5C6RA

Crystal structure of ph domain of asap1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
110
structure length
110
Chain Sequence
b'QLQGNKEYGSEKKGFLLKKSDGIRKVWQRRKCAVKNGILTISHATSNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYIAWISVLTNSKEEALTMAFRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Arf-GAP
publication title Molecular Basis for Cooperative Binding of Anionic Phospholipids to the PH Domain of the Arf GAP ASAP1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 28
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5c6rA00
3UZTA 2W2XC 2DA0A 2N23A 2I1JA 4KVGB 3G9WA 5LONB 1PLSA 1XKEA 1WGQA 1ZC4B 1NU2A 4HB3B 4HAZB 4Z2NA 2HE7A 4BBKA 2Y8FA 1U5FA 2LG1A 5C6RA 4DX90 2LYDA 1W1HA 3AJ4A 3HQCA 5KQ4A 4TYZA 2RLOA 1GG3A 4EJNA 3PVUA 3NSUA 3N7CA 1BTNA 2BCJA 1FHXA 5DH9B 1LW3A 1ZC3B 4GZUA 1AQCA 2DHJA 1Y5OA 3QIJA 1V88A 1XD4A 3TCAA 2DX5A 1MAIA 1Y19B 2YT1A 3ODOA 1GC7A 3KY9A 2YS1A 1QQGA 2D10A 2MWNB 1WJ1A 1J19A 1XX0A 2H7EA 3PEGA 3QBVB 2LULA 5D3VA 2V76A 5JHGA 2UZSA 2IYBA 2GCJA 3WA0A 2FJLA 2D9VA 2P0HA 3FSSA 2AL6A 2P8VA 2R0DA 2L2IA 4K2PA 1FAOA 3AU5A 1Q67A 5KQ1A 3X23A 5JP4A 1V89A 1K5DB 3HW2B 4F7UP 4A6FA 2G35A 2ADZA 1EAZA 1WVHA 1OQNA 1RJ2A 2L1CA 3IVFA 3MPXA 4YONA 2UVMA 4H8SA 3SNHA 3DXDA 4MT7A 2I1KA 1WI1A 2NMBA 2W2XD 3FEHA 3PSCA 2DFKA 2RUKB 1SHCA 4KHBB 1U27A 4MY6A 2CAYA 4A5KA 3F5RA 4D0NB 4GN1A 3RCPA 1FOEA 4K17A 3D8DA 5JLJB 1ISNA 3ZVRA 1UNPA 3ODWA 2PZ1A 5DHFB 2YRYA 4ZRIA 4A6FB 1NTVA 2ELAA 2H7DA 1UEFA 4HAVB 4CHMA 5D27A 4C0AA 1NI2A 4IAPA 2IFSA 3HK0A 2KUPA 4IOYX 1WJMA 3TVVA 1SGHA 1MK7B 2QKMA 2LKOA 3U8ZA 1I7AA 5CLQB 3FM8C 1B55A 1WGUA 2K2JA 2OQBA 1KZGA 4HHVA 2YVCA 1OMWA 2VSZA 4GMXB 1V5MA 4HATB 3WYFB 1FGZA 3SYXA 2ZPYA 2D4QA 1KZ7A 2DN6A 1IRSA 1H10A 1FB8A 4L6EA 4Y94A 2Z0OA 1MIXA 1MKEA 1OY2A 1QC6A 4CYEA 1V5PA 4K81A 1W1DA 3SUZA 4DBBA 1DBHA 5KCVA 1UNQA 1P6SA 1TQZA 1UNRA 4ZRJA 1M7EA 1DDVA 5C79A 1GC6A 1U29A 2EMSA 2Y7BA 4HAWB 5L81A 1X1GA 3U7DA 2COAA 2MKRA 2N0YA 3SO6A 2HTHB 1BWNA 3PZDA 1W1GA 1ZVRA 2QKLA 2DYNA 1ZM0A 2EC1A 5J3YA 3QWMA 1UPQA 1FHWA 5J3QA 2M38A 2KCJA 3P6AA 3TW1A 1EGXA 4NSWA 4WJ7A 4F7GA 1DDWA 4HB2B 4HB0B 2D9ZA 2YS5A 2CY4A 1MPHA 2VKIA 5JHHA 4HAXB 2D11A 1PMSA 5CLLB 2UZRA 3LJUX 2EMTA 2J0KA 2M14A 1BAKA 2DTCA 5D3XA 5C5BA 2R09A 4IFSA 1DYNA 1N3HA 5J3TA 3PVWA 2DYQA 3VOQA 3O96A 2YS3A 1P5TA 1M7RA 2J59M 4XWXA 3M1IB 4KHAA 2EJ8A 3F0WA 4NY0A 1KI1B 2ROZB 1V61A 2ELBA 2DLWA 1P3RA 3D8EA 4WSFA 4YL8A 3VIAA 1DROA 2VRWB 3ML4A 1UPRA 1U5GA 2GS0A 3DXCA 2KGXB 4PQ0A 4MK0A 2CY5A 2YSZA 5C5BB 4A6HA 4HDOA 1X86A 2K2UA 3AU4A 2D9XA 1U5EA 2DHIA 3SV1A 3P7ZA 3A8PA 3PG7A 3A8QA 2Q13A 4HAYB 2LOZA 2X18A 2XQNM 4HDQA 1X05A 5D3WA 3ULBA 2D2QA 1TXDA 3BJIA 1MK9B 4GPTB 1LB1A 1EF1A 5HE3A 1PFJA 2Z0QA 5D3YA 3TO1A 2YF0A 1V5UA 4WVFB 4A6KA 1TJ6A 2YT0A 4TKNA 3KZ1A 1BTKA 2MFQA 2D9WA 3D8FA 4CHJA 4B6HA 5HE0A 2NZ8B 2AEHA 2CODA 2MDXA 2COCA 2P0FA 2Y8GA 3PP2A 3DXEA 2COFA 2Z0PA 3ULCA 3A98B 2P0DA 2GCLA 