5C6RA

Crystal structure of ph domain of asap1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
110
structure length
110
Chain Sequence
QLQGNKEYGSEKKGFLLKKSDGIRKVWQRRKCAVKNGILTISHATSNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYIAWISVLTNSKEEALTMAFRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Arf-GAP
publication title Molecular Basis for Cooperative Binding of Anionic Phospholipids to the PH Domain of the Arf GAP ASAP1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 28
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5c6rA00
3N7CA 2D9VA 1U5GA 2NZ8B 4B6HA 3LJUX 4L6EA 3G9WA 2W2XC 1UNRA 3U8ZA 4A6FA 1X11A 3V5WA 2E2XA 2YVCA 1ZSQA 1XODA 2I1JA 2GCLA 1X86A 3A8QA 4HB4B 1ISNA 2PZ1A 2UVMA 2D4QA 2Z0PA 3AU5A 3WA0A 1TXDA 2DKQA 4HAVB 4IFSA 1RJ2A 4KHOA 4CHMA 1MIZB 1XKEA 4HB0B 1ZM0A 4MY6A 3PVWA 1FGYA 4MT7A 3OANA 2QKMA 1NTYA 3TO1A 2Z0QA 3FEHA 2RVBB 4H8SA 2H7DA 2N23A 3TCAA 4KHBB 1PMSA 2MFQA 2DHKA 1XX0A 2J0MA 1W1GA 1UEFA 4CYEA 5HE1A 2D9ZA 2J0JA 1MK7B 1N3HA 1WJ1A 1MAIA 1XCGA 3MDBC 5JLJB 1WG7A 1PLSA 4GN1A 3BJIA 1U5EA 2KCJA 1V5UA 2K2UA 4CHJA 2EMTA 3TFMA 2I5FA 1BWNA 2JP2A 4F7HA 5HE0A 2HE7A 1OMWA 2RNRB 1RRPB 1U27A 4HHVA 4DBBA 2W2WA 1NTVA 5DH9B 3M1IB 4DXAB 3PSCA 4F7GA 1KI1B 1BTKA 2LKOA 1K5DB 2I1KA 5C5BA 3MPXA 5LONB 1DBHA 3GYPA 3TW1A 2ROVA 3FSSA 4GMXB 2CY5A 4EJNA 5L81A 5LOPB 1P5TA 2D9XA 1QQGA 1J0WA 1XR0B 2UZRA 2CAYA 3SNHA 1V5MA 2D10A 4IOYX 1K5GB 4NSWA 1IRSA 1V5PA 2ZPYA 2KUPA 3QWMA 2X18A 4K17A 2LG1A 4ZRIA 3RCPA 3A8PA 2BCJA 1DDVA 2DHJA 1WI1A 5C5BB 4HB2B 5CLLB 4GPTB 3PP2A 4HDOA 3NSUA 3QIJA 3ODWA 2OTXA 2W2XD 5DHAB 2N0YA 3VOQA 4XWXA 4D0NB 3F0WA 3KY9A 4HAUB 4EKUA 5C79A 2EJ8A 2ROZB 2DN6A 2DFKA 4HAXB 4YONA 3ODOA 1V88A 2COCA 1Q67A 3TVVA 2VSZA 2YS3A 4WSFA 2VRWB 1W1HA 4Z2NA 5JP4A 2RUKB 2DTCA 3ZDTA 2L1CA 1ZVRA 4GXBA 1X1GA 3WYFB 2KGXB 1MIXA 1I7AA 3HK0A 4HAYB 1U2BA 2EC1A 4HATB 4PQ0A 2Z0OA 5KQ1A 1WVHA 4F7UP 1LB1A 2GJYA 3ML4A 2P8VA 2Y8FA 3KSYA 5EFXA 2LOZA 1BTNA 3U7DA 1TQZA 1WGUA 1UPRA 2IFSA 2MKRA 5DHFB 2LYDA 5J3YA 1M7RA 5C6RA 3P7ZA 4DX8A 2D9WA 3KRWA 1H4RA 2DKPA 1U5DA 3F5RA 2LOXA 4KHAA 1SHCA 2D11A 1J19A 2Q13A 4MK0A 1GC7A 3BINA 2VKIA 3DXCA 4A6HA 5D3YA 2RSGA 3PVUA 2CODA 3PZDA 3SUZA 1U5FA 4TYZA 1SGHA 1UNQA 2DYNA 5KCVA 3KZ1A 2J0KA 5HE2A 1XD4A 1P3RA 1P6SA 3FM8C 3D8EA 1FAOA 2ELBA 1Y5OA 2YS5A 2YRYA 2DA0A 1BAKA 1DDMA 5FI0A 1GC6A 3PEGA 2ELAA 2FJLA 2DYQA 2NMBA 1DYNA 1OQNA 4C0AA 2UZSA 1AQCA 5HE3A 5J3QA 3ULBA 4WJ7A 3SO6A 3P6AA 5C16A 1EF1A 5D3VA 4K2OA 2YF0A 1OY2A 2I5CA 5D27A 1M7EA 1I2HA 1X1FA 5CLQB 2OQBA 3CXBB 1V61A 1GG3A 5J3TA 1FHWA 2CY4A 3GYOA 4ZRKA 2R0DA 3PVLA 5KQ4A 1Z87A 1H10A 4HAWB 1ZC4B 1DROA 2YS1A 4NY0A 2CRFA 2G35A 1LW3A 3X23A 4P7IA 2MDXA 5DI9B 3AJ4A 3D8FA 4K81A 1FOEA 2GS0A 4TKNA 2D2QA 2P0FA 4ZRJA 1AWEA 2IYBA 5D3XA 1FHOA 2MWNB 2HTHB 1EVHA 2YT1A 3IVFA 4PNKA 2AL6A 3ZVRA 3HQCA 1UPQA 3VIAA 3O96A 2COFA 4A6FB 3AU4A 4BBKA 3QBVB 3KRXA 5DIFB 4HB3B 2ADZA 1DDWA 1PFJA 