5C6RA

Crystal structure of ph domain of asap1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
110
structure length
110
Chain Sequence
QLQGNKEYGSEKKGFLLKKSDGIRKVWQRRKCAVKNGILTISHATSNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYIAWISVLTNSKEEALTMAFRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Basis for Cooperative Binding of Anionic Phospholipids to the PH Domain of the Arf GAP ASAP1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Arf-GAP
total genus 28
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5c6rA00
1J19A 1GC7A 4WJ7A 4IFSA 2LG1A 1ZC3B 2YS5A 2DHJA 3WYFB 4IOYX 1V5MA 3RCPA 3FM8C 2EMTA 3VIAA 1KZGA 2UZRA 2Z0QA 3SV1A 3SYXA 1PFJA 3HK0A 3O96A 3P6AA 2DYQA 4D0NB 3PSCA 3GYPA 5DI9B 4PQ0A 2ELBA 3SNHA 2DHKA 2IYBA 3VOQA 3DXDA 2KCJA 3TO1A 2ELAA 1XD4A 1M7RA 1H4RA 1RRPB 2NMBA 1H10A 5C79A 3GYOA 3KY9A 2CY4A 1U5FA 1I2HA 4P7IA 2KUPA 4GPTB 5EFXA 4B6HA 4CYEA 2J0JA 4KVGB 1NTVA 3AU5A 1PMSA 1DDMA 1IRSA 1TJ6A 3F0WA 1XKEA 3FEHA 4F7HA 4H8SA 3BINA 2DX5A 1MKEA 4EJNA 4HAWB 2IFSA 1U5EA 1ZM0A 2COFA 2J0MA 1P6SA 2H7DA 1M7EA 2D9YA 4GN1A 2OTXA 1X86A 3PG7A 3D8FA 2CAYA 3KRWA 4HAYB 4GMXB 3PP2A 3X23A 2UZSA 1FHXA 2BCJA 2E2XA 4YL8A 5DHAB 4F7UP 3TFMA 2P0HA 2RUKB 1Y5OA 3TCAA 2GJYA 2D4QA 5LOPB 4EMOA 4A5KA 2DHIA 2P0DA 2Z0OA 2W2XD 2AL6A 5J3QA 2YRYA 5FI1A 4GXBA 1FGYA 1UNQA 2I1JA 4DXAB 5DH9B 2H7EA 3TW1A 3ZVRA 1TQZA 1UEFA 3TVVA 2UVMA 2QKLA 2YF0A 4IAPA 2RGNB 1I7AA 3LJUX 4MK0A 2D10A 4HB2B 4A6FB 1MIZB 3MPXA 5C6RA 4EKUA 2HTHB 1WGQA 1XODA 3CXBB 1V89A 2Y8GA 2CODA 3T06A 1DYNA 3OANA 4CHJA 5D3WA 4HAUB 3PVLA 4MT7A 3A8QA 3ODXA 3QBVB 1MK9B 4HAZB 2OQBA 3M1IB 1B55A 3HQCA 2D11A 5D27A 4TKNA 2YSZA 3KZ1A 1V5PA 1RJ2A 2LKOA 1X05A 3QIJA 1EVHA 2EJ8A 5JP4A 2EC1A 2G35A 5HE2A 2N23A 3KRXA 2MFQA 2YS1A 2I5FA 1Q67A 2Z0PA 1DDWA 3IVFA 2V76A 4YONA 2RNRB 1QQGA 4HATB 1KZ7A 4A6HA 1MIXA 3G9WA 2L2IA 3PEGA 5CLQB 4K2OA 1GC6A 1P3RA 2ADZA 1WJ1A 2RVBB 1UPQA 2GS0A 2VKIA 1W1DA 1V88A 1N3HA 3DXEA 4Y94A 1U29A 1PLSA 2EMSA 4NY0A 2NZ8B 2Y8FA 1UNPA 2MWNB 2X18A 1DROA 3PVWA 3KSYA 1EGXA 3SO6A 3MDBC 1E5WA 1BWNA 2K2JA 1KI1B 1MAIA 5C5BA 2JP2A 3A8PA 4CHMA 1V5UA 3AJ4A 3NSUA 3P7ZA 3SUZA 4BBKA 5JLJB 1NTYA 3PZDA 1SHCA 4XWXA 1BAKA 2M14A 3ML4A 1WG7A 1WVHA 4HDOA 1U5DA 1U5GA 2COCA 4MY6A 1X1FA 1ZC4B 1OMWA 1X1GA 4KAXB 4A6FA 2DLWA 3FSSA 2ROZB 2LULA 1FHOA 2VSZA 1J0WA 1BTKA 1WGUA 2W2XC 4HDQA 1FGZA 5C16A 5GOWB 5KQ1A 1GG3A 2XQNM 2HE7A 1K5DB 2R09A 1U2BA 3U8ZA 4HB0B 3CIKA 1Y19B 3BJIA 1NI2A 2I5CA 2DKQA 1U27A 2DN6A 2D9ZA 2LOXA 5HE0A 2DTCA 4NSWA 1ZSQA 3ULBA 3AU4A 4HAXB 2P8VA 1W1HA 2J59M 5JHGA 5DIFB 1SGHA 1K5GB 5HE3A 1EAZA 3V5WA 2DA0A 1ZVRA 5J3TA 3N7CA 5D3XA 1Z87A 2LOZA 2GCLA 3U7DA 3ODOA 4PNKA 2D9XA 3F5RA 4KHOA 5FI0A 5KCVA 4HHVA 4TYZA 2RLOA 4F7GA 1X11A 2I1KA 1EF1A 2N0YA 5D3YA 2D9VA 2CY5A 2ZPYA 4Z2NA 3QWMA 2K2UA 4ZRIA 2M38A 3DXCA 2YVCA 1NU2A 1ISNA 2D2QA 3HW2B 4HAVB 2AEHA 3D8EA 5C5BB 1TXDA 1BTNA 2MDXA 1QC6A 1UPRA 4WVFB 1WJMA 4Z2MB 