2RNRB 1DDMA 3GYOA 2J0JA 2RGNB 1I2HA 1FHOA 5C16A 1ZSQA 1FGYA 2I5FA 2J0MA 5DI9B 2JP2A 2GJYA 1RRPB 5HE1A 4P7IA 2W2WA 2D9YA 4ZRKA 1WG7A 4K2OA 2K00A 5DIFB 2I5CA 2DHKA 4KAXB 3KRXA 3PVLA 5HE2A 2RSGA 3ODXA 1H4RA 4PNKA 3T06A 2OTXA 3KRWA 1NTYA 1Z87A 1U2BA 4KHOA 5FI1A 3OANA 3GYPA 4HB4B 5DHAB 4F7HA 1XR0B 4GXBA 3TFMA 4HAUB 4DX8A 1AWEA 5FI0A 2DKQA 3CIKA 1K5GB 3MDBC 3BINA 2RVBB 4Z2MB 4GMVA 5EFXA 1U5DA 2DX1A 1X11A 4EMOA 1XCGA 4EKUA 3KSYA 2ROVA 5LOPB 4DXAB 3CXBB 1EVHA 1X1FA 5GOWB 2CRFA 2E2XA 1MIZB 1J0WA 1E5WA 2DKPA 1XODA 2LOXA 3V5WA 3ZDTA
chains in the Genus database with same CATH superfamily
3UZTA 2W2XC 2DA0A 2N23A 2I1JA 4KVGB 3FVCA 3G9WA 5LONB 1PLSA 1XKEA 1WGQA 1ZC4B 1NU2A 2K8EA 4HB3B 4HAZB 4Z2NA 2HE7A 4BBKA 2Y8FA 1U5FA 2LG1A 5C6RA 4DX90 2LYDA 1W1HA 3AJ4A 3HQCA 5KQ4A 4TYZA 2RLOA 1GG3A 2Z13A 4EJNA 3PVUA 4QJ5B 3NSUA 3N7CA 1BTNA 2BCJA 1FHXA 5DH9B 1LW3A 1ZC3B 4GZUA 1AQCA 2DHJA 1Y5OA 3QIJA 1V88A 1XD4A 3TCAA 2DX5A 1MAIA 2Z59A 1Y19B 2Z14A 2YT1A 3ODOA 1GC7A 3KY9A 2YS1A 1QQGA 2D10A 2MWNB 2KIGA 1WJ1A 1J19A 1XX0A 2H7EA 3PEGA 3QBVB 2LULA 5D3VA 2V76A 1ZYIA 5JHGA 2UZSA 2IYBA 2GCJA 3WA0A 2FJLA 2D9VA 2P0HA 3FSSA 2AL6A 2P8VA 2KIEA 2R0DA 2L2IA 4K2PA 1FAOA 3AU5A 4KHBA 4HSIA 1Q67A 5KQ1A 5M4YB 3X23A 5JP4A 1V89A 1K5DB 1MI1A 3HW2B 4F7UP 4A6FA 2G35A 2ADZA 1EAZA 1WVHA 2K49A 1OQNA 1RJ2A 2L1CA 3IVFA 3NWDA 3MPXA 4YONA 2UVMA 4H8SA 2YT2A 3SNHA 3DXDA 4MT7A 2I1KA 1WI1A 4GNKB 2NMBA 2W2XD 2Z4DA 3FEHA 3PSCA 2DFKA 2RUKB 1SHCA 4KHBB 1U27A 4MY6A 2CAYA 4QJ4B 4A5KA 3F5RA 4D0NB 4GN1A 3RCPA 1FOEA 4K17A 3D8DA 5JLJB 1ISNA 3ZVRA 1UNPA 3ODWA 2PZ1A 5DHFB 2YRYA 4ZRIA 4A6FB 1NTVA 2ELAA 2H7DA 1UEFA 4HAVB 4DIXA 4CHMA 5D27A 4C0AA 1NI2A 4IAPA 3DCXA 2IFSA 3HK0A 2KUPA 4IOYX 1WJMA 2R2YA 3TVVA 1SGHA 1MK7B 2QKMA 2LKOA 3U8ZA 1I7AA 5CLQB 3FM8C 1B55A 1WGUA 2K2JA 2OQBA 3HSAA 1KZGA 4HHVA 2YVCA 1OMWA 2VSZA 4GMXB 1V5MA 4HATB 3WYFB 1FGZA 3SYXA 2ZPYA 2D4QA 1KZ7A 2DN6A 1IRSA 1H10A 1FB8A 4L6EA 4Y94A 3NW8A 2Z0OA 1MIXA 1MKEA 1OY2A 1QC6A 4CYEA 4CSQA 1V5PA 4K81A 1W1DA 2NBVA 3SUZA 4DBBA 1DBHA 5KCVA 1UNQA 1P6SA 1TQZA 1UNRA 4ZRJA 1M7EA 1DDVA 5C79A 1GC6A 1U29A 2EMSA 2Y7BA 5I2SA 4HAWB 5L81A 1X1GA 3U7DA 2COAA 2MKRA 2N0YA 3SO6A 2HTHB 1BWNA 3PZDA 1W1GA 1ZVRA 2QKLA 2DYNA 1ZM0A 2EC1A 5J3YA 3QWMA 1UPQA 1FHWA 5J3QA 2M38A 2KCJA 3P6AA 3TW1A 1EGXA 3A58A 4NSWA 4WJ7A 4F7GA 1DDWA 4HB2B 4HB0B 2D9ZA 2YS5A 4GOUA 2CY4A 1MPHA 2VKIA 5JHHA 4HAXB 2D11A 1PMSA 5CLLB 5LG4B 2UZRA 3LJUX 2EMTA 2J0KA 2M14A 1BAKA 2DTCA 5D3XA 5C5BA 5IRSA 2R09A 4IFSA 1DYNA 1N3HA 5J3TA 3PVWA 2DYQA 3VOQA 3O96A 2RRFA 2YS3A 1P5TA 1M7RA 2J59M 4L1RA 4XWXA 3M1IB 4KHAA 2EJ8A 3F0WA 4NY0A 1KI1B 2ROZB 1V61A 4QXAB 2ELBA 2DLWA 1P3RA 3D8EA 3HIEA 3U12A 4WSFA 4YL8A 3VIAA 1DROA 2VRWB 3ML4A 1UPRA 1U5GA 2GS0A 3DXCA 2KGXB 4PQ0A 1T77A 4MK0A 2CY5A 2YSZA 5C5BB 4A6HA 4HDOA 1X86A 2K2UA 3AU4A 2D9XA 1U5EA 2DHIA 3SV1A 3P7ZA 3A8PA 3PG7A 3A8QA 2Q13A 3OHMB 4HAYB 2LOZA 2X18A 2XQNM 4HDQA 1X05A 5D3WA 3ULBA 