2YSZA

Solution structure of the chimera of the c-terminal pid domain of fe65l and the c-terminal tail peptide of app
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
185
structure length
185
Chain Sequence
GSSGSSGPTPKTELVQKFRVQYLGMLPVDRPVGMDTLNSAIENLMTSSSKEDWPSVNMNVADATVTVISEKNEEEVLVECRVRFLSFMGVGKDVHTFAFIMDTGNQRFECHVFWCEPNAANVSEAVQAACSGPSSGIEGRGSSGSSGSSGSSGDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amyloid beta A4 precursor protein-binding family B member 2
publication title Structure of the C-terminal phosphotyrosine interaction domain of Fe65L1 complexed with the cytoplasmic tail of amyloid precursor protein reveals a novel peptide binding mode
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 26
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2007-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2yszA01
1EAZA 4YONA 2UVMA 4A6FA 2ADZA 4GZUA 2Y7BA 3FM8C 3SV1A 2Y8GA 2I5FA 2DYQA 1NTVA 4HAWB 3HQCA 4D0NB 2X18A 4HATB 2UZSA 1I7AA 2UZRA 3A98B 3QIJA 2L2IA 4MY6A 2P8VA 4A6FB 5KCVA 1OQNA 1KI1B 5HE3A 1SHCA 1EF1A 4H8SA 2VRWB 2K00A 2KUPA 4HB0B 2DX1A 2IYBA 1Y19B 4KHOA 1K5GB 1FOEA 2N0YA 2ROVA 2EMSA 3O96A 4GXBA 2DFKA 2LYDA 3ZVRA 4IAPA 1UNRA 2H7EA 3AJ4A 3KY9A 4A6HA 5CLLB 2VKIA 5FI0A 2P0HA 2Z0OA 1FGYA 3DXEA 4HAXB 3KZ1A 2QKLA 3VIAA 4KHBB 3WA0A 4K17A 2ZPYA 2RSGA 2MFQA 1PMSA 4Y94A 2LULA 2COAA 1TXDA 1GG3A 4HB3B 2J59M 3PZDA 4L6EA 1BTNA 4CYEA 1ZC4B 3AU4A 2KGXB 2DN6A 3QWMA 5LONB 1TQZA 1MAIA 1U29A 1QC6A 4C0AA 3ODOA 5D3YA 5C5BA 2HTHB 4K2OA 2CODA 2DKPA 2D9VA 1PLSA 2I1KA 2QKMA 1ZVRA 4GPTB 1FAOA 4GMVA 5C16A 1W1HA 5C79A 4HAYB 2J0KA 5KQ4A 4K2PA 1J19A 5D3WA 1BAKA 1XCGA 1M7EA 5C5BB 1LB1A 4HAUB 2YT1A 4HAVB 3PSCA 1MKEA 3GYOA 4DX90 3KRXA 4HDQA 1DDWA 2Z0PA 1QQGA 4KAXB 5DIFB 1RRPB 1U5GA 2D9XA 2D11A 2DA0A 1ISNA 1AQCA 2GCJA 3DXCA 4ZRIA 4F7GA 1MPHA 1OY2A 1DYNA 2PZ1A 2CAYA 5JLJB 1H10A 1RJ2A 4Z2MB 1X05A 1BWNA 1MIXA 1KZ7A 2J0JA 2KCJA 3D8FA 4PQ0A 2RGNB 1K5DB 1V5MA 2FJLA 4TKNA 4NSWA 1EGXA 3DXDA 4WSFA 5D3XA 5J3QA 3F5RA 1X86A 2W2WA 1U5DA 2V76A 1UPQA 3NSUA 3HW2B 1FB8A 2DX5A 1U27A 4TYZA 2GCLA 3U7DA 2EJ8A 4B6HA 2YT0A 1MIZB 1V5UA 3TFMA 1P6SA 5J3YA 3HK0A 2K2JA 5J3TA 4ZRJA 3PVUA 3ZDTA 3PEGA 1FHXA 1P3RA 2CRFA 2P0FA 2LOZA 2RLOA 4WJ7A 3SUZA 2JP2A 2YS3A 5DHAB 4EMOA 2L1CA 4K81A 3CIKA 3IVFA 2D4QA 1XX0A 1B55A 3U8ZA 2DHKA 3X23A 3OANA 1OMWA 3CXBB 1U5EA 2D9WA 3FSSA 1XD4A 5HE1A 5KQ1A 3TVVA 1WJ1A 1UNQA 1BTKA 1DDVA 3MDBC 2D2QA 2W2XC 1V61A 1WI1A 2VSZA 1U5FA 1H4RA 2LOXA 3P7ZA 2RVBB 3V5WA 2M14A 1SGHA 4IFSA 2DLWA 2YSZA 2YRYA 1X1GA 4YL8A 4Z2NA 2MWNB 3SYXA 2D10A 4F7UP 2P0DA 1AWEA 2DTCA 1GC6A 2DHIA 2NMBA 2XQNM 5L81A 2GS0A 3PVLA 1LW3A 4GMXB 4BBKA 4EJNA 1FGZA 1U2BA 3BINA 1DBHA 4P7IA 5EFXA 2Y8FA 1N3HA 1WVHA 5JP4A 4HB2B 2Z0QA 4DX8A 3ODWA 1XR0B 3PVWA 3AU5A 5HE0A 5C6RA 1ZC3B 3FEHA 5JHHA 5GOWB 1WGQA 4A6KA 1FHWA 4HDOA 2EMTA 3WYFB 2YS5A 3G9WA 1PFJA 3SNHA 1V89A 2H7DA 4IOYX 1ZM0A 4WVFB 1KZGA 4XWXA 3TW1A 2D9ZA 3M1IB 3F0WA 4CHJA 