4DX8A 2Q13A 4DX90 1FHWA 5CLLB 1XCGA 4K2PA 2QKMA 1UNRA 2CRFA 5L81A 4GZUA 4DBBA 3D8DA 2W2WA 4ZRJA 4K81A 4A6KA 5J3YA 2DYNA 1AWEA 4WSFA 2COAA 2PZ1A 3ODWA 3WA0A 1P5TA 2VRWB 1OY2A 1V61A 2ROVA 3ULCA 2YT1A 4HB4B 2Y7BA 1MK7B 5KQ4A 5LONB 1AQCA 2L1CA 1DDVA 2DX1A 4ZRKA 2MKRA 1W1GA 4L6EA 5JHHA 1DBHA 1OQNA 3A98B 3UZTA 3ZDTA 2DFKA 2YS3A 1MPHA 2RSGA 2R0DA 2YT0A 1FAOA 2GCJA 2LYDA 2P0FA 4K17A 1LB1A 1FB8A 1FOEA 2KGXB 2K00A 5D3VA 4C0AA 4KHAA 3PVUA 5DHFB 4KHBB 1LW3A 1XR0B 4HB3B 2J0KA 5HE1A 4GMVA 2D9WA 2FJLA 1WI1A 1XX0A 2DKPA
chains in the Genus database with same CATH superfamily
1J19A 1GC7A 4WJ7A 4IFSA 2LG1A 1ZC3B 2YS5A 2DHJA 3WYFB 4IOYX 1V5MA 3RCPA 3FM8C 2EMTA 3VIAA 1KZGA 2UZRA 2Z0QA 3SV1A 3SYXA 1PFJA 3HK0A 3O96A 3P6AA 2DYQA 4D0NB 3PSCA 3GYPA 5DI9B 4PQ0A 2ELBA 3SNHA 2DHKA 2IYBA 4GNKB 3VOQA 3DXDA 2KCJA 3TO1A 2ELAA 1XD4A 1M7RA 1H4RA 3HSAA 4DIXA 1RRPB 2NMBA 1H10A 5C79A 3GYOA 3KY9A 2CY4A 1U5FA 1I2HA 4P7IA 2KUPA 3B77A 4GPTB 5EFXA 4B6HA 4CYEA 2J0JA 4KVGB 1NTVA 4HSIA 3AU5A 1PMSA 1DDMA 1IRSA 1TJ6A 3F0WA 1XKEA 3FEHA 4F7HA 4H8SA 3BINA 2DX5A 1MKEA 4EJNA 4HAWB 2IFSA 1U5EA 1ZM0A 2COFA 2J0MA 1P6SA 2H7DA 1M7EA 2D9YA 4GN1A 2OTXA 1X86A 3PG7A 3HIEA 3D8FA 2CAYA 3KRWA 4HAYB 4GMXB 3PP2A 3X23A 2UZSA 1FHXA 2BCJA 2E2XA 4YL8A 5DHAB 4F7UP 3TFMA 2P0HA 2RUKB 5LG4B 1Y5OA 3TCAA 2GJYA 2D4QA 5LOPB 3OHMB 3U12A 4L1RA 4EMOA 4A5KA 3NWDA 2DHIA 2P0DA 2Z0OA 2W2XD 2AL6A 5J3QA 2YRYA 5FI1A 4GOUA 4GXBA 1FGYA 3NWAA 1UNQA 2I1JA 4DXAB 5DH9B 2H7EA 3TW1A 3ZVRA 1TQZA 1UEFA 3TVVA 2UVMA 2QKLA 2YF0A 4IAPA 2RGNB 1I7AA 5M4YB 3LJUX 4MK0A 2D10A 4HB2B 4A6FB 1MIZB 3MPXA 5C6RA 4EKUA 2HTHB 1WGQA 1XODA 3CXBB 1V89A 2Y8GA 2CODA 3T06A 1DYNA 3OANA 4CHJA 5D3WA 4HAUB 4CSQA 3PVLA 4MT7A 3A8QA 3ODXA 3QBVB 1MK9B 4HAZB 2OQBA 3M1IB 1B55A 3HQCA 2D11A 5D27A 4TKNA 2YSZA 3KZ1A 2GUMA 1V5PA 1RJ2A 2LKOA 1X05A 3QIJA 1EVHA 2EJ8A 5JP4A 4OT1A 2EC1A 2G35A 5HE2A 2N23A 3KRXA 2MFQA 2YS1A 2I5FA 1Q67A 4QXAB 2Z0PA 1DDWA 3IVFA 2V76A 4YONA 2RNRB 1QQGA 4HATB 1KZ7A 4A6HA 1MIXA 1MI1A 3G9WA 2L2IA 3PEGA 5CLQB 4K2OA 1GC6A 1P3RA 2ADZA 1WJ1A 2ZKMX 2RVBB 1UPQA 2GS0A 2VKIA 3NWFA 1W1DA 1V88A 1N3HA 3DXEA 4Y94A 5I2SA 1U29A 2KR0A 1PLSA 2EMSA 4NY0A 2NZ8B 2Y8FA 1UNPA 2MWNB 2X18A 1DROA 3PVWA 3KSYA 1EGXA 3SO6A 3MDBC 1E5WA 1BWNA 2K2JA 1KI1B 1MAIA 5C5BA 2JP2A 3A8PA 4CHMA 1V5UA 3AJ4A 3NSUA 3P7ZA 3SUZA 4BBKA 2Z59A 5JLJB 1NTYA 3PZDA 1SHCA 4XWXA 1BAKA 2M14A 3ML4A 2NBVA 3FVCA 1WG7A 1WVHA 4HDOA 1U5DA 1U5GA 2COCA 4MY6A 1X1FA 1ZC4B 4QJ5B 1OMWA 1X1GA 4KAXB 4A6FA 2DLWA 3FSSA 2ROZB 2LULA 1FHOA 2VSZA 1J0WA 1BTKA 1WGUA 2W2XC 2Z13A 4HDQA 1FGZA 5C16A 5GOWB 5KQ1A 1GG3A 2XQNM 2HE7A 1K5DB 2R09A 1U2BA 4KHBA 3U8ZA 4HB0B 3CIKA 1Y19B 3BJIA 1NI2A 2I5CA 2DKQA 1U27A 2DN6A 2D9ZA 4QJ3B 2LOXA 5HE0A 2DTCA 4NSWA 1ZSQA 3ULBA 3AU4A 4HAXB 2P8VA 1W1HA 2J59M 5JHGA 1ZYIA 5DIFB 1SGHA 5IRSA 1K5GB 5HE3A 1EAZA 3V5WA 2DA0A 2KIEA 1ZVRA 5J3TA 3N7CA 5D3XA 1Z87A 2LOZA 2GCLA 3U7DA 3ODOA 4PNKA 2D9XA 3F5RA 4KHOA 