2D2QA 1TXDA 3BJIA 1MK9B 4GPTB 1LB1A 1EF1A 5HE3A 1PFJA 2Z0QA 5D3YA 3TO1A 2YF0A 2GUMA 4QJ3B 1V5UA 4WVFB 4A6KA 1TJ6A 2YT0A 4TKNA 3KZ1A 1BTKA 2MFQA 2D9WA 3D8FA 4CHJA 4B6HA 5HE0A 2NZ8B 2AEHA 2CODA 2MDXA 2COCA 2P0FA 2Y8GA 3PP2A 3DXEA 2ZKMX 2COFA 4OSNA 2Z0PA 3ULCA 3A98B 2P0DA 2GCLA 2RNRB 1DDMA 3GYOA 2J0JA 2RGNB 1I2HA 1FHOA 5C16A 1ZSQA 3NWAA 1FGYA 2I5FA 2J0MA 5DI9B 2JP2A 2GJYA 1RRPB 2KUQA 5HE1A 4P7IA 2W2WA 2D9YA 4ZRKA 1WG7A 4K2OA 2K00A 5DIFB 2I5CA 2DHKA 2KR0A 4KAXB 3KRXA 3PVLA 5HE2A 2RSGA 3ODXA 1H4RA 2FJUB 4PNKA 3T06A 2OTXA 3KRWA 1NTYA 1Z87A 1U2BA 4KHOA 5FI1A 3OANA 3GYPA 4HB4B 5DHAB 4F7HA 1XR0B 4GXBA 3TFMA 4HAUB 4DX8A 1AWEA 5FI0A 3NWFA 2DKQA 5I2MA 3CIKA 1K5GB 3MDBC 3BINA 4OT1A 2RVBB 4Z2MB 4GMVA 5EFXA 1U5DA 2DX1A 1X11A 4EMOA 3B77A 1XCGA 4EKUA 3KSYA 2ROVA 5LOPB 4DXAB 3CXBB 1EVHA 1X1FA 5GOWB 4D6WA 2CRFA 2E2XA 1MIZB 1J0WA 1E5WA 2DKPA 1XODA 2LOXA 3V5WA 3ZDTA
chains in the Genus database with same CATH topology
3UZTA 2W2XC 2DA0A 2N23A 2I1JA 4KVGB 3G9WA 5LONB 1PLSA 1XKEA 1WGQA 1ZC4B 1NU2A 4HB3B 4HAZB 4Z2NA 2HE7A 4BBKA 2Y8FA 1U5FA 2LG1A 5C6RA 4DX90 2LYDA 1W1HA 3AJ4A 3HQCA 5KQ4A 4TYZA 2RLOA 1GG3A 4EJNA 3PVUA 3NSUA 3N7CA 1BTNA 2BCJA 1FHXA 5DH9B 1LW3A 1ZC3B 4GZUA 1AQCA 2DHJA 1Y5OA 3QIJA 1V88A 1XD4A 3TCAA 2DX5A 1MAIA 1Y19B 2YT1A 3ODOA 1GC7A 3KY9A 2YS1A 1QQGA 2D10A 2MWNB 1WJ1A 1J19A 1XX0A 2H7EA 3PEGA 3QBVB 2LULA 5D3VA 2V76A 5JHGA 2UZSA 2IYBA 2GCJA 3WA0A 2FJLA 2D9VA 2P0HA 3FSSA 2AL6A 2P8VA 2R0DA 2L2IA 4K2PA 1FAOA 3AU5A 1Q67A 5KQ1A 3X23A 5JP4A 1V89A 1K5DB 3HW2B 4F7UP 4A6FA 2G35A 2ADZA 1EAZA 1WVHA 1OQNA 1RJ2A 2L1CA 3IVFA 3MPXA 4YONA 2UVMA 4H8SA 3SNHA 3DXDA 4MT7A 2I1KA 1WI1A 2NMBA 2W2XD 3FEHA 3PSCA 2DFKA 2RUKB 1SHCA 4KHBB 1U27A 4MY6A 2CAYA 4A5KA 3F5RA 4D0NB 4GN1A 3RCPA 1FOEA 4K17A 3D8DA 5JLJB 1ISNA 3ZVRA 1UNPA 3ODWA 2PZ1A 5DHFB 2YRYA 4ZRIA 4A6FB 1NTVA 2ELAA 2H7DA 1UEFA 4HAVB 4CHMA 5D27A 4C0AA 1NI2A 4IAPA 2IFSA 3HK0A 2KUPA 4IOYX 1WJMA 3TVVA 1SGHA 1MK7B 2QKMA 2LKOA 3U8ZA 1I7AA 5CLQB 3FM8C 1B55A 1WGUA 2K2JA 2OQBA 1KZGA 4HHVA 2YVCA 1OMWA 2VSZA 4GMXB 1V5MA 4HATB 3WYFB 1FGZA 3SYXA 2ZPYA 2D4QA 1KZ7A 2DN6A 1IRSA 1H10A 1FB8A 4L6EA 4Y94A 2Z0OA 1MIXA 1MKEA 1OY2A 1QC6A 4CYEA 1V5PA 4K81A 1W1DA 3SUZA 4DBBA 1DBHA 5KCVA 1UNQA 1P6SA 1TQZA 1UNRA 4ZRJA 1M7EA 1DDVA 5C79A 1GC6A 1U29A 2EMSA 2Y7BA 4HAWB 5L81A 1X1GA 3U7DA 2COAA 2MKRA 2N0YA 3SO6A 2HTHB 1BWNA 3PZDA 1W1GA 1ZVRA 2QKLA 2DYNA 1ZM0A 2EC1A 5J3YA 3QWMA 1UPQA 1FHWA 5J3QA 2M38A 2KCJA 3P6AA 3TW1A 1EGXA 4NSWA 4WJ7A 4F7GA 1DDWA 4HB2B 4HB0B 2D9ZA 2YS5A 2CY4A 1MPHA 2VKIA 5JHHA 4HAXB 2D11A 1PMSA 5CLLB 2UZRA 3LJUX 2EMTA 2J0KA 2M14A 1BAKA 2DTCA 5D3XA 5C5BA 2R09A 4IFSA 1DYNA 1N3HA 5J3TA 3PVWA 2DYQA 3VOQA 3O96A 2YS3A 1P5TA 1M7RA 2J59M 4XWXA 3M1IB 4KHAA 2EJ8A 3F0WA 4NY0A 1KI1B 2ROZB 1V61A 2ELBA 2DLWA 1P3RA 3D8EA 4WSFA 4YL8A 3VIAA 1DROA 2VRWB 3ML4A 1UPRA 1U5GA 2GS0A 3DXCA 2KGXB 4PQ0A 4MK0A 2CY5A 2YSZA 5C5BB 4A6HA 4HDOA 1X86A 2K2UA 3AU4A 2D9XA 