3ML4A 1V88A 3TCAA 3TO1A 4A5KA 2DYNA 4GN1A 2MKRA 1I2HA 4F7HA 2W2XD 5DHFB 3PG7A 1IRSA 2ROZB 1GC7A 2RUKB 1NU2A 2HE7A 3RCPA 3UZTA 4NY0A 2RNRB 1WJMA 2IFSA 2EC1A 2J0MA 1XKEA 3ULCA 2G35A 4HB4B 3ULBA 1UPRA 5D3VA 1M7RA 1P5TA 4CHMA 1Z87A 2COFA 2GJYA 1UEFA 5LOPB 3T06A 4MK0A 5CLQB 2R09A 5DH9B 4DBBA 1UNPA 4HAZB 2NZ8B 3QBVB 1DDMA 2MDXA 1E5WA 3GYPA 3PP2A 3ODXA 2YVCA 1TJ6A 4MT7A 4ZRKA 2E2XA 2R0DA 1Q67A 3D8DA 2D9YA 3P6AA 2DKQA 1MK7B 1J0WA 2COCA 1XODA 2BCJA 2CY4A 2YS1A 2LKOA 1DROA 3VOQA 2I1JA 2OTXA 5DI9B 1ZSQA 2AEHA 1NTYA 1X11A 2YF0A 1FHOA 3MPXA 3N7CA 1W1DA 2AL6A 2LG1A 3KRWA 2ELBA 2CY5A 4PNKA 2DHJA 3SO6A 5D27A 5JHGA 4HHVA 3D8EA 3BJIA 2ELAA 2K2UA 5HE2A 1MK9B 2I5CA 4KVGB 5FI1A 2M38A 1EVHA 2OQBA 1V5PA 1X1FA 3A8QA 1WG7A 2Q13A 1NI2A 4DXAB 4KHAA 3A8PA 1WGUA 1Y5OA 2N23A 3LJUX 4EKUA 1W1GA 3KSYA
chains in the Genus database with same CATH superfamily
1EAZA 4YONA 2UVMA 4A6FA 2ADZA 4GZUA 4QXAB 2Y7BA 3FM8C 3SV1A 2Y8GA 2I5FA 2DYQA 4GOUA 1NTVA 4HAWB 3HQCA 4D0NB 2X18A 4HATB 2UZSA 1I7AA 2UZRA 3A98B 5I2SA 3QIJA 2L2IA 4MY6A 2P8VA 4A6FB 5KCVA 1OQNA 1KI1B 5HE3A 1SHCA 1EF1A 4H8SA 2VRWB 2K00A 2KUPA 4HB0B 2DX1A 2IYBA 1Y19B 4KHOA 3B77A 1K5GB 1FOEA 2KR0A 2N0YA 2ROVA 2EMSA 2Z59A 3O96A 4GXBA 2DFKA 2LYDA 3ZVRA 4IAPA 1UNRA 2H7EA 3AJ4A 3KY9A 4A6HA 4KHBA 5CLLB 2VKIA 5FI0A 2P0HA 2Z0OA 1FGYA 3DXEA 4HAXB 3KZ1A 5I2MA 2QKLA 2Z14A 3VIAA 4KHBB 3WA0A 4K17A 2ZPYA 4QJ4B 2RSGA 2MFQA 1PMSA 4Y94A 3NW8A 4OSNA 2LULA 2COAA 1TXDA 1GG3A 4HB3B 2J59M 3PZDA 4L6EA 1BTNA 4OT1A 4CYEA 1ZC4B 3AU4A 2KGXB 2DN6A 3QWMA 5LONB 1TQZA 1MAIA 1U29A 1QC6A 4C0AA 3ODOA 5D3YA 5C5BA 2HTHB 4K2OA 2CODA 2DKPA 2D9VA 1PLSA 2I1KA 2QKMA 1ZVRA 4GPTB 1FAOA 4GMVA 5C16A 1W1HA 5C79A 4HAYB 2J0KA 5KQ4A 4K2PA 1J19A 3HIEA 5D3WA 1BAKA 1XCGA 1M7EA 5C5BB 1LB1A 4HAUB 2YT1A 4HAVB 3PSCA 1MKEA 3GYOA 4DX90 3KRXA 4HDQA 1DDWA 4D6WA 2Z0PA 1QQGA 4KAXB 2NBVA 5DIFB 1RRPB 1U5GA 2D9XA 2D11A 2DA0A 1ISNA 1AQCA 2GCJA 3DXCA 4ZRIA 4F7GA 1MPHA 1OY2A 1DYNA 2ZKMX 2PZ1A 2CAYA 5JLJB 1H10A 1RJ2A 4Z2MB 1X05A 1BWNA 1MIXA 1KZ7A 2J0JA 2KCJA 3D8FA 4PQ0A 2RGNB 1K5DB 1V5MA 2FJLA 4TKNA 4NSWA 1EGXA 3DXDA 4WSFA 5D3XA 5J3QA 4DIXA 3F5RA 4HSIA 1X86A 4L1RA 2W2WA 2Z13A 1U5DA 2V76A 3A58A 1UPQA 3FVCA 3NSUA 3HW2B 1FB8A 2DX5A 1U27A 4TYZA 2GCLA 3U7DA 2EJ8A 4B6HA 2YT0A 1MIZB 1V5UA 3TFMA 3DCXA 4QJ5B 1P6SA 5J3YA 3HK0A 3OHMB 2K2JA 5J3TA 4ZRJA 3PVUA 3ZDTA 3PEGA 1FHXA 1P3RA 2CRFA 2P0FA 2LOZA 2RLOA 4WJ7A 3SUZA 2JP2A 2YS3A 5DHAB 4EMOA 2L1CA 2KIGA 4K81A 3CIKA 3IVFA 2D4QA 1XX0A 1B55A 3U8ZA 2DHKA 3X23A 3OANA 1OMWA 3CXBB 1U5EA 2D9WA 3FSSA 1XD4A 5HE1A 3NWDA 5KQ1A 2K49A 3TVVA 1WJ1A 1UNQA 1BTKA 1DDVA 3MDBC 2KIEA 2D2QA 2W2XC 1V61A 1WI1A 2VSZA 1U5FA 1H4RA 2LOXA 3P7ZA 2RVBB 3V5WA 2M14A 1SGHA 4IFSA 2DLWA 2YSZA 2YRYA 1X1GA 4YL8A 1ZYIA 4Z2NA 2MWNB 3SYXA 2D10A 4F7UP 2P0DA 1AWEA 2DTCA 1GC6A 2DHIA 2NMBA 3HSAA 2XQNM 5L81A 2GS0A 3PVLA 1LW3A 4GMXB 4BBKA 4EJNA 1FGZA 1U2BA 3BINA 1DBHA 4P7IA 3U12A 5EFXA 2Y8FA 1N3HA 1WVHA 5JP4A 4HB2B 2Z0QA 4DX8A 3ODWA 