2YSZA

Solution structure of the chimera of the c-terminal pid domain of fe65l and the c-terminal tail peptide of app
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
185
structure length
185
Chain Sequence
b'GSSGSSGPTPKTELVQKFRVQYLGMLPVDRPVGMDTLNSAIENLMTSSSKEDWPSVNMNVADATVTVISEKNEEEVLVECRVRFLSFMGVGKDVHTFAFIMDTGNQRFECHVFWCEPNAANVSEAVQAACSGPSSGIEGRGSSGSSGSSGSSGDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amyloid beta A4 precursor protein-binding family B member 2
publication title Structure of the C-terminal phosphotyrosine interaction domain of Fe65L1 complexed with the cytoplasmic tail of amyloid precursor protein reveals a novel peptide binding mode
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 26
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2007-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2yszA01
1FB8A 3PEGA 3SV1A 2D9YA 5KQ4A 2L2IA 2CY5A 2RGNB 1XR0B 1E5WA 4WSFA 3AU5A 3G9WA 1NTYA 2KCJA 1FHOA 5J3TA 4HAVB 2DHJA 4HDQA 1FOEA 2EJ8A 5JHGA 1UNRA 2CAYA 3ULCA 1TXDA 1TJ6A 2K00A 2DYQA 1MKEA 4A6FA 3X23A 2EC1A 2MFQA 3U7DA 5C5BA 2GJYA 2UVMA 1KI1B 5J3YA 3VOQA 3GYPA 2N23A 2R09A 2P8VA 1DYNA 3P6AA 1IRSA 4DX8A 4EKUA 2LG1A 3KRXA 4HB4B 1H4RA 2I1JA 4PQ0A 2K2JA 1U27A 2YS3A 1DDWA 2HTHB 2H7EA 1GC6A 3DXCA 5FI1A 1V5PA 4HAUB 2M38A 2YT0A 5HE1A 3FM8C 2CY4A 1W1DA 5KCVA 1V89A 1N3HA 5J3QA 2AEHA 4GPTB 4Z2NA 2MDXA 1FGYA 2M14A 4GN1A 2MKRA 1U5DA 3IVFA 2ROZB 4ZRKA 5DIFB 2N0YA 1XCGA 2NZ8B 3PP2A 4DX90 5EFXA 4K17A 2COCA 2Y8FA 1QC6A 2D4QA 2PZ1A 3ODXA 3ZVRA 1LW3A 1KZGA 2YS1A 1XKEA 1TQZA 2ADZA 2H7DA 2G35A 1AQCA 2D9ZA 2UZRA 1RJ2A 1UNPA 2LKOA 1BTNA 2ZPYA 4MK0A 2ELBA 2DHKA 2GCJA 2D9XA 2P0FA 3WA0A 5C6RA 3A8PA 2DYNA 2X18A 2UZSA 4GMXB 3FEHA 1UNQA 2DX5A 4MY6A 2J59M 3AJ4A 3WYFB 2K2UA 2YF0A 1ISNA 4IAPA 5DHAB 1V5UA 3D8FA 4K2PA 1SGHA 2D11A 1MK7B 3QIJA 1ZVRA 5LOPB 2IFSA 4A5KA 3KRWA 2YS5A 4BBKA 1LB1A 2IYBA 1FAOA 5CLLB 1V5MA 1J0WA 2CRFA 4F7UP 2D2QA 3D8EA 1OY2A 3UZTA 4KVGB 3PVUA 3HW2B 4TKNA 1OMWA 1QQGA 2W2XC 5D27A 3SO6A 2EMSA 2DTCA 3F5RA 1B55A 