5FI0A 5KCVA 2Z4DA 4HHVA 4TYZA 2RLOA 4F7GA 1X11A 2I1KA 1EF1A 2N0YA 5D3YA 2D9VA 2CY5A 4QJ4B 2ZPYA 4Z2NA 3QWMA 2K2UA 4ZRIA 2M38A 3DXCA 2YVCA 1NU2A 1ISNA 2KUQA 2D2QA 3HW2B 4HAVB 2AEHA 3D8EA 5C5BB 2K8EA 1TXDA 1BTNA 2MDXA 1QC6A 1UPRA 4WVFB 4D6WA 1WJMA 4Z2MB 4DX8A 2Q13A 4DX90 1FHWA 5CLLB 1XCGA 4K2PA 5I2MA 2QKMA 1UNRA 2CRFA 5L81A 4GZUA 4DBBA 2YT2A 3D8DA 2W2WA 4ZRJA 3NW8A 4K81A 2R2YA 2FJUB 4A6KA 5J3YA 2DYNA 1AWEA 4WSFA 2COAA 2PZ1A 3ODWA 3WA0A 1P5TA 2VRWB 2K49A 1OY2A 1V61A 3A58A 2ROVA 3ULCA 2RRFA 2YT1A 4HB4B 2Y7BA 1MK7B 5KQ4A 5LONB 1AQCA 3DCXA 2L1CA 1DDVA 2DX1A 4ZRKA 4OSNA 2MKRA 2KIGA 1W1GA 4L6EA 5JHHA 1DBHA 1OQNA 2Z14A 3A98B 3UZTA 3ZDTA 2DFKA 2YS3A 1MPHA 2RSGA 2R0DA 2YT0A 1FAOA 2GCJA 2LYDA 2P0FA 4K17A 1LB1A 1FB8A 1FOEA 2KGXB 2K00A 5D3VA 4C0AA 4KHAA 3PVUA 5DHFB 4KHBB 1LW3A 1XR0B 4HB3B 2J0KA 5HE1A 4GMVA 2D9WA 2FJLA 1WI1A 1XX0A 1T77A 2DKPA
chains in the Genus database with same CATH topology
1J19A 1GC7A 4WJ7A 4IFSA 2LG1A 1ZC3B 2YS5A 2DHJA 3WYFB 4IOYX 1V5MA 3RCPA 3FM8C 2EMTA 3VIAA 1KZGA 2UZRA 2Z0QA 3SV1A 3SYXA 1PFJA 3HK0A 3O96A 3P6AA 2DYQA 4D0NB 3PSCA 3GYPA 5DI9B 4PQ0A 2ELBA 3SNHA 2DHKA 2IYBA 3VOQA 3DXDA 2KCJA 3TO1A 2ELAA 1XD4A 1M7RA 1H4RA 1RRPB 2NMBA 1H10A 5C79A 3GYOA 3KY9A 2CY4A 1U5FA 1I2HA 4P7IA 2KUPA 4GPTB 5EFXA 4B6HA 4CYEA 2J0JA 4KVGB 1NTVA 3AU5A 1PMSA 1DDMA 1IRSA 1TJ6A 3F0WA 1XKEA 3FEHA 4F7HA 4H8SA 3BINA 2DX5A 1MKEA 4EJNA 4HAWB 2IFSA 1U5EA 1ZM0A 2COFA 2J0MA 1P6SA 2H7DA 1M7EA 2D9YA 4GN1A 2OTXA 1X86A 3PG7A 3D8FA 2CAYA 3KRWA 4HAYB 4GMXB 3PP2A 3X23A 2UZSA 1FHXA 2BCJA 2E2XA 4YL8A 5DHAB 4F7UP 3TFMA 2P0HA 2RUKB 1Y5OA 3TCAA 2GJYA 2D4QA 5LOPB 4EMOA 4A5KA 2DHIA 2P0DA 2Z0OA 2W2XD 2AL6A 5J3QA 2YRYA 5FI1A 4GXBA 1FGYA 1UNQA 2I1JA 4DXAB 5DH9B 2H7EA 3TW1A 3ZVRA 1TQZA 1UEFA 3TVVA 2UVMA 2QKLA 2YF0A 4IAPA 2RGNB 1I7AA 3LJUX 4MK0A 2D10A 4HB2B 4A6FB 1MIZB 3MPXA 5C6RA 4EKUA 2HTHB 1WGQA 1XODA 3CXBB 1V89A 2Y8GA 2CODA 3T06A 1DYNA 3OANA 4CHJA 5D3WA 4HAUB 3PVLA 4MT7A 3A8QA 3ODXA 3QBVB 1MK9B 4HAZB 2OQBA 3M1IB 1B55A 3HQCA 2D11A 5D27A 4TKNA 2YSZA 3KZ1A 1V5PA 1RJ2A 2LKOA 1X05A 3QIJA 1EVHA 2EJ8A 5JP4A 2EC1A 2G35A 5HE2A 2N23A 3KRXA 2MFQA 2YS1A 2I5FA 1Q67A 2Z0PA 1DDWA 3IVFA 2V76A 4YONA 2RNRB 1QQGA 4HATB 1KZ7A 4A6HA 1MIXA 3G9WA 2L2IA 3PEGA 5CLQB 4K2OA 1GC6A 1P3RA 2ADZA 1WJ1A 2RVBB 1UPQA 2GS0A 2VKIA 1W1DA 1V88A 1N3HA 3DXEA 4Y94A 1U29A 1PLSA 2EMSA 4NY0A 2NZ8B 2Y8FA 1UNPA 2MWNB 2X18A 1DROA 3PVWA 3KSYA 1EGXA 3SO6A 3MDBC 1E5WA 1BWNA 2K2JA 1KI1B 1MAIA 5C5BA 2JP2A 3A8PA 4CHMA 1V5UA 3AJ4A 3NSUA 3P7ZA 3SUZA 4BBKA 5JLJB 1NTYA 3PZDA 1SHCA 4XWXA 1BAKA 2M14A 3ML4A 1WG7A 1WVHA 4HDOA 1U5DA 1U5GA 2COCA 4MY6A 1X1FA 1ZC4B 1OMWA 1X1GA 4KAXB 4A6FA 2DLWA 3FSSA 2ROZB 2LULA 1FHOA 2VSZA 1J0WA 1BTKA 1WGUA 2W2XC 4HDQA 1FGZA 5C16A 5GOWB 5KQ1A 1GG3A 2XQNM 2HE7A 1K5DB 2R09A 1U2BA 3U8ZA 4HB0B 3CIKA 1Y19B 3BJIA 1NI2A 2I5CA 2DKQA 1U27A 2DN6A 2D9ZA 2LOXA 5HE0A 2DTCA 4NSWA 1ZSQA 3ULBA 3AU4A 4HAXB 2P8VA 1W1HA 