  1SGH A;  1UEF A;  3IVF A;  4ZRJ A;  2IYB A;  3PSC A;  4F7G A;  1W1H A;  4GPT B;  3U7D A;  2MFQ A;  2Y8F A;  1FAO A;  1MPH A;  1W1D A;  2IFS A;  4A6H A;  3GYP A;  2YVC A;  4HDQ A;  4F7U P;  3ULB A;  4MY6 A;  2EMT A;  1GG3 A;  1X1G A;  1FOE A;  2KUP A;  5FI0 A;  5FI1 A;  4A6K A;  4HAZ B;  1UPQ A;  1P5T A;  3KY9 A;  2D4Q A;  4ZRI A;  2JP2 A;  4WVF B;  5GOW B;  1M7E A;  4HDO A;  3F0W A;  2PZ1 A;  1MK9 B;  3P7Z A;  2ELB A;  1MAI A;  4F7H A;  3D8E A;  4CYE A;  1EGX A;  4TYZ A;  5C5B B;  1GC7 A;  3KZ1 A;  5DHA B;  1TQZ A;  1H10 A;  1RRP B;  2H7E A;  2UZS A;  1X86 A;  2D9Z A;  3BIN A;  2G35 A;  4IAP A;  4EJN A;  5KCV A;  5HE2 A;  4IOY X;  3TO1 A;  2VKI A;  1MIZ B;  2Y7B A;  1KZG A;  2GCL A;  4DX8 A;  2CY4 A;  1WI1 A;  4DBB A;  3PVU A;  2N0Y A;  1BTK A;  1Y5O A;  3FEH A;  4BBK A;  2J0M A;  2RVB B;  1OMW A;  2W2X C;  3GYO A;  3ULC A;  1GC6 A;  4C0A A;  4HB3 B;  2D9Y A;  2ROZ B;  1KZ7 A;  2EC1 A;  3PVW A;  1V5M A;  1OQN A;  4HAX B;  3ZDT A;  1UPR A;  4IFS A;  1UNQ A;  4HHV A;  3MPX A;  3M1I B;  3ODW A;  3TW1 A;  4MT7 A;  2HE7 A;  4K17 A;  1MIX A;  4MK0 A;  2DHJ A;  4GZU A;  2VRW B;  1EF1 A;  5JP4 A;  3AU4 A;  1MKE A;  3ML4 A;  2M38 A;  1DYN A;  2LKO A;  1TXD A;  2Z0Q A;  2R09 A;  2MKR A;  5C5B A;  3HQC A;  1BAK A;  1DDM A;  4KHA A;  2MDX A;  4HB2 B;  1AQC A;  5D3X A;  2COD A;  1B55 A;  5L81 A;  5C79 A;  1X1F A;  2LUL A;  2DX1 A;  1PLS A;  5JHG A;  1UNP A;  2L1C A;  2D9V A;  4H8S A;  5KQ4 A;  4K2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...