2YSZA

Solution structure of the chimera of the c-terminal pid domain of fe65l and the c-terminal tail peptide of app
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
185
structure length
185
Chain Sequence
GSSGSSGPTPKTELVQKFRVQYLGMLPVDRPVGMDTLNSAIENLMTSSSKEDWPSVNMNVADATVTVISEKNEEEVLVECRVRFLSFMGVGKDVHTFAFIMDTGNQRFECHVFWCEPNAANVSEAVQAACSGPSSGIEGRGSSGSSGSSGSSGDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the C-terminal phosphotyrosine interaction domain of Fe65L1 complexed with the cytoplasmic tail of amyloid precursor protein reveals a novel peptide binding mode
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Amyloid beta A4 precursor protein-binding family B member 2
total genus 26
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2007-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2yszA01
4HHVA 5DHFB 1U29A 1X1GA 3M1IB 3TFMA 1GG3A 4CYEA 2LKOA 1PLSA 2Y8GA 1WJ1A 2H7EA 2LULA 2NMBA 1WVHA 3PVLA 2KCJA 1DDMA 1IRSA 1PMSA 1V61A 5JHGA 1V89A 2YS5A 2DHIA 1QC6A 1FHXA 3KSYA 4NY0A 3ULCA 3QIJA 3SUZA 4YL8A 2MWNB 3SYXA 4HB0B 2Y7BA 1KZGA 2CRFA 4WJ7A 3SO6A 4DX90 2J0JA 4KHOA 2GS0A 3QBVB 2PZ1A 1MIZB 2BCJA 2D9WA 1N3HA 2DFKA 4KHAA 3MPXA 2RVBB 5FI0A 1H4RA 1SGHA 5DH9B 1XR0B 3HK0A 3PEGA 4EJNA 1GC6A 1B55A 1BWNA 5DIFB 3TCAA 3ZDTA 2DHJA 2DHKA 1Q67A 2DKQA 5HE1A 2YS3A 2Y8FA 2DX1A 4IOYX 1P6SA 2UZRA 5J3QA 2RLOA 1I2HA 2D4QA 3DXCA 4Y94A 2DKPA 4IAPA 1MIXA 1UNPA 1FGYA 2DLWA 2COAA 1EGXA 3SV1A 2OQBA 2HE7A 5HE2A 3QWMA 4GMXB 4HDQA 2D11A 2W2WA 2QKLA 1I7AA 2COCA 1OY2A 3PSCA 1V5MA 4K2OA 1Y19B 4Z2MB 1U5GA 4D0NB 1WG7A 2AEHA 2H7DA 1P3RA 2J59M 3OANA 4GMVA 5C6RA 2R09A 4CHJA 1Z87A 4Z2NA 1WGQA 2J0KA 1KZ7A 3V5WA 5HE3A 4XWXA 2CY4A 1TXDA 1NI2A 2YS1A 1XX0A 3KZ1A 4DBBA 1ZC4B 3BJIA 1W1HA 1AWEA 2CY5A 5C16A 1XKEA 2JP2A 3A98B 2COFA 1ISNA 1NTVA 4TKNA 2FJLA 3T06A 3HQCA 3ODXA 5LONB 3FEHA 3WYFB 2DYNA 4DXAB 3ZVRA 3WA0A 2ELBA 2LOZA 2IFSA 5C5BB 1X86A 2YSZA 2I5CA 1U5FA 4HAZB 2E2XA 3N7CA 3IVFA 4MT7A 1AQCA 4F7GA 3SNHA 5LOPB 4KHBB 3FSSA 4MY6A 1MAIA 4PNKA 5DI9B 1FGZA 2VSZA 4DX8A 4HAYB 2DN6A 5D3WA 1V5PA 3HW2B 4A6HA 2P0HA 1WJMA 1MKEA 4GN1A 3TVVA 3LJUX 2EJ8A 4HAUB 2GJYA 5C5BA 2GCLA 1DDVA 5HE0A 3F5RA 3GYOA 5JP4A 3MDBC 2UZSA 1J19A 1FHWA 1EF1A 5L81A 1DYNA 2Z0PA 1OQNA 1UNRA 1LW3A 2D2QA 2L2IA 2ROVA 1BTNA 2V76A 3FM8C 4HAXB 1MK7B 3VOQA 4GPTB 4K81A 2RGNB 1EVHA 3RCPA 1WI1A 1DROA 3ML4A 3D8FA 2P0DA 1UNQA 1BAKA 2Z0QA 5KQ1A 4WSFA 4WVFB 2ZPYA 3TW1A 2W2XD 3DXEA 3X23A 2K00A 4GZUA 1J0WA 1V88A 2YT1A 5FI1A 1UPQA 1MK9B 1FOEA 3KY9A 1UPRA 1KI1B 4B6HA 2CODA 2D9VA 5GOWB 2RUKB 4HAVB 1RRPB 4KVGB 4L6EA 1ZVRA 2GCJA 1ZM0A 1M7EA 1SHCA 2DA0A 2DYQA 1V5UA 3U8ZA 2N0YA 2D9XA 1TJ6A 2XQNM 2YRYA 3D8EA 1XODA 2IYBA 2J0MA 2ELAA 3G9WA 2KUPA 2YVCA 2RSGA 3DXDA 1RJ2A 5C79A 5KCVA 4C0AA 2K2UA 2MKRA 4K2PA 2CAYA 1WGUA 1ZSQA 2OTXA 2EMTA 3U7DA 3AU5A 2NZ8B 4HB3B 2M38A 3GYPA 4HB4B 2UVMA 4GXBA 3ODWA 4PQ0A 4HATB 1K5GB 2N23A 5D27A 4CHMA 2MDXA 2YF0A 1FB8A 3D8DA 2P0FA 4KAXB 