5FI1A 2H7EA 2YSZA 2K00A 5D3WA 5JHGA 1FB8A 1FHXA 2GCJA 3D8DA 3SYXA 3SV1A 1FGZA 3PG7A 4GZUA 1EAZA 4HAZB 2RGNB 1TJ6A 4A6KA 1U29A 1KZGA 1NU2A 2M14A 3DXEA 4GMVA 1WGQA 1W1DA 1Y19B 4IAPA 1EGXA 4Z2MB 2DHIA 2V76A 4DX90 4Y94A 2DX1A 2Y7BA 4WVFB 1ZC3B 4HDQA 4A5KA 1MK9B 3T06A 4YL8A 2RLOA 2DLWA 2K2JA 3A98B 1UNPA 3HW2B 1NI2A 2AEHA 5JHHA 2LULA 2R09A 2DX5A 2J59M 3UZTA 1KZ7A 2COAA 2Y8GA 1V89A 2P0HA 1B55A 3ODXA 1MPHA 2XQNM 2D9YA 5GOWB 3DXDA 2L2IA 2P0DA 4K2PA 4KVGB 3CIKA 1X05A 2EMSA 1E5WA 2QKLA 4EMOA 1QC6A 4KAXB 3ULCA 2M38A 1MKEA 1WJMA 2YT0A
chains in the Genus database with same CATH superfamily
3N7CA 2D9VA 1U5GA 2NZ8B 4B6HA 3LJUX 4L6EA 3B77A 3G9WA 2W2XC 1UNRA 3U8ZA 4A6FA 1X11A 3V5WA 2E2XA 2YVCA 5LG4B 1ZSQA 1XODA 2I1JA 2GCLA 3NWFA 1X86A 3A8QA 4KHBA 4QJ4B 4HB4B 4OT1A 1ISNA 2PZ1A 2UVMA 2D4QA 2Z0PA 3AU5A 3WA0A 5IRSA 1TXDA 2DKQA 4HAVB 4IFSA 1RJ2A 4KHOA 4CHMA 1MIZB 1XKEA 2RRFA 4HB0B 1ZM0A 4MY6A 3PVWA 2ZKMX 1FGYA 4MT7A 3OANA 2QKMA 1NTYA 3TO1A 2Z0QA 3NWDA 2K49A 3FVCA 3FEHA 2RVBB 4H8SA 2H7DA 1MI1A 2N23A 3TCAA 4KHBB 1PMSA 2MFQA 2DHKA 1XX0A 2J0MA 2K8EA 3U12A 1W1GA 1UEFA 4CYEA 5HE1A 2D9ZA 2Z4DA 2J0JA 1MK7B 2KR0A 1N3HA 1WJ1A 4GNKB 1MAIA 1XCGA 3MDBC 5JLJB 1WG7A 1PLSA 4GN1A 3BJIA 1U5EA 2KCJA 1V5UA 2K2UA 4CHJA 1ZYIA 2EMTA 3TFMA 2I5FA 1BWNA 2JP2A 4F7HA 5HE0A 2HE7A 1OMWA 2RNRB 1RRPB 1U27A 4HHVA 4DBBA 2W2WA 1NTVA 5DH9B 3M1IB 4DXAB 3PSCA 4F7GA 1KI1B 1BTKA 2LKOA 1K5DB 2I1KA 5C5BA 3MPXA 5LONB 1DBHA 3GYPA 3TW1A 2ROVA 3FSSA 4GMXB 2CY5A 4EJNA 5L81A 5LOPB 1P5TA 2D9XA 1QQGA 1J0WA 1XR0B 2UZRA 2CAYA 3SNHA 1V5MA 2D10A 4HSIA 4IOYX 1K5GB 4NSWA 1IRSA 1V5PA 2ZPYA 2KUPA 3QWMA 2X18A 3DCXA 4K17A 2LG1A 4ZRIA 3RCPA 3A8PA 2BCJA 1DDVA 2DHJA 1WI1A 4QXAB 5C5BB 2KIEA 2FJUB 4HB2B 5CLLB 4GPTB 1T77A 3PP2A 4HDOA 3NSUA 3QIJA 5I2MA 3ODWA 2OTXA 2W2XD 5DHAB 2N0YA 3VOQA 4XWXA 4D0NB 3F0WA 3KY9A 4HAUB 4EKUA 5C79A 2EJ8A 2ROZB 2DN6A 2DFKA 4HAXB 4YONA 3ODOA 1V88A 4D6WA 2COCA 1Q67A 3TVVA 2VSZA 2YS3A 4WSFA 2VRWB 1W1HA 4Z2NA 5JP4A 2RUKB 2DTCA 3ZDTA 2L1CA 1ZVRA 4GXBA 1X1GA 3WYFB 4OSNA 2KGXB 1MIXA 1I7AA 3HK0A 3HSAA 4HAYB 1U2BA 2EC1A 4HATB 4PQ0A 2Z0OA 5KQ1A 1WVHA 4F7UP 1LB1A 2GJYA 3ML4A 2P8VA 2Y8FA 3KSYA 5EFXA 2LOZA 2NBVA 5M4YB 1BTNA 3U7DA 1TQZA 1WGUA 1UPRA 4DIXA 2IFSA 2MKRA 5DHFB 2LYDA 5J3YA 1M7RA 5C6RA 3P7ZA 4DX8A 2D9WA 3KRWA 1H4RA 2DKPA 4L1RA 1U5DA 3F5RA 2LOXA 4KHAA 1SHCA 2D11A 3A58A 1J19A 2Q13A 4MK0A 1GC7A 3BINA 2VKIA 3NWAA 3DXCA 3NW8A 4A6HA 5D3YA 2RSGA 3PVUA 2CODA 3PZDA 3SUZA 1U5FA 4TYZA 1SGHA 1UNQA 2DYNA 5KCVA 3KZ1A 2J0KA 5HE2A 1XD4A 1P3RA 1P6SA 3FM8C 3HIEA 3D8EA 1FAOA 2ELBA 1Y5OA 2YS5A 2YRYA 2DA0A 1BAKA 1DDMA 5FI0A 1GC6A 2Z59A 3PEGA 2ELAA 2FJLA 2DYQA 2NMBA 1DYNA 1OQNA 4C0AA 2UZSA 1AQCA 5HE3A 5J3QA 3ULBA 4WJ7A 3SO6A 3P6AA 5C16A 1EF1A 2YT2A 5D3VA 4K2OA 2YF0A 1OY2A 2I5CA 5D27A 1M7EA 1I2HA 1X1FA 4QJ3B 5CLQB 2OQBA 5I2SA 3CXBB 1V61A 1GG3A 5J3TA 1FHWA 2CY4A 3GYOA 4ZRKA 2R0DA 3PVLA 5KQ4A 1Z87A 1H10A 4HAWB 1ZC4B 2KUQA 