1EGXA 2Q13A 1MAIA 2NMBA 2OTXA 4KHAA 4WVFB 3FSSA 1PMSA 3TVVA 4GXBA 5DH9B 1X11A 2FJLA 3BINA 2QKLA 2LULA 4A6HA 5C16A 1U5FA 2DKPA 2Z0PA 4GZUA 1U29A 2P0HA 5D3YA 5JHHA 2CODA 1P5TA 2DKQA 2YT1A 2VKIA 4HAZB 5GOWB 4P7IA 1SHCA 5DI9B 1BWNA 2XQNM 1MIZB 5D3VA 2D10A 4H8SA 3GYOA 1P3RA 1WGUA 2Z0OA 2LOZA 5DHFB 2DX1A 3DXEA 5LONB 3SUZA 2HE7A 4NY0A 1U2BA 3VIAA 3TO1A 1PLSA 4KHBB 2DFKA 5CLQB 4HDOA 1ZC4B 1Y5OA 1FGZA 4MT7A 3QBVB 4CHMA 1WVHA 3PZDA 4YONA 1KZ7A 4EMOA 1NI2A 1NU2A 3SYXA 3V5WA 2YVCA 2KGXB 5HE0A 2I5FA 3ML4A 1ZC3B 4PNKA 1P6SA 4K2OA 3SNHA 4HAWB 1XD4A 1GG3A 1V88A 1XX0A 2LOXA 2YRYA 1AWEA 4KHOA 3ZDTA 2RNRB 2W2WA 2DLWA 2RVBB 5JP4A 2BCJA 1X1GA 4HB0B 2D9WA 3RCPA 1NTVA 3CIKA 3MPXA 2R0DA 5C79A 2AL6A 2DA0A 2I1KA 1W1GA 4L6EA 1UPQA 1WG7A 4HB2B 2I5CA 4C0AA 2J0KA 2P0DA 2LYDA 1MIXA 1Z87A 1V61A 2MWNB 4IFSA 5JLJB 1OQNA 3ODWA 3KY9A 3AU4A 3PVWA 1BAKA 5KQ1A 1EF1A 5HE3A 3MDBC 3P7ZA 1FHWA 3O96A 4KAXB 1RRPB 1DDMA 1U5GA 1XODA 2L1CA 2W2XD 1K5GB 3PSCA 2RLOA 3A8QA 1M7RA 3TCAA 1DDVA 1WJMA 1U5EA 1BTKA 1UPRA 3F0WA 3NSUA 4ZRJA 3CXBB 5FI0A 1DBHA 5D3WA 3A98B 4DBBA 2GCLA 5HE2A 2KUPA 1W1HA 4ZRIA 4B6HA 1ZM0A 2OQBA 4F7GA 4XWXA 3D8DA 2J0JA 4HATB 4WJ7A 3QWMA 2QKMA 4IOYX 4CHJA 5D3XA 1M7EA 1I2HA 2DHIA 4K81A 3TW1A 3OANA 1X1FA 2D9VA 2YSZA 3HK0A 2RUKB 4HHVA 1EAZA 1Y19B 4Z2MB 4GMVA 2VSZA 4DXAB 3BJIA 4A6FB 1PFJA 2Z0QA 2JP2A 5C5BB 4F7HA 3LJUX 3PG7A 1MK9B 2COFA 4HAXB 2J0MA 1UEFA 1H10A 3M1IB 2EMTA 4CYEA 2DN6A 4EJNA 2Y7BA 3DXDA 1ZSQA 2ELAA 3TFMA 4A6KA 1MPHA 4HAYB 1K5DB 2ROVA 2COAA 4NSWA 1J19A 1FHXA 5L81A 3HQCA 2Y8GA 1I7AA 1Q67A 1EVHA 3U8ZA 1WGQA 4TYZA 1DROA 3PVLA 1WI1A 2RSGA 1X86A 2E2XA 2VRWB 3KSYA 1X05A 3KZ1A 3ODOA 4YL8A 3ULBA 4Y94A 3T06A 4HB3B 3N7CA 2GS0A 1GC7A 2V76A 4D0NB 1WJ1A
chains in the Genus database with same CATH superfamily