2G35A 2D9YA 5EFXA 5CLLB 5D3YA 2LG1A 1UEFA 4A6FB 2YT0A 4K17A 2D10A 4TYZA 1XCGA 4A5KA 1E5WA 2Z0OA 1OMWA 1GC7A 2RNRB 1NTYA 2ROZB 1FHOA 4F7HA 2I1KA 3A8QA 2LOXA 2Q13A 3CIKA 4BBKA 3NSUA 2VRWB 1EAZA 1W1DA 4ZRIA 3PZDA 3PVUA 3AJ4A 3A8PA 1H10A 4H8SA 4YONA 5JLJB 2D9ZA 2M14A 2X18A 2HTHB 1DBHA 1ZC3B 2W2XC 5J3TA 2VKIA 4HDOA 4HB2B 3BINA 3PG7A 5J3YA 2EMSA 2MFQA 3KRWA 1W1GA 2L1CA 5D3XA 4A6FA 1LB1A 3P6AA 1U27A 1K5DB 3F0WA 4NSWA 2DX5A 2DTCA 1M7RA 3AU4A 3ULBA 4F7UP 1DDWA 2QKMA 1QQGA 1FAOA 3KRXA 4HAWB 4EKUA 4IFSA 4ZRJA 5JHHA 1X1FA 3P7ZA 2EC1A 3VIAA 1NU2A 1U2BA 2P8VA 4A6KA 3PVWA 2AL6A 3CXBB 1X11A 2I5FA 1P5TA 4MK0A 1Y5OA 1TQZA 1X05A 1XD4A 4ZRKA 4P7IA 1PFJA 2LYDA 5DHAB 1MPHA 3TO1A 4EMOA 2ADZA 5D3VA 1U5DA 3ODOA 2K2JA 2R0DA 3O96A 1BTKA 2KGXB 3UZTA 3PP2A 5CLQB 5KQ4A 1U5EA 2I1JA
chains in the Genus database with same CATH superfamily
4HHVA 5DHFB 1U29A 4GOUA 1X1GA 5I2MA 3M1IB 3TFMA 1GG3A 4CYEA 5IRSA 2LKOA 1PLSA 2Y8GA 1WJ1A 2H7EA 2LULA 2NMBA 1WVHA 3PVLA 2KCJA 1DDMA 1IRSA 1PMSA 1V61A 5JHGA 1V89A 2YS5A 3KSYA 2DHIA 1QC6A 1FHXA 4NY0A 3ULCA 3QIJA 3SUZA 4YL8A 2MWNB 3SYXA 4HB0B 2Y7BA 1KZGA 2CRFA 4WJ7A 3SO6A 4DX90 2J0JA 2K8EA 4KHOA 2GS0A 3QBVB 2PZ1A 3FVCA 1MIZB 2BCJA 2D9WA 1N3HA 2DFKA 4KHAA 3MPXA 2RVBB 5FI0A 1H4RA 1SGHA 5DH9B 1XR0B 3HK0A 3PEGA 4EJNA 1GC6A 4QJ4B 1B55A 1BWNA 5DIFB 3TCAA 3ZDTA 2DHJA 2DHKA 1Q67A 2DKQA 5HE1A 2YS3A 2Y8FA 2DX1A 4IOYX 1P6SA 2K49A 2UZRA 5J3QA 2RLOA 1I2HA 2D4QA 3DXCA 3HSAA 4Y94A 2DKPA 4IAPA 1MIXA 1UNPA 1FGYA 2DLWA 2Z4DA 2COAA 1EGXA 3SV1A 2OQBA 2HE7A 5HE2A 3QWMA 4GMXB 4HDQA 2Z13A 2D11A 2W2WA 2QKLA 1I7AA 2COCA 1OY2A 3PSCA 4L1RA 1V5MA 4K2OA 1Y19B 4Z2MB 1U5GA 4D0NB 3NWFA 1WG7A 2AEHA 2H7DA 1P3RA 2J59M 3OANA 4GMVA 5C6RA 2R09A 4CHJA 1Z87A 4Z2NA 1WGQA 2J0KA 1KZ7A 3V5WA 5HE3A 4XWXA 2CY4A 1TXDA 1NI2A 2YS1A 1XX0A 3KZ1A 4DBBA 1ZC4B 3BJIA 1W1HA 1AWEA 2CY5A 5C16A 1XKEA 2JP2A 3A98B 2COFA 1ISNA 1NTVA 4TKNA 2FJLA 3T06A 3HQCA 3ODXA 5LONB 3FEHA 3WYFB 2DYNA 4DXAB 3ZVRA 3WA0A 2YT2A 2ELBA 2LOZA 5M4YB 2IFSA 5C5BB 1X86A 2YSZA 2I5CA 1U5FA 4HAZB 2E2XA 3N7CA 3IVFA 4MT7A 1AQCA 4F7GA 4QJ3B 3SNHA 5I2SA 5LOPB 4KHBB 3FSSA 4MY6A 1MAIA 4PNKA 5DI9B 1FGZA 2VSZA 4DX8A 4QJ5B 4HAYB 1ZYIA 2DN6A 5D3WA 1V5PA 3HW2B 4A6HA 2P0HA 1WJMA 1MKEA 4GN1A 3TVVA 3LJUX 2EJ8A 4HAUB 3U12A 2GJYA 5C5BA 2GCLA 1DDVA 5HE0A 3F5RA 3GYOA 5JP4A 3MDBC 2UZSA 1J19A 1FHWA 1EF1A 5L81A 1DYNA 2Z0PA 1OQNA 1UNRA 1LW3A 2KR0A 2D2QA 2L2IA 2ROVA 1BTNA 2V76A 3FM8C 4HAXB 1MK7B 3VOQA 4GPTB 4K81A 2RGNB 1EVHA 3RCPA 1WI1A 1DROA 3ML4A 3D8FA 2Z59A 2P0DA 1UNQA 1BAKA 2Z0QA 5KQ1A 4WSFA 4WVFB 2ZPYA 2KUQA 3TW1A 2W2XD 3DXEA 3X23A 2K00A 4GZUA 1J0WA 1V88A 2YT1A 5FI1A 1UPQA 3DCXA 1MK9B 1FOEA 3KY9A 3NW8A 1UPRA 3NWAA 1KI1B 4B6HA 2CODA 2D9VA 5GOWB 2RUKB 4HAVB 1RRPB 4KVGB 4L6EA 1ZVRA 2GCJA 1ZM0A 1M7EA 1SHCA 2DA0A 2DYQA 1V5UA 3U8ZA 4DIXA 2N0YA 2D9XA 1TJ6A 2XQNM 2YRYA 3D8EA 1XODA 2IYBA 2J0MA 2ELAA 3G9WA 2KUPA 2YVCA 2RSGA 3DXDA 1RJ2A 5LG4B 5C79A 4QXAB 5KCVA 4C0AA 4GNKB 2K2UA 2MKRA 4K2PA 