2J59M 5JHGA 5DIFB 1SGHA 1K5GB 5HE3A 1EAZA 3V5WA 2DA0A 1ZVRA 5J3TA 3N7CA 5D3XA 1Z87A 2LOZA 2GCLA 3U7DA 3ODOA 4PNKA 2D9XA 3F5RA 4KHOA 5FI0A 5KCVA 4HHVA 4TYZA 2RLOA 4F7GA 1X11A 2I1KA 1EF1A 2N0YA 5D3YA 2D9VA 2CY5A 2ZPYA 4Z2NA 3QWMA 2K2UA 4ZRIA 2M38A 3DXCA 2YVCA 1NU2A 1ISNA 2D2QA 3HW2B 4HAVB 2AEHA 3D8EA 5C5BB 1TXDA 1BTNA 2MDXA 1QC6A 1UPRA 4WVFB 1WJMA 4Z2MB 4DX8A 2Q13A 4DX90 1FHWA 5CLLB 1XCGA 4K2PA 2QKMA 1UNRA 2CRFA 5L81A 4GZUA 4DBBA 3D8DA 2W2WA 4ZRJA 4K81A 4A6KA 5J3YA 2DYNA 1AWEA 4WSFA 2COAA 2PZ1A 3ODWA 3WA0A 1P5TA 2VRWB 1OY2A 1V61A 2ROVA 3ULCA 2YT1A 4HB4B 2Y7BA 1MK7B 5KQ4A 5LONB 1AQCA 2L1CA 1DDVA 2DX1A 4ZRKA 2MKRA 1W1GA 4L6EA 5JHHA 1DBHA 1OQNA 3A98B 3UZTA 3ZDTA 2DFKA 2YS3A 1MPHA 2RSGA 2R0DA 2YT0A 1FAOA 2GCJA 2LYDA 2P0FA 4K17A 1LB1A 1FB8A 1FOEA 2KGXB 2K00A 5D3VA 4C0AA 4KHAA 3PVUA 5DHFB 4KHBB 1LW3A 1XR0B 4HB3B 2J0KA 5HE1A 4GMVA 2D9WA 2FJLA 1WI1A 1XX0A 2DKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J19 A;  1GC7 A;  4WJ7 A;  4IFS A;  2LG1 A;  1ZC3 B;  2YS5 A;  2DHJ A;  3WYF B;  4IOY X;  1V5M A;  3RCP A;  3FM8 C;  2EMT A;  3VIA A;  1KZG A;  2UZR A;  2Z0Q A;  3SV1 A;  3SYX A;  1PFJ A;  3HK0 A;  3O96 A;  3P6A A;  2DYQ A;  4D0N B;  3PSC A;  3GYP A;  5DI9 B;  4PQ0 A;  2ELB A;  3SNH A;  2DHK A;  2IYB A;  3VOQ A;  3DXD A;  2KCJ A;  3TO1 A;  2ELA A;  1XD4 A;  1M7R A;  1H4R A;  1RRP B;  2NMB A;  1H10 A;  5C79 A;  3GYO A;  3KY9 A;  2CY4 A;  1U5F A;  1I2H A;  4P7I A;  2KUP A;  4GPT B;  5EFX A;  4B6H A;  4CYE A;  2J0J A;  4KVG B;  1NTV A;  3AU5 A;  1PMS A;  1DDM A;  1IRS A;  1TJ6 A;  3F0W A;  1XKE A;  3FEH A;  4F7H A;  4H8S A;  3BIN A;  2DX5 A;  1MKE A;  4EJN A;  4HAW B;  2IFS A;  1U5E A;  1ZM0 A;  2COF A;  2J0M A;  1P6S A;  2H7D A;  1M7E A;  2D9Y A;  4GN1 A;  2OTX A;  1X86 A;  3PG7 A;  3D8F A;  2CAY A;  3KRW A;  4HAY B;  4GMX B;  3PP2 A;  3X23 A;  2UZS A;  1FHX A;  2BCJ A;  2E2X A;  4YL8 A;  5DHA B;  4F7U P;  3TFM A;  2P0H A;  2RUK B;  1Y5O A;  3TCA A;  2GJY A;  2D4Q A;  5LOP B;  4EMO A;  4A5K A;  2DHI A;  2P0D A;  2Z0O A;  2W2X D;  2AL6 A;  5J3Q A;  2YRY A;  5FI1 A;  4GXB A;  1FGY A;  1UNQ A;  2I1J A;  4DXA B;  5DH9 B;  2H7E A;  3TW1 A;  3ZVR A;  1TQZ A;  1UEF A;  3TVV A;  2UVM A;  2QKL A;  2YF0 A;  4IAP A;  2RGN B;  1I7A A;  3LJU X;  4MK0 A;  2D10 A;  4HB2 B;  4A6F B;  1MIZ B;  3MPX A;  5C6R A;  4EKU A;  2HTH B;  1WGQ A;  1XOD A;  3CXB B;  1V89 A;  2Y8G A;  2COD A;  3T06 A;  1DYN A;  3OAN A;  4CHJ A;  5D3W A;  4HAU B;  3PVL A;  4MT7 A;  3A8Q A;  3ODX A;  3QBV B;  1MK9 B;  4HAZ B;  2OQB A;  3M1I B;  1B55 A;  3HQC A;  2D11 A;  5D27 A;  4TKN A;  2YSZ A;  3KZ1 A;  1V5P A;  1RJ2 A;  2LKO A;  1X05 A;  3QIJ A;  1EVH A;  2EJ8 A;  5JP4 A;  2EC1 A;  2G35 A;  5HE2 A;  2N23 A;  3KRX A;  2MFQ A;  2YS1 A;  2I5F A;  1Q67 A;  2Z0P A;  1DDW A;  3IVF A;  2V76 A;  4YON A;  2RNR B;  1QQG A;  4HAT B;  1KZ7 A;  4A6H A;  1MIX A;  3G9W A;  2L2I A;  3PEG A;  5CLQ B;  