1U5EA 2DHIA 3SV1A 3P7ZA 3A8PA 3PG7A 3A8QA 2Q13A 4HAYB 2LOZA 2X18A 2XQNM 4HDQA 1X05A 5D3WA 3ULBA 2D2QA 1TXDA 3BJIA 1MK9B 4GPTB 1LB1A 1EF1A 5HE3A 1PFJA 2Z0QA 5D3YA 3TO1A 2YF0A 1V5UA 4WVFB 4A6KA 1TJ6A 2YT0A 4TKNA 3KZ1A 1BTKA 2MFQA 2D9WA 3D8FA 4CHJA 4B6HA 5HE0A 2NZ8B 2AEHA 2CODA 2MDXA 2COCA 2P0FA 2Y8GA 3PP2A 3DXEA 2COFA 2Z0PA 3ULCA 3A98B 2P0DA 2GCLA 2RNRB 1DDMA 3GYOA 2J0JA 2RGNB 1I2HA 1FHOA 5C16A 1ZSQA 1FGYA 2I5FA 2J0MA 5DI9B 2JP2A 2GJYA 1RRPB 5HE1A 4P7IA 2W2WA 2D9YA 4ZRKA 1WG7A 4K2OA 2K00A 5DIFB 2I5CA 2DHKA 4KAXB 3KRXA 3PVLA 5HE2A 2RSGA 3ODXA 1H4RA 4PNKA 3T06A 2OTXA 3KRWA 1NTYA 1Z87A 1U2BA 4KHOA 5FI1A 3OANA 3GYPA 4HB4B 5DHAB 4F7HA 1XR0B 4GXBA 3TFMA 4HAUB 4DX8A 1AWEA 5FI0A 2DKQA 3CIKA 1K5GB 3MDBC 3BINA 2RVBB 4Z2MB 4GMVA 5EFXA 1U5DA 2DX1A 1X11A 4EMOA 1XCGA 4EKUA 3KSYA 2ROVA 5LOPB 4DXAB 3CXBB 1EVHA 1X1FA 5GOWB 2CRFA 2E2XA 1MIZB 1J0WA 1E5WA 2DKPA 1XODA 2LOXA 3V5WA 3ZDTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UZT A;  2W2X C;  2DA0 A;  2N23 A;  2I1J A;  4KVG B;  3G9W A;  5LON B;  1PLS A;  1XKE A;  1WGQ A;  1ZC4 B;  1NU2 A;  4HB3 B;  4HAZ B;  4Z2N A;  2HE7 A;  4BBK A;  2Y8F A;  1U5F A;  2LG1 A;  5C6R A;  4DX9 0;  2LYD A;  1W1H A;  3AJ4 A;  3HQC A;  5KQ4 A;  4TYZ A;  2RLO A;  1GG3 A;  4EJN A;  3PVU A;  3NSU A;  3N7C A;  1BTN A;  2BCJ A;  1FHX A;  5DH9 B;  1LW3 A;  1ZC3 B;  4GZU A;  1AQC A;  2DHJ A;  1Y5O A;  3QIJ A;  1V88 A;  1XD4 A;  3TCA A;  2DX5 A;  1MAI A;  1Y19 B;  2YT1 A;  3ODO A;  1GC7 A;  3KY9 A;  2YS1 A;  1QQG A;  2D10 A;  2MWN B;  1WJ1 A;  1J19 A;  1XX0 A;  2H7E A;  3PEG A;  3QBV B;  2LUL A;  5D3V A;  2V76 A;  5JHG A;  2UZS A;  2IYB A;  2GCJ A;  3WA0 A;  2FJL A;  2D9V A;  2P0H A;  3FSS A;  2AL6 A;  2P8V A;  2R0D A;  2L2I A;  4K2P A;  1FAO A;  3AU5 A;  1Q67 A;  5KQ1 A;  3X23 A;  5JP4 A;  1V89 A;  1K5D B;  3HW2 B;  4F7U P;  4A6F A;  2G35 A;  2ADZ A;  1EAZ A;  1WVH A;  1OQN A;  1RJ2 A;  2L1C A;  3IVF A;  3MPX A;  4YON A;  2UVM A;  4H8S A;  3SNH A;  3DXD A;  4MT7 A;  2I1K A;  1WI1 A;  2NMB A;  2W2X D;  3FEH A;  3PSC A;  2DFK A;  2RUK B;  1SHC A;  4KHB B;  1U27 A;  4MY6 A;  2CAY A;  4A5K A;  3F5R A;  4D0N B;  4GN1 A;  3RCP A;  1FOE A;  4K17 A;  3D8D A;  5JLJ B;  1ISN A;  3ZVR A;  1UNP A;  3ODW A;  2PZ1 A;  5DHF B;  2YRY A;  4ZRI A;  4A6F B;  1NTV A;  2ELA A;  2H7D A;  1UEF A;  4HAV B;  4CHM A;  5D27 A;  4C0A A;  1NI2 A;  4IAP A;  2IFS A;  3HK0 A;  2KUP A;  4IOY X;  1WJM A;  3TVV A;  1SGH A;  1MK7 B;  2QKM A;  2LKO A;  3U8Z A;  1I7A A;  5CLQ B;  3FM8 C;  1B55 A;  1WGU A;  2K2J A;  2OQB A;  1KZG A;  4HHV A;  2YVC A;  1OMW A;  2VSZ A;  4GMX B;  1V5M A;  4HAT B;  3WYF B;  1FGZ A;  3SYX A;  2ZPY A;  2D4Q A;  1KZ7 A;  2DN6 A;  1IRS A;  1H10 A;  1FB8 A;  4L6E A;  4Y94 A;  2Z0O A;  1MIX A;  1MKE A;  1OY2 A;  1QC6 A;  4CYE A;  1V5P A;  4K81 A;  1W1D A;  3SUZ A;  4DBB A;  1DBH A;  5KCV A;  1UNQ A;  1P6S A;  1TQZ A;  1UNR A;  4ZRJ A;  1M7E A;  