2CAYA 1WGUA 1ZSQA 2OTXA 2EMTA 3U7DA 3AU5A 2NZ8B 4HB3B 2M38A 3GYPA 4HB4B 2UVMA 4GXBA 3ODWA 4PQ0A 4HATB 1K5GB 2N23A 5D27A 4CHMA 2MDXA 2YF0A 1FB8A 3D8DA 2P0FA 4KAXB 2RRFA 2G35A 2D9YA 3B77A 5EFXA 5CLLB 4OT1A 5D3YA 2LG1A 2Z14A 1UEFA 4A6FB 2YT0A 4K17A 2D10A 4TYZA 1XCGA 4A5KA 1E5WA 2Z0OA 1OMWA 1GC7A 1T77A 2RNRB 4D6WA 1NTYA 2ROZB 1FHOA 4F7HA 2I1KA 3A8QA 2LOXA 2Q13A 3CIKA 4BBKA 3NSUA 4KHBA 3HIEA 2VRWB 1EAZA 1W1DA 4ZRIA 3PZDA 3PVUA 3AJ4A 3A8PA 1H10A 4H8SA 4YONA 2R2YA 5JLJB 2D9ZA 2M14A 2X18A 2HTHB 1DBHA 1ZC3B 2W2XC 2FJUB 3A58A 5J3TA 2VKIA 4HDOA 4HB2B 3BINA 3PG7A 5J3YA 2EMSA 2MFQA 3KRWA 1W1GA 2L1CA 5D3XA 4A6FA 1LB1A 3P6AA 1U27A 1K5DB 3F0WA 4NSWA 2DX5A 3OHMB 2DTCA 3NWDA 2KIEA 1M7RA 2NBVA 3AU4A 3ULBA 4CSQA 4F7UP 2KIGA 1DDWA 2QKMA 1QQGA 1FAOA 3KRXA 4HAWB 4EKUA 4HSIA 4IFSA 4ZRJA 5JHHA 2ZKMX 1X1FA 3P7ZA 2EC1A 3VIAA 1NU2A 1U2BA 1MI1A 2P8VA 4A6KA 3PVWA 2AL6A 3CXBB 1X11A 2I5FA 1P5TA 4MK0A 1Y5OA 1TQZA 1X05A 1XD4A 4ZRKA 4P7IA 1PFJA 2LYDA 5DHAB 1MPHA 3TO1A 4EMOA 2ADZA 5D3VA 1U5DA 2GUMA 3ODOA 2K2JA 2R0DA 3O96A 1BTKA 2KGXB 3UZTA 3PP2A 5CLQB 4OSNA 5KQ4A 1U5EA 2I1JA
chains in the Genus database with same CATH topology
4HHVA 5DHFB 1U29A 1X1GA 3M1IB 3TFMA 1GG3A 4CYEA 2LKOA 1PLSA 2Y8GA 1WJ1A 2H7EA 2LULA 2NMBA 1WVHA 3PVLA 2KCJA 1DDMA 1IRSA 1PMSA 1V61A 5JHGA 1V89A 2YS5A 2DHIA 1QC6A 1FHXA 3KSYA 4NY0A 3ULCA 3QIJA 3SUZA 4YL8A 2MWNB 3SYXA 4HB0B 2Y7BA 1KZGA 2CRFA 4WJ7A 3SO6A 4DX90 2J0JA 4KHOA 2GS0A 3QBVB 2PZ1A 1MIZB 2BCJA 2D9WA 1N3HA 2DFKA 4KHAA 3MPXA 2RVBB 5FI0A 1H4RA 1SGHA 5DH9B 1XR0B 3HK0A 3PEGA 4EJNA 1GC6A 1B55A 1BWNA 5DIFB 3TCAA 3ZDTA 2DHJA 2DHKA 1Q67A 2DKQA 5HE1A 2YS3A 2Y8FA 2DX1A 4IOYX 1P6SA 2UZRA 5J3QA 2RLOA 1I2HA 2D4QA 3DXCA 4Y94A 2DKPA 4IAPA 1MIXA 1UNPA 1FGYA 2DLWA 2COAA 1EGXA 3SV1A 2OQBA 2HE7A 5HE2A 3QWMA 4GMXB 4HDQA 2D11A 2W2WA 2QKLA 1I7AA 2COCA 1OY2A 3PSCA 1V5MA 4K2OA 1Y19B 4Z2MB 1U5GA 4D0NB 1WG7A 2AEHA 2H7DA 1P3RA 2J59M 3OANA 4GMVA 5C6RA 2R09A 4CHJA 1Z87A 4Z2NA 1WGQA 2J0KA 1KZ7A 3V5WA 5HE3A 4XWXA 2CY4A 1TXDA 1NI2A 2YS1A 1XX0A 3KZ1A 4DBBA 1ZC4B 3BJIA 1W1HA 1AWEA 2CY5A 5C16A 1XKEA 2JP2A 3A98B 2COFA 1ISNA 1NTVA 4TKNA 2FJLA 3T06A 3HQCA 3ODXA 5LONB 3FEHA 3WYFB 2DYNA 4DXAB 3ZVRA 3WA0A 2ELBA 2LOZA 2IFSA 5C5BB 1X86A 2YSZA 2I5CA 1U5FA 4HAZB 2E2XA 3N7CA 3IVFA 4MT7A 1AQCA 4F7GA 3SNHA 5LOPB 4KHBB 3FSSA 4MY6A 1MAIA 4PNKA 5DI9B 1FGZA 2VSZA 4DX8A 4HAYB 2DN6A 5D3WA 1V5PA 3HW2B 4A6HA 2P0HA 1WJMA 1MKEA 4GN1A 3TVVA 3LJUX 2EJ8A 4HAUB 2GJYA 5C5BA 2GCLA 1DDVA 5HE0A 3F5RA 3GYOA 5JP4A 3MDBC 2UZSA 1J19A 1FHWA 1EF1A 5L81A 1DYNA 2Z0PA 1OQNA 1UNRA 1LW3A 2D2QA 2L2IA 2ROVA 1BTNA 2V76A 3FM8C 4HAXB 1MK7B 3VOQA 4GPTB 4K81A 2RGNB 1EVHA 3RCPA 1WI1A 1DROA 3ML4A 3D8FA 2P0DA 1UNQA 1BAKA 2Z0QA 5KQ1A 4WSFA 4WVFB 2ZPYA 3TW1A 2W2XD 3DXEA 3X23A 2K00A 4GZUA 1J0WA 1V88A 2YT1A 5FI1A 1UPQA 1MK9B 1FOEA 3KY9A 1UPRA 1KI1B 4B6HA 2CODA 2D9VA 5GOWB 2RUKB 4HAVB 1RRPB 4KVGB 4L6EA 1ZVRA 2GCJA 1ZM0A 1M7EA 1SHCA 2DA0A 2DYQA 1V5UA 3U8ZA 2N0YA 2D9XA 