4K2O A;  1GC6 A;  1P3R A;  2ADZ A;  1WJ1 A;  2RVB B;  1UPQ A;  2GS0 A;  2VKI A;  1W1D A;  1V88 A;  1N3H A;  3DXE A;  4Y94 A;  1U29 A;  1PLS A;  2EMS A;  4NY0 A;  2NZ8 B;  2Y8F A;  1UNP A;  2MWN B;  2X18 A;  1DRO A;  3PVW A;  3KSY A;  1EGX A;  3SO6 A;  3MDB C;  1E5W A;  1BWN A;  2K2J A;  1KI1 B;  1MAI A;  5C5B A;  2JP2 A;  3A8P A;  4CHM A;  1V5U A;  3AJ4 A;  3NSU A;  3P7Z A;  3SUZ A;  4BBK A;  5JLJ B;  1NTY A;  3PZD A;  1SHC A;  4XWX A;  1BAK A;  2M14 A;  3ML4 A;  1WG7 A;  1WVH A;  4HDO A;  1U5D A;  1U5G A;  2COC A;  4MY6 A;  1X1F A;  1ZC4 B;  1OMW A;  1X1G A;  4KAX B;  4A6F A;  2DLW A;  3FSS A;  2ROZ B;  2LUL A;  1FHO A;  2VSZ A;  1J0W A;  1BTK A;  1WGU A;  2W2X C;  4HDQ A;  1FGZ A;  5C16 A;  5GOW B;  5KQ1 A;  1GG3 A;  2XQN M;  2HE7 A;  1K5D B;  2R09 A;  1U2B A;  3U8Z A;  4HB0 B;  3CIK A;  1Y19 B;  3BJI A;  1NI2 A;  2I5C A;  2DKQ A;  1U27 A;  2DN6 A;  2D9Z A;  2LOX A;  5HE0 A;  2DTC A;  4NSW A;  1ZSQ A;  3ULB A;  3AU4 A;  4HAX B;  2P8V A;  1W1H A;  2J59 M;  5JHG A;  5DIF B;  1SGH A;  1K5G B;  5HE3 A;  1EAZ A;  3V5W A;  2DA0 A;  1ZVR A;  5J3T A;  3N7C A;  5D3X A;  1Z87 A;  2LOZ A;  2GCL A;  3U7D A;  3ODO A;  4PNK A;  2D9X A;  3F5R A;  4KHO A;  5FI0 A;  5KCV A;  4HHV A;  4TYZ A;  2RLO A;  4F7G A;  1X11 A;  2I1K A;  1EF1 A;  2N0Y A;  5D3Y A;  2D9V A;  2CY5 A;  2ZPY A;  4Z2N A;  3QWM A;  2K2U A;  4ZRI A;  2M38 A;  3DXC A;  2YVC A;  1NU2 A;  1ISN A;  2D2Q A;  3HW2 B;  4HAV B;  2AEH A;  3D8E A;  5C5B B;  1TXD A;  1BTN A;  2MDX A;  1QC6 A;  1UPR A;  4WVF B;  1WJM A;  4Z2M B;  4DX8 A;  2Q13 A;  4DX9 0;  1FHW A;  5CLL B;  1XCG A;  4K2P A;  2QKM A;  1UNR A;  2CRF A;  5L81 A;  4GZU A;  4DBB A;  3D8D A;  2W2W A;  4ZRJ A;  4K81 A;  4A6K A;  5J3Y A;  2DYN A;  1AWE A;  4WSF A;  2COA A;  2PZ1 A;  3ODW A;  3WA0 A;  1P5T A;  2VRW B;  1OY2 A;  1V61 A;  2ROV A;  3ULC A;  2YT1 A;  4HB4 B;  2Y7B A;  1MK7 B;  5KQ4 A;  5LON B;  1AQC A;  2L1C A;  1DDV A;  2DX1 A;  4ZRK A;  2MKR A;  1W1G A;  4L6E A;  5JHH A;  1DBH A;  1OQN A;  3A98 B;  3UZT A;  3ZDT A;  2DFK A;  2YS3 A;  1MPH A;  2RSG A;  2R0D A;  2YT0 A;  1FAO A;  2GCJ A;  2LYD A;  2P0F A;  4K17 A;  1LB1 A;  1FB8 A;  1FOE A;  2KGX B;  2K00 A;  5D3V A;  4C0A A;  4KHA A;  3PVU A;  5DHF B;  4KHB B;  1LW3 A;  1XR0 B;  4HB3 B;  2J0K A;  5HE1 A;  4GMV A;  2D9W A;  2FJL A;  1WI1 A;  1XX0 A;  2DKP A; 
#chains in the Genus database with same CATH topology
 1J19 A;  1GC7 A;  4WJ7 A;  4IFS A;  2LG1 A;  1ZC3 B;  2YS5 A;  2DHJ A;  3WYF B;  4IOY X;  1V5M A;  3RCP A;  3FM8 C;  2EMT A;  3VIA A;  1KZG A;  2UZR A;  2Z0Q A;  3SV1 A;  3SYX A;  1PFJ A;  3HK0 A;  3O96 A;  3P6A A;  2DYQ A;  4D0N B;  3PSC A;  3GYP A;  5DI9 B;  4PQ0 A;  2ELB A;  3SNH A;  2DHK A;  2IYB A;  4GNK B;  3VOQ A;  3DXD A;  2KCJ A;  3TO1 A;  2ELA A;  1XD4 A;  1M7R A;  1H4R A;  3HSA A;  4DIX A;  1RRP B;  2NMB A;  1H10 A;  5C79 A;  3GYO A;  3KY9 A;  2CY4 A;  1U5F