1DROA 2YS1A 4NY0A 2CRFA 2G35A 1LW3A 3X23A 4P7IA 2MDXA 5DI9B 3AJ4A 3D8FA 4K81A 4GOUA 1FOEA 2GS0A 4TKNA 2D2QA 2P0FA 4ZRJA 1AWEA 2IYBA 5D3XA 1FHOA 2MWNB 2HTHB 1EVHA 2YT1A 3IVFA 4PNKA 2AL6A 3ZVRA 3HQCA 1UPQA 3VIAA 3O96A 2COFA 4A6FB 3AU4A 4BBKA 3QBVB 3KRXA 5DIFB 4HB3B 2ADZA 1DDWA 1PFJA 2Z14A 5FI1A 2H7EA 2YSZA 2K00A 5D3WA 5JHGA 1FB8A 1FHXA 2GCJA 3D8DA 3SYXA 3SV1A 1FGZA 3PG7A 4GZUA 1EAZA 4HAZB 2RGNB 1TJ6A 4A6KA 1U29A 1KZGA 1NU2A 2M14A 3DXEA 4GMVA 1WGQA 1W1DA 1Y19B 4IAPA 2R2YA 1EGXA 4Z2MB 2DHIA 2V76A 4QJ5B 4DX90 4Y94A 2DX1A 2Y7BA 4WVFB 1ZC3B 4HDQA 4A5KA 1MK9B 3T06A 4YL8A 2RLOA 2DLWA 2K2JA 4CSQA 2Z13A 3A98B 1UNPA 3HW2B 1NI2A 2AEHA 2GUMA 5JHHA 2LULA 2R09A 2DX5A 2J59M 3UZTA 1KZ7A 2COAA 2Y8GA 1V89A 2P0HA 1B55A 3ODXA 1MPHA 2XQNM 2D9YA 2KIGA 5GOWB 3DXDA 2L2IA 2P0DA 4K2PA 4KVGB 3CIKA 1X05A 2EMSA 1E5WA 2QKLA 4EMOA 1QC6A 4KAXB 3ULCA 2M38A 3OHMB 1MKEA 1WJMA 2YT0A
chains in the Genus database with same CATH topology
3N7CA 2D9VA 1U5GA 2NZ8B 4B6HA 3LJUX 4L6EA 3G9WA 2W2XC 1UNRA 3U8ZA 4A6FA 1X11A 3V5WA 2E2XA 2YVCA 1ZSQA 1XODA 2I1JA 2GCLA 1X86A 3A8QA 4HB4B 1ISNA 2PZ1A 2UVMA 2D4QA 2Z0PA 3AU5A 3WA0A 1TXDA 2DKQA 4HAVB 4IFSA 1RJ2A 4KHOA 4CHMA 1MIZB 1XKEA 4HB0B 1ZM0A 4MY6A 3PVWA 1FGYA 4MT7A 3OANA 2QKMA 1NTYA 3TO1A 2Z0QA 3FEHA 2RVBB 4H8SA 2H7DA 2N23A 3TCAA 4KHBB 1PMSA 2MFQA 2DHKA 1XX0A 2J0MA 1W1GA 1UEFA 4CYEA 5HE1A 2D9ZA 2J0JA 1MK7B 1N3HA 1WJ1A 1MAIA 1XCGA 3MDBC 5JLJB 1WG7A 1PLSA 4GN1A 3BJIA 1U5EA 2KCJA 1V5UA 2K2UA 4CHJA 2EMTA 3TFMA 2I5FA 1BWNA 2JP2A 4F7HA 5HE0A 2HE7A 1OMWA 2RNRB 1RRPB 1U27A 4HHVA 4DBBA 2W2WA 1NTVA 5DH9B 3M1IB 4DXAB 3PSCA 4F7GA 1KI1B 1BTKA 2LKOA 1K5DB 2I1KA 5C5BA 3MPXA 5LONB 1DBHA 3GYPA 3TW1A 2ROVA 3FSSA 4GMXB 2CY5A 4EJNA 5L81A 5LOPB 1P5TA 2D9XA 1QQGA 1J0WA 1XR0B 2UZRA 2CAYA 3SNHA 1V5MA 2D10A 4IOYX 1K5GB 4NSWA 1IRSA 1V5PA 2ZPYA 2KUPA 3QWMA 2X18A 4K17A 2LG1A 4ZRIA 3RCPA 3A8PA 2BCJA 1DDVA 2DHJA 1WI1A 5C5BB 4HB2B 5CLLB 4GPTB 3PP2A 4HDOA 3NSUA 3QIJA 3ODWA 2OTXA 2W2XD 5DHAB 2N0YA 3VOQA 4XWXA 4D0NB 3F0WA 3KY9A 4HAUB 4EKUA 5C79A 2EJ8A 2ROZB 2DN6A 2DFKA 4HAXB 4YONA 3ODOA 1V88A 2COCA 1Q67A 3TVVA 2VSZA 2YS3A 4WSFA 2VRWB 1W1HA 4Z2NA 5JP4A 2RUKB 2DTCA 3ZDTA 2L1CA 1ZVRA 4GXBA 1X1GA 3WYFB 2KGXB 1MIXA 1I7AA 3HK0A 4HAYB 1U2BA 2EC1A 4HATB 4PQ0A 2Z0OA 5KQ1A 1WVHA 4F7UP 1LB1A 2GJYA 3ML4A 2P8VA 2Y8FA 3KSYA 5EFXA 2LOZA 1BTNA 3U7DA 1TQZA 1WGUA 1UPRA 2IFSA 2MKRA 5DHFB 2LYDA 5J3YA 1M7RA 5C6RA 3P7ZA 4DX8A 2D9WA 3KRWA 1H4RA 2DKPA 1U5DA 3F5RA 2LOXA 4KHAA 1SHCA 2D11A 1J19A 2Q13A 4MK0A 1GC7A 3BINA 2VKIA 3DXCA 4A6HA 5D3YA 2RSGA 3PVUA 2CODA 3PZDA 3SUZA 1U5FA 4TYZA 1SGHA 1UNQA 2DYNA 5KCVA 3KZ1A 2J0KA 5HE2A 1XD4A 1P3RA 1P6SA 3FM8C 3D8EA 1FAOA 2ELBA 1Y5OA 2YS5A 2YRYA 2DA0A 1BAKA 1DDMA 5FI0A 1GC6A 3PEGA 2ELAA 2FJLA 2DYQA 2NMBA 1DYNA 1OQNA 4C0AA 2UZSA 1AQCA 5HE3A 5J3QA 3ULBA 4WJ7A 3SO6A 3P6AA 5C16A 1EF1A 5D3VA 4K2OA 2YF0A 1OY2A 2I5CA 5D27A 1M7EA 1I2HA 1X1FA 5CLQB 2OQBA 3CXBB 1V61A 1GG3A 