1FB8A 3PEGA 3SV1A 2D9YA 5KQ4A 2L2IA 2CY5A 2RGNB 1XR0B 1E5WA 4WSFA 3AU5A 3G9WA 1NTYA 2KCJA 1FHOA 5J3TA 4HAVB 2DHJA 4HDQA 1FOEA 2EJ8A 5JHGA 1UNRA 3NWAA 2CAYA 3ULCA 1TXDA 1TJ6A 3FVCA 2K00A 2DYQA 1MKEA 4A6FA 3X23A 2EC1A 2MFQA 3U7DA 5C5BA 2GJYA 2UVMA 1KI1B 5J3YA 3VOQA 3GYPA 2N23A 4OT1A 2R09A 2P8VA 1DYNA 2NBVA 5I2SA 3P6AA 1IRSA 4DX8A 5IRSA 4EKUA 2LG1A 3KRXA 4HB4B 1H4RA 2I1JA 4PQ0A 2K2JA 1U27A 2YS3A 1DDWA 2HTHB 2H7EA 1GC6A 3DXCA 5FI1A 1V5PA 4HAUB 2M38A 2YT0A 5HE1A 3OHMB 3FM8C 2CY4A 1W1DA 5KCVA 1V89A 1N3HA 5J3QA 2AEHA 4GPTB 4Z2NA 2MDXA 3A58A 1FGYA 2M14A 4GN1A 2MKRA 1U5DA 2ROZB 3IVFA 4ZRKA 5DIFB 2N0YA 1XCGA 2NZ8B 3PP2A 4DX90 5EFXA 3B77A 4K17A 2COCA 2Y8FA 1QC6A 2D4QA 2PZ1A 3ODXA 3ZVRA 1LW3A 1KZGA 2YS1A 1XKEA 1TQZA 2ADZA 2H7DA 2G35A 1AQCA 2D9ZA 2K49A 2UZRA 1RJ2A 1UNPA 2LKOA 1BTNA 2ZPYA 4MK0A 2ELBA 2DHKA 2GCJA 2D9XA 2P0FA 3WA0A 5C6RA 3A8PA 2DYNA 2X18A 2UZSA 4GMXB 3FEHA 1UNQA 2DX5A 4MY6A 2J59M 3AJ4A 3WYFB 2K2UA 2GUMA 2YF0A 1ISNA 4IAPA 5DHAB 1V5UA 3D8FA 4K2PA 1SGHA 2D11A 1MK7B 3QIJA 1ZVRA 5LOPB 2IFSA 4A5KA 3KRWA 2YS5A 4BBKA 1LB1A 2IYBA 1FAOA 5CLLB 1V5MA 1J0WA 2CRFA 4F7UP 2D2QA 2FJUB 3D8EA 1OY2A 3UZTA 4KVGB 3PVUA 3HW2B 4TKNA 1OMWA 1QQGA 2W2XC 5D27A 3SO6A 2EMSA 2DTCA 3F5RA 1B55A 1EGXA 2Q13A 1MAIA 2NMBA 3NWDA 2OTXA 4KHAA 5I2MA 4WVFB 3FSSA 1PMSA 3TVVA 4GXBA 5DH9B 1X11A 2FJLA 3BINA 2QKLA 2LULA 4GNKB 4A6HA 5C16A 1U5FA 2DKPA 2Z0PA 4GZUA 1U29A 2KR0A 2P0HA 5D3YA 5JHHA 2CODA 1P5TA 4QXAB 2DKQA 2YT1A 2VKIA 4HAZB 5GOWB 4P7IA 1SHCA 5DI9B 1BWNA 2XQNM 1MIZB 5D3VA 2D10A 4H8SA 3GYOA 1P3RA 1WGUA 2Z0OA 2LOZA 5DHFB 2DX1A 3DXEA 1ZYIA 5LONB 3SUZA 2HE7A 4NY0A 1U2BA 3VIAA 3TO1A 1PLSA 4KHBB 2DFKA 5CLQB 4HDOA 1ZC4B 1Y5OA 1FGZA 4MT7A 2KIGA 3QBVB 4CHMA 1WVHA 3PZDA 4YONA 1KZ7A 4EMOA 1NI2A 1NU2A 3SYXA 3V5WA 2YVCA 2KGXB 5HE0A 2I5FA 3ML4A 1MI1A 1ZC3B 4PNKA 1P6SA 4K2OA 3SNHA 4GOUA 3DCXA 4HAWB 1XD4A 1GG3A 1V88A 1XX0A 2LOXA 3U12A 2YRYA 1AWEA 4KHOA 3ZDTA 2RNRB 2W2WA 2DLWA 2RVBB 2Z4DA 5JP4A 2BCJA 1X1GA 4HB0B 2D9WA 3RCPA 1NTVA 3CIKA 3MPXA 2R0DA 5C79A 2AL6A 2DA0A 2I1KA 1W1GA 2R2YA 4L6EA 2KIEA 1UPQA 1WG7A 4HB2B 2I5CA 4C0AA 2J0KA 2P0DA 2LYDA 1MIXA 1Z87A 1V61A 2MWNB 4IFSA 5JLJB 1OQNA 3ODWA 3KY9A 3AU4A 3PVWA 1BAKA 5KQ1A 5M4YB 1EF1A 5HE3A 3MDBC 3NW8A 3P7ZA 1FHWA 3O96A 4KAXB 1RRPB 4L1RA 1DDMA 1U5GA 1XODA 2L1CA 2W2XD 1K5GB 2RLOA 3A8QA 3PSCA 1M7RA 