A;  1I2H A;  4P7I A;  2KUP A;  3B77 A;  4GPT B;  5EFX A;  4B6H A;  4CYE A;  2J0J A;  4KVG B;  1NTV A;  4HSI A;  3AU5 A;  1PMS A;  1DDM A;  1IRS A;  1TJ6 A;  3F0W A;  1XKE A;  3FEH A;  4F7H A;  4H8S A;  3BIN A;  2DX5 A;  1MKE A;  4EJN A;  4HAW B;  2IFS A;  1U5E A;  1ZM0 A;  2COF A;  2J0M A;  1P6S A;  2H7D A;  1M7E A;  2D9Y A;  4GN1 A;  2OTX A;  1X86 A;  3PG7 A;  3HIE A;  3D8F A;  2CAY A;  3KRW A;  4HAY B;  4GMX B;  3PP2 A;  3X23 A;  2UZS A;  1FHX A;  2BCJ A;  2E2X A;  4YL8 A;  5DHA B;  4F7U P;  3TFM A;  2P0H A;  2RUK B;  5LG4 B;  1Y5O A;  3TCA A;  2GJY A;  2D4Q A;  5LOP B;  3OHM B;  3U12 A;  4L1R A;  4EMO A;  4A5K A;  3NWD A;  2DHI A;  2P0D A;  2Z0O A;  2W2X D;  2AL6 A;  5J3Q A;  2YRY A;  5FI1 A;  4GOU A;  4GXB A;  1FGY A;  3NWA A;  1UNQ A;  2I1J A;  4DXA B;  5DH9 B;  2H7E A;  3TW1 A;  3ZVR A;  1TQZ A;  1UEF A;  3TVV A;  2UVM A;  2QKL A;  2YF0 A;  4IAP A;  2RGN B;  1I7A A;  5M4Y B;  3LJU X;  4MK0 A;  2D10 A;  4HB2 B;  4A6F B;  1MIZ B;  3MPX A;  5C6R A;  4EKU A;  2HTH B;  1WGQ A;  1XOD A;  3CXB B;  1V89 A;  2Y8G A;  2COD A;  3T06 A;  1DYN A;  3OAN A;  4CHJ A;  5D3W A;  4HAU B;  4CSQ A;  3PVL A;  4MT7 A;  3A8Q A;  3ODX A;  3QBV B;  1MK9 B;  4HAZ B;  2OQB A;  3M1I B;  1B55 A;  3HQC A;  2D11 A;  5D27 A;  4TKN A;  2YSZ A;  3KZ1 A;  2GUM A;  1V5P A;  1RJ2 A;  2LKO A;  1X05 A;  3QIJ A;  1EVH A;  2EJ8 A;  5JP4 A;  4OT1 A;  2EC1 A;  2G35 A;  5HE2 A;  2N23 A;  3KRX A;  2MFQ A;  2YS1 A;  2I5F A;  1Q67 A;  4QXA B;  2Z0P A;  1DDW A;  3IVF A;  2V76 A;  4YON A;  2RNR B;  1QQG A;  4HAT B;  1KZ7 A;  4A6H A;  1MIX A;  1MI1 A;  3G9W A;  2L2I A;  3PEG A;  5CLQ B;  4K2O A;  1GC6 A;  1P3R A;  2ADZ A;  1WJ1 A;  2ZKM X;  2RVB B;  1UPQ A;  2GS0 A;  2VKI A;  3NWF A;  1W1D A;  1V88 A;  1N3H A;  3DXE A;  4Y94 A;  5I2S A;  1U29 A;  2KR0 A;  1PLS A;  2EMS A;  4NY0 A;  2NZ8 B;  2Y8F A;  1UNP A;  2MWN B;  2X18 A;  1DRO A;  3PVW A;  3KSY A;  1EGX A;  3SO6 A;  3MDB C;  1E5W A;  1BWN A;  2K2J A;  1KI1 B;  1MAI A;  5C5B A;  2JP2 A;  3A8P A;  4CHM A;  1V5U A;  3AJ4 A;  3NSU A;  3P7Z A;  3SUZ A;  4BBK A;  2Z59 A;  5JLJ B;  1NTY A;  3PZD A;  1SHC A;  4XWX A;  1BAK A;  2M14 A;  3ML4 A;  2NBV A;  3FVC A;  1WG7 A;  1WVH A;  4HDO A;  1U5D A;  1U5G A;  2COC A;  4MY6 A;  1X1F A;  1ZC4 B;  4QJ5 B;  1OMW A;  1X1G A;  4KAX B;  4A6F A;  2DLW A;  3FSS A;  2ROZ B;  2LUL A;  1FHO A;  2VSZ A;  1J0W A;  1BTK A;  1WGU A;  2W2X C;  2Z13 A;  4HDQ A;  1FGZ A;  5C16 A;  5GOW B;  5KQ1 A;  1GG3 A;  2XQN M;  2HE7 A;  1K5D B;  2R09 A;  1U2B A;  4KHB A;  3U8Z A;  4HB0 B;  3CIK A;  1Y19 B;  3BJI A;  1NI2 A;  2I5C A;  2DKQ A;  1U27 A;  2DN6 A;  2D9Z A;  4QJ3 B;  2LOX A;  5HE0 A;  2DTC A;  4NSW A;  1ZSQ A;  3ULB A;  3AU4 A;  4HAX B;  2P8V A;  1W1H A;  2J59 M;  5JHG A;  1ZYI A;  5DIF B;  1SGH A;  5IRS A;  1K5G B;  5HE3 A;  1EAZ A;  3V5W A;  2DA0 A;  2KIE A;  1ZVR A;  5J3T A;  3N7C A;  5D3X A;  1Z87 