1TJ6A 2XQNM 2YRYA 3D8EA 1XODA 2IYBA 2J0MA 2ELAA 3G9WA 2KUPA 2YVCA 2RSGA 3DXDA 1RJ2A 5C79A 5KCVA 4C0AA 2K2UA 2MKRA 4K2PA 2CAYA 1WGUA 1ZSQA 2OTXA 2EMTA 3U7DA 3AU5A 2NZ8B 4HB3B 2M38A 3GYPA 4HB4B 2UVMA 4GXBA 3ODWA 4PQ0A 4HATB 1K5GB 2N23A 5D27A 4CHMA 2MDXA 2YF0A 1FB8A 3D8DA 2P0FA 4KAXB 2G35A 2D9YA 5EFXA 5CLLB 5D3YA 2LG1A 1UEFA 4A6FB 2YT0A 4K17A 2D10A 4TYZA 1XCGA 4A5KA 1E5WA 2Z0OA 1OMWA 1GC7A 2RNRB 1NTYA 2ROZB 1FHOA 4F7HA 2I1KA 3A8QA 2LOXA 2Q13A 3CIKA 4BBKA 3NSUA 2VRWB 1EAZA 1W1DA 4ZRIA 3PZDA 3PVUA 3AJ4A 3A8PA 1H10A 4H8SA 4YONA 5JLJB 2D9ZA 2M14A 2X18A 2HTHB 1DBHA 1ZC3B 2W2XC 5J3TA 2VKIA 4HDOA 4HB2B 3BINA 3PG7A 5J3YA 2EMSA 2MFQA 3KRWA 1W1GA 2L1CA 5D3XA 4A6FA 1LB1A 3P6AA 1U27A 1K5DB 3F0WA 4NSWA 2DX5A 2DTCA 1M7RA 3AU4A 3ULBA 4F7UP 1DDWA 2QKMA 1QQGA 1FAOA 3KRXA 4HAWB 4EKUA 4IFSA 4ZRJA 5JHHA 1X1FA 3P7ZA 2EC1A 3VIAA 1NU2A 1U2BA 2P8VA 4A6KA 3PVWA 2AL6A 3CXBB 1X11A 2I5FA 1P5TA 4MK0A 1Y5OA 1TQZA 1X05A 1XD4A 4ZRKA 4P7IA 1PFJA 2LYDA 5DHAB 1MPHA 3TO1A 4EMOA 2ADZA 5D3VA 1U5DA 3ODOA 2K2JA 2R0DA 3O96A 1BTKA 2KGXB 3UZTA 3PP2A 5CLQB 5KQ4A 1U5EA 2I1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HHV A;  5DHF B;  1U29 A;  1X1G A;  3M1I B;  3TFM A;  1GG3 A;  4CYE A;  2LKO A;  1PLS A;  2Y8G A;  1WJ1 A;  2H7E A;  2LUL A;  2NMB A;  1WVH A;  3PVL A;  2KCJ A;  1DDM A;  1IRS A;  1PMS A;  1V61 A;  5JHG A;  1V89 A;  2YS5 A;  2DHI A;  1QC6 A;  1FHX A;  3KSY A;  4NY0 A;  3ULC A;  3QIJ A;  3SUZ A;  4YL8 A;  2MWN B;  3SYX A;  4HB0 B;  2Y7B A;  1KZG A;  2CRF A;  4WJ7 A;  3SO6 A;  4DX9 0;  2J0J A;  4KHO A;  2GS0 A;  3QBV B;  2PZ1 A;  1MIZ B;  2BCJ A;  2D9W A;  1N3H A;  2DFK A;  4KHA A;  3MPX A;  2RVB B;  5FI0 A;  1H4R A;  1SGH A;  5DH9 B;  1XR0 B;  3HK0 A;  3PEG A;  4EJN A;  1GC6 A;  1B55 A;  1BWN A;  5DIF B;  3TCA A;  3ZDT A;  2DHJ A;  2DHK A;  1Q67 A;  2DKQ A;  5HE1 A;  2YS3 A;  2Y8F A;  2DX1 A;  4IOY X;  1P6S A;  2UZR A;  5J3Q A;  2RLO A;  1I2H A;  2D4Q A;  3DXC A;  4Y94 A;  2DKP A;  4IAP A;  1MIX A;  1UNP A;  1FGY A;  2DLW A;  2COA A;  1EGX A;  3SV1 A;  2OQB A;  2HE7 A;  5HE2 A;  3QWM A;  4GMX B;  4HDQ A;  2D11 A;  2W2W A;  2QKL A;  1I7A A;  2COC A;  1OY2 A;  3PSC A;  1V5M A;  4K2O A;  1Y19 B;  4Z2M B;  1U5G A;  4D0N B;  1WG7 A;  2AEH A;  2H7D A;  1P3R A;  2J59 M;  3OAN A;  4GMV A;  5C6R A;  2R09 A;  4CHJ A;  1Z87 A;  4Z2N A;  1WGQ A;  2J0K A;  1KZ7 A;  3V5W A;  5HE3 A;  4XWX A;  2CY4 A;  1TXD A;  1NI2 A;  2YS1 A;  1XX0 A;  3KZ1 A;  4DBB A;  1ZC4 B;  3BJI A;  1W1H A;  1AWE A;  2CY5 A;  5C16 A;  1XKE A;  2JP2 A;  3A98 B;  2COF A;  1ISN A;  1NTV A;  4TKN A;  2FJL A;  3T06 A;  3HQC A;  3ODX A;  5LON B;  3FEH A;  3WYF B;  2DYN A;  4DXA B;  3ZVR A;  3WA0 A;  2ELB A;  2LOZ A;  2IFS A;  5C5B B;  1X86 A;  2YSZ A;  2I5C A;  1U5F A;  4HAZ B;  2E2X A;  3N7C A;  3IVF A;  4MT7 A;  1AQC A;  4F7G A;  3SNH A;  5LOP B;  4KHB B;  3FSS A;  4MY6 A;  1MAI A;  4PNK A;  5DI9 B;  1FGZ A;  2VSZ A;  4DX8 A;  4HAY B;  2DN6 A;  