5C6RA

Crystal structure of ph domain of asap1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
110
structure length
110
Chain Sequence
QLQGNKEYGSEKKGFLLKKSDGIRKVWQRRKCAVKNGILTISHATSNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYIAWISVLTNSKEEALTMAFRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Arf-GAP
publication title Molecular Basis for Cooperative Binding of Anionic Phospholipids to the PH Domain of the Arf GAP ASAP1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 28
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5c6rA00
2M14A 2DKQA 2P0HA 5JLJB 1OQNA 3QIJA 5JP4A 1J0WA 2IFSA 2K2UA 2PZ1A 4D0NB 1J19A 2DYQA 2RLOA 2X18A 3VOQA 1I7AA 1QC6A 4MK0A 4NY0A 3QBVB 2XQNM 1U29A 3PG7A 2DYNA 3GYOA 4HAVB 3ZVRA 1E5WA 1OMWA 5D3XA 2R0DA 2GCJA 1ZM0A 3PZDA 2YS3A 1DBHA 3DXCA 3LJUX 1BTNA 4K2OA 4HAXB 4TYZA 1U5DA 5EFXA 3U7DA 4P7IA 4A6FB 4DX90 1W1GA 1U2BA 4KHAA 2G35A 3ML4A 4GPTB 2VKIA 4K17A 3ZDTA 1UPQA 3AU4A 1FHXA 1NU2A 3PEGA 5C6RA 1UNPA 1V61A 2LOXA 2YT0A 4HAUB 3TVVA 4EMOA 3PP2A 1BAKA 2J59M 2KGXB 2DLWA 1FB8A 2BCJA 3WA0A 3TFMA 2I1JA 4HDOA 1XKEA 5C5BB 2HE7A 1N3HA 2CODA 3M1IB 2D9WA 1P6SA 2DHJA 2VRWB 1X11A 2LYDA 4EJNA 4EKUA 2FJLA 5FI1A 4YL8A 5J3TA 4A6KA 4Z2MB 2DKPA 4MT7A 5CLQB 5HE0A 1EF1A 3FM8C 4H8SA 2QKMA 3ULBA 2DX5A 1WVHA 3X23A 3TCAA 1WJMA 1NTVA 1ZVRA 3A8QA 4GN1A 1Y19B 2DN6A 2LOZA 3P7ZA 1EAZA 4A5KA 1GG3A 1FAOA 2UZRA 1Q67A 3ODOA 1XODA 2VSZA 2D11A 3MDBC 1V5MA 3D8EA 2RGNB 2P0FA 2OQBA 1GC7A 3VIAA 2YRYA 3OANA 3ODWA 5HE3A 3NSUA 3P6AA 3CIKA 2ROVA 2W2WA 4B6HA 1DDMA 2UZSA 3IVFA 1SHCA 5CLLB 1WGQA 5JHHA 4PNKA 2YF0A 1SGHA 3KRXA 5D27A 4WJ7A 5HE1A 5KCVA 1MIZB 5HE2A 2CY5A 2Z0PA 4HAZB 2GJYA 3SNHA 5DI9B 1MKEA 2D9VA 3N7CA 2Y8GA 1ISNA 3HK0A 3AJ4A 5J3YA 1U5EA 1XR0B 4TKNA 1BTKA 3RCPA 1EVHA 5C16A 4A6HA 1EGXA 3BJIA 1WI1A 4DX8A 2I5CA 4WSFA 1NTYA 3T06A 3KSYA 5GOWB 4Y94A 1UPRA 1X86A 1U5FA 1X1GA 3D8DA 4KVGB 2OTXA 4A6FA 2DTCA 1TXDA 4CYEA 4F7GA 2W2XD 2V76A 2N23A 3PVUA 4YONA 2Z0QA 2IYBA 1FHOA 3SV1A 1X05A 2EJ8A 5DH9B 2COCA 3F0WA 5KQ4A 2RUKB 1PFJA 1DYNA 1TQZA 3SUZA 1Y5OA 5KQ1A 3WYFB 2JP2A 3KY9A 1MIXA 2L2IA 1LW3A 3G9WA 1BWNA 2KCJA 5FI0A 2Z0OA 2ROZB 2MFQA 1XD4A 3A8PA 5C5BA 4HB0B 2DX1A 3QWMA 2Y7BA 2D9XA 1FOEA 2RNRB 1MK9B 2K2JA 2LG1A 5C79A 1UEFA 2MDXA 4HAWB 3KZ1A 4CHJA 4HB4B 2J0JA 1B55A 2L1CA 2UVMA 5D3WA 2EMTA 2Y8FA 2GS0A 1W1HA 1PLSA 2P8VA 1Z87A 1UNRA 1XCGA 1P5TA 4HB3B 5JHGA 2DHKA 3A98B 2CRFA 2LKOA 3MPXA 4F7UP 1K5GB 4KHOA 2D10A 1WGUA 1AWEA 2CY4A 2YS1A 1U5GA 2ADZA 4IAPA 4WVFB 2EMSA 2YS5A 1V89A 2GCLA 3PSCA 1FHWA 1P3RA 1DDVA 4IFSA 3KRWA 4MY6A 3PVWA 1XX0A 1TJ6A 2MKRA 3FEHA 5J3QA 2COFA 3V5WA 2ELAA 3DXEA 2LULA 2NMBA 5DIFB 4KAXB 4HAYB 3ULCA 2D9ZA 1FGZA 2I1KA 3F5RA 3SYXA 2W2XC 2CAYA 4ZRIA 2YSZA 2D9YA 5LOPB 2NZ8B 1AQCA 1LB1A 3CXBB 4ZRKA 2AL6A 2DA0A 4F7HA 3GYPA 3O96A 1M7EA 1W1DA 4ZRJA 2HTHB 1UNQA 2RSGA 3DXDA 4PQ0A 4XWXA 1H4RA 4GMXB 3D8FA 4CHMA 1KZGA 1DDWA 5D3VA 4GXBA 4KHBB 4K81A 