1DDV A;  5C79 A;  1GC6 A;  1U29 A;  2EMS A;  2Y7B A;  4HAW B;  5L81 A;  1X1G A;  3U7D A;  2COA A;  2MKR A;  2N0Y A;  3SO6 A;  2HTH B;  1BWN A;  3PZD A;  1W1G A;  1ZVR A;  2QKL A;  2DYN A;  1ZM0 A;  2EC1 A;  5J3Y A;  3QWM A;  1UPQ A;  1FHW A;  5J3Q A;  2M38 A;  2KCJ A;  3P6A A;  3TW1 A;  1EGX A;  4NSW A;  4WJ7 A;  4F7G A;  1DDW A;  4HB2 B;  4HB0 B;  2D9Z A;  2YS5 A;  2CY4 A;  1MPH A;  2VKI A;  5JHH A;  4HAX B;  2D11 A;  1PMS A;  5CLL B;  2UZR A;  3LJU X;  2EMT A;  2J0K A;  2M14 A;  1BAK A;  2DTC A;  5D3X A;  5C5B A;  2R09 A;  4IFS A;  1DYN A;  1N3H A;  5J3T A;  3PVW A;  2DYQ A;  3VOQ A;  3O96 A;  2YS3 A;  1P5T A;  1M7R A;  2J59 M;  4XWX A;  3M1I B;  4KHA A;  2EJ8 A;  3F0W A;  4NY0 A;  1KI1 B;  2ROZ B;  1V61 A;  2ELB A;  2DLW A;  1P3R A;  3D8E A;  4WSF A;  4YL8 A;  3VIA A;  1DRO A;  2VRW B;  3ML4 A;  1UPR A;  1U5G A;  2GS0 A;  3DXC A;  2KGX B;  4PQ0 A;  4MK0 A;  2CY5 A;  2YSZ A;  5C5B B;  4A6H A;  4HDO A;  1X86 A;  2K2U A;  3AU4 A;  2D9X A;  1U5E A;  2DHI A;  3SV1 A;  3P7Z A;  3A8P A;  3PG7 A;  3A8Q A;  2Q13 A;  4HAY B;  2LOZ A;  2X18 A;  2XQN M;  4HDQ A;  1X05 A;  5D3W A;  3ULB A;  2D2Q A;  1TXD A;  3BJI A;  1MK9 B;  4GPT B;  1LB1 A;  1EF1 A;  5HE3 A;  1PFJ A;  2Z0Q A;  5D3Y A;  3TO1 A;  2YF0 A;  1V5U A;  4WVF B;  4A6K A;  1TJ6 A;  2YT0 A;  4TKN A;  3KZ1 A;  1BTK A;  2MFQ A;  2D9W A;  3D8F A;  4CHJ A;  4B6H A;  5HE0 A;  2NZ8 B;  2AEH A;  2COD A;  2MDX A;  2COC A;  2P0F A;  2Y8G A;  3PP2 A;  3DXE A;  2COF A;  2Z0P A;  3ULC A;  3A98 B;  2P0D A;  2GCL A;  2RNR B;  1DDM A;  3GYO A;  2J0J A;  2RGN B;  1I2H A;  1FHO A;  5C16 A;  1ZSQ A;  1FGY A;  2I5F A;  2J0M A;  5DI9 B;  2JP2 A;  2GJY A;  1RRP B;  5HE1 A;  4P7I A;  2W2W A;  2D9Y A;  4ZRK A;  1WG7 A;  4K2O A;  2K00 A;  5DIF B;  2I5C A;  2DHK A;  4KAX B;  3KRX A;  3PVL A;  5HE2 A;  2RSG A;  3ODX A;  1H4R A;  4PNK A;  3T06 A;  2OTX A;  3KRW A;  1NTY A;  1Z87 A;  1U2B A;  4KHO A;  5FI1 A;  3OAN A;  3GYP A;  4HB4 B;  5DHA B;  4F7H A;  1XR0 B;  4GXB A;  3TFM A;  4HAU B;  4DX8 A;  1AWE A;  5FI0 A;  2DKQ A;  3CIK A;  1K5G B;  3MDB C;  3BIN A;  2RVB B;  4Z2M B;  4GMV A;  5EFX A;  1U5D A;  2DX1 A;  1X11 A;  4EMO A;  1XCG A;  4EKU A;  3KSY A;  2ROV A;  5LOP B;  4DXA B;  3CXB B;  1EVH A;  1X1F A;  5GOW B;  2CRF A;  2E2X A;  1MIZ B;  1J0W A;  1E5W A;  2DKP A;  1XOD A;  2LOX A;  3V5W A;  3ZDT A; 
#chains in the Genus database with same CATH topology
 3UZT A;  2W2X C;  2DA0 A;  2N23 A;  2I1J A;  4KVG B;  3FVC A;  3G9W A;  5LON B;  1PLS A;  1XKE A;  1WGQ A;  1ZC4 B;  1NU2 A;  2K8E A;  4HB3 B;  4HAZ B;  4Z2N A;  2HE7 A;  4BBK A;  2Y8F A;  1U5F A;  2LG1 A;  5C6R A;  4DX9 0;  2LYD A;  1W1H A;  3AJ4 A;  3HQC A;  5KQ4 A;  4TYZ A;  2RLO A;  1GG3 A;  2Z13 A;  4EJN A;  3PVU A;  4QJ5 B;  3NSU A;  3N7C A;  1BTN A;  2BCJ A;  1FHX A;  5DH9 B;  1LW3 A;  1ZC3 B;  4GZU A;  1AQC A;  2DHJ A;  1Y5O A;  3QIJ A;  1V88 A;  1XD4 