5J3TA 1FHWA 2CY4A 3GYOA 4ZRKA 2R0DA 3PVLA 5KQ4A 1Z87A 1H10A 4HAWB 1ZC4B 1DROA 2YS1A 4NY0A 2CRFA 2G35A 1LW3A 3X23A 4P7IA 2MDXA 5DI9B 3AJ4A 3D8FA 4K81A 1FOEA 2GS0A 4TKNA 2D2QA 2P0FA 4ZRJA 1AWEA 2IYBA 5D3XA 1FHOA 2MWNB 2HTHB 1EVHA 2YT1A 3IVFA 4PNKA 2AL6A 3ZVRA 3HQCA 1UPQA 3VIAA 3O96A 2COFA 4A6FB 3AU4A 4BBKA 3QBVB 3KRXA 5DIFB 4HB3B 2ADZA 1DDWA 1PFJA 5FI1A 2H7EA 2YSZA 2K00A 5D3WA 5JHGA 1FB8A 1FHXA 2GCJA 3D8DA 3SYXA 3SV1A 1FGZA 3PG7A 4GZUA 1EAZA 4HAZB 2RGNB 1TJ6A 4A6KA 1U29A 1KZGA 1NU2A 2M14A 3DXEA 4GMVA 1WGQA 1W1DA 1Y19B 4IAPA 1EGXA 4Z2MB 2DHIA 2V76A 4DX90 4Y94A 2DX1A 2Y7BA 4WVFB 1ZC3B 4HDQA 4A5KA 1MK9B 3T06A 4YL8A 2RLOA 2DLWA 2K2JA 3A98B 1UNPA 3HW2B 1NI2A 2AEHA 5JHHA 2LULA 2R09A 2DX5A 2J59M 3UZTA 1KZ7A 2COAA 2Y8GA 1V89A 2P0HA 1B55A 3ODXA 1MPHA 2XQNM 2D9YA 5GOWB 3DXDA 2L2IA 2P0DA 4K2PA 4KVGB 3CIKA 1X05A 2EMSA 1E5WA 2QKLA 4EMOA 1QC6A 4KAXB 3ULCA 2M38A 1MKEA 1WJMA 2YT0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N7C A;  2D9V A;  1U5G A;  2NZ8 B;  4B6H A;  3LJU X;  4L6E A;  3G9W A;  2W2X C;  1UNR A;  3U8Z A;  4A6F A;  1X11 A;  3V5W A;  2E2X A;  2YVC A;  1ZSQ A;  1XOD A;  2I1J A;  2GCL A;  1X86 A;  3A8Q A;  4HB4 B;  1ISN A;  2PZ1 A;  2UVM A;  2D4Q A;  2Z0P A;  3AU5 A;  3WA0 A;  1TXD A;  2DKQ A;  4HAV B;  4IFS A;  1RJ2 A;  4KHO A;  4CHM A;  1MIZ B;  1XKE A;  4HB0 B;  1ZM0 A;  4MY6 A;  3PVW A;  1FGY A;  4MT7 A;  3OAN A;  2QKM A;  1NTY A;  3TO1 A;  2Z0Q A;  3FEH A;  2RVB B;  4H8S A;  2H7D A;  2N23 A;  3TCA A;  4KHB B;  1PMS A;  2MFQ A;  2DHK A;  1XX0 A;  2J0M A;  1W1G A;  1UEF A;  4CYE A;  5HE1 A;  2D9Z A;  2J0J A;  1MK7 B;  1N3H A;  1WJ1 A;  1MAI A;  1XCG A;  3MDB C;  5JLJ B;  1WG7 A;  1PLS A;  4GN1 A;  3BJI A;  1U5E A;  2KCJ A;  1V5U A;  2K2U A;  4CHJ A;  2EMT A;  3TFM A;  2I5F A;  1BWN A;  2JP2 A;  4F7H A;  5HE0 A;  2HE7 A;  1OMW A;  2RNR B;  1RRP B;  1U27 A;  4HHV A;  4DBB A;  2W2W A;  1NTV A;  5DH9 B;  3M1I B;  4DXA B;  3PSC A;  4F7G A;  1KI1 B;  1BTK A;  2LKO A;  1K5D B;  2I1K A;  5C5B A;  3MPX A;  5LON B;  1DBH A;  3GYP A;  3TW1 A;  2ROV A;  3FSS A;  4GMX B;  2CY5 A;  4EJN A;  5L81 A;  5LOP B;  1P5T A;  2D9X A;  1QQG A;  1J0W A;  1XR0 B;  2UZR A;  2CAY A;  3SNH A;  1V5M A;  2D10 A;  4IOY X;  1K5G B;  4NSW A;  1IRS A;  1V5P A;  2ZPY A;  2KUP A;  3QWM A;  2X18 A;  4K17 A;  2LG1 A;  4ZRI A;  3RCP A;  3A8P A;  2BCJ A;  1DDV A;  2DHJ A;  1WI1 A;  5C5B B;  4HB2 B;  5CLL B;  4GPT B;  3PP2 A;  4HDO A;  3NSU A;  3QIJ A;  3ODW A;  2OTX A;  2W2X D;  5DHA B;  2N0Y A;  3VOQ A;  4XWX A;  4D0N B;  3F0W A;  3KY9 A;  4HAU B;  4EKU A;  5C79 A;  2EJ8 A;  2ROZ B;  2DN6 A;  2DFK A;  4HAX B;  4YON A;  3ODO A;  1V88 A;  2COC A;  1Q67 A;  3TVV A;  2VSZ A;  2YS3 A;  4WSF A;  2VRW B;  1W1H A;  4Z2N A;  5JP4 A;  2RUK B;  2DTC A;  3ZDT A;  2L1C A;  1ZVR A;  4GXB A;  1X1G A;  3WYF B;  2KGX B;  1MIX A;  1I7A A;  3HK0 A;  4HAY B;  1U2B A;  2EC1 A;  4HAT B;  4PQ0 A;  