1XR0B 3PVWA 3AU5A 5HE0A 5C6RA 1ZC3B 3FEHA 5JHHA 5GOWB 1WGQA 4A6KA 1FHWA 4HDOA 2EMTA 2FJUB 2YT2A 1MI1A 3WYFB 2YS5A 3G9WA 1PFJA 3SNHA 1V89A 2H7DA 2K8EA 4IOYX 1ZM0A 4WVFB 1KZGA 4QJ3B 4XWXA 3TW1A 2D9ZA 3M1IB 3F0WA 4CHJA 3ML4A 1V88A 3TCAA 3TO1A 4A5KA 2DYNA 4GN1A 2MKRA 1I2HA 4F7HA 2W2XD 5DHFB 3PG7A 1IRSA 2ROZB 1GC7A 2RUKB 1NU2A 2HE7A 3RCPA 3UZTA 4NY0A 2RNRB 1WJMA 2IFSA 2EC1A 2J0MA 1XKEA 3ULCA 2G35A 4HB4B 3ULBA 1UPRA 5D3VA 1M7RA 1P5TA 4CHMA 1Z87A 2COFA 2GJYA 1UEFA 5LOPB 3T06A 4MK0A 5CLQB 2R09A 5DH9B 4CSQA 4DBBA 1UNPA 2GUMA 4HAZB 2NZ8B 3QBVB 1DDMA 2MDXA 1E5WA 3GYPA 3PP2A 3ODXA 2YVCA 5LG4B 1TJ6A 4MT7A 2Z4DA 4ZRKA 2E2XA 2R0DA 1Q67A 3D8DA 2D9YA 3P6AA 2DKQA 2R2YA 1T77A 1MK7B 1J0WA 2COCA 1XODA 2BCJA 2CY4A 2YS1A 2LKOA 1DROA 3VOQA 2I1JA 2OTXA 5DI9B 1ZSQA 2AEHA 1NTYA 1X11A 2YF0A 1FHOA 3MPXA 3N7CA 1W1DA 2AL6A 2LG1A 3KRWA 2ELBA 2CY5A 3NWFA 2RRFA 4PNKA 2DHJA 5M4YB 3NWAA 3SO6A 5D27A 5JHGA 4HHVA 3D8EA 3BJIA 2ELAA 2K2UA 5HE2A 1MK9B 2I5CA 4KVGB 2KUQA 5IRSA 5FI1A 2M38A 1EVHA 2OQBA 1V5PA 1X1FA 3A8QA 1WG7A 2Q13A 1NI2A 4DXAB 4KHAA 3A8PA 1WGUA 1Y5OA 2N23A 3LJUX 4EKUA 1W1GA 3KSYA 4GNKB
chains in the Genus database with same CATH topology
1EAZA 4YONA 2UVMA 4A6FA 2ADZA 4GZUA 2Y7BA 3FM8C 3SV1A 2Y8GA 2I5FA 2DYQA 1NTVA 4HAWB 3HQCA 4D0NB 2X18A 4HATB 2UZSA 1I7AA 2UZRA 3A98B 3QIJA 2L2IA 4MY6A 2P8VA 4A6FB 5KCVA 1OQNA 1KI1B 5HE3A 1SHCA 1EF1A 4H8SA 2VRWB 2K00A 2KUPA 4HB0B 2DX1A 2IYBA 1Y19B 4KHOA 1K5GB 1FOEA 2N0YA 2ROVA 2EMSA 3O96A 4GXBA 2DFKA 2LYDA 3ZVRA 4IAPA 1UNRA 2H7EA 3AJ4A 3KY9A 4A6HA 5CLLB 2VKIA 5FI0A 2P0HA 2Z0OA 1FGYA 3DXEA 4HAXB 3KZ1A 2QKLA 3VIAA 4KHBB 3WA0A 4K17A 2ZPYA 2RSGA 2MFQA 1PMSA 4Y94A 2LULA 2COAA 1TXDA 1GG3A 4HB3B 2J59M 3PZDA 4L6EA 1BTNA 4CYEA 1ZC4B 3AU4A 2KGXB 2DN6A 3QWMA 5LONB 1TQZA 1MAIA 1U29A 1QC6A 4C0AA 3ODOA 5D3YA 5C5BA 2HTHB 4K2OA 2CODA 2DKPA 2D9VA 1PLSA 2I1KA 2QKMA 1ZVRA 4GPTB 1FAOA 4GMVA 5C16A 1W1HA 5C79A 4HAYB 2J0KA 5KQ4A 4K2PA 1J19A 5D3WA 1BAKA 1XCGA 1M7EA 5C5BB 1LB1A 4HAUB 2YT1A 4HAVB 3PSCA 1MKEA 3GYOA 4DX90 3KRXA 4HDQA 1DDWA 2Z0PA 1QQGA 4KAXB 5DIFB 1RRPB 1U5GA 2D9XA 2D11A 2DA0A 1ISNA 1AQCA 2GCJA 3DXCA 4ZRIA 4F7GA 1MPHA 1OY2A 1DYNA 2PZ1A 2CAYA 5JLJB 1H10A 1RJ2A 4Z2MB 1X05A 1BWNA 1MIXA 1KZ7A 2J0JA 2KCJA 3D8FA 4PQ0A 2RGNB 1K5DB 1V5MA 2FJLA 4TKNA 4NSWA 1EGXA 3DXDA 4WSFA 5D3XA 5J3QA 3F5RA 1X86A 2W2WA 1U5DA 2V76A 1UPQA 3NSUA 3HW2B 1FB8A 2DX5A 1U27A 4TYZA 2GCLA 3U7DA 2EJ8A 4B6HA 2YT0A 1MIZB 1V5UA 3TFMA 1P6SA 5J3YA 3HK0A 2K2JA 5J3TA 4ZRJA 3PVUA 3ZDTA 3PEGA 1FHXA 1P3RA 2CRFA 2P0FA 2LOZA 2RLOA 4WJ7A 3SUZA 2JP2A 2YS3A 5DHAB 4EMOA 2L1CA 4K81A 3CIKA 3IVFA 2D4QA 1XX0A 1B55A 3U8ZA 2DHKA 3X23A 3OANA 1OMWA 3CXBB 1U5EA 2D9WA 3FSSA 1XD4A 5HE1A 5KQ1A 3TVVA 1WJ1A 1UNQA 1BTKA 1DDVA 3MDBC 2D2QA 2W2XC 1V61A 1WI1A 2VSZA 1U5FA 1H4RA 2LOXA 3P7ZA 2RVBB 3V5WA 2M14A 1SGHA 4IFSA 2DLWA 2YSZA 2YRYA 1X1GA 4YL8A 4Z2NA 2MWNB 3SYXA 2D10A 4F7UP 2P0DA 1AWEA 2DTCA 1GC6A 2DHIA 2NMBA 2XQNM 5L81A 2GS0A 3PVLA 1LW3A 4GMXB 4BBKA 