4Z2NA 3HW2B 1KZ7A 1IRSA 2M38A 2R09A 1U27A 2DHIA 1MK7B 2Q13A 1KI1B 2QKLA 5L81A 1K5DB 2J0MA 3BINA 3U8ZA 1QQGA 1V5PA 3FSSA 3SO6A 2COAA 4DXAB 3UZTA 2H7EA 2RVBB 3PVLA 4NSWA 1MPHA 3ODXA 1X1FA 1NI2A 1FGYA 2AEHA 2YT1A 2ZPYA 4HB2B 3AU5A 1PMSA 1ZC4B 2K00A 4IOYX 2ELBA 3HQCA 2E2XA 2P0DA 1I2HA 4GMVA 1M7RA 4DBBA 2YVCA 5DHAB 1MAIA 2D4QA 4C0AA 1V5UA 2EC1A 1RRPB 3TO1A 2D2QA 1WJ1A 4HDQA 4K2PA 2H7DA 4HATB 1OY2A 1ZC3B 1ZSQA 5DHFB 1V88A 1GC6A 1DROA 2N0YA 4HHVA 1H10A 5LONB 4L6EA 1RJ2A 1WG7A 2I5FA 4BBKA 2MWNB 4GZUA 2DFKA 2KUPA 5D3YA 3TW1A 2J0KA
chains in the Genus database with same CATH superfamily
2M14A 2DKQA 2P0HA 5JLJB 1OQNA 3QIJA 5JP4A 1J0WA 2IFSA 2K2UA 4QXAB 2PZ1A 4D0NB 1J19A 2DYQA 2RLOA 2X18A 3VOQA 1I7AA 1QC6A 2YT2A 4MK0A 4NY0A 3QBVB 2XQNM 1MI1A 1U29A 3PG7A 2DYNA 2KR0A 3GYOA 4HAVB 3ZVRA 1E5WA 2K8EA 1OMWA 5D3XA 4QJ5B 2Z13A 2R0DA 2GCJA 1ZM0A 3PZDA 2YS3A 1DBHA 3DXCA 3LJUX 1BTNA 4K2OA 4HAXB 4TYZA 1U5DA 5EFXA 3U7DA 4P7IA 4A6FB 4DX90 1W1GA 1U2BA 4KHAA 2G35A 3ML4A 4GPTB 2VKIA 4K17A 3ZDTA 1T77A 1UPQA 3AU4A 1FHXA 1NU2A 3PEGA 5C6RA 1UNPA 1V61A 2LOXA 2YT0A 4HAUB 3TVVA 4EMOA 3PP2A 1BAKA 2J59M 2KGXB 2DLWA 1FB8A 5I2MA 2BCJA 3WA0A 3TFMA 2I1JA 2Z59A 4HDOA 1XKEA 5C5BB 2HE7A 1N3HA 2CODA 3M1IB 2KIGA 2D9WA 1P6SA 2DHJA 2VRWB 1X11A 2LYDA 4EJNA 2R2YA 4EKUA 2FJLA 5FI1A 4YL8A 5J3TA 4A6KA 4Z2MB 2DKPA 4MT7A 5CLQB 5HE0A 1EF1A 3FM8C 4H8SA 4D6WA 2QKMA 3ULBA 2DX5A 1WVHA 3FVCA 3X23A 3TCAA 1WJMA 1NTVA 1ZVRA 3DCXA 3A8QA 4GN1A 1Y19B 2DN6A 2LOZA 3P7ZA 1EAZA 4A5KA 1GG3A 1FAOA 2UZRA 1Q67A 3ODOA 1XODA 2VSZA 2D11A 3MDBC 1V5MA 3D8EA 2RGNB 2NBVA 2P0FA 2OQBA 1GC7A 3VIAA 2YRYA 3OANA 3ODWA 5HE3A 3NSUA 3P6AA 3B77A 3CIKA 2ROVA 2W2WA 4B6HA 1DDMA 2UZSA 3IVFA 1SHCA 5CLLB 4QJ3B 1WGQA 5JHHA 4PNKA 2YF0A 1SGHA 3KRXA 5D27A 2K49A 4WJ7A 5HE1A 5KCVA 1MIZB 5HE2A 2CY5A 2Z0PA 4HAZB 2GJYA 3SNHA 5DI9B 1MKEA 2D9VA 3N7CA 2Y8GA 1ISNA 5IRSA 3HK0A 2KUQA 3AJ4A 5J3YA 5LG4B 1U5EA 1XR0B 4TKNA 1BTKA 3RCPA 1EVHA 5C16A 4A6HA 1EGXA 3BJIA 1WI1A 2GUMA 4DX8A 2I5CA 4WSFA 1NTYA 3T06A 3KSYA 5GOWB 4Y94A 1UPRA 1X86A 1U5FA 1X1GA 2ZKMX 3D8DA 4KVGB 2OTXA 4A6FA 2Z14A 2DTCA 1TXDA 4CYEA 4F7GA 2W2XD 2V76A 2N23A 3PVUA 4YONA 2Z0QA 2IYBA 1FHOA 3SV1A 1X05A 2EJ8A 5DH9B 2COCA 3F0WA 5KQ4A 2RUKB 1PFJA 1DYNA 1TQZA 3SUZA 1Y5OA 5KQ1A 3WYFB 2JP2A 3KY9A 1MIXA 2L2IA 1LW3A 2FJUB 3G9WA 1BWNA 2KCJA 5FI0A 2Z0OA 2ROZB 2MFQA 1XD4A 3A8PA 5C5BA 4HB0B 2DX1A 3QWMA 2Y7BA 3NWAA 2D9XA 1FOEA 2RNRB 1MK9B 2K2JA 2LG1A 5C79A 1UEFA 2MDXA 4HAWB 3KZ1A 4CHJA 4HB4B 2J0JA 1B55A 2L1CA 2UVMA 5D3WA 2EMTA 2Y8FA 2GS0A 3OHMB 1W1HA 1PLSA 2P8VA 1Z87A 5I2SA 1UNRA 1ZYIA 1XCGA 1P5TA 4HB3B 4DIXA 5JHGA 2DHKA 3A98B 2CRFA 2LKOA 3U12A 3MPXA 4F7UP 1K5GB 4KHOA 2D10A 1WGUA 4HSIA 5M4YB 1AWEA 2CY4A 2YS1A 1U5GA 2ADZA 4IAPA 4WVFB 2EMSA 2YS5A 4OSNA 1V89A 2GCLA 3PSCA 1FHWA 1P3RA 1DDVA 3HIEA 4IFSA 3A58A 3KRWA 4MY6A 3HSAA 3PVWA 1XX0A 1TJ6A 2MKRA 3FEHA 5J3QA 2COFA 3V5WA 2ELAA 2RRFA 3DXEA 2LULA 2NMBA 5DIFB 