2Z0O A;  5KQ1 A;  1WVH A;  4F7U P;  1LB1 A;  2GJY A;  3ML4 A;  2P8V A;  2Y8F A;  3KSY A;  5EFX A;  2LOZ A;  1BTN A;  3U7D A;  1TQZ A;  1WGU A;  1UPR A;  2IFS A;  2MKR A;  5DHF B;  2LYD A;  5J3Y A;  1M7R A;  5C6R A;  3P7Z A;  4DX8 A;  2D9W A;  3KRW A;  1H4R A;  2DKP A;  1U5D A;  3F5R A;  2LOX A;  4KHA A;  1SHC A;  2D11 A;  1J19 A;  2Q13 A;  4MK0 A;  1GC7 A;  3BIN A;  2VKI A;  3DXC A;  4A6H A;  5D3Y A;  2RSG A;  3PVU A;  2COD A;  3PZD A;  3SUZ A;  1U5F A;  4TYZ A;  1SGH A;  1UNQ A;  2DYN A;  5KCV A;  3KZ1 A;  2J0K A;  5HE2 A;  1XD4 A;  1P3R A;  1P6S A;  3FM8 C;  3D8E A;  1FAO A;  2ELB A;  1Y5O A;  2YS5 A;  2YRY A;  2DA0 A;  1BAK A;  1DDM A;  5FI0 A;  1GC6 A;  3PEG A;  2ELA A;  2FJL A;  2DYQ A;  2NMB A;  1DYN A;  1OQN A;  4C0A A;  2UZS A;  1AQC A;  5HE3 A;  5J3Q A;  3ULB A;  4WJ7 A;  3SO6 A;  3P6A A;  5C16 A;  1EF1 A;  5D3V A;  4K2O A;  2YF0 A;  1OY2 A;  2I5C A;  5D27 A;  1M7E A;  1I2H A;  1X1F A;  5CLQ B;  2OQB A;  3CXB B;  1V61 A;  1GG3 A;  5J3T A;  1FHW A;  2CY4 A;  3GYO A;  4ZRK A;  2R0D A;  3PVL A;  5KQ4 A;  1Z87 A;  1H10 A;  4HAW B;  1ZC4 B;  1DRO A;  2YS1 A;  4NY0 A;  2CRF A;  2G35 A;  1LW3 A;  3X23 A;  4P7I A;  2MDX A;  5DI9 B;  3AJ4 A;  3D8F A;  4K81 A;  1FOE A;  2GS0 A;  4TKN A;  2D2Q A;  2P0F A;  4ZRJ A;  1AWE A;  2IYB A;  5D3X A;  1FHO A;  2MWN B;  2HTH B;  1EVH A;  2YT1 A;  3IVF A;  4PNK A;  2AL6 A;  3ZVR A;  3HQC A;  1UPQ A;  3VIA A;  3O96 A;  2COF A;  4A6F B;  3AU4 A;  4BBK A;  3QBV B;  3KRX A;  5DIF B;  4HB3 B;  2ADZ A;  1DDW A;  1PFJ A;  5FI1 A;  2H7E A;  2YSZ A;  2K00 A;  5D3W A;  5JHG A;  1FB8 A;  1FHX A;  2GCJ A;  3D8D A;  3SYX A;  3SV1 A;  1FGZ A;  3PG7 A;  4GZU A;  1EAZ A;  4HAZ B;  2RGN B;  1TJ6 A;  4A6K A;  1U29 A;  1KZG A;  1NU2 A;  2M14 A;  3DXE A;  4GMV A;  1WGQ A;  1W1D A;  1Y19 B;  4IAP A;  1EGX A;  4Z2M B;  2DHI A;  2V76 A;  4DX9 0;  4Y94 A;  2DX1 A;  2Y7B A;  4WVF B;  1ZC3 B;  4HDQ A;  4A5K A;  1MK9 B;  3T06 A;  4YL8 A;  2RLO A;  2DLW A;  2K2J A;  3A98 B;  1UNP A;  3HW2 B;  1NI2 A;  2AEH A;  5JHH A;  2LUL A;  2R09 A;  2DX5 A;  2J59 M;  3UZT A;  1KZ7 A;  2COA A;  2Y8G A;  1V89 A;  2P0H A;  1B55 A;  3ODX A;  1MPH A;  2XQN M;  2D9Y A;  5GOW B;  3DXD A;  2L2I A;  2P0D A;  4K2P A;  4KVG B;  3CIK A;  1X05 A;  2EMS A;  1E5W A;  2QKL A;  4EMO A;  1QC6 A;  4KAX B;  3ULC A;  2M38 A;  1MKE A;  1WJM A;  2YT0 A; 
#chains in the Genus database with same CATH topology
 3N7C A;  2D9V A;  1U5G A;  2NZ8 B;  4B6H A;  3LJU X;  4L6E A;  3B77 A;  3G9W A;  2W2X C;  1UNR A;  3U8Z A;  4A6F A;  1X11 A;  3V5W A;  2E2X A;  2YVC A;  5LG4 B;  1ZSQ A;  1XOD A;  2I1J A;  2GCL A;  3NWF A;  1X86 A;  3A8Q A;  4KHB A;  4QJ4 B;  4HB4 B;  4OT1 A;  1ISN A;  2PZ1 A;  2UVM A;  2D4Q A;  2Z0P A;  3AU5 A;  3WA0 A;  5IRS A;  1TXD A;  2DKQ A;  4HAV B;  4IFS A;  1RJ2 A;  4KHO A;  4CHM A;  1MIZ B;  1XKE A;  2RRF A;  4HB0 B;  1ZM0 A;  4MY6 A;  3PVW A;  2ZKM