4EJNA 1FGZA 1U2BA 3BINA 1DBHA 4P7IA 5EFXA 2Y8FA 1N3HA 1WVHA 5JP4A 4HB2B 2Z0QA 4DX8A 3ODWA 1XR0B 3PVWA 3AU5A 5HE0A 5C6RA 1ZC3B 3FEHA 5JHHA 5GOWB 1WGQA 4A6KA 1FHWA 4HDOA 2EMTA 3WYFB 2YS5A 3G9WA 1PFJA 3SNHA 1V89A 2H7DA 4IOYX 1ZM0A 4WVFB 1KZGA 4XWXA 3TW1A 2D9ZA 3M1IB 3F0WA 4CHJA 3ML4A 1V88A 3TCAA 3TO1A 4A5KA 2DYNA 4GN1A 2MKRA 1I2HA 4F7HA 2W2XD 5DHFB 3PG7A 1IRSA 2ROZB 1GC7A 2RUKB 1NU2A 2HE7A 3RCPA 3UZTA 4NY0A 2RNRB 1WJMA 2IFSA 2EC1A 2J0MA 1XKEA 3ULCA 2G35A 4HB4B 3ULBA 1UPRA 5D3VA 1M7RA 1P5TA 4CHMA 1Z87A 2COFA 2GJYA 1UEFA 5LOPB 3T06A 4MK0A 5CLQB 2R09A 5DH9B 4DBBA 1UNPA 4HAZB 2NZ8B 3QBVB 1DDMA 2MDXA 1E5WA 3GYPA 3PP2A 3ODXA 2YVCA 1TJ6A 4MT7A 4ZRKA 2E2XA 2R0DA 1Q67A 3D8DA 2D9YA 3P6AA 2DKQA 1MK7B 1J0WA 2COCA 1XODA 2BCJA 2CY4A 2YS1A 2LKOA 1DROA 3VOQA 2I1JA 2OTXA 5DI9B 1ZSQA 2AEHA 1NTYA 1X11A 2YF0A 1FHOA 3MPXA 3N7CA 1W1DA 2AL6A 2LG1A 3KRWA 2ELBA 2CY5A 4PNKA 2DHJA 3SO6A 5D27A 5JHGA 4HHVA 3D8EA 3BJIA 2ELAA 2K2UA 5HE2A 1MK9B 2I5CA 4KVGB 5FI1A 2M38A 1EVHA 2OQBA 1V5PA 1X1FA 3A8QA 1WG7A 2Q13A 1NI2A 4DXAB 4KHAA 3A8PA 1WGUA 1Y5OA 2N23A 3LJUX 4EKUA 1W1GA 3KSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EAZ A;  4YON A;  2UVM A;  4A6F A;  2ADZ A;  4GZU A;  2Y7B A;  3FM8 C;  3SV1 A;  2Y8G A;  2I5F A;  2DYQ A;  1NTV A;  4HAW B;  3HQC A;  4D0N B;  2X18 A;  4HAT B;  2UZS A;  1I7A A;  2UZR A;  3A98 B;  3QIJ A;  2L2I A;  4MY6 A;  2P8V A;  4A6F B;  5KCV A;  1OQN A;  1KI1 B;  5HE3 A;  1SHC A;  1EF1 A;  4H8S A;  2VRW B;  2K00 A;  2KUP A;  4HB0 B;  2DX1 A;  2IYB A;  1Y19 B;  4KHO A;  1K5G B;  1FOE A;  2N0Y A;  2ROV A;  2EMS A;  3O96 A;  4GXB A;  2DFK A;  2LYD A;  3ZVR A;  4IAP A;  1UNR A;  2H7E A;  3AJ4 A;  3KY9 A;  4A6H A;  5CLL B;  2VKI A;  5FI0 A;  2P0H A;  2Z0O A;  1FGY A;  3DXE A;  4HAX B;  3KZ1 A;  2QKL A;  3VIA A;  4KHB B;  3WA0 A;  4K17 A;  2ZPY A;  2RSG A;  2MFQ A;  1PMS A;  4Y94 A;  2LUL A;  2COA A;  1TXD A;  1GG3 A;  4HB3 B;  2J59 M;  3PZD A;  4L6E A;  1BTN A;  4CYE A;  1ZC4 B;  3AU4 A;  2KGX B;  2DN6 A;  3QWM A;  5LON B;  1TQZ A;  1MAI A;  1U29 A;  1QC6 A;  4C0A A;  3ODO A;  5D3Y A;  5C5B A;  2HTH B;  4K2O A;  2COD A;  2DKP A;  2D9V A;  1PLS A;  2I1K A;  2QKM A;  1ZVR A;  4GPT B;  1FAO A;  4GMV A;  5C16 A;  1W1H A;  5C79 A;  4HAY B;  2J0K A;  5KQ4 A;  4K2P A;  1J19 A;  5D3W A;  1BAK A;  1XCG A;  1M7E A;  5C5B B;  1LB1 A;  4HAU B;  2YT1 A;  4HAV B;  3PSC A;  1MKE A;  3GYO A;  4DX9 0;  3KRX A;  4HDQ A;  1DDW A;  2Z0P A;  1QQG A;  4KAX B;  5DIF B;  1RRP B;  1U5G A;  2D9X A;  2D11 A;  2DA0 A;  1ISN A;  1AQC A;  2GCJ A;  3DXC A;  4ZRI A;  4F7G A;  1MPH A;  1OY2 A;  1DYN A;  2PZ1 A;  2CAY A;  5JLJ B;  1H10 A;  1RJ2 A;  4Z2M B;  1X05 A;  1BWN A;  1MIX A;  1KZ7 A;  2J0J A;  2KCJ A;  3D8F A;  4PQ0 A;  2RGN B;  1K5D B;  1V5M A;  2FJL A;  4TKN A;  4NSW A;  1EGX A;  3DXD A;  4WSF A;  5D3X A;  5J3Q A;  3F5R A;  1X86 A;  2W2W A;  1U5D A;  2V76 A;  1UPQ A;  3NSU A;  3HW2 B;  1FB8 A;  2DX5 A;  1U27 A;  