4KAXB 4HAYB 3ULCA 2D9ZA 1FGZA 2I1KA 3F5RA 3SYXA 3NWDA 2W2XC 2CAYA 4ZRIA 2YSZA 2D9YA 4CSQA 5LOPB 2NZ8B 1AQCA 1LB1A 3CXBB 4ZRKA 3NWFA 2AL6A 2DA0A 4F7HA 3GYPA 3O96A 1M7EA 1W1DA 4GNKB 4ZRJA 2HTHB 1UNQA 2RSGA 3DXDA 4OT1A 4PQ0A 4XWXA 1H4RA 4GMXB 3D8FA 4CHMA 1KZGA 1DDWA 2KIEA 5D3VA 4GXBA 4KHBB 4K81A 4Z2NA 3HW2B 1KZ7A 1IRSA 2M38A 2R09A 1U27A 2DHIA 1MK7B 2Q13A 1KI1B 3NW8A 2QKLA 5L81A 1K5DB 2J0MA 3BINA 3U8ZA 1QQGA 1V5PA 3FSSA 3SO6A 2COAA 4DXAB 3UZTA 2H7EA 2RVBB 3PVLA 4KHBA 4NSWA 1MPHA 3ODXA 1X1FA 1NI2A 1FGYA 2AEHA 2YT1A 2ZPYA 4HB2B 3AU5A 1PMSA 1ZC4B 2K00A 4IOYX 2ELBA 3HQCA 2E2XA 2P0DA 4QJ4B 1I2HA 4GMVA 1M7RA 4DBBA 2YVCA 5DHAB 1MAIA 2D4QA 4C0AA 1V5UA 2EC1A 1RRPB 3TO1A 2D2QA 1WJ1A 4HDQA 4K2PA 2H7DA 4HATB 1OY2A 1ZC3B 2Z4DA 4L1RA 4GOUA 1ZSQA 5DHFB 1V88A 1GC6A 1DROA 2N0YA 4HHVA 1H10A 5LONB 4L6EA 1RJ2A 1WG7A 2I5FA 4BBKA 2MWNB 4GZUA 2DFKA 2KUPA 5D3YA 3TW1A 2J0KA
chains in the Genus database with same CATH topology
2M14A 2DKQA 2P0HA 5JLJB 1OQNA 3QIJA 5JP4A 1J0WA 2IFSA 2K2UA 2PZ1A 4D0NB 1J19A 2DYQA 2RLOA 2X18A 3VOQA 1I7AA 1QC6A 4MK0A 4NY0A 3QBVB 2XQNM 1U29A 3PG7A 2DYNA 3GYOA 4HAVB 3ZVRA 1E5WA 1OMWA 5D3XA 2R0DA 2GCJA 1ZM0A 3PZDA 2YS3A 1DBHA 3DXCA 3LJUX 1BTNA 4K2OA 4HAXB 4TYZA 1U5DA 5EFXA 3U7DA 4P7IA 4A6FB 4DX90 1W1GA 1U2BA 4KHAA 2G35A 3ML4A 4GPTB 2VKIA 4K17A 3ZDTA 1UPQA 3AU4A 1FHXA 1NU2A 3PEGA 5C6RA 1UNPA 1V61A 2LOXA 2YT0A 4HAUB 3TVVA 4EMOA 3PP2A 1BAKA 2J59M 2KGXB 2DLWA 1FB8A 2BCJA 3WA0A 3TFMA 2I1JA 4HDOA 1XKEA 5C5BB 2HE7A 1N3HA 2CODA 3M1IB 2D9WA 1P6SA 2DHJA 2VRWB 1X11A 2LYDA 4EJNA 4EKUA 2FJLA 5FI1A 4YL8A 5J3TA 4A6KA 4Z2MB 2DKPA 4MT7A 5CLQB 5HE0A 1EF1A 3FM8C 4H8SA 2QKMA 3ULBA 2DX5A 1WVHA 3X23A 3TCAA 1WJMA 1NTVA 1ZVRA 3A8QA 4GN1A 1Y19B 2DN6A 2LOZA 3P7ZA 1EAZA 4A5KA 1GG3A 1FAOA 2UZRA 1Q67A 3ODOA 1XODA 2VSZA 2D11A 3MDBC 1V5MA 3D8EA 2RGNB 2P0FA 2OQBA 1GC7A 3VIAA 2YRYA 3OANA 3ODWA 5HE3A 3NSUA 3P6AA 3CIKA 2ROVA 2W2WA 4B6HA 1DDMA 2UZSA 3IVFA 1SHCA 5CLLB 1WGQA 5JHHA 4PNKA 2YF0A 1SGHA 3KRXA 5D27A 4WJ7A 5HE1A 5KCVA 1MIZB 5HE2A 2CY5A 2Z0PA 4HAZB 2GJYA 3SNHA 5DI9B 1MKEA 2D9VA 3N7CA 2Y8GA 1ISNA 3HK0A 3AJ4A 5J3YA 1U5EA 1XR0B 4TKNA 1BTKA 3RCPA 1EVHA 5C16A 4A6HA 1EGXA 3BJIA 1WI1A 4DX8A 2I5CA 4WSFA 1NTYA 3T06A 3KSYA 5GOWB 4Y94A 1UPRA 1X86A 1U5FA 1X1GA 3D8DA 4KVGB 2OTXA 4A6FA 2DTCA 1TXDA 4CYEA 4F7GA 2W2XD 2V76A 2N23A 3PVUA 4YONA 2Z0QA 2IYBA 1FHOA 3SV1A 1X05A 2EJ8A 5DH9B 2COCA 3F0WA 5KQ4A 2RUKB 1PFJA 1DYNA 1TQZA 3SUZA 1Y5OA 5KQ1A 3WYFB 2JP2A 3KY9A 1MIXA 2L2IA 1LW3A 3G9WA 1BWNA 2KCJA 5FI0A 2Z0OA 2ROZB 2MFQA 1XD4A 3A8PA 5C5BA 4HB0B 2DX1A 3QWMA 2Y7BA 2D9XA 1FOEA 2RNRB 1MK9B 2K2JA 2LG1A 5C79A 1UEFA 2MDXA 4HAWB 3KZ1A 4CHJA 4HB4B 2J0JA 1B55A 2L1CA 2UVMA 5D3WA 2EMTA 2Y8FA 2GS0A 1W1HA 1PLSA 2P8VA 1Z87A 1UNRA 1XCGA 1P5TA 4HB3B 5JHGA 2DHKA 3A98B 2CRFA 2LKOA 3MPXA 4F7UP 1K5GB 4KHOA 2D10A 1WGUA 1AWEA 2CY4A 2YS1A 1U5GA 2ADZA 4IAPA 4WVFB 2EMSA 2YS5A 1V89A 2GCLA 3PSCA 1FHWA 1P3RA 1DDVA 4IFSA 