3TCAA 1DDVA 1WJMA 1U5EA 4QJ4B 1BTKA 1UPRA 3F0WA 3NSUA 4ZRJA 3CXBB 5FI0A 1DBHA 5D3WA 3A98B 4DBBA 2GCLA 4KHBA 2KUPA 5HE2A 1W1HA 4ZRIA 4D6WA 4B6HA 1ZM0A 2OQBA 4F7GA 4XWXA 3D8DA 2J0JA 2Z13A 4CSQA 4HATB 4WJ7A 3QWMA 4DIXA 2Z59A 2QKMA 4IOYX 4CHJA 5D3XA 1M7EA 1I2HA 2DHIA 4K81A 3TW1A 3HIEA 3HSAA 3OANA 1X1FA 2D9VA 2YSZA 3HK0A 2K8EA 2RUKB 4HHVA 1EAZA 1Y19B 4Z2MB 4GMVA 2VSZA 4DXAB 3BJIA 4A6FB 1PFJA 2Z0QA 2JP2A 5C5BB 4F7HA 3LJUX 3PG7A 1MK9B 2YT2A 4HSIA 2COFA 4HAXB 2J0MA 1UEFA 1H10A 3M1IB 2EMTA 4CYEA 2DN6A 4EJNA 2Y7BA 3DXDA 5LG4B 1ZSQA 2ELAA 3TFMA 4A6KA 3NWFA 1MPHA 4HAYB 1K5DB 2ROVA 4OSNA 2COAA 4NSWA 2RRFA 1J19A 1FHXA 5L81A 3HQCA 2Y8GA 1I7AA 2Z14A 1Q67A 1EVHA 3U8ZA 1WGQA 4TYZA 1T77A 1DROA 3PVLA 1WI1A 2RSGA 1X86A 2E2XA 2VRWB 2ZKMX 2KUQA 3KSYA 1X05A 3KZ1A 3ODOA 4YL8A 4QJ5B 3ULBA 4Y94A 3T06A 4QJ3B 4HB3B 3N7CA 2GS0A 1GC7A 2V76A 4D0NB 1WJ1A
chains in the Genus database with same CATH topology
1FB8A 3PEGA 3SV1A 2D9YA 5KQ4A 2L2IA 2CY5A 2RGNB 1XR0B 1E5WA 4WSFA 3AU5A 3G9WA 1NTYA 2KCJA 1FHOA 5J3TA 4HAVB 2DHJA 4HDQA 1FOEA 2EJ8A 5JHGA 1UNRA 2CAYA 3ULCA 1TXDA 1TJ6A 2K00A 2DYQA 1MKEA 4A6FA 3X23A 2EC1A 2MFQA 3U7DA 5C5BA 2GJYA 2UVMA 1KI1B 5J3YA 3VOQA 3GYPA 2N23A 2R09A 2P8VA 1DYNA 3P6AA 1IRSA 4DX8A 4EKUA 2LG1A 3KRXA 4HB4B 1H4RA 2I1JA 4PQ0A 2K2JA 1U27A 2YS3A 1DDWA 2HTHB 2H7EA 1GC6A 3DXCA 5FI1A 1V5PA 4HAUB 2M38A 2YT0A 5HE1A 3FM8C 2CY4A 1W1DA 5KCVA 1V89A 1N3HA 5J3QA 2AEHA 4GPTB 4Z2NA 2MDXA 1FGYA 2M14A 4GN1A 2MKRA 1U5DA 3IVFA 2ROZB 4ZRKA 5DIFB 2N0YA 1XCGA 2NZ8B 3PP2A 4DX90 5EFXA 4K17A 2COCA 2Y8FA 1QC6A 2D4QA 2PZ1A 3ODXA 3ZVRA 1LW3A 1KZGA 2YS1A 1XKEA 1TQZA 2ADZA 2H7DA 2G35A 1AQCA 2D9ZA 2UZRA 1RJ2A 1UNPA 2LKOA 1BTNA 2ZPYA 4MK0A 2ELBA 2DHKA 2GCJA 2D9XA 2P0FA 3WA0A 5C6RA 3A8PA 2DYNA 2X18A 2UZSA 4GMXB 3FEHA 1UNQA 2DX5A 4MY6A 2J59M 3AJ4A 3WYFB 2K2UA 2YF0A 1ISNA 4IAPA 5DHAB 1V5UA 3D8FA 4K2PA 1SGHA 2D11A 1MK7B 3QIJA 1ZVRA 5LOPB 2IFSA 4A5KA 3KRWA 2YS5A 4BBKA 1LB1A 2IYBA 1FAOA 5CLLB 1V5MA 1J0WA 2CRFA 4F7UP 2D2QA 3D8EA 1OY2A 3UZTA 4KVGB 3PVUA 3HW2B 4TKNA 1OMWA 1QQGA 2W2XC 5D27A 