4TYZ A;  2GCL A;  3U7D A;  2EJ8 A;  4B6H A;  2YT0 A;  1MIZ B;  1V5U A;  3TFM A;  1P6S A;  5J3Y A;  3HK0 A;  2K2J A;  5J3T A;  4ZRJ A;  3PVU A;  3ZDT A;  3PEG A;  1FHX A;  1P3R A;  2CRF A;  2P0F A;  2LOZ A;  2RLO A;  4WJ7 A;  3SUZ A;  2JP2 A;  2YS3 A;  5DHA B;  4EMO A;  2L1C A;  4K81 A;  3CIK A;  3IVF A;  2D4Q A;  1XX0 A;  1B55 A;  3U8Z A;  2DHK A;  3X23 A;  3OAN A;  1OMW A;  3CXB B;  1U5E A;  2D9W A;  3FSS A;  1XD4 A;  5HE1 A;  5KQ1 A;  3TVV A;  1WJ1 A;  1UNQ A;  1BTK A;  1DDV A;  3MDB C;  2D2Q A;  2W2X C;  1V61 A;  1WI1 A;  2VSZ A;  1U5F A;  1H4R A;  2LOX A;  3P7Z A;  2RVB B;  3V5W A;  2M14 A;  1SGH A;  4IFS A;  2DLW A;  2YSZ A;  2YRY A;  1X1G A;  4YL8 A;  4Z2N A;  2MWN B;  3SYX A;  2D10 A;  4F7U P;  2P0D A;  1AWE A;  2DTC A;  1GC6 A;  2DHI A;  2NMB A;  2XQN M;  5L81 A;  2GS0 A;  3PVL A;  1LW3 A;  4GMX B;  4BBK A;  4EJN A;  1FGZ A;  1U2B A;  3BIN A;  1DBH A;  4P7I A;  5EFX A;  2Y8F A;  1N3H A;  1WVH A;  5JP4 A;  4HB2 B;  2Z0Q A;  4DX8 A;  3ODW A;  1XR0 B;  3PVW A;  3AU5 A;  5HE0 A;  5C6R A;  1ZC3 B;  3FEH A;  5JHH A;  5GOW B;  1WGQ A;  4A6K A;  1FHW A;  4HDO A;  2EMT A;  3WYF B;  2YS5 A;  3G9W A;  1PFJ A;  3SNH A;  1V89 A;  2H7D A;  4IOY X;  1ZM0 A;  4WVF B;  1KZG A;  4XWX A;  3TW1 A;  2D9Z A;  3M1I B;  3F0W A;  4CHJ A;  3ML4 A;  1V88 A;  3TCA A;  3TO1 A;  4A5K A;  2DYN A;  4GN1 A;  2MKR A;  1I2H A;  4F7H A;  2W2X D;  5DHF B;  3PG7 A;  1IRS A;  2ROZ B;  1GC7 A;  2RUK B;  1NU2 A;  2HE7 A;  3RCP A;  3UZT A;  4NY0 A;  2RNR B;  1WJM A;  2IFS A;  2EC1 A;  2J0M A;  1XKE A;  3ULC A;  2G35 A;  4HB4 B;  3ULB A;  1UPR A;  5D3V A;  1M7R A;  1P5T A;  4CHM A;  1Z87 A;  2COF A;  2GJY A;  1UEF A;  5LOP B;  3T06 A;  4MK0 A;  5CLQ B;  2R09 A;  5DH9 B;  4DBB A;  1UNP A;  4HAZ B;  2NZ8 B;  3QBV B;  1DDM A;  2MDX A;  1E5W A;  3GYP A;  3PP2 A;  3ODX A;  2YVC A;  1TJ6 A;  4MT7 A;  4ZRK A;  2E2X A;  2R0D A;  1Q67 A;  3D8D A;  2D9Y A;  3P6A A;  2DKQ A;  1MK7 B;  1J0W A;  2COC A;  1XOD A;  2BCJ A;  2CY4 A;  2YS1 A;  2LKO A;  1DRO A;  3VOQ A;  2I1J A;  2OTX A;  5DI9 B;  1ZSQ A;  2AEH A;  1NTY A;  1X11 A;  2YF0 A;  1FHO A;  3MPX A;  3N7C A;  1W1D A;  2AL6 A;  2LG1 A;  3KRW A;  2ELB A;  2CY5 A;  4PNK A;  2DHJ A;  3SO6 A;  5D27 A;  5JHG A;  4HHV A;  3D8E A;  3BJI A;  2ELA A;  2K2U A;  5HE2 A;  1MK9 B;  2I5C A;  4KVG B;  5FI1 A;  2M38 A;  1EVH A;  2OQB A;  1V5P A;  1X1F A;  3A8Q A;  1WG7 A;  2Q13 A;  1NI2 A;  4DXA B;  4KHA A;  3A8P A;  1WGU A;  1Y5O A;  2N23 A;  3LJU X;  4EKU A;  1W1G A;  3KSY A; 
#chains in the Genus database with same CATH topology