3KRWA 4MY6A 3PVWA 1XX0A 1TJ6A 2MKRA 3FEHA 5J3QA 2COFA 3V5WA 2ELAA 3DXEA 2LULA 2NMBA 5DIFB 4KAXB 4HAYB 3ULCA 2D9ZA 1FGZA 2I1KA 3F5RA 3SYXA 2W2XC 2CAYA 4ZRIA 2YSZA 2D9YA 5LOPB 2NZ8B 1AQCA 1LB1A 3CXBB 4ZRKA 2AL6A 2DA0A 4F7HA 3GYPA 3O96A 1M7EA 1W1DA 4ZRJA 2HTHB 1UNQA 2RSGA 3DXDA 4PQ0A 4XWXA 1H4RA 4GMXB 3D8FA 4CHMA 1KZGA 1DDWA 5D3VA 4GXBA 4KHBB 4K81A 4Z2NA 3HW2B 1KZ7A 1IRSA 2M38A 2R09A 1U27A 2DHIA 1MK7B 2Q13A 1KI1B 2QKLA 5L81A 1K5DB 2J0MA 3BINA 3U8ZA 1QQGA 1V5PA 3FSSA 3SO6A 2COAA 4DXAB 3UZTA 2H7EA 2RVBB 3PVLA 4NSWA 1MPHA 3ODXA 1X1FA 1NI2A 1FGYA 2AEHA 2YT1A 2ZPYA 4HB2B 3AU5A 1PMSA 1ZC4B 2K00A 4IOYX 2ELBA 3HQCA 2E2XA 2P0DA 1I2HA 4GMVA 1M7RA 4DBBA 2YVCA 5DHAB 1MAIA 2D4QA 4C0AA 1V5UA 2EC1A 1RRPB 3TO1A 2D2QA 1WJ1A 4HDQA 4K2PA 2H7DA 4HATB 1OY2A 1ZC3B 1ZSQA 5DHFB 1V88A 1GC6A 1DROA 2N0YA 4HHVA 1H10A 5LONB 4L6EA 1RJ2A 1WG7A 2I5FA 4BBKA 2MWNB 4GZUA 2DFKA 2KUPA 5D3YA 3TW1A 2J0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M14 A;  2DKQ A;  2P0H A;  5JLJ B;  1OQN A;  3QIJ A;  5JP4 A;  1J0W A;  2IFS A;  2K2U A;  2PZ1 A;  4D0N B;  1J19 A;  2DYQ A;  2RLO A;  2X18 A;  3VOQ A;  1I7A A;  1QC6 A;  4MK0 A;  4NY0 A;  3QBV B;  2XQN M;  1U29 A;  3PG7 A;  2DYN A;  3GYO A;  4HAV B;  3ZVR A;  1E5W A;  1OMW A;  5D3X A;  2R0D A;  2GCJ A;  1ZM0 A;  3PZD A;  2YS3 A;  1DBH A;  3DXC A;  3LJU X;  1BTN A;  4K2O A;  4HAX B;  4TYZ A;  1U5D A;  5EFX A;  3U7D A;  4P7I A;  4A6F B;  4DX9 0;  1W1G A;  1U2B A;  4KHA A;  2G35 A;  3ML4 A;  4GPT B;  2VKI A;  4K17 A;  3ZDT A;  1UPQ A;  3AU4 A;  1FHX A;  1NU2 A;  3PEG A;  5C6R A;  1UNP A;  1V61 A;  2LOX A;  2YT0 A;  4HAU B;  3TVV A;  4EMO A;  3PP2 A;  1BAK A;  2J59 M;  2KGX B;  2DLW A;  1FB8 A;  2BCJ A;  3WA0 A;  3TFM A;  2I1J A;  4HDO A;  1XKE A;  5C5B B;  2HE7 A;  1N3H A;  2COD A;  3M1I B;  2D9W A;  1P6S A;  2DHJ A;  2VRW B;  1X11 A;  2LYD A;  4EJN A;  4EKU A;  2FJL A;  5FI1 A;  4YL8 A;  5J3T A;  4A6K A;  4Z2M B;  2DKP A;  4MT7 A;  5CLQ B;  5HE0 A;  1EF1 A;  3FM8 C;  4H8S A;  2QKM A;  3ULB A;  2DX5 A;  1WVH A;  3X23 A;  3TCA A;  1WJM A;  1NTV A;  1ZVR A;  3A8Q A;  4GN1 A;  1Y19 B;  2DN6 A;  2LOZ A;  3P7Z A;  1EAZ A;  4A5K A;  1GG3 A;  1FAO A;  2UZR A;  1Q67 A;  3ODO A;  1XOD A;  2VSZ A;  2D11 A;  3MDB C;  1V5M A;  3D8E A;  2RGN B;  2P0F A;  2OQB A;  1GC7 A;  3VIA A;  2YRY A;  3OAN A;  3ODW A;  5HE3 A;  3NSU A;  3P6A A;  3CIK A;  2ROV A;  2W2W A;  4B6H A;  1DDM A;  2UZS A;  3IVF A;  1SHC A;  5CLL B;  1WGQ A;  5JHH A;  4PNK A;  2YF0 A;  1SGH A;  3KRX A;  5D27 A;  4WJ7 A;  5HE1 A;  5KCV A;  1MIZ B;  5HE2 A;  2CY5 A;  2Z0P A;  4HAZ B;  2GJY A;  3SNH A;  5DI9 B;  1MKE A;  2D9V A;  3N7C A;  2Y8G A;  1ISN A;  3HK0 A;  3AJ4 A;  5J3Y A;  1U5E A;  1XR0 B;  4TKN A;  1BTK A;  3RCP A;  1EVH A;  5C16 A;  4A6H A;  1EGX A;  3BJI A;  1WI1 A;  4DX8 A;  2I5C A;  4WSF A;  1NTY A;  3T06 A;  3KSY A;  5GOW B;  4Y94 A;  1UPR A;  1X86 A;  1U5F A;  1X1G A;  