3SO6A 2EMSA 2DTCA 3F5RA 1B55A 1EGXA 2Q13A 1MAIA 2NMBA 2OTXA 4KHAA 4WVFB 3FSSA 1PMSA 3TVVA 4GXBA 5DH9B 1X11A 2FJLA 3BINA 2QKLA 2LULA 4A6HA 5C16A 1U5FA 2DKPA 2Z0PA 4GZUA 1U29A 2P0HA 5D3YA 5JHHA 2CODA 1P5TA 2DKQA 2YT1A 2VKIA 4HAZB 5GOWB 4P7IA 1SHCA 5DI9B 1BWNA 2XQNM 1MIZB 5D3VA 2D10A 4H8SA 3GYOA 1P3RA 1WGUA 2Z0OA 2LOZA 5DHFB 2DX1A 3DXEA 5LONB 3SUZA 2HE7A 4NY0A 1U2BA 3VIAA 3TO1A 1PLSA 4KHBB 2DFKA 5CLQB 4HDOA 1ZC4B 1Y5OA 1FGZA 4MT7A 3QBVB 4CHMA 1WVHA 3PZDA 4YONA 1KZ7A 4EMOA 1NI2A 1NU2A 3SYXA 3V5WA 2YVCA 2KGXB 5HE0A 2I5FA 3ML4A 1ZC3B 4PNKA 1P6SA 4K2OA 3SNHA 4HAWB 1XD4A 1GG3A 1V88A 1XX0A 2LOXA 2YRYA 1AWEA 4KHOA 3ZDTA 2RNRB 2W2WA 2DLWA 2RVBB 5JP4A 2BCJA 1X1GA 4HB0B 2D9WA 3RCPA 1NTVA 3CIKA 3MPXA 2R0DA 5C79A 2AL6A 2DA0A 2I1KA 1W1GA 4L6EA 1UPQA 1WG7A 4HB2B 2I5CA 4C0AA 2J0KA 2P0DA 2LYDA 1MIXA 1Z87A 1V61A 2MWNB 4IFSA 5JLJB 1OQNA 3ODWA 3KY9A 3AU4A 3PVWA 1BAKA 5KQ1A 1EF1A 5HE3A 3MDBC 3P7ZA 1FHWA 3O96A 4KAXB 1RRPB 1DDMA 1U5GA 1XODA 2L1CA 2W2XD 1K5GB 3PSCA 2RLOA 3A8QA 1M7RA 3TCAA 1DDVA 1WJMA 1U5EA 1BTKA 1UPRA 3F0WA 3NSUA 4ZRJA 3CXBB 5FI0A 1DBHA 5D3WA 3A98B 4DBBA 2GCLA 5HE2A 2KUPA 1W1HA 4ZRIA 4B6HA 1ZM0A 2OQBA 4F7GA 4XWXA 3D8DA 2J0JA 4HATB 4WJ7A 3QWMA 2QKMA 4IOYX 4CHJA 5D3XA 1M7EA 1I2HA 2DHIA 4K81A 3TW1A 3OANA 1X1FA 2D9VA 2YSZA 3HK0A 2RUKB 4HHVA 1EAZA 1Y19B 4Z2MB 4GMVA 2VSZA 4DXAB 3BJIA 4A6FB 1PFJA 2Z0QA 2JP2A 5C5BB 4F7HA 3LJUX 3PG7A 1MK9B 2COFA 4HAXB 2J0MA 1UEFA 1H10A 3M1IB 2EMTA 4CYEA 2DN6A 4EJNA 2Y7BA 3DXDA 1ZSQA 2ELAA 3TFMA 4A6KA 1MPHA 4HAYB 1K5DB 2ROVA 2COAA 4NSWA 1J19A 1FHXA 5L81A 3HQCA 2Y8GA 1I7AA 1Q67A 1EVHA 3U8ZA 1WGQA 4TYZA 1DROA 3PVLA 1WI1A 2RSGA 1X86A 2E2XA 2VRWB 3KSYA 1X05A 3KZ1A 3ODOA 4YL8A 3ULBA 4Y94A 3T06A 4HB3B 3N7CA 2GS0A 1GC7A 2V76A 4D0NB 1WJ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FB8 A;  3PEG A;  3SV1 A;  2D9Y A;  5KQ4 A;  2L2I A;  2CY5 A;  2RGN B;  1XR0 B;  1E5W A;  4WSF A;  3AU5 A;  3G9W A;  1NTY A;  2KCJ A;  1FHO A;  5J3T A;  4HAV B;  2DHJ A;  4HDQ A;  1FOE A;  2EJ8 A;  5JHG A;  1UNR A;  2CAY A;  3ULC A;  1TXD