5D3W A;  1V5P A;  3HW2 B;  4A6H A;  2P0H A;  1WJM A;  1MKE A;  4GN1 A;  3TVV A;  3LJU X;  2EJ8 A;  4HAU B;  2GJY A;  5C5B A;  2GCL A;  1DDV A;  5HE0 A;  3F5R A;  3GYO A;  5JP4 A;  3MDB C;  2UZS A;  1J19 A;  1FHW A;  1EF1 A;  5L81 A;  1DYN A;  2Z0P A;  1OQN A;  1UNR A;  1LW3 A;  2D2Q A;  2L2I A;  2ROV A;  1BTN A;  2V76 A;  3FM8 C;  4HAX B;  1MK7 B;  3VOQ A;  4GPT B;  4K81 A;  2RGN B;  1EVH A;  3RCP A;  1WI1 A;  1DRO A;  3ML4 A;  3D8F A;  2P0D A;  1UNQ A;  1BAK A;  2Z0Q A;  5KQ1 A;  4WSF A;  4WVF B;  2ZPY A;  3TW1 A;  2W2X D;  3DXE A;  3X23 A;  2K00 A;  4GZU A;  1J0W A;  1V88 A;  2YT1 A;  5FI1 A;  1UPQ A;  1MK9 B;  1FOE A;  3KY9 A;  1UPR A;  1KI1 B;  4B6H A;  2COD A;  2D9V A;  5GOW B;  2RUK B;  4HAV B;  1RRP B;  4KVG B;  4L6E A;  1ZVR A;  2GCJ A;  1ZM0 A;  1M7E A;  1SHC A;  2DA0 A;  2DYQ A;  1V5U A;  3U8Z A;  2N0Y A;  2D9X A;  1TJ6 A;  2XQN M;  2YRY A;  3D8E A;  1XOD A;  2IYB A;  2J0M A;  2ELA A;  3G9W A;  2KUP A;  2YVC A;  2RSG A;  3DXD A;  1RJ2 A;  5C79 A;  5KCV A;  4C0A A;  2K2U A;  2MKR A;  4K2P A;  2CAY A;  1WGU A;  1ZSQ A;  2OTX A;  2EMT A;  3U7D A;  3AU5 A;  2NZ8 B;  4HB3 B;  2M38 A;  3GYP A;  4HB4 B;  2UVM A;  4GXB A;  3ODW A;  4PQ0 A;  4HAT B;  1K5G B;  2N23 A;  5D27 A;  4CHM A;  2MDX A;  2YF0 A;  1FB8 A;  3D8D A;  2P0F A;  4KAX B;  2G35 A;  2D9Y A;  5EFX A;  5CLL B;  5D3Y A;  2LG1 A;  1UEF A;  4A6F B;  2YT0 A;  4K17 A;  2D10 A;  4TYZ A;  1XCG A;  4A5K A;  1E5W A;  2Z0O A;  1OMW A;  1GC7 A;  2RNR B;  1NTY A;  2ROZ B;  1FHO A;  4F7H A;  2I1K A;  3A8Q A;  2LOX A;  2Q13 A;  3CIK A;  4BBK A;  3NSU A;  2VRW B;  1EAZ A;  1W1D A;  4ZRI A;  3PZD A;  3PVU A;  3AJ4 A;  3A8P A;  1H10 A;  4H8S A;  4YON A;  5JLJ B;  2D9Z A;  2M14 A;  2X18 A;  2HTH B;  1DBH A;  1ZC3 B;  2W2X C;  5J3T A;  2VKI A;  4HDO A;  4HB2 B;  3BIN A;  3PG7 A;  5J3Y A;  2EMS A;  2MFQ A;  3KRW A;  1W1G A;  2L1C A;  5D3X A;  4A6F A;  1LB1 A;  3P6A A;  1U27 A;  1K5D B;  3F0W A;  4NSW A;  2DX5 A;  2DTC A;  1M7R A;  3AU4 A;  3ULB A;  4F7U P;  1DDW A;  2QKM A;  1QQG A;  1FAO A;  3KRX A;  4HAW B;  4EKU A;  4IFS A;  4ZRJ A;  5JHH A;  1X1F A;  3P7Z A;  2EC1 A;  3VIA A;  1NU2 A;  1U2B A;  2P8V A;  4A6K A;  3PVW A;  2AL6 A;  3CXB B;  1X11 A;  2I5F A;  1P5T A;  4MK0 A;  1Y5O A;  1TQZ A;  1X05 A;  1XD4 A;  4ZRK A;  4P7I A;  1PFJ A;  2LYD A;  5DHA B;  1MPH A;  3TO1 A;  4EMO A;  2ADZ A;  5D3V A;  1U5D A;  3ODO A;  2K2J A;  2R0D A;  3O96 A;  1BTK A;  2KGX B;  3UZT A;  3PP2 A;  5CLQ B;  5KQ4 A;  1U5E A;  2I1J A; 
#chains in the Genus database with same CATH topology