3D8D A;  4KVG B;  2OTX A;  4A6F A;  2DTC A;  1TXD A;  4CYE A;  4F7G A;  2W2X D;  2V76 A;  2N23 A;  3PVU A;  4YON A;  2Z0Q A;  2IYB A;  1FHO A;  3SV1 A;  1X05 A;  2EJ8 A;  5DH9 B;  2COC A;  3F0W A;  5KQ4 A;  2RUK B;  1PFJ A;  1DYN A;  1TQZ A;  3SUZ A;  1Y5O A;  5KQ1 A;  3WYF B;  2JP2 A;  3KY9 A;  1MIX A;  2L2I A;  1LW3 A;  3G9W A;  1BWN A;  2KCJ A;  5FI0 A;  2Z0O A;  2ROZ B;  2MFQ A;  1XD4 A;  3A8P A;  5C5B A;  4HB0 B;  2DX1 A;  3QWM A;  2Y7B A;  2D9X A;  1FOE A;  2RNR B;  1MK9 B;  2K2J A;  2LG1 A;  5C79 A;  1UEF A;  2MDX A;  4HAW B;  3KZ1 A;  4CHJ A;  4HB4 B;  2J0J A;  1B55 A;  2L1C A;  2UVM A;  5D3W A;  2EMT A;  2Y8F A;  2GS0 A;  1W1H A;  1PLS A;  2P8V A;  1Z87 A;  1UNR A;  1XCG A;  1P5T A;  4HB3 B;  5JHG A;  2DHK A;  3A98 B;  2CRF A;  2LKO A;  3MPX A;  4F7U P;  1K5G B;  4KHO A;  2D10 A;  1WGU A;  1AWE A;  2CY4 A;  2YS1 A;  1U5G A;  2ADZ A;  4IAP A;  4WVF B;  2EMS A;  2YS5 A;  1V89 A;  2GCL A;  3PSC A;  1FHW A;  1P3R A;  1DDV A;  4IFS A;  3KRW A;  4MY6 A;  3PVW A;  1XX0 A;  1TJ6 A;  2MKR A;  3FEH A;  5J3Q A;  2COF A;  3V5W A;  2ELA A;  3DXE A;  2LUL A;  2NMB A;  5DIF B;  4KAX B;  4HAY B;  3ULC A;  2D9Z A;  1FGZ A;  2I1K A;  3F5R A;  3SYX A;  2W2X C;  2CAY A;  4ZRI A;  2YSZ A;  2D9Y A;  5LOP B;  2NZ8 B;  1AQC A;  1LB1 A;  3CXB B;  4ZRK A;  2AL6 A;  2DA0 A;  4F7H A;  3GYP A;  3O96 A;  1M7E A;  1W1D A;  4ZRJ A;  2HTH B;  1UNQ A;  2RSG A;  3DXD A;  4PQ0 A;  4XWX A;  1H4R A;  4GMX B;  3D8F A;  4CHM A;  1KZG A;  1DDW A;  5D3V A;  4GXB A;  4KHB B;  4K81 A;  4Z2N A;  3HW2 B;  1KZ7 A;  1IRS A;  2M38 A;  2R09 A;  1U27 A;  2DHI A;  1MK7 B;  2Q13 A;  1KI1 B;  2QKL A;  5L81 A;  1K5D B;  2J0M A;  3BIN A;  3U8Z A;  1QQG A;  1V5P A;  3FSS A;  3SO6 A;  2COA A;  4DXA B;  3UZT A;  2H7E A;  2RVB B;  3PVL A;  4NSW A;  1MPH A;  3ODX A;  1X1F A;  1NI2 A;  1FGY A;  2AEH A;  2YT1 A;  2ZPY A;  4HB2 B;  3AU5 A;  1PMS A;  1ZC4 B;  2K00 A;  4IOY X;  2ELB A;  3HQC A;  2E2X A;  2P0D A;  1I2H A;  4GMV A;  1M7R A;  4DBB A;  2YVC A;  5DHA B;  1MAI A;  2D4Q A;  4C0A A;  1V5U A;  2EC1 A;  1RRP B;  3TO1 A;  2D2Q A;  1WJ1 A;  4HDQ A;  4K2P A;  2H7D A;  4HAT B;  1OY2 A;  1ZC3 B;  1ZSQ A;  5DHF B;  1V88 A;  1GC6 A;  1DRO A;  2N0Y A;  4HHV A;  1H10 A;  5LON B;  4L6E A;  1RJ2 A;  1WG7 A;  2I5F A;  4BBK A;  2MWN B;  4GZU A;  2DFK A;  2KUP A;  5D3Y A;  3TW1 A;  2J0K A; 
#chains in the Genus database with same CATH topology
 2M14 A;  2DKQ A;  2P0H A;  5JLJ B;  1OQN A;  3QIJ A;  5JP4 A;  1J0W A;  2IFS A;  2K2U A;  4QXA B;  2PZ1 A;  4D0N B;  1J19 A;  2DYQ A;  2RLO A;  2X18 A;  3VOQ A;  1I7A A;  1QC6 A;  2YT2 A;  4MK0 A;  4NY0 A;  3QBV B;  2XQN M;  1MI1 A;  1U29 A;  3PG7 A;  2DYN A;  2KR0 A;  3GYO A;  4HAV B;  3ZVR A;  1E5W A;  2K8E A;  1OMW A;  5D3X A;  4QJ5 B;  2Z13 A;  2R0D A;  2GCJ A;  1ZM0 A;  3PZD A;  2YS3 A;  1DBH A;  3DXC A;  3LJU X;  1BTN A;  4K2O A;  4HAX B;  4TYZ A;  1U5D