A;  1TJ6 A;  2K00 A;  2DYQ A;  1MKE A;  4A6F A;  3X23 A;  2EC1 A;  2MFQ A;  3U7D A;  5C5B A;  2GJY A;  2UVM A;  1KI1 B;  5J3Y A;  3VOQ A;  3GYP A;  2N23 A;  2R09 A;  2P8V A;  1DYN A;  3P6A A;  1IRS A;  4DX8 A;  4EKU A;  2LG1 A;  3KRX A;  4HB4 B;  1H4R A;  2I1J A;  4PQ0 A;  2K2J A;  1U27 A;  2YS3 A;  1DDW A;  2HTH B;  2H7E A;  1GC6 A;  3DXC A;  5FI1 A;  1V5P A;  4HAU B;  2M38 A;  2YT0 A;  5HE1 A;  3FM8 C;  2CY4 A;  1W1D A;  5KCV A;  1V89 A;  1N3H A;  5J3Q A;  2AEH A;  4GPT B;  4Z2N A;  2MDX A;  1FGY A;  2M14 A;  4GN1 A;  2MKR A;  1U5D A;  3IVF A;  2ROZ B;  4ZRK A;  5DIF B;  2N0Y A;  1XCG A;  2NZ8 B;  3PP2 A;  4DX9 0;  5EFX A;  4K17 A;  2COC A;  2Y8F A;  1QC6 A;  2D4Q A;  2PZ1 A;  3ODX A;  3ZVR A;  1LW3 A;  1KZG A;  2YS1 A;  1XKE A;  1TQZ A;  2ADZ A;  2H7D A;  2G35 A;  1AQC A;  2D9Z A;  2UZR A;  1RJ2 A;  1UNP A;  2LKO A;  1BTN A;  2ZPY A;  4MK0 A;  2ELB A;  2DHK A;  2GCJ A;  2D9X A;  2P0F A;  3WA0 A;  5C6R A;  3A8P A;  2DYN A;  2X18 A;  2UZS A;  4GMX B;  3FEH A;  1UNQ A;  2DX5 A;  4MY6 A;  2J59 M;  3AJ4 A;  3WYF B;  2K2U A;  2YF0 A;  1ISN A;  4IAP A;  5DHA B;  1V5U A;  3D8F A;  4K2P A;  1SGH A;  2D11 A;  1MK7 B;  3QIJ A;  1ZVR A;  5LOP B;  2IFS A;  4A5K A;  3KRW A;  2YS5 A;  4BBK A;  1LB1 A;  2IYB A;  1FAO A;  5CLL B;  1V5M A;  1J0W A;  2CRF A;  4F7U P;  2D2Q A;  3D8E A;  1OY2 A;  3UZT A;  4KVG B;  3PVU A;  3HW2 B;  4TKN A;  1OMW A;  1QQG A;  2W2X C;  5D27 A;  3SO6 A;  2EMS A;  2DTC A;  3F5R A;  1B55 A;  1EGX A;  2Q13 A;  1MAI A;  2NMB A;  2OTX A;  4KHA A;  4WVF B;  3FSS A;  1PMS A;  3TVV A;  4GXB A;  5DH9 B;  1X11 A;  2FJL A;  3BIN A;  2QKL A;  2LUL A;  4A6H A;  5C16 A;  1U5F A;  2DKP A;  2Z0P A;  4GZU A;  1U29 A;  2P0H A;  5D3Y A;  5JHH A;  2COD A;  1P5T A;  2DKQ A;  2YT1 A;  2VKI A;  4HAZ B;  5GOW B;  4P7I A;  1SHC A;  5DI9 B;  1BWN A;  2XQN M;  1MIZ B;  5D3V A;  2D10 A;  4H8S A;  3GYO A;  1P3R A;  1WGU A;  2Z0O A;  2LOZ A;  5DHF B;  2DX1 A;  3DXE A;  5LON B;  3SUZ A;  2HE7 A;  4NY0 A;  1U2B A;  3VIA A;  3TO1 A;  1PLS A;  4KHB