X;  1FGY A;  4MT7 A;  3OAN A;  2QKM A;  1NTY A;  3TO1 A;  2Z0Q A;  3NWD A;  2K49 A;  3FVC A;  3FEH A;  2RVB B;  4H8S A;  2H7D A;  1MI1 A;  2N23 A;  3TCA A;  4KHB B;  1PMS A;  2MFQ A;  2DHK A;  1XX0 A;  2J0M A;  2K8E A;  3U12 A;  1W1G A;  1UEF A;  4CYE A;  5HE1 A;  2D9Z A;  2Z4D A;  2J0J A;  1MK7 B;  2KR0 A;  1N3H A;  1WJ1 A;  4GNK B;  1MAI A;  1XCG A;  3MDB C;  5JLJ B;  1WG7 A;  1PLS A;  4GN1 A;  3BJI A;  1U5E A;  2KCJ A;  1V5U A;  2K2U A;  4CHJ A;  1ZYI A;  2EMT A;  3TFM A;  2I5F A;  1BWN A;  2JP2 A;  4F7H A;  5HE0 A;  2HE7 A;  1OMW A;  2RNR B;  1RRP B;  1U27 A;  4HHV A;  4DBB A;  2W2W A;  1NTV A;  5DH9 B;  3M1I B;  4DXA B;  3PSC A;  4F7G A;  1KI1 B;  1BTK A;  2LKO A;  1K5D B;  2I1K A;  5C5B A;  3MPX A;  5LON B;  1DBH A;  3GYP A;  3TW1 A;  2ROV A;  3FSS A;  4GMX B;  2CY5 A;  4EJN A;  5L81 A;  5LOP B;  1P5T A;  2D9X A;  1QQG A;  1J0W A;  1XR0 B;  2UZR A;  2CAY A;  3SNH A;  1V5M A;  2D10 A;  4HSI A;  4IOY X;  1K5G B;  4NSW A;  1IRS A;  1V5P A;  2ZPY A;  2KUP A;  3QWM A;  2X18 A;  3DCX A;  4K17 A;  2LG1 A;  4ZRI A;  3RCP A;  3A8P A;  2BCJ A;  1DDV A;  2DHJ A;  1WI1 A;  4QXA B;  5C5B B;  2KIE A;  2FJU B;  4HB2 B;  5CLL B;  4GPT B;  1T77 A;  3PP2 A;  4HDO A;  3NSU A;  3QIJ A;  5I2M A;  3ODW A;  2OTX A;  2W2X D;  5DHA B;  2N0Y A;  3VOQ A;  4XWX A;  4D0N B;  3F0W A;  3KY9 A;  4HAU B;  4EKU A;  5C79 A;  2EJ8 A;  2ROZ B;  2DN6 A;  2DFK A;  4HAX B;  4YON A;  3ODO A;  1V88 A;  4D6W A;  2COC A;  1Q67 A;  3TVV A;  2VSZ A;  2YS3 A;  4WSF A;  2VRW B;  1W1H A;  4Z2N A;  5JP4 A;  2RUK B;  2DTC A;  3ZDT A;  2L1C A;  1ZVR A;  4GXB A;  1X1G A;  3WYF B;  4OSN A;  2KGX B;  1MIX A;  1I7A A;  3HK0 A;  3HSA A;  4HAY B;  1U2B A;  2EC1 A;  4HAT B;  4PQ0 A;  2Z0O A;  5KQ1 A;  1WVH A;  4F7U P;  1LB1 A;  2GJY A;  3ML4 A;  2P8V A;  2Y8F A;  3KSY A;  5EFX A;  2LOZ A;  2NBV A;  5M4Y B;  1BTN A;  3U7D A;  1TQZ A;  1WGU A;  1UPR A;  4DIX A;  2IFS A;  2MKR A;  5DHF B;  2LYD A;  5J3Y A;  1M7R A;  5C6R A;  3P7Z A;  4DX8 A;  2D9W A;  3KRW A;  1H4R A;  2DKP A;  4L1R A;  1U5D A;  3F5R A;  2LOX A;  4KHA A;  1SHC A;  2D11 A;  3A58 A;  1J19 A;  2Q13 A;  4MK0 A;  1GC7 A;  3BIN A;  2VKI A;  3NWA A;  3DXC A;  3NW8 A;  4A6H A;  5D3Y A;  2RSG A;  3PVU A;  2COD A;  3PZD A;  3SUZ A;  1U5F A;  4TYZ A;  1SGH A;  1UNQ A;  2DYN A;  5KCV A;  3KZ1 A;  2J0K A;  5HE2 A;  1XD4 A;  1P3R A;  1P6S A;  3FM8 C;  3HIE A;  3D8E A;  1FAO A;  2ELB A;  1Y5O A;  2YS5 A;  2YRY A;  2DA0 A;  1BAK A;  1DDM A;  5FI0 A;  1GC6 A;  2Z59 A;  3PEG A;  2ELA A;  2FJL A;  2DYQ A;  2NMB A;  1DYN A;  1OQN A;  4C0A A;  2UZS A;  1AQC A;  5HE3 A;  5J3Q A;  3ULB A;  4WJ7 A;  3SO6 A;  3P6A A;  5C16 A;  1EF1 A;  2YT2 A;  5D3V A;  4K2O A;  2YF0 A;  1OY2 A;  2I5C A;  5D27 A;  1M7E A;  1I2H A;  1X1F A;  4QJ3 B;  5CLQ B;  2OQB A;  5I2S A;  3CXB B;  1V61 A;  1GG3 A;  5J3T A;  1FHW A;  2CY4 A;  3GYO A;  4ZRK A;  2R0D A;  3PVL A;  5KQ4 