 4HHV A;  5DHF B;  1U29 A;  4GOU A;  1X1G A;  5I2M A;  3M1I B;  3TFM A;  1GG3 A;  4CYE A;  5IRS A;  2LKO A;  1PLS A;  2Y8G A;  1WJ1 A;  2H7E A;  2LUL A;  2NMB A;  1WVH A;  3PVL A;  2KCJ A;  1DDM A;  1IRS A;  1PMS A;  1V61 A;  5JHG A;  1V89 A;  2YS5 A;  3KSY A;  2DHI A;  1QC6 A;  1FHX A;  4NY0 A;  3ULC A;  3QIJ A;  3SUZ A;  4YL8 A;  2MWN B;  3SYX A;  4HB0 B;  2Y7B A;  1KZG A;  2CRF A;  4WJ7 A;  3SO6 A;  4DX9 0;  2J0J A;  2K8E A;  4KHO A;  2GS0 A;  3QBV B;  2PZ1 A;  3FVC A;  1MIZ B;  2BCJ A;  2D9W A;  1N3H A;  2DFK A;  4KHA A;  3MPX A;  2RVB B;  5FI0 A;  1H4R A;  1SGH A;  5DH9 B;  1XR0 B;  3HK0 A;  3PEG A;  4EJN A;  1GC6 A;  4QJ4 B;  1B55 A;  1BWN A;  5DIF B;  3TCA A;  3ZDT A;  2DHJ A;  2DHK A;  1Q67 A;  2DKQ A;  5HE1 A;  2YS3 A;  2Y8F A;  2DX1 A;  4IOY X;  1P6S A;  2K49 A;  2UZR A;  5J3Q A;  2RLO A;  1I2H A;  2D4Q A;  3DXC A;  3HSA A;  4Y94 A;  2DKP A;  4IAP A;  1MIX A;  1UNP A;  1FGY A;  2DLW A;  2Z4D A;  2COA A;  1EGX A;  3SV1 A;  2OQB A;  2HE7 A;  5HE2 A;  3QWM A;  4GMX B;  4HDQ A;  2Z13 A;  2D11 A;  2W2W A;  2QKL A;  1I7A A;  2COC A;  1OY2 A;  3PSC A;  4L1R A;  1V5M A;  4K2O A;  1Y19 B;  4Z2M B;  1U5G A;  4D0N B;  3NWF A;  1WG7 A;  2AEH A;  2H7D A;  1P3R A;  2J59 M;  3OAN A;  4GMV A;  5C6R A;  2R09 A;  4CHJ A;  1Z87 A;  4Z2N A;  1WGQ A;  2J0K A;  1KZ7 A;  3V5W A;  5HE3 A;  4XWX A;  2CY4 A;  1TXD A;  1NI2 A;  2YS1 A;  1XX0 A;  3KZ1 A;  4DBB A;  1ZC4 B;  3BJI A;  1W1H A;  1AWE A;  2CY5 A;  5C16 A;  1XKE A;  2JP2 A;  3A98 B;  2COF A;  1ISN A;  1NTV A;  4TKN A;  2FJL A;  3T06 A;  3HQC A;  3ODX A;  5LON B;  3FEH A;  3WYF B;  2DYN A;  4DXA B;  3ZVR A;  3WA0 A;  2YT2 A;  2ELB A;  2LOZ A;  5M4Y B;  2IFS A;  5C5B B;  1X86 A;  2YSZ A;  2I5C A;  1U5F A;  4HAZ B;  2E2X A;  3N7C A;  3IVF A;  4MT7 A;  1AQC A;  4F7G A;  4QJ3 B;  3SNH A;  5I2S A;  5LOP B;  4KHB B;  3FSS A;  4MY6 A;  1MAI A;  4PNK A;  5DI9 B;  1FGZ A;  2VSZ A;  4DX8 A;  4QJ5 B;  4HAY B;  1ZYI A;  2DN6 A;  5D3W A;  1V5P A;  3HW2 B;  4A6H A;  2P0H A;  1WJM A;  1MKE A;  4GN1 A;  3TVV A;  3LJU X;  2EJ8 A;  4HAU B;  3U12 A;  2GJY A;  5C5B A;  2GCL A;  1DDV A;  5HE0 A;  3F5R A;  3GYO A;  5JP4 A;  3MDB C;  2UZS A;  1J19 A;  1FHW A;  1EF1 A;  5L81 A;  1DYN A;  2Z0P A;  1OQN A;  1UNR A;  1LW3 A;  2KR0 A;  2D2Q A;  2L2I A;  2ROV A;  1BTN A;  2V76 A;  3FM8 C;  4HAX B;  1MK7 B;  3VOQ A;  4GPT B;  4K81 A;  2RGN B;  1EVH A;  3RCP A;  1WI1 A;  1DRO A;  3ML4 A;  3D8F A;  2Z59 A;  2P0D A;  1UNQ A;  1BAK A;  2Z0Q A;  5KQ1 A;  4WSF A;  4WVF B;  2ZPY A;  2KUQ A;  3TW1 A;  2W2X D;  3DXE A;  3X23 A;  2K00 A;  4GZU A;  1J0W A;  1V88 A;  2YT1 A;  5FI1 A;  1UPQ A;  3DCX A;  1MK9 B;  1FOE A;  3KY9 A;  3NW8 A;  1UPR A;  3NWA A;  1KI1 B;  4B6H A;  2COD A;  2D9V A;  5GOW B;  2RUK B;  4HAV B;  1RRP B;  4KVG B;  4L6E A;  1ZVR A;  2GCJ A;  1ZM0 A;  1M7E A;  1SHC A;  2DA0 A;  2DYQ A;  1V5U A;  3U8Z A;  4DIX A;  2N0Y A;  2D9X A;  1TJ6 A;  2XQN M;  2YRY A;  3D8E A;  1XOD A;  2IYB A;  2J0M A;  2ELA A;  3G9W A;  2KUP A;  2YVC A;  2RSG A;  3DXD A;  1RJ2 A;  5LG4 B;  5C79 A;  4QXA B;  5KCV A;  4C0A A;  4GNK B;  2K2U A;  2MKR A;  4K2P A;  2CAY A;  1WGU A;  1ZSQ A;  2OTX A;  2EMT A;  3U7D A;  3AU5 A;  2NZ8 B;  4HB3 B;  2M38 A;  3GYP A;  4HB4 B;  2UVM A;  4GXB A;  3ODW A;  4PQ0 A;  4HAT B;  1K5G B;  2N23 A;  5D27 A;  