A;  2LOZ A;  2GCL A;  3U7D A;  3ODO A;  4PNK A;  2D9X A;  3F5R A;  4KHO A;  5FI0 A;  5KCV A;  2Z4D A;  4HHV A;  4TYZ A;  2RLO A;  4F7G A;  1X11 A;  2I1K A;  1EF1 A;  2N0Y A;  5D3Y A;  2D9V A;  2CY5 A;  4QJ4 B;  2ZPY A;  4Z2N A;  3QWM A;  2K2U A;  4ZRI A;  2M38 A;  3DXC A;  2YVC A;  1NU2 A;  1ISN A;  2KUQ A;  2D2Q A;  3HW2 B;  4HAV B;  2AEH A;  3D8E A;  5C5B B;  2K8E A;  1TXD A;  1BTN A;  2MDX A;  1QC6 A;  1UPR A;  4WVF B;  4D6W A;  1WJM A;  4Z2M B;  4DX8 A;  2Q13 A;  4DX9 0;  1FHW A;  5CLL B;  1XCG A;  4K2P A;  5I2M A;  2QKM A;  1UNR A;  2CRF A;  5L81 A;  4GZU A;  4DBB A;  2YT2 A;  3D8D A;  2W2W A;  4ZRJ A;  3NW8 A;  4K81 A;  2R2Y A;  2FJU B;  4A6K A;  5J3Y A;  2DYN A;  1AWE A;  4WSF A;  2COA A;  2PZ1 A;  3ODW A;  3WA0 A;  1P5T A;  2VRW B;  2K49 A;  1OY2 A;  1V61 A;  3A58 A;  2ROV A;  3ULC A;  2RRF A;  2YT1 A;  4HB4 B;  2Y7B A;  1MK7 B;  5KQ4 A;  5LON B;  1AQC A;  3DCX A;  2L1C A;  1DDV A;  2DX1 A;  4ZRK A;  4OSN A;  2MKR A;  2KIG A;  1W1G A;  4L6E A;  5JHH A;  1DBH A;  1OQN A;  2Z14 A;  3A98 B;  3UZT A;  3ZDT A;  2DFK A;  2YS3 A;  1MPH A;  2RSG A;  2R0D A;  2YT0 A;  1FAO A;  2GCJ A;  2LYD A;  2P0F A;  4K17 A;  1LB1 A;  1FB8 A;  1FOE A;  2KGX B;  2K00 A;  5D3V A;  4C0A A;  4KHA A;  3PVU A;  5DHF B;  4KHB B;  1LW3 A;  1XR0 B;  4HB3 B;  2J0K A;  5HE1 A;  4GMV A;  2D9W A;  2FJL A;  1WI1 A;  1XX0 A;  1T77 A;  2DKP A; 
#chains in the Genus database with same CATH homology
 1J19 A;  1GC7 A;  4WJ7 A;  4IFS A;  2LG1 A;  1ZC3 B;  2YS5 A;  2DHJ A;  3WYF B;  4IOY X;  1V5M A;  3RCP A;  3FM8 C;  2EMT A;  3VIA A;  1KZG A;  2UZR A;  2Z0Q A;  3SV1 A;  3SYX A;  1PFJ A;  3HK0 A;  3O96 A;  3P6A A;  2DYQ A;  4D0N B;  3PSC A;  3GYP A;  5DI9 B;  4PQ0 A;  2ELB A;  3SNH A;  2DHK A;  2IYB A;  3VOQ A;  3DXD A;  2KCJ A;  3TO1 A;  2ELA A;  1XD4 A;  1M7R A;  1H4R A;  1RRP B;  2NMB A;  1H10 A;  5C79 A;  3GYO A;  3KY9 A;  2CY4 A;  1U5F A;  1I2H A;  4P7I A;  2KUP A;  4GPT B;  5EFX A;  4B6H A;  4CYE A;  2J0J A;  4KVG B;  1NTV A;  3AU5 A;  1PMS A;  1DDM A;  1IRS A;  1TJ6 A;  3F0W A;  1XKE A;  3FEH A;  4F7H A;  4H8S A;  3BIN A;  2DX5 A;  1MKE A;  4EJN A;  4HAW B;  2IFS A;  1U5E A;  1ZM0 A;  2COF A;  2J0M A;  1P6S A;  2H7D A;  1M7E A;  2D9Y A;  4GN1 A;  2OTX A;  1X86 A;  3PG7 A;  3D8F A;  2CAY A;  3KRW A;  4HAY B;  4GMX B;  3PP2 A;  3X23 A;  2UZS A;  1FHX A;  2BCJ A;  2E2X A;  4YL8 A;  5DHA B;  4F7U P;  3TFM A;  2P0H A;  2RUK B;  1Y5O A;  3TCA A;  2GJY A;  2D4Q A;  5LOP B;  4EMO A;  4A5K A;  2DHI A;  2P0D A;  2Z0O A;  2W2X D;  2AL6 A;  5J3Q A;  2YRY A;  5FI1 A;  4GXB A;  1FGY A;  1UNQ A;  2I1J A;  4DXA B;  5DH9 B;  2H7E A;  3TW1 A;  3ZVR A;  1TQZ A;  1UEF A;  3TVV A;  2UVM A;  2QKL A;  2YF0 A;  4IAP A;  2RGN B;  1I7A A;  3LJU X;  4MK0 A;  2D10 A;  4HB2 B;  4A6F B;  1MIZ B;  3MPX A;  5C6R A;  4EKU A;  2HTH B;  1WGQ A;  1XOD A;  3CXB B;  1V89 A;  2Y8G A;  2COD A;  3T06 A;  