B;  2DFK A;  5CLQ B;  4HDO A;  1ZC4 B;  1Y5O A;  1FGZ A;  4MT7 A;  3QBV B;  4CHM A;  1WVH A;  3PZD A;  4YON A;  1KZ7 A;  4EMO A;  1NI2 A;  1NU2 A;  3SYX A;  3V5W A;  2YVC A;  2KGX B;  5HE0 A;  2I5F A;  3ML4 A;  1ZC3 B;  4PNK A;  1P6S A;  4K2O A;  3SNH A;  4HAW B;  1XD4 A;  1GG3 A;  1V88 A;  1XX0 A;  2LOX A;  2YRY A;  1AWE A;  4KHO A;  3ZDT A;  2RNR B;  2W2W A;  2DLW A;  2RVB B;  5JP4 A;  2BCJ A;  1X1G A;  4HB0 B;  2D9W A;  3RCP A;  1NTV A;  3CIK A;  3MPX A;  2R0D A;  5C79 A;  2AL6 A;  2DA0 A;  2I1K A;  1W1G A;  4L6E A;  1UPQ A;  1WG7 A;  4HB2 B;  2I5C A;  4C0A A;  2J0K A;  2P0D A;  2LYD A;  1MIX A;  1Z87 A;  1V61 A;  2MWN B;  4IFS A;  5JLJ B;  1OQN A;  3ODW A;  3KY9 A;  3AU4 A;  3PVW A;  1BAK A;  5KQ1 A;  1EF1 A;  5HE3 A;  3MDB C;  3P7Z A;  1FHW A;  3O96 A;  4KAX B;  1RRP B;  1DDM A;  1U5G A;  1XOD A;  2L1C A;  2W2X D;  1K5G B;  3PSC A;  2RLO A;  3A8Q A;  1M7R A;  3TCA A;  1DDV A;  1WJM A;  1U5E A;  1BTK A;  1UPR A;  3F0W A;  3NSU A;  4ZRJ A;  3CXB B;  5FI0 A;  1DBH A;  5D3W A;  3A98 B;  4DBB A;  2GCL A;  5HE2 A;  2KUP A;  1W1H A;  4ZRI A;  4B6H A;  1ZM0 A;  2OQB A;  4F7G A;  4XWX A;  3D8D A;  2J0J A;  4HAT B;  4WJ7 A;  3QWM A;  2QKM A;  4IOY X;  4CHJ A;  5D3X A;  1M7E A;  1I2H A;  2DHI A;  4K81 A;  3TW1 A;  3OAN A;  1X1F A;  2D9V A;  2YSZ A;  3HK0 A;  2RUK B;  4HHV A;  1EAZ A;  1Y19 B;  4Z2M B;  4GMV A;  2VSZ A;  4DXA B;  3BJI A;  4A6F B;  1PFJ A;  2Z0Q A;  2JP2 A;  5C5B B;  4F7H A;  3LJU X;  3PG7 A;  1MK9 B;  2COF A;  4HAX B;  2J0M A;  1UEF A;  1H10 A;  3M1I B;  2EMT A;  4CYE A;  2DN6 A;  4EJN A;  2Y7B A;  3DXD A;  1ZSQ A;  2ELA A;  3TFM A;  4A6K A;  1MPH A;  4HAY B;  1K5D B;  2ROV A;  2COA A;  4NSW A;  1J19 A;  1FHX A;  5L81 A;  3HQC A;  2Y8G A;  1I7A A;  1Q67 A;  1EVH A;  3U8Z A;  1WGQ A;  4TYZ A;  1DRO A;  3PVL A;  1WI1 A;  2RSG A;  1X86 A;  2E2X A;  2VRW B;  3KSY A;  1X05 A;  3KZ1 A;  3ODO A;  4YL8 A;  3ULB A;  4Y94 A;  3T06 A;  4HB3 B;  3N7C A;  2GS0 A;  1GC7 A;  2V76 A;  4D0N B;  1WJ1 A; 
#chains in the Genus database with same CATH topology