4CHM A;  2MDX A;  2YF0 A;  1FB8 A;  3D8D A;  2P0F A;  4KAX B;  2RRF A;  2G35 A;  2D9Y A;  3B77 A;  5EFX A;  5CLL B;  4OT1 A;  5D3Y A;  2LG1 A;  2Z14 A;  1UEF A;  4A6F B;  2YT0 A;  4K17 A;  2D10 A;  4TYZ A;  1XCG A;  4A5K A;  1E5W A;  2Z0O A;  1OMW A;  1GC7 A;  1T77 A;  2RNR B;  4D6W A;  1NTY A;  2ROZ B;  1FHO A;  4F7H A;  2I1K A;  3A8Q A;  2LOX A;  2Q13 A;  3CIK A;  4BBK A;  3NSU A;  4KHB A;  3HIE A;  2VRW B;  1EAZ A;  1W1D A;  4ZRI A;  3PZD A;  3PVU A;  3AJ4 A;  3A8P A;  1H10 A;  4H8S A;  4YON A;  2R2Y A;  5JLJ B;  2D9Z A;  2M14 A;  2X18 A;  2HTH B;  1DBH A;  1ZC3 B;  2W2X C;  2FJU B;  3A58 A;  5J3T A;  2VKI A;  4HDO A;  4HB2 B;  3BIN A;  3PG7 A;  5J3Y A;  2EMS A;  2MFQ A;  3KRW A;  1W1G A;  2L1C A;  5D3X A;  4A6F A;  1LB1 A;  3P6A A;  1U27 A;  1K5D B;  3F0W A;  4NSW A;  2DX5 A;  3OHM B;  2DTC A;  3NWD A;  2KIE A;  1M7R A;  2NBV A;  3AU4 A;  3ULB A;  4CSQ A;  4F7U P;  2KIG A;  1DDW A;  2QKM A;  1QQG A;  1FAO A;  3KRX A;  4HAW B;  4EKU A;  4HSI A;  4IFS A;  4ZRJ A;  5JHH A;  2ZKM X;  1X1F A;  3P7Z A;  2EC1 A;  3VIA A;  1NU2 A;  1U2B A;  1MI1 A;  2P8V A;  4A6K A;  3PVW A;  2AL6 A;  3CXB B;  1X11 A;  2I5F A;  1P5T A;  4MK0 A;  1Y5O A;  1TQZ A;  1X05 A;  1XD4 A;  4ZRK A;  4P7I A;  1PFJ A;  2LYD A;  5DHA B;  1MPH A;  3TO1 A;  4EMO A;  2ADZ A;  5D3V A;  1U5D A;  2GUM A;  3ODO A;  2K2J A;  2R0D A;  3O96 A;  1BTK A;  2KGX B;  3UZT A;  3PP2 A;  5CLQ B;  4OSN A;  5KQ4 A;  1U5E A;  2I1J A; 
#chains in the Genus database with same CATH homology
 4HHV A;  5DHF B;  1U29 A;  1X1G A;  3M1I B;  3TFM A;  1GG3 A;  4CYE A;  2LKO A;  1PLS A;  2Y8G A;  1WJ1 A;  2H7E A;  2LUL A;  2NMB A;  1WVH A;  3PVL A;  2KCJ A;  1DDM A;  1IRS A;  1PMS A;  1V61 A;  5JHG A;  1V89 A;  2YS5 A;  2DHI A;  1QC6 A;  1FHX A;  3KSY A;  4NY0 A;  3ULC A;  3QIJ A;  3SUZ A;  4YL8 A;  2MWN B;  3SYX A;  4HB0 B;  2Y7B A;  1KZG A;  2CRF A;  4WJ7 A;  3SO6 A;  4DX9 0;  2J0J A;  4KHO A;  2GS0 A;  3QBV B;  2PZ1 A;  1MIZ B;  2BCJ A;  2D9W A;  1N3H A;  2DFK A;  4KHA A;  3MPX A;  2RVB B;  5FI0 A;  1H4R A;  1SGH A;  5DH9 B;  1XR0 B;  3HK0 A;  3PEG A;  4EJN A;  1GC6 A;  1B55 A;  1BWN A;  5DIF B;  3TCA A;  3ZDT A;  2DHJ A;  2DHK A;  1Q67 A;  2DKQ A;  5HE1 A;  2YS3 A;  2Y8F A;  2DX1 A;  4IOY X;  1P6S A;  2UZR A;  5J3Q A;  2RLO A;  1I2H A;  2D4Q A;  3DXC A;  4Y94 A;  2DKP A;  4IAP A;  1MIX A;  1UNP A;  1FGY A;  2DLW A;  2COA A;  1EGX A;  3SV1 A;  2OQB A;  2HE7 A;  5HE2 A;  3QWM A;  4GMX B;  4HDQ A;  2D11 A;  2W2W A;  2QKL A;  1I7A A;  2COC A;  1OY2 A;  3PSC A;  1V5M A;  4K2O A;  1Y19 B;  4Z2M B;  1U5G A;  4D0N B;  1WG7 A;  2AEH A;  2H7D A;  1P3R A;  2J59 M;  3OAN A;  4GMV A;  5C6R A;  2R09 A;  4CHJ A;  1Z87 A;  4Z2N A;  1WGQ A;  2J0K A;  1KZ7 A;  3V5W A;  5HE3 A;  4XWX A;  2CY4 A;  1TXD A;  1NI2 A;  2YS1 A;  1XX0 A;  3KZ1 A;  4DBB A;  1ZC4 B;  3BJI A;  1W1H A;  1AWE A;  2CY5 A;  5C16 A;  1XKE A;  2JP2 A;  3A98 B;  2COF A;  1ISN A;  