A;  5EFX A;  3U7D A;  4P7I A;  4A6F B;  4DX9 0;  1W1G A;  1U2B A;  4KHA A;  2G35 A;  3ML4 A;  4GPT B;  2VKI A;  4K17 A;  3ZDT A;  1T77 A;  1UPQ A;  3AU4 A;  1FHX A;  1NU2 A;  3PEG A;  5C6R A;  1UNP A;  1V61 A;  2LOX A;  2YT0 A;  4HAU B;  3TVV A;  4EMO A;  3PP2 A;  1BAK A;  2J59 M;  2KGX B;  2DLW A;  1FB8 A;  5I2M A;  2BCJ A;  3WA0 A;  3TFM A;  2I1J A;  2Z59 A;  4HDO A;  1XKE A;  5C5B B;  2HE7 A;  1N3H A;  2COD A;  3M1I B;  2KIG A;  2D9W A;  1P6S A;  2DHJ A;  2VRW B;  1X11 A;  2LYD A;  4EJN A;  2R2Y A;  4EKU A;  2FJL A;  5FI1 A;  4YL8 A;  5J3T A;  4A6K A;  4Z2M B;  2DKP A;  4MT7 A;  5CLQ B;  5HE0 A;  1EF1 A;  3FM8 C;  4H8S A;  4D6W A;  2QKM A;  3ULB A;  2DX5 A;  1WVH A;  3FVC A;  3X23 A;  3TCA A;  1WJM A;  1NTV A;  1ZVR A;  3DCX A;  3A8Q A;  4GN1 A;  1Y19 B;  2DN6 A;  2LOZ A;  3P7Z A;  1EAZ A;  4A5K A;  1GG3 A;  1FAO A;  2UZR A;  1Q67 A;  3ODO A;  1XOD A;  2VSZ A;  2D11 A;  3MDB C;  1V5M A;  3D8E A;  2RGN B;  2NBV A;  2P0F A;  2OQB A;  1GC7 A;  3VIA A;  2YRY A;  3OAN A;  3ODW A;  5HE3 A;  3NSU A;  3P6A A;  3B77 A;  3CIK A;  2ROV A;  2W2W A;  4B6H A;  1DDM A;  2UZS A;  3IVF A;  1SHC A;  5CLL B;  4QJ3 B;  1WGQ A;  5JHH A;  4PNK A;  2YF0 A;  1SGH A;  3KRX A;  5D27 A;  2K49 A;  4WJ7 A;  5HE1 A;  5KCV A;  1MIZ B;  5HE2 A;  2CY5 A;  2Z0P A;  4HAZ B;  2GJY A;  3SNH A;  5DI9 B;  1MKE A;  2D9V A;  3N7C A;  2Y8G A;  1ISN A;  5IRS A;  3HK0 A;  2KUQ A;  3AJ4 A;  5J3Y A;  5LG4 B;  1U5E A;  1XR0 B;  4TKN A;  1BTK A;  3RCP A;  1EVH A;  5C16 A;  4A6H A;  1EGX A;  3BJI A;  1WI1 A;  2GUM A;  4DX8 A;  2I5C A;  4WSF A;  1NTY A;  3T06 A;  3KSY A;  5GOW B;  4Y94 A;  1UPR A;  1X86 A;  1U5F A;  1X1G A;  2ZKM X;  3D8D A;  4KVG B;  2OTX A;  4A6F A;  2Z14 A;  2DTC A;  1TXD A;  4CYE A;  4F7G A;  2W2X D;  2V76 A;  2N23 A;  3PVU A;  4YON A;  2Z0Q A;  2IYB A;  1FHO A;  3SV1 A;  1X05 A;  2EJ8 A;  5DH9 B;  2COC A;  3F0W A;  5KQ4 A;  2RUK B;  1PFJ A;  1DYN A;  1TQZ A;  3SUZ A;  1Y5O A;  5KQ1 A;  3WYF B;  2JP2 A;  3KY9 A;  1MIX A;  2L2I A;  1LW3 A;  2FJU B;  3G9W A;  1BWN A;  2KCJ A;  5FI0 A;  2Z0O A;  2ROZ B;  2MFQ A;  1XD4 A;  3A8P A;  5C5B A;  4HB0 B;  2DX1 A;  3QWM A;  2Y7B A;  3NWA A;  2D9X A;  1FOE A;  2RNR B;  1MK9 B;  2K2J A;  2LG1 A;  5C79 A;  1UEF A;  2MDX A;  4HAW B;  3KZ1 A;  4CHJ A;  4HB4 B;  2J0J A;  1B55 A;  2L1C A;  2UVM A;  5D3W A;  2EMT A;  2Y8F A;  2GS0 A;  3OHM B;  1W1H A;  1PLS A;  2P8V A;  1Z87 A;  5I2S A;  1UNR A;  1ZYI A;  1XCG A;  1P5T A;  4HB3 B;  4DIX A;  5JHG A;  2DHK A;  3A98 B;  2CRF A;  2LKO A;  3U12 A;  3MPX A;  4F7U P;  1K5G B;  4KHO A;  2D10 A;  1WGU A;  4HSI A;  5M4Y B;  1AWE A;  2CY4 A;  2YS1 A;  1U5G A;  2ADZ A;  4IAP A;  4WVF B;  2EMS A;  2YS5 A;  4OSN A;  1V89 A;  2GCL A;  3PSC A;  1FHW A;  1P3R A;  1DDV A;  3HIE A;  4IFS A;  3A58 A;  3KRW A;  4MY6 A;  3HSA A;  3PVW A;  1XX0 A;  1TJ6 A;  2MKR A;  3FEH A;  5J3Q A;  2COF A;  3V5W A;  