A;  3TCA A;  2DX5 A;  1MAI A;  2Z59 A;  1Y19 B;  2Z14 A;  2YT1 A;  3ODO A;  1GC7 A;  3KY9 A;  2YS1 A;  1QQG A;  2D10 A;  2MWN B;  2KIG A;  1WJ1 A;  1J19 A;  1XX0 A;  2H7E A;  3PEG A;  3QBV B;  2LUL A;  5D3V A;  2V76 A;  1ZYI A;  5JHG A;  2UZS A;  2IYB A;  2GCJ A;  3WA0 A;  2FJL A;  2D9V A;  2P0H A;  3FSS A;  2AL6 A;  2P8V A;  2KIE A;  2R0D A;  2L2I A;  4K2P A;  1FAO A;  3AU5 A;  4KHB A;  4HSI A;  1Q67 A;  5KQ1 A;  5M4Y B;  3X23 A;  5JP4 A;  1V89 A;  1K5D B;  1MI1 A;  3HW2 B;  4F7U P;  4A6F A;  2G35 A;  2ADZ A;  1EAZ A;  1WVH A;  2K49 A;  1OQN A;  1RJ2 A;  2L1C A;  3IVF A;  3NWD A;  3MPX A;  4YON A;  2UVM A;  4H8S A;  2YT2 A;  3SNH A;  3DXD A;  4MT7 A;  2I1K A;  1WI1 A;  4GNK B;  2NMB A;  2W2X D;  2Z4D A;  3FEH A;  3PSC A;  2DFK A;  2RUK B;  1SHC A;  4KHB B;  1U27 A;  4MY6 A;  2CAY A;  4QJ4 B;  4A5K A;  3F5R A;  4D0N B;  4GN1 A;  3RCP A;  1FOE A;  4K17 A;  3D8D A;  5JLJ B;  1ISN A;  3ZVR A;  1UNP A;  3ODW A;  2PZ1 A;  5DHF B;  2YRY A;  4ZRI A;  4A6F B;  1NTV A;  2ELA A;  2H7D A;  1UEF A;  4HAV B;  4DIX A;  4CHM A;  5D27 A;  4C0A A;  1NI2 A;  4IAP A;  3DCX A;  2IFS A;  3HK0 A;  2KUP A;  4IOY X;  1WJM A;  2R2Y A;  3TVV A;  1SGH A;  1MK7 B;  2QKM A;  2LKO A;  3U8Z A;  1I7A A;  5CLQ B;  3FM8 C;  1B55 A;  1WGU A;  2K2J A;  2OQB A;  3HSA A;  1KZG A;  4HHV A;  2YVC A;  1OMW A;  2VSZ A;  4GMX B;  1V5M A;  4HAT B;  3WYF B;  1FGZ A;  3SYX A;  2ZPY A;  2D4Q A;  1KZ7 A;  2DN6 A;  1IRS A;  1H10 A;  1FB8 A;  4L6E A;  4Y94 A;  3NW8 A;  2Z0O A;  1MIX A;  1MKE A;  1OY2 A;  1QC6 A;  4CYE A;  4CSQ A;  1V5P A;  4K81 A;  1W1D A;  2NBV A;  3SUZ A;  4DBB A;  1DBH A;  5KCV A;  1UNQ A;  1P6S A;  1TQZ A;  1UNR A;  4ZRJ A;  1M7E A;  1DDV A;  5C79 A;  1GC6 A;  1U29 A;  2EMS A;  2Y7B A;  5I2S A;  4HAW B;  5L81 A;  1X1G A;  3U7D A;  2COA A;  2MKR A;  2N0Y A;  3SO6 A;  2HTH B;  1BWN A;  3PZD A;  1W1G A;  1ZVR A;  2QKL A;  2DYN A;  1ZM0 A;  2EC1 A;  5J3Y A;  3QWM A;  1UPQ A;  1FHW A;  5J3Q A;  2M38 A;  2KCJ A;  3P6A A;  3TW1 A;  1EGX A;  3A58 A;  4NSW A;  4WJ7 A;  4F7G A;  1DDW A;  4HB2 B;  4HB0 B;  2D9Z A;  2YS5 A;  4GOU A;  2CY4 A;  1MPH A;  2VKI A;  5JHH A;  4HAX B;  2D11 A;  1PMS A;  5CLL B;  5LG4 B;  2UZR A;  3LJU X;  2EMT A;  2J0K A;  2M14 A;  1BAK A;  2DTC A;  5D3X A;  5C5B A;  5IRS A;  2R09 A;  4IFS A;  1DYN A;  1N3H A;  5J3T A;  3PVW A;  2DYQ A;  3VOQ A;  3O96 A;  2RRF A;  2YS3 A;  1P5T A;  1M7R A;  2J59 M;  4L1R A;  4XWX A;  3M1I B;  4KHA A;  2EJ8 A;  3F0W A;  4NY0 A;  1KI1 B;  2ROZ B;  1V61 A;  4QXA B;  2ELB A;  2DLW A;  1P3R A;  3D8E A;  3HIE A;  3U12 A;  4WSF A;  4YL8 A;  3VIA A;  1DRO A;  2VRW B;  3ML4 A;  1UPR A;  1U5G A;  2GS0 A;  3DXC A;  2KGX B;  4PQ0 A;  1T77 A;  4MK0 A;  2CY5 A;  2YSZ A;  5C5B B;  4A6H A;  4HDO A;  1X86 A;  2K2U A;  3AU4 A;  2D9X A;  1U5E A;  2DHI A;  3SV1 A;  3P7Z A;  3A8P A;  3PG7 A;  3A8Q A;  2Q13 A;  3OHM B;  4HAY B;  2LOZ A;  