 1EAZ A;  4YON A;  2UVM A;  4A6F A;  2ADZ A;  4GZU A;  4QXA B;  2Y7B A;  3FM8 C;  3SV1 A;  2Y8G A;  2I5F A;  2DYQ A;  4GOU A;  1NTV A;  4HAW B;  3HQC A;  4D0N B;  2X18 A;  4HAT B;  2UZS A;  1I7A A;  2UZR A;  3A98 B;  5I2S A;  3QIJ A;  2L2I A;  4MY6 A;  2P8V A;  4A6F B;  5KCV A;  1OQN A;  1KI1 B;  5HE3 A;  1SHC A;  1EF1 A;  4H8S A;  2VRW B;  2K00 A;  2KUP A;  4HB0 B;  2DX1 A;  2IYB A;  1Y19 B;  4KHO A;  3B77 A;  1K5G B;  1FOE A;  2KR0 A;  2N0Y A;  2ROV A;  2EMS A;  2Z59 A;  3O96 A;  4GXB A;  2DFK A;  2LYD A;  3ZVR A;  4IAP A;  1UNR A;  2H7E A;  3AJ4 A;  3KY9 A;  4A6H A;  4KHB A;  5CLL B;  2VKI A;  5FI0 A;  2P0H A;  2Z0O A;  1FGY A;  3DXE A;  4HAX B;  3KZ1 A;  5I2M A;  2QKL A;  2Z14 A;  3VIA A;  4KHB B;  3WA0 A;  4K17 A;  2ZPY A;  4QJ4 B;  2RSG A;  2MFQ A;  1PMS A;  4Y94 A;  3NW8 A;  4OSN A;  2LUL A;  2COA A;  1TXD A;  1GG3 A;  4HB3 B;  2J59 M;  3PZD A;  4L6E A;  1BTN A;  4OT1 A;  4CYE A;  1ZC4 B;  3AU4 A;  2KGX B;  2DN6 A;  3QWM A;  5LON B;  1TQZ A;  1MAI A;  1U29 A;  1QC6 A;  4C0A A;  3ODO A;  5D3Y A;  5C5B A;  2HTH B;  4K2O A;  2COD A;  2DKP A;  2D9V A;  1PLS A;  2I1K A;  2QKM A;  1ZVR A;  4GPT B;  1FAO A;  4GMV A;  5C16 A;  1W1H A;  5C79 A;  4HAY B;  2J0K A;  5KQ4 A;  4K2P A;  1J19 A;  3HIE A;  5D3W A;  1BAK A;  1XCG A;  1M7E A;  5C5B B;  1LB1 A;  4HAU B;  2YT1 A;  4HAV B;  3PSC A;  1MKE A;  3GYO A;  4DX9 0;  3KRX A;  4HDQ A;  1DDW A;  4D6W A;  2Z0P A;  1QQG A;  4KAX B;  2NBV A;  5DIF B;  1RRP B;  1U5G A;  2D9X A;  2D11 A;  2DA0 A;  1ISN A;  1AQC A;  2GCJ A;  3DXC A;  4ZRI A;  4F7G A;  1MPH A;  1OY2 A;  1DYN A;  2ZKM X;  2PZ1 A;  2CAY A;  5JLJ B;  1H10 A;  1RJ2 A;  4Z2M B;  1X05 A;  1BWN A;  1MIX A;  1KZ7 A;  2J0J A;  2KCJ A;  3D8F A;  4PQ0 A;  2RGN B;  1K5D B;  1V5M A;  2FJL A;  4TKN A;  4NSW A;  1EGX A;  3DXD A;  4WSF A;  5D3X A;  5J3Q A;  4DIX A;  3F5R A;  4HSI A;  1X86 A;  4L1R A;  2W2W A;  2Z13 A;  1U5D A;  2V76 A;  3A58 A;  1UPQ A;  3FVC A;  3NSU A;  3HW2 B;  1FB8 A;  2DX5 A;  1U27 A;  4TYZ A;  2GCL A;  3U7D A;  2EJ8 A;  4B6H A;  2YT0 A;  1MIZ B;  1V5U A;  3TFM A;  3DCX A;  4QJ5 B;  1P6S A;  5J3Y A;  3HK0 A;  3OHM B;  2K2J A;  5J3T A;  4ZRJ A;  3PVU A;  3ZDT A;  3PEG A;  1FHX A;  1P3R A;  2CRF A;  2P0F A;  2LOZ A;  2RLO A;  4WJ7 A;  3SUZ A;  2JP2 A;  2YS3 A;  5DHA B;  4EMO A;  2L1C A;  2KIG A;  4K81 A;  3CIK A;  3IVF A;  2D4Q A;  1XX0 A;  1B55 A;  3U8Z A;  2DHK A;  3X23 A;  3OAN A;  1OMW A;  3CXB B;  1U5E A;  2D9W A;  3FSS A;  1XD4 A;  5HE1 A;  3NWD A;  5KQ1 A;  2K49 A;  3TVV A;  1WJ1 A;  1UNQ A;  1BTK A;  1DDV A;  3MDB C;  2KIE A;  2D2Q A;  2W2X C;  1V61 A;  1WI1 A;  2VSZ A;  1U5F A;  1H4R A;  2LOX A;  3P7Z A;  2RVB B;  3V5W A;  2M14 A;  1SGH A;  4IFS A;  2DLW A;  2YSZ A;  2YRY A;  1X1G A;  4YL8 A;  1ZYI A;  4Z2N A;  2MWN B;  3SYX A;  2D10 A;  4F7U P;  2P0D A;  1AWE A;  2DTC A;  1GC6 A;  2DHI A;  2NMB A;  3HSA A;  2XQN M;  5L81 A;  2GS0 A;  3PVL A;  1LW3 A;  4GMX B;  4BBK A;  4EJN A;  1FGZ A;  1U2B A;  3BIN A;  1DBH A;  4P7I A;  3U12 A;  5EFX A;  2Y8F A;  1N3H A;  1WVH A;  5JP4 A;  4HB2 B;  2Z0Q A;  4DX8 A;  3ODW A;  1XR0 B;  3PVW A;  3AU5 A;  5HE0 A;  5C6R A;  1ZC3 B;  3FEH A;  5JHH A;  5GOW B;  1WGQ A;  4A6K A;  1FHW A;  4HDO A;  2EMT A;  2FJU B;  2YT2 A;  1MI1 A;  3WYF B;  2YS5 A;  3G9W A;  1PFJ A;  3SNH A;  