A;  1Z87 A;  1H10 A;  4HAW B;  1ZC4 B;  2KUQ A;  1DRO A;  2YS1 A;  4NY0 A;  2CRF A;  2G35 A;  1LW3 A;  3X23 A;  4P7I A;  2MDX A;  5DI9 B;  3AJ4 A;  3D8F A;  4K81 A;  4GOU A;  1FOE A;  2GS0 A;  4TKN A;  2D2Q A;  2P0F A;  4ZRJ A;  1AWE A;  2IYB A;  5D3X A;  1FHO A;  2MWN B;  2HTH B;  1EVH A;  2YT1 A;  3IVF A;  4PNK A;  2AL6 A;  3ZVR A;  3HQC A;  1UPQ A;  3VIA A;  3O96 A;  2COF A;  4A6F B;  3AU4 A;  4BBK A;  3QBV B;  3KRX A;  5DIF B;  4HB3 B;  2ADZ A;  1DDW A;  1PFJ A;  2Z14 A;  5FI1 A;  2H7E A;  2YSZ A;  2K00 A;  5D3W A;  5JHG A;  1FB8 A;  1FHX A;  2GCJ A;  3D8D A;  3SYX A;  3SV1 A;  1FGZ A;  3PG7 A;  4GZU A;  1EAZ A;  4HAZ B;  2RGN B;  1TJ6 A;  4A6K A;  1U29 A;  1KZG A;  1NU2 A;  2M14 A;  3DXE A;  4GMV A;  1WGQ A;  1W1D A;  1Y19 B;  4IAP A;  2R2Y A;  1EGX A;  4Z2M B;  2DHI A;  2V76 A;  4QJ5 B;  4DX9 0;  4Y94 A;  2DX1 A;  2Y7B A;  4WVF B;  1ZC3 B;  4HDQ A;  4A5K A;  1MK9 B;  3T06 A;  4YL8 A;  2RLO A;  2DLW A;  2K2J A;  4CSQ A;  2Z13 A;  3A98 B;  1UNP A;  3HW2 B;  1NI2 A;  2AEH A;  2GUM A;  5JHH A;  2LUL A;  2R09 A;  2DX5 A;  2J59 M;  3UZT A;  1KZ7 A;  2COA A;  2Y8G A;  1V89 A;  2P0H A;  1B55 A;  3ODX A;  1MPH A;  2XQN M;  2D9Y A;  2KIG A;  5GOW B;  3DXD A;  2L2I A;  2P0D A;  4K2P A;  4KVG B;  3CIK A;  1X05 A;  2EMS A;  1E5W A;  2QKL A;  4EMO A;  1QC6 A;  4KAX B;  3ULC A;  2M38 A;  3OHM B;  1MKE A;  1WJM A;  2YT0 A; 
#chains in the Genus database with same CATH homology
 3N7C A;  2D9V A;  1U5G A;  2NZ8 B;  4B6H A;  3LJU X;  4L6E A;  3G9W A;  2W2X C;  1UNR A;  3U8Z A;  4A6F A;  1X11 A;  3V5W A;  2E2X A;  2YVC A;  1ZSQ A;  1XOD A;  2I1J A;  2GCL A;  1X86 A;  3A8Q A;  4HB4 B;  1ISN A;  2PZ1 A;  2UVM A;  2D4Q A;  2Z0P A;  3AU5 A;  3WA0 A;  1TXD A;  2DKQ A;  4HAV B;  4IFS A;  1RJ2 A;  4KHO A;  4CHM A;  1MIZ B;  1XKE A;  4HB0 B;  1ZM0 A;  4MY6 A;  3PVW A;  1FGY A;  4MT7 A;  3OAN A;  2QKM A;  1NTY A;  3TO1 A;  2Z0Q A;  3FEH A;  2RVB B;  4H8S A;  2H7D A;  2N23 A;  3TCA A;  4KHB B;  1PMS A;  2MFQ A;  2DHK A;  1XX0 A;  2J0M A;  1W1G A;  1UEF A;  4CYE A;  5HE1 A;  2D9Z A;  2J0J A;  1MK7 B;  1N3H A;  1WJ1 A;  1MAI A;  1XCG A;  3MDB C;  5JLJ B;  1WG7 A;  1PLS A;  4GN1 A;  3BJI A;  1U5E A;  2KCJ A;  1V5U A;  2K2U A;  4CHJ A;  2EMT A;  3TFM A;  2I5F A;  1BWN A;  2JP2 A;  4F7H A;  5HE0 A;  2HE7 A;  1OMW A;  2RNR B;  1RRP B;  1U27 A;  4HHV A;  4DBB A;  2W2W A;  1NTV A;  5DH9 B;  3M1I B;  4DXA B;  3PSC A;  4F7G A;  1KI1 B;  1BTK A;  2LKO A;  1K5D B;  2I1K A;  5C5B A;  3MPX A;  5LON B;  1DBH A;  3GYP A;  3TW1 A;  2ROV A;  3FSS A;  4GMX B;  2CY5 A;  4EJN A;  5L81 A;  5LOP B;  1P5T A;  2D9X A;  1QQG A;  1J0W A;  1XR0 B;  2UZR A;  2CAY A;  3SNH A;  1V5M A;  2D10 A;  4IOY X;  1K5G B;  4NSW A;  1IRS A;  1V5P A;  2ZPY A;  2KUP A;  3QWM A;  2X18 A;  4K17 A;  2LG1 A;  4ZRI A;  3RCP A;  3A8P A;  2BCJ A;  1DDV A;  2DHJ A;  1WI1 A;  5C5B B;  4HB2 B;  5CLL B;  4GPT B;  