2ELA A;  2RRF A;  3DXE A;  2LUL A;  2NMB A;  5DIF B;  4KAX B;  4HAY B;  3ULC A;  2D9Z A;  1FGZ A;  2I1K A;  3F5R A;  3SYX A;  3NWD A;  2W2X C;  2CAY A;  4ZRI A;  2YSZ A;  2D9Y A;  4CSQ A;  5LOP B;  2NZ8 B;  1AQC A;  1LB1 A;  3CXB B;  4ZRK A;  3NWF A;  2AL6 A;  2DA0 A;  4F7H A;  3GYP A;  3O96 A;  1M7E A;  1W1D A;  4GNK B;  4ZRJ A;  2HTH B;  1UNQ A;  2RSG A;  3DXD A;  4OT1 A;  4PQ0 A;  4XWX A;  1H4R A;  4GMX B;  3D8F A;  4CHM A;  1KZG A;  1DDW A;  2KIE A;  5D3V A;  4GXB A;  4KHB B;  4K81 A;  4Z2N A;  3HW2 B;  1KZ7 A;  1IRS A;  2M38 A;  2R09 A;  1U27 A;  2DHI A;  1MK7 B;  2Q13 A;  1KI1 B;  3NW8 A;  2QKL A;  5L81 A;  1K5D B;  2J0M A;  3BIN A;  3U8Z A;  1QQG A;  1V5P A;  3FSS A;  3SO6 A;  2COA A;  4DXA B;  3UZT A;  2H7E A;  2RVB B;  3PVL A;  4KHB A;  4NSW A;  1MPH A;  3ODX A;  1X1F A;  1NI2 A;  1FGY A;  2AEH A;  2YT1 A;  2ZPY A;  4HB2 B;  3AU5 A;  1PMS A;  1ZC4 B;  2K00 A;  4IOY X;  2ELB A;  3HQC A;  2E2X A;  2P0D A;  4QJ4 B;  1I2H A;  4GMV A;  1M7R A;  4DBB A;  2YVC A;  5DHA B;  1MAI A;  2D4Q A;  4C0A A;  1V5U A;  2EC1 A;  1RRP B;  3TO1 A;  2D2Q A;  1WJ1 A;  4HDQ A;  4K2P A;  2H7D A;  4HAT B;  1OY2 A;  1ZC3 B;  2Z4D A;  4L1R A;  4GOU A;  1ZSQ A;  5DHF B;  1V88 A;  1GC6 A;  1DRO A;  2N0Y A;  4HHV A;  1H10 A;  5LON B;  4L6E A;  1RJ2 A;  1WG7 A;  2I5F A;  4BBK A;  2MWN B;  4GZU A;  2DFK A;  2KUP A;  5D3Y A;  3TW1 A;  2J0K A; 
#chains in the Genus database with same CATH homology
 2M14 A;  2DKQ A;  2P0H A;  5JLJ B;  1OQN A;  3QIJ A;  5JP4 A;  1J0W A;  2IFS A;  2K2U A;  2PZ1 A;  4D0N B;  1J19 A;  2DYQ A;  2RLO A;  2X18 A;  3VOQ A;  1I7A A;  1QC6 A;  4MK0 A;  4NY0 A;  3QBV B;  2XQN M;  1U29 A;  3PG7 A;  2DYN A;  3GYO A;  4HAV B;  3ZVR A;  1E5W A;  1OMW A;  5D3X A;  2R0D A;  2GCJ A;  1ZM0 A;  3PZD A;  2YS3 A;  1DBH A;  3DXC A;  3LJU X;  1BTN A;  4K2O A;  4HAX B;  4TYZ A;  1U5D A;  5EFX A;  3U7D A;  4P7I A;  4A6F B;  4DX9 0;  1W1G A;  1U2B A;  4KHA A;  2G35 A;  3ML4 A;  4GPT B;  2VKI A;  4K17 A;  3ZDT A;  1UPQ A;  3AU4 A;  1FHX A;  1NU2 A;  3PEG A;  5C6R A;  1UNP A;  1V61 A;  2LOX A;  2YT0 A;  4HAU B;  3TVV A;  4EMO A;  3PP2 A;  1BAK A;  2J59 M;  2KGX B;  2DLW A;  1FB8 A;  2BCJ A;  3WA0 A;  3TFM A;  2I1J A;  4HDO A;  1XKE A;  5C5B B;  2HE7 A;  1N3H A;  2COD A;  3M1I B;  2D9W A;  1P6S A;  2DHJ A;  2VRW B;  1X11 A;  2LYD A;  4EJN A;  4EKU A;  2FJL A;  5FI1 A;  4YL8 A;  5J3T A;  4A6K A;  4Z2M B;  2DKP A;  4MT7 A;  5CLQ B;  5HE0 A;  1EF1 A;  3FM8 C;  4H8S A;  2QKM A;  3ULB A;  2DX5 A;  1WVH A;  3X23 A;  3TCA A;  1WJM A;  1NTV A;  1ZVR A;  3A8Q A;  4GN1 A;  1Y19 B;  2DN6 A;  2LOZ A;  3P7Z A;  1EAZ A;  4A5K A;  1GG3 A;  1FAO A;  2UZR A;  1Q67 A;  3ODO A;  1XOD A;  2VSZ A;  2D11 A;  3MDB C;  1V5M A;  3D8E A;  2RGN B;  2P0F A;  2OQB A;  1GC7 A;  3VIA A;  2YRY A;  3OAN A;  3ODW A;  5HE3 A;  3NSU A;  3P6A A;  3CIK A;  2ROV A;  2W2W A;  4B6H A;  1DDM A;  2UZS A;  