1DYN A;  3OAN A;  4CHJ A;  5D3W A;  4HAU B;  3PVL A;  4MT7 A;  3A8Q A;  3ODX A;  3QBV B;  1MK9 B;  4HAZ B;  2OQB A;  3M1I B;  1B55 A;  3HQC A;  2D11 A;  5D27 A;  4TKN A;  2YSZ A;  3KZ1 A;  1V5P A;  1RJ2 A;  2LKO A;  1X05 A;  3QIJ A;  1EVH A;  2EJ8 A;  5JP4 A;  2EC1 A;  2G35 A;  5HE2 A;  2N23 A;  3KRX A;  2MFQ A;  2YS1 A;  2I5F A;  1Q67 A;  2Z0P A;  1DDW A;  3IVF A;  2V76 A;  4YON A;  2RNR B;  1QQG A;  4HAT B;  1KZ7 A;  4A6H A;  1MIX A;  3G9W A;  2L2I A;  3PEG A;  5CLQ B;  4K2O A;  1GC6 A;  1P3R A;  2ADZ A;  1WJ1 A;  2RVB B;  1UPQ A;  2GS0 A;  2VKI A;  1W1D A;  1V88 A;  1N3H A;  3DXE A;  4Y94 A;  1U29 A;  1PLS A;  2EMS A;  4NY0 A;  2NZ8 B;  2Y8F A;  1UNP A;  2MWN B;  2X18 A;  1DRO A;  3PVW A;  3KSY A;  1EGX A;  3SO6 A;  3MDB C;  1E5W A;  1BWN A;  2K2J A;  1KI1 B;  1MAI A;  5C5B A;  2JP2 A;  3A8P A;  4CHM A;  1V5U A;  3AJ4 A;  3NSU A;  3P7Z A;  3SUZ A;  4BBK A;  5JLJ B;  1NTY A;  3PZD A;  1SHC A;  4XWX A;  1BAK A;  2M14 A;  3ML4 A;  1WG7 A;  1WVH A;  4HDO A;  1U5D A;  1U5G A;  2COC A;  4MY6 A;  1X1F A;  1ZC4 B;  1OMW A;  1X1G A;  4KAX B;  4A6F A;  2DLW A;  3FSS A;  2ROZ B;  2LUL A;  1FHO A;  2VSZ A;  1J0W A;  1BTK A;  1WGU A;  2W2X C;  4HDQ A;  1FGZ A;  5C16 A;  5GOW B;  5KQ1 A;  1GG3 A;  2XQN M;  2HE7 A;  1K5D B;  2R09 A;  1U2B A;  3U8Z A;  4HB0 B;  3CIK A;  1Y19 B;  3BJI A;  1NI2 A;  2I5C A;  2DKQ A;  1U27 A;  2DN6 A;  2D9Z A;  2LOX A;  5HE0 A;  2DTC A;  4NSW A;  1ZSQ A;  3ULB A;  3AU4 A;  4HAX B;  2P8V A;  1W1H A;  2J59 M;  5JHG A;  5DIF B;  1SGH A;  1K5G B;  5HE3 A;  1EAZ A;  3V5W A;  2DA0 A;  1ZVR A;  5J3T A;  3N7C A;  5D3X A;  1Z87 A;  2LOZ A;  2GCL A;  3U7D A;  3ODO A;  4PNK A;  2D9X A;  3F5R A;  4KHO A;  5FI0 A;  5KCV A;  4HHV A;  4TYZ A;  2RLO A;  4F7G A;  1X11 A;  2I1K A;  1EF1 A;  2N0Y A;  5D3Y A;  2D9V A;  2CY5 A;  2ZPY A;  4Z2N A;  3QWM A;  2K2U A;  4ZRI A;  2M38 A;  3DXC A;  2YVC A;  1NU2 A;  1ISN A;  2D2Q A;  3HW2 B;  4HAV B;  2AEH A;  3D8E A;  5C5B B;  1TXD A;  1BTN A;  2MDX A;  1QC6 A;  1UPR A;  4WVF B;  1WJM A;  4Z2M B;  4DX8 A;  2Q13 A;  4DX9 0;  1FHW A;  5CLL B;  1XCG A;  4K2P A;  2QKM A;  1UNR A;  2CRF A;  5L81 A;  4GZU A;  4DBB A;  3D8D A;  2W2W A;  4ZRJ A;  4K81 A;  4A6K A;  5J3Y A;  2DYN A;  1AWE A;  4WSF A;  2COA A;  2PZ1 A;  3ODW A;  3WA0 A;  1P5T A;  2VRW B;  1OY2 A;  1V61 A;  2ROV A;  3ULC A;  2YT1 A;  4HB4 B;  2Y7B A;  1MK7 B;  5KQ4 A;  5LON B;  1AQC A;  2L1C A;  1DDV A;  2DX1 A;  4ZRK A;  2MKR A;  1W1G A;  4L6E A;  5JHH A;  1DBH A;  1OQN A;  3A98 B;  3UZT A;  3ZDT A;  2DFK A;  2YS3 A;  1MPH A;  2RSG A;  2R0D A;  2YT0 A;  1FAO A;  2GCJ A;  2LYD A;  2P0F A;  4K17 A;  1LB1 A;  1FB8 A;  1FOE A;  2KGX B;  2K00 A;  5D3V A;  4C0A A;  4KHA A;  3PVU A;  5DHF B;  4KHB B;  1LW3 A;  1XR0 B;  4HB3 B;  2J0K A;  5HE1 A;  4GMV A;  2D9W A;  2FJL A;  1WI1 A;  1XX0 A;  2DKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...