2X18 A;  2XQN M;  4HDQ A;  1X05 A;  5D3W A;  3ULB A;  2D2Q A;  1TXD A;  3BJI A;  1MK9 B;  4GPT B;  1LB1 A;  1EF1 A;  5HE3 A;  1PFJ A;  2Z0Q A;  5D3Y A;  3TO1 A;  2YF0 A;  2GUM A;  4QJ3 B;  1V5U A;  4WVF B;  4A6K A;  1TJ6 A;  2YT0 A;  4TKN A;  3KZ1 A;  1BTK A;  2MFQ A;  2D9W A;  3D8F A;  4CHJ A;  4B6H A;  5HE0 A;  2NZ8 B;  2AEH A;  2COD A;  2MDX A;  2COC A;  2P0F A;  2Y8G A;  3PP2 A;  3DXE A;  2ZKM X;  2COF A;  4OSN A;  2Z0P A;  3ULC A;  3A98 B;  2P0D A;  2GCL A;  2RNR B;  1DDM A;  3GYO A;  2J0J A;  2RGN B;  1I2H A;  1FHO A;  5C16 A;  1ZSQ A;  3NWA A;  1FGY A;  2I5F A;  2J0M A;  5DI9 B;  2JP2 A;  2GJY A;  1RRP B;  2KUQ A;  5HE1 A;  4P7I A;  2W2W A;  2D9Y A;  4ZRK A;  1WG7 A;  4K2O A;  2K00 A;  5DIF B;  2I5C A;  2DHK A;  2KR0 A;  4KAX B;  3KRX A;  3PVL A;  5HE2 A;  2RSG A;  3ODX A;  1H4R A;  2FJU B;  4PNK A;  3T06 A;  2OTX A;  3KRW A;  1NTY A;  1Z87 A;  1U2B A;  4KHO A;  5FI1 A;  3OAN A;  3GYP A;  4HB4 B;  5DHA B;  4F7H A;  1XR0 B;  4GXB A;  3TFM A;  4HAU B;  4DX8 A;  1AWE A;  5FI0 A;  3NWF A;  2DKQ A;  5I2M A;  3CIK A;  1K5G B;  3MDB C;  3BIN A;  4OT1 A;  2RVB B;  4Z2M B;  4GMV A;  5EFX A;  1U5D A;  2DX1 A;  1X11 A;  4EMO A;  3B77 A;  1XCG A;  4EKU A;  3KSY A;  2ROV A;  5LOP B;  4DXA B;  3CXB B;  1EVH A;  1X1F A;  5GOW B;  4D6W A;  2CRF A;  2E2X A;  1MIZ B;  1J0W A;  1E5W A;  2DKP A;  1XOD A;  2LOX A;  3V5W A;  3ZDT A; 
#chains in the Genus database with same CATH homology
 3UZT A;  2W2X C;  2DA0 A;  2N23 A;  2I1J A;  4KVG B;  3G9W A;  5LON B;  1PLS A;  1XKE A;  1WGQ A;  1ZC4 B;  1NU2 A;  4HB3 B;  4HAZ B;  4Z2N A;  2HE7 A;  4BBK A;  2Y8F A;  1U5F A;  2LG1 A;  5C6R A;  4DX9 0;  2LYD A;  1W1H A;  3AJ4 A;  3HQC A;  5KQ4 A;  4TYZ A;  2RLO A;  1GG3 A;  4EJN A;  3PVU A;  3NSU A;  3N7C A;  1BTN A;  2BCJ A;  1FHX A;  5DH9 B;  1LW3 A;  1ZC3 B;  4GZU A;  1AQC A;  2DHJ A;  1Y5O A;  3QIJ A;  1V88 A;  1XD4 A;  3TCA A;  2DX5 A;  1MAI A;  1Y19 B;  2YT1 A;  3ODO A;  1GC7 A;  3KY9 A;  2YS1 A;  1QQG A;  2D10 A;  2MWN B;  1WJ1 A;  1J19 A;  1XX0 A;  2H7E A;  3PEG A;  3QBV B;  2LUL A;  5D3V A;  2V76 A;  5JHG A;  2UZS A;  2IYB A;  2GCJ A;  3WA0 A;  2FJL A;  2D9V A;  2P0H A;  3FSS A;  2AL6 A;  2P8V A;  2R0D A;  2L2I A;  4K2P A;  1FAO A;  3AU5 A;  1Q67 A;  5KQ1 A;  3X23 A;  5JP4 A;  1V89 A;  1K5D B;  3HW2 B;  4F7U P;  4A6F A;  2G35 A;  2ADZ A;  1EAZ A;  1WVH A;  1OQN A;  1RJ2 A;  2L1C A;  3IVF A;  3MPX A;  4YON A;  2UVM A;  4H8S A;  3SNH A;  3DXD A;  4MT7 A;  2I1K A;  1WI1 A;  2NMB A;  2W2X D;  3FEH A;  3PSC A;  2DFK A;  2RUK B;  1SHC A;  4KHB B;  1U27 A;  4MY6 A;  2CAY A;  4A5K A;  3F5R A;  4D0N B;  4GN1 A;  3RCP A;  1FOE A;  4K17 A;  3D8D A;  5JLJ B;  1ISN A;  3ZVR A;  1UNP A;  3ODW A;  2PZ1 A;  5DHF B;  2YRY A;  4ZRI A;  4A6F B;  1NTV A;  2ELA A;  2H7D A;  1UEF A;  4HAV B;  4CHM A;  5D27 A;  4C0A A;  1NI2 A;  4IAP A;  2IFS A;  3HK0 A;  2KUP A;  4IOY X;  1WJM A;  