1NTV A;  4TKN A;  2FJL A;  3T06 A;  3HQC A;  3ODX A;  5LON B;  3FEH A;  3WYF B;  2DYN A;  4DXA B;  3ZVR A;  3WA0 A;  2ELB A;  2LOZ A;  2IFS A;  5C5B B;  1X86 A;  2YSZ A;  2I5C A;  1U5F A;  4HAZ B;  2E2X A;  3N7C A;  3IVF A;  4MT7 A;  1AQC A;  4F7G A;  3SNH A;  5LOP B;  4KHB B;  3FSS A;  4MY6 A;  1MAI A;  4PNK A;  5DI9 B;  1FGZ A;  2VSZ A;  4DX8 A;  4HAY B;  2DN6 A;  5D3W A;  1V5P A;  3HW2 B;  4A6H A;  2P0H A;  1WJM A;  1MKE A;  4GN1 A;  3TVV A;  3LJU X;  2EJ8 A;  4HAU B;  2GJY A;  5C5B A;  2GCL A;  1DDV A;  5HE0 A;  3F5R A;  3GYO A;  5JP4 A;  3MDB C;  2UZS A;  1J19 A;  1FHW A;  1EF1 A;  5L81 A;  1DYN A;  2Z0P A;  1OQN A;  1UNR A;  1LW3 A;  2D2Q A;  2L2I A;  2ROV A;  1BTN A;  2V76 A;  3FM8 C;  4HAX B;  1MK7 B;  3VOQ A;  4GPT B;  4K81 A;  2RGN B;  1EVH A;  3RCP A;  1WI1 A;  1DRO A;  3ML4 A;  3D8F A;  2P0D A;  1UNQ A;  1BAK A;  2Z0Q A;  5KQ1 A;  4WSF A;  4WVF B;  2ZPY A;  3TW1 A;  2W2X D;  3DXE A;  3X23 A;  2K00 A;  4GZU A;  1J0W A;  1V88 A;  2YT1 A;  5FI1 A;  1UPQ A;  1MK9 B;  1FOE A;  3KY9 A;  1UPR A;  1KI1 B;  4B6H A;  2COD A;  2D9V A;  5GOW B;  2RUK B;  4HAV B;  1RRP B;  4KVG B;  4L6E A;  1ZVR A;  2GCJ A;  1ZM0 A;  1M7E A;  1SHC A;  2DA0 A;  2DYQ A;  1V5U A;  3U8Z A;  2N0Y A;  2D9X A;  1TJ6 A;  2XQN M;  2YRY A;  3D8E A;  1XOD A;  2IYB A;  2J0M A;  2ELA A;  3G9W A;  2KUP A;  2YVC A;  2RSG A;  3DXD A;  1RJ2 A;  5C79 A;  5KCV A;  4C0A A;  2K2U A;  2MKR A;  4K2P A;  2CAY A;  1WGU A;  1ZSQ A;  2OTX A;  2EMT A;  3U7D A;  3AU5 A;  2NZ8 B;  4HB3 B;  2M38 A;  3GYP A;  4HB4 B;  2UVM A;  4GXB A;  3ODW A;  4PQ0 A;  4HAT B;  1K5G B;  2N23 A;  5D27 A;  4CHM A;  2MDX A;  2YF0 A;  1FB8 A;  3D8D A;  2P0F A;  4KAX B;  2G35 A;  2D9Y A;  5EFX A;  5CLL B;  5D3Y A;  2LG1 A;  1UEF A;  4A6F B;  2YT0 A;  4K17 A;  2D10 A;  4TYZ A;  1XCG A;  4A5K A;  1E5W A;  2Z0O A;  1OMW A;  1GC7 A;  2RNR B;  1NTY A;  2ROZ B;  1FHO A;  4F7H A;  2I1K A;  3A8Q A;  2LOX A;  2Q13 A;  3CIK A;  4BBK A;  3NSU A;  2VRW B;  1EAZ A;  1W1D A;  4ZRI A;  3PZD A;  3PVU A;  3AJ4 A;  3A8P A;  1H10 A;  4H8S A;  4YON A;  5JLJ B;  2D9Z A;  2M14 A;  2X18 A;  2HTH B;  1DBH A;  1ZC3 B;  2W2X C;  5J3T A;  2VKI A;  4HDO A;  4HB2 B;  3BIN A;  3PG7 A;  5J3Y A;  2EMS A;  2MFQ A;  3KRW A;  1W1G A;  2L1C A;  5D3X A;  4A6F A;  1LB1 A;  3P6A A;  1U27 A;  1K5D B;  3F0W A;  4NSW A;  2DX5 A;  2DTC A;  1M7R A;  3AU4 A;  3ULB A;  4F7U P;  1DDW A;  2QKM A;  1QQG A;  1FAO A;  3KRX A;  4HAW B;  4EKU A;  4IFS A;  4ZRJ A;  5JHH A;  1X1F A;  3P7Z A;  2EC1 A;  3VIA A;  1NU2 A;  1U2B A;  2P8V A;  4A6K A;  3PVW A;  2AL6 A;  3CXB B;  1X11 A;  2I5F A;  1P5T A;  4MK0 A;  1Y5O A;  1TQZ A;  1X05 A;  1XD4 A;  4ZRK A;  4P7I A;  1PFJ A;  2LYD A;  5DHA B;  1MPH A;  3TO1 A;  4EMO A;  2ADZ A;  5D3V A;  1U5D A;  3ODO A;  2K2J A;  2R0D A;  3O96 A;  1BTK A;  2KGX B;  3UZT A;  3PP2 A;  5CLQ B;  5KQ4 A;  1U5E A;  2I1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...