3IVF A;  1SHC A;  5CLL B;  1WGQ A;  5JHH A;  4PNK A;  2YF0 A;  1SGH A;  3KRX A;  5D27 A;  4WJ7 A;  5HE1 A;  5KCV A;  1MIZ B;  5HE2 A;  2CY5 A;  2Z0P A;  4HAZ B;  2GJY A;  3SNH A;  5DI9 B;  1MKE A;  2D9V A;  3N7C A;  2Y8G A;  1ISN A;  3HK0 A;  3AJ4 A;  5J3Y A;  1U5E A;  1XR0 B;  4TKN A;  1BTK A;  3RCP A;  1EVH A;  5C16 A;  4A6H A;  1EGX A;  3BJI A;  1WI1 A;  4DX8 A;  2I5C A;  4WSF A;  1NTY A;  3T06 A;  3KSY A;  5GOW B;  4Y94 A;  1UPR A;  1X86 A;  1U5F A;  1X1G A;  3D8D A;  4KVG B;  2OTX A;  4A6F A;  2DTC A;  1TXD A;  4CYE A;  4F7G A;  2W2X D;  2V76 A;  2N23 A;  3PVU A;  4YON A;  2Z0Q A;  2IYB A;  1FHO A;  3SV1 A;  1X05 A;  2EJ8 A;  5DH9 B;  2COC A;  3F0W A;  5KQ4 A;  2RUK B;  1PFJ A;  1DYN A;  1TQZ A;  3SUZ A;  1Y5O A;  5KQ1 A;  3WYF B;  2JP2 A;  3KY9 A;  1MIX A;  2L2I A;  1LW3 A;  3G9W A;  1BWN A;  2KCJ A;  5FI0 A;  2Z0O A;  2ROZ B;  2MFQ A;  1XD4 A;  3A8P A;  5C5B A;  4HB0 B;  2DX1 A;  3QWM A;  2Y7B A;  2D9X A;  1FOE A;  2RNR B;  1MK9 B;  2K2J A;  2LG1 A;  5C79 A;  1UEF A;  2MDX A;  4HAW B;  3KZ1 A;  4CHJ A;  4HB4 B;  2J0J A;  1B55 A;  2L1C A;  2UVM A;  5D3W A;  2EMT A;  2Y8F A;  2GS0 A;  1W1H A;  1PLS A;  2P8V A;  1Z87 A;  1UNR A;  1XCG A;  1P5T A;  4HB3 B;  5JHG A;  2DHK A;  3A98 B;  2CRF A;  2LKO A;  3MPX A;  4F7U P;  1K5G B;  4KHO A;  2D10 A;  1WGU A;  1AWE A;  2CY4 A;  2YS1 A;  1U5G A;  2ADZ A;  4IAP A;  4WVF B;  2EMS A;  2YS5 A;  1V89 A;  2GCL A;  3PSC A;  1FHW A;  1P3R A;  1DDV A;  4IFS A;  3KRW A;  4MY6 A;  3PVW A;  1XX0 A;  1TJ6 A;  2MKR A;  3FEH A;  5J3Q A;  2COF A;  3V5W A;  2ELA A;  3DXE A;  2LUL A;  2NMB A;  5DIF B;  4KAX B;  4HAY B;  3ULC A;  2D9Z A;  1FGZ A;  2I1K A;  3F5R A;  3SYX A;  2W2X C;  2CAY A;  4ZRI A;  2YSZ A;  2D9Y A;  5LOP B;  2NZ8 B;  1AQC A;  1LB1 A;  3CXB B;  4ZRK A;  2AL6 A;  2DA0 A;  4F7H A;  3GYP A;  3O96 A;  1M7E A;  1W1D A;  4ZRJ A;  2HTH B;  1UNQ A;  2RSG A;  3DXD A;  4PQ0 A;  4XWX A;  1H4R A;  4GMX B;  3D8F A;  4CHM A;  1KZG A;  1DDW A;  5D3V A;  4GXB A;  4KHB B;  4K81 A;  4Z2N A;  3HW2 B;  1KZ7 A;  1IRS A;  2M38 A;  2R09 A;  1U27 A;  2DHI A;  1MK7 B;  2Q13 A;  1KI1 B;  2QKL A;  5L81 A;  1K5D B;  2J0M A;  3BIN A;  3U8Z A;  1QQG A;  1V5P A;  3FSS A;  3SO6 A;  2COA A;  4DXA B;  3UZT A;  2H7E A;  2RVB B;  3PVL A;  4NSW A;  1MPH A;  3ODX A;  1X1F A;  1NI2 A;  1FGY A;  2AEH A;  2YT1 A;  2ZPY A;  4HB2 B;  3AU5 A;  1PMS A;  1ZC4 B;  2K00 A;  4IOY X;  2ELB A;  3HQC A;  2E2X A;  2P0D A;  1I2H A;  4GMV A;  1M7R A;  4DBB A;  2YVC A;  5DHA B;  1MAI A;  2D4Q A;  4C0A A;  1V5U A;  2EC1 A;  1RRP B;  3TO1 A;  2D2Q A;  1WJ1 A;  4HDQ A;  4K2P A;  2H7D A;  4HAT B;  1OY2 A;  1ZC3 B;  1ZSQ A;  5DHF B;  1V88 A;  1GC6 A;  1DRO A;  2N0Y A;  4HHV A;  1H10 A;  5LON B;  4L6E A;  1RJ2 A;  1WG7 A;  2I5F A;  4BBK A;  2MWN B;  4GZU A;  2DFK A;  2KUP A;  5D3Y A;  3TW1 A;  2J0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...