 1FB8 A;  3PEG A;  3SV1 A;  2D9Y A;  5KQ4 A;  2L2I A;  2CY5 A;  2RGN B;  1XR0 B;  1E5W A;  4WSF A;  3AU5 A;  3G9W A;  1NTY A;  2KCJ A;  1FHO A;  5J3T A;  4HAV B;  2DHJ A;  4HDQ A;  1FOE A;  2EJ8 A;  5JHG A;  1UNR A;  3NWA A;  2CAY A;  3ULC A;  1TXD A;  1TJ6 A;  3FVC A;  2K00 A;  2DYQ A;  1MKE A;  4A6F A;  3X23 A;  2EC1 A;  2MFQ A;  3U7D A;  5C5B A;  2GJY A;  2UVM A;  1KI1 B;  5J3Y A;  3VOQ A;  3GYP A;  2N23 A;  4OT1 A;  2R09 A;  2P8V A;  1DYN A;  2NBV A;  5I2S A;  3P6A A;  1IRS A;  4DX8 A;  5IRS A;  4EKU A;  2LG1 A;  3KRX A;  4HB4 B;  1H4R A;  2I1J A;  4PQ0 A;  2K2J A;  1U27 A;  2YS3 A;  1DDW A;  2HTH B;  2H7E A;  1GC6 A;  3DXC A;  5FI1 A;  1V5P A;  4HAU B;  2M38 A;  2YT0 A;  5HE1 A;  3OHM B;  3FM8 C;  2CY4 A;  1W1D A;  5KCV A;  1V89 A;  1N3H A;  5J3Q A;  2AEH A;  4GPT B;  4Z2N A;  2MDX A;  3A58 A;  1FGY A;  2M14 A;  4GN1 A;  2MKR A;  1U5D A;  2ROZ B;  3IVF A;  4ZRK A;  5DIF B;  2N0Y A;  1XCG A;  2NZ8 B;  3PP2 A;  4DX9 0;  5EFX A;  3B77 A;  4K17 A;  2COC A;  2Y8F A;  1QC6 A;  2D4Q A;  2PZ1 A;  3ODX A;  3ZVR A;  1LW3 A;  1KZG A;  2YS1 A;  1XKE A;  1TQZ A;  2ADZ A;  2H7D A;  2G35 A;  1AQC A;  2D9Z A;  2K49 A;  2UZR A;  1RJ2 A;  1UNP A;  2LKO A;  1BTN A;  2ZPY A;  4MK0 A;  2ELB A;  2DHK A;  2GCJ A;  2D9X A;  2P0F A;  3WA0 A;  5C6R A;  3A8P A;  2DYN A;  2X18 A;  2UZS A;  4GMX B;  3FEH A;  1UNQ A;  2DX5 A;  4MY6 A;  2J59 M;  3AJ4 A;  3WYF B;  2K2U A;  2GUM A;  2YF0 A;  1ISN A;  4IAP A;  5DHA B;  1V5U A;  3D8F A;  4K2P A;  1SGH A;  2D11 A;  1MK7 B;  3QIJ A;  1ZVR A;  5LOP B;  2IFS A;  4A5K A;  3KRW A;  2YS5 A;  4BBK A;  1LB1 A;  2IYB A;  1FAO A;  5CLL B;  1V5M A;  1J0W A;  2CRF A;  4F7U P;  2D2Q A;  2FJU B;  3D8E A;  1OY2 A;  3UZT A;  4KVG B;  3PVU A;  3HW2 B;  4TKN A;  1OMW A;  1QQG A;  2W2X C;  5D27 A;  3SO6 A;  2EMS A;  2DTC A;  3F5R A;  1B55 A;  1EGX A;  2Q13 A;  1MAI A;  2NMB A;  3NWD A;  2OTX A;  4KHA A;  5I2M A;  4WVF B;  3FSS A;  1PMS A;  3TVV A;  4GXB A;  5DH9 B;  1X11 A;  2FJL A;  3BIN A;  2QKL A;  2LUL A