1V89 A;  2H7D A;  2K8E A;  4IOY X;  1ZM0 A;  4WVF B;  1KZG A;  4QJ3 B;  4XWX A;  3TW1 A;  2D9Z A;  3M1I B;  3F0W A;  4CHJ A;  3ML4 A;  1V88 A;  3TCA A;  3TO1 A;  4A5K A;  2DYN A;  4GN1 A;  2MKR A;  1I2H A;  4F7H A;  2W2X D;  5DHF B;  3PG7 A;  1IRS A;  2ROZ B;  1GC7 A;  2RUK B;  1NU2 A;  2HE7 A;  3RCP A;  3UZT A;  4NY0 A;  2RNR B;  1WJM A;  2IFS A;  2EC1 A;  2J0M A;  1XKE A;  3ULC A;  2G35 A;  4HB4 B;  3ULB A;  1UPR A;  5D3V A;  1M7R A;  1P5T A;  4CHM A;  1Z87 A;  2COF A;  2GJY A;  1UEF A;  5LOP B;  3T06 A;  4MK0 A;  5CLQ B;  2R09 A;  5DH9 B;  4CSQ A;  4DBB A;  1UNP A;  2GUM A;  4HAZ B;  2NZ8 B;  3QBV B;  1DDM A;  2MDX A;  1E5W A;  3GYP A;  3PP2 A;  3ODX A;  2YVC A;  5LG4 B;  1TJ6 A;  4MT7 A;  2Z4D A;  4ZRK A;  2E2X A;  2R0D A;  1Q67 A;  3D8D A;  2D9Y A;  3P6A A;  2DKQ A;  2R2Y A;  1T77 A;  1MK7 B;  1J0W A;  2COC A;  1XOD A;  2BCJ A;  2CY4 A;  2YS1 A;  2LKO A;  1DRO A;  3VOQ A;  2I1J A;  2OTX A;  5DI9 B;  1ZSQ A;  2AEH A;  1NTY A;  1X11 A;  2YF0 A;  1FHO A;  3MPX A;  3N7C A;  1W1D A;  2AL6 A;  2LG1 A;  3KRW A;  2ELB A;  2CY5 A;  3NWF A;  2RRF A;  4PNK A;  2DHJ A;  5M4Y B;  3NWA A;  3SO6 A;  5D27 A;  5JHG A;  4HHV A;  3D8E A;  3BJI A;  2ELA A;  2K2U A;  5HE2 A;  1MK9 B;  2I5C A;  4KVG B;  2KUQ A;  5IRS A;  5FI1 A;  2M38 A;  1EVH A;  2OQB A;  1V5P A;  1X1F A;  3A8Q A;  1WG7 A;  2Q13 A;  1NI2 A;  4DXA B;  4KHA A;  3A8P A;  1WGU A;  1Y5O A;  2N23 A;  3LJU X;  4EKU A;  1W1G A;  3KSY A;  4GNK B; 
#chains in the Genus database with same CATH homology
 1EAZ A;  4YON A;  2UVM A;  4A6F A;  2ADZ A;  4GZU A;  2Y7B A;  3FM8 C;  3SV1 A;  2Y8G A;  2I5F A;  2DYQ A;  1NTV A;  4HAW B;  3HQC A;  4D0N B;  2X18 A;  4HAT B;  2UZS A;  1I7A A;  2UZR A;  3A98 B;  3QIJ A;  2L2I A;  4MY6 A;  2P8V A;  4A6F B;  5KCV A;  1OQN A;  1KI1 B;  5HE3 A;  1SHC A;  1EF1 A;  4H8S A;  2VRW B;  2K00 A;  2KUP A;  4HB0 B;  2DX1 A;  2IYB A;  1Y19 B;  4KHO A;  1K5G B;  1FOE A;  2N0Y A;  2ROV A;  2EMS A;  3O96 A;  4GXB A;  2DFK A;  2LYD A;  3ZVR A;  4IAP A;  1UNR A;  2H7E A;  3AJ4 A;  3KY9 A;  4A6H A;  5CLL B;  2VKI A;  5FI0 A;  2P0H A;  2Z0O A;  1FGY A;  3DXE A;  4HAX B;  3KZ1 A;  2QKL A;  3VIA A;  4KHB B;  3WA0 A;  4K17 A;  2ZPY A;  2RSG A;  2MFQ A;  1PMS A;  4Y94 A;  2LUL A;  2COA A;  1TXD A;  1GG3 A;  4HB3 B;  2J59 M;  3PZD A;  4L6E A;  1BTN A;  4CYE A;  1ZC4 B;  3AU4 A;  2KGX B;  2DN6 A;  3QWM A;  5LON B;  1TQZ A;  1MAI A;  1U29 A;  1QC6 A;  4C0A A;  3ODO A;  5D3Y A;  5C5B A;  2HTH B;  4K2O A;  2COD A;  2DKP A;  2D9V A;  1PLS A;  2I1K A;  2QKM A;  1ZVR A;  4GPT B;  1FAO A;  4GMV A;  5C16 A;  1W1H A;  5C79 A;  4HAY B;  2J0K A;  5KQ4 A;  4K2P A;  1J19 A;  5D3W A;  1BAK A;  1XCG A;  1M7E A;  5C5B B;  1LB1 A;  4HAU B;  2YT1 A;  4HAV B;  3PSC A;  1MKE A;  3GYO A;  4DX9 0;  3KRX A;  4HDQ A;  1DDW A;  2Z0P A;  1QQG A;  4KAX B;  5DIF B;  1RRP B;  1U5G A;  2D9X A;  2D11 A;  2DA0 A;  1ISN A;  1AQC A;  2GCJ A;  3DXC A;  4ZRI A;  4F7G A;  1MPH A;  1OY2 A;  1DYN A;  2PZ1 A;  2CAY A;  5JLJ B;  1H10 A;  1RJ2 A;  4Z2M B;  1X05 A;  1BWN A;  1MIX A;  1KZ7 A;  2J0J A;  2KCJ A;  3D8F A;  4PQ0 A;  2RGN B;  1K5D B;  1V5M A;  2FJL A;  4TKN A;  4NSW A;  1EGX A;  3DXD A;  4WSF A;  5D3X A;  5J3Q A;  3F5R A;  1X86 A;  2W2W A;  1U5D A;  2V76 A;  1UPQ A;  3NSU A;  3HW2 B;  1FB8 A;  2DX5 A;  1U27 A;  4TYZ A;  2GCL A;  3U7D A;  2EJ8 A;  4B6H A;  2YT0 A;  1MIZ B;  1V5U A;  3TFM A;  1P6S A;  5J3Y A;  3HK0 A;  2K2J A;  5J3T A;  4ZRJ A;  3PVU A;  3ZDT A;  3PEG A;  1FHX A;  1P3R A;  2CRF A;  2P0F A;  2LOZ A;  2RLO A;  4WJ7 A;  3SUZ A;  2JP2 A;  2YS3 A;  5DHA B;  4EMO A;  2L1C A;  4K81 A;  3CIK A;  3IVF A;  2D4Q A;  1XX0 A;  1B55 A;  3U8Z A;  2DHK A;  3X23 A;  3OAN A;  1OMW A;  3CXB B;  1U5E A;  2D9W A;  3FSS A;  1XD4 A;  5HE1 A;  5KQ1 A;  3TVV A;  1WJ1 A;  1UNQ A;  1BTK A;  1DDV A;  3MDB C;  2D2Q A;  2W2X C;  1V61 A;  1WI1 A;  2VSZ A;  1U5F A;  1H4R A;  2LOX A;  3P7Z A;  2RVB B;  3V5W A;  2M14 A;  1SGH A;  4IFS A;  2DLW A;  2YSZ A;  2YRY A;  1X1G A;  4YL8 A;  4Z2N A;  2MWN B;  3SYX A;  2D10 A;  4F7U P;  2P0D A;  1AWE A;  2DTC A;  1GC6 A;  2DHI A;  2NMB A;  2XQN M;  5L81 A;  2GS0 A;  3PVL A;  1LW3 A;  4GMX B;  4BBK A;  4EJN A;  1FGZ A;  1U2B A;  3BIN A;  1DBH A;  4P7I A;  5EFX A;  2Y8F A;  1N3H A;  1WVH A;  5JP4 A;  4HB2 B;  2Z0Q A;  4DX8 A;  3ODW A;  1XR0 B;  3PVW A;  3AU5 A;  5HE0 A;  5C6R A;  1ZC3 B;  3FEH A;  5JHH A;  5GOW B;  1WGQ A;  4A6K A;  1FHW A;  4HDO A;  2EMT A;  3WYF B;  2YS5 A;  3G9W A;  1PFJ A;  3SNH A;  1V89 A;  2H7D A;  4IOY X;  1ZM0 A;  4WVF B;  1KZG A;  4XWX A;  3TW1 A;  2D9Z A;  3M1I B;  3F0W A;  4CHJ A;  3ML4 A;  1V88 A;  3TCA A;  3TO1 A;  4A5K A;  2DYN A;  4GN1 A;  2MKR A;  1I2H A;  4F7H A;  2W2X D;  5DHF B;  3PG7 A;  1IRS A;  2ROZ B;  1GC7 A;  2RUK B;  1NU2 A;  2HE7 A;  3RCP A;  3UZT A;  4NY0 A;  2RNR B;  1WJM A;  2IFS A;  2EC1 A;  2J0M A;  1XKE A;  3ULC A;  2G35 A;  4HB4 B;  3ULB A;  1UPR A;  5D3V A;  1M7R A;  1P5T A;  4CHM A;  1Z87 A;  2COF A;  2GJY A;  1UEF A;  5LOP B;  3T06 A;  4MK0 A;  5CLQ B;  2R09 A;  5DH9 B;  4DBB A;  1UNP A;  4HAZ B;  2NZ8 B;  3QBV B;  1DDM A;  2MDX A;  1E5W A;  3GYP A;  3PP2 A;  3ODX A;  2YVC A;  1TJ6 A;  4MT7 A;  4ZRK A;  2E2X A;  2R0D A;  1Q67 A;  3D8D A;  2D9Y A;  3P6A A;  2DKQ A;  1MK7 B;  1J0W A;  2COC A;  1XOD A;  2BCJ A;  2CY4 A;  2YS1 A;  2LKO A;  1DRO A;  3VOQ A;  2I1J A;  2OTX A;  5DI9 B;  1ZSQ A;  2AEH A;  1NTY A;  1X11 A;  2YF0 A;  1FHO A;  3MPX A;  3N7C A;  1W1D A;  2AL6 A;  2LG1 A;  3KRW A;  2ELB A;  2CY5 A;  4PNK A;  2DHJ A;  3SO6 A;  5D27 A;  5JHG A;  4HHV A;  3D8E A;  3BJI A;  2ELA A;  2K2U A;  5HE2 A;  1MK9 B;  2I5C A;  4KVG B;  5FI1 A;  2M38 A;  1EVH A;  2OQB A;  1V5P A;  1X1F A;  3A8Q A;  1WG7 A;  2Q13 A;  1NI2 A;  4DXA B;  4KHA A;  3A8P A;  1WGU A;  1Y5O A;  2N23 A;  3LJU X;  4EKU A;  1W1G A;  3KSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...