3TVV A;  1SGH A;  1MK7 B;  2QKM A;  2LKO A;  3U8Z A;  1I7A A;  5CLQ B;  3FM8 C;  1B55 A;  1WGU A;  2K2J A;  2OQB A;  1KZG A;  4HHV A;  2YVC A;  1OMW A;  2VSZ A;  4GMX B;  1V5M A;  4HAT B;  3WYF B;  1FGZ A;  3SYX A;  2ZPY A;  2D4Q A;  1KZ7 A;  2DN6 A;  1IRS A;  1H10 A;  1FB8 A;  4L6E A;  4Y94 A;  2Z0O A;  1MIX A;  1MKE A;  1OY2 A;  1QC6 A;  4CYE A;  1V5P A;  4K81 A;  1W1D A;  3SUZ A;  4DBB A;  1DBH A;  5KCV A;  1UNQ A;  1P6S A;  1TQZ A;  1UNR A;  4ZRJ A;  1M7E A;  1DDV A;  5C79 A;  1GC6 A;  1U29 A;  2EMS A;  2Y7B A;  4HAW B;  5L81 A;  1X1G A;  3U7D A;  2COA A;  2MKR A;  2N0Y A;  3SO6 A;  2HTH B;  1BWN A;  3PZD A;  1W1G A;  1ZVR A;  2QKL A;  2DYN A;  1ZM0 A;  2EC1 A;  5J3Y A;  3QWM A;  1UPQ A;  1FHW A;  5J3Q A;  2M38 A;  2KCJ A;  3P6A A;  3TW1 A;  1EGX A;  4NSW A;  4WJ7 A;  4F7G A;  1DDW A;  4HB2 B;  4HB0 B;  2D9Z A;  2YS5 A;  2CY4 A;  1MPH A;  2VKI A;  5JHH A;  4HAX B;  2D11 A;  1PMS A;  5CLL B;  2UZR A;  3LJU X;  2EMT A;  2J0K A;  2M14 A;  1BAK A;  2DTC A;  5D3X A;  5C5B A;  2R09 A;  4IFS A;  1DYN A;  1N3H A;  5J3T A;  3PVW A;  2DYQ A;  3VOQ A;  3O96 A;  2YS3 A;  1P5T A;  1M7R A;  2J59 M;  4XWX A;  3M1I B;  4KHA A;  2EJ8 A;  3F0W A;  4NY0 A;  1KI1 B;  2ROZ B;  1V61 A;  2ELB A;  2DLW A;  1P3R A;  3D8E A;  4WSF A;  4YL8 A;  3VIA A;  1DRO A;  2VRW B;  3ML4 A;  1UPR A;  1U5G A;  2GS0 A;  3DXC A;  2KGX B;  4PQ0 A;  4MK0 A;  2CY5 A;  2YSZ A;  5C5B B;  4A6H A;  4HDO A;  1X86 A;  2K2U A;  3AU4 A;  2D9X A;  1U5E A;  2DHI A;  3SV1 A;  3P7Z A;  3A8P A;  3PG7 A;  3A8Q A;  2Q13 A;  4HAY B;  2LOZ A;  2X18 A;  2XQN M;  4HDQ A;  1X05 A;  5D3W A;  3ULB A;  2D2Q A;  1TXD A;  3BJI A;  1MK9 B;  4GPT B;  1LB1 A;  1EF1 A;  5HE3 A;  1PFJ A;  2Z0Q A;  5D3Y A;  3TO1 A;  2YF0 A;  1V5U A;  4WVF B;  4A6K A;  1TJ6 A;  2YT0 A;  4TKN A;  3KZ1 A;  1BTK A;  2MFQ A;  2D9W A;  3D8F A;  4CHJ A;  4B6H A;  5HE0 A;  2NZ8 B;  2AEH A;  2COD A;  2MDX A;  2COC A;  2P0F A;  2Y8G A;  3PP2 A;  3DXE A;  2COF A;  2Z0P A;  3ULC A;  3A98 B;  2P0D A;  2GCL A;  2RNR B;  1DDM A;  3GYO A;  2J0J A;  2RGN B;  1I2H A;  1FHO A;  5C16 A;  1ZSQ A;  1FGY A;  2I5F A;  2J0M A;  5DI9 B;  2JP2 A;  2GJY A;  1RRP B;  5HE1 A;  4P7I A;  2W2W A;  2D9Y A;  4ZRK A;  1WG7 A;  4K2O A;  2K00 A;  5DIF B;  2I5C A;  2DHK A;  4KAX B;  3KRX A;  3PVL A;  5HE2 A;  2RSG A;  3ODX A;  1H4R A;  4PNK A;  3T06 A;  2OTX A;  3KRW A;  1NTY A;  1Z87 A;  1U2B A;  4KHO A;  5FI1 A;  3OAN A;  3GYP A;  4HB4 B;  5DHA B;  4F7H A;  1XR0 B;  4GXB A;  3TFM A;  4HAU B;  4DX8 A;  1AWE A;  5FI0 A;  2DKQ A;  3CIK A;  1K5G B;  3MDB C;  3BIN A;  2RVB B;  4Z2M B;  4GMV A;  5EFX A;  1U5D A;  2DX1 A;  1X11 A;  4EMO A;  1XCG A;  4EKU A;  3KSY A;  2ROV A;  5LOP B;  4DXA B;  3CXB B;  1EVH A;  1X1F A;  5GOW B;  2CRF A;  2E2X A;  1MIZ B;  1J0W A;  1E5W A;  2DKP A;  1XOD A;  2LOX A;  3V5W A;  3ZDT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...