3PP2 A;  4HDO A;  3NSU A;  3QIJ A;  3ODW A;  2OTX A;  2W2X D;  5DHA B;  2N0Y A;  3VOQ A;  4XWX A;  4D0N B;  3F0W A;  3KY9 A;  4HAU B;  4EKU A;  5C79 A;  2EJ8 A;  2ROZ B;  2DN6 A;  2DFK A;  4HAX B;  4YON A;  3ODO A;  1V88 A;  2COC A;  1Q67 A;  3TVV A;  2VSZ A;  2YS3 A;  4WSF A;  2VRW B;  1W1H A;  4Z2N A;  5JP4 A;  2RUK B;  2DTC A;  3ZDT A;  2L1C A;  1ZVR A;  4GXB A;  1X1G A;  3WYF B;  2KGX B;  1MIX A;  1I7A A;  3HK0 A;  4HAY B;  1U2B A;  2EC1 A;  4HAT B;  4PQ0 A;  2Z0O A;  5KQ1 A;  1WVH A;  4F7U P;  1LB1 A;  2GJY A;  3ML4 A;  2P8V A;  2Y8F A;  3KSY A;  5EFX A;  2LOZ A;  1BTN A;  3U7D A;  1TQZ A;  1WGU A;  1UPR A;  2IFS A;  2MKR A;  5DHF B;  2LYD A;  5J3Y A;  1M7R A;  5C6R A;  3P7Z A;  4DX8 A;  2D9W A;  3KRW A;  1H4R A;  2DKP A;  1U5D A;  3F5R A;  2LOX A;  4KHA A;  1SHC A;  2D11 A;  1J19 A;  2Q13 A;  4MK0 A;  1GC7 A;  3BIN A;  2VKI A;  3DXC A;  4A6H A;  5D3Y A;  2RSG A;  3PVU A;  2COD A;  3PZD A;  3SUZ A;  1U5F A;  4TYZ A;  1SGH A;  1UNQ A;  2DYN A;  5KCV A;  3KZ1 A;  2J0K A;  5HE2 A;  1XD4 A;  1P3R A;  1P6S A;  3FM8 C;  3D8E A;  1FAO A;  2ELB A;  1Y5O A;  2YS5 A;  2YRY A;  2DA0 A;  1BAK A;  1DDM A;  5FI0 A;  1GC6 A;  3PEG A;  2ELA A;  2FJL A;  2DYQ A;  2NMB A;  1DYN A;  1OQN A;  4C0A A;  2UZS A;  1AQC A;  5HE3 A;  5J3Q A;  3ULB A;  4WJ7 A;  3SO6 A;  3P6A A;  5C16 A;  1EF1 A;  5D3V A;  4K2O A;  2YF0 A;  1OY2 A;  2I5C A;  5D27 A;  1M7E A;  1I2H A;  1X1F A;  5CLQ B;  2OQB A;  3CXB B;  1V61 A;  1GG3 A;  5J3T A;  1FHW A;  2CY4 A;  3GYO A;  4ZRK A;  2R0D A;  3PVL A;  5KQ4 A;  1Z87 A;  1H10 A;  4HAW B;  1ZC4 B;  1DRO A;  2YS1 A;  4NY0 A;  2CRF A;  2G35 A;  1LW3 A;  3X23 A;  4P7I A;  2MDX A;  5DI9 B;  3AJ4 A;  3D8F A;  4K81 A;  1FOE A;  2GS0 A;  4TKN A;  2D2Q A;  2P0F A;  4ZRJ A;  1AWE A;  2IYB A;  5D3X A;  1FHO A;  2MWN B;  2HTH B;  1EVH A;  2YT1 A;  3IVF A;  4PNK A;  2AL6 A;  3ZVR A;  3HQC A;  1UPQ A;  3VIA A;  3O96 A;  2COF A;  4A6F B;  3AU4 A;  4BBK A;  3QBV B;  3KRX A;  5DIF B;  4HB3 B;  2ADZ A;  1DDW A;  1PFJ A;  5FI1 A;  2H7E A;  2YSZ A;  2K00 A;  5D3W A;  5JHG A;  1FB8 A;  1FHX A;  2GCJ A;  3D8D A;  3SYX A;  3SV1 A;  1FGZ A;  3PG7 A;  4GZU A;  1EAZ A;  4HAZ B;  2RGN B;  1TJ6 A;  4A6K A;  1U29 A;  1KZG A;  1NU2 A;  2M14 A;  3DXE A;  4GMV A;  1WGQ A;  1W1D A;  1Y19 B;  4IAP A;  1EGX A;  4Z2M B;  2DHI A;  2V76 A;  4DX9 0;  4Y94 A;  2DX1 A;  2Y7B A;  4WVF B;  1ZC3 B;  4HDQ A;  4A5K A;  1MK9 B;  3T06 A;  4YL8 A;  2RLO A;  2DLW A;  2K2J A;  3A98 B;  1UNP A;  3HW2 B;  1NI2 A;  2AEH A;  5JHH A;  2LUL A;  2R09 A;  2DX5 A;  2J59 M;  3UZT A;  1KZ7 A;  2COA A;  2Y8G A;  1V89 A;  2P0H A;  1B55 A;  3ODX A;  1MPH A;  2XQN M;  2D9Y A;  5GOW B;  3DXD A;  2L2I A;  2P0D A;  4K2P A;  4KVG B;  3CIK A;  1X05 A;  2EMS A;  1E5W A;  2QKL A;  4EMO A;  1QC6 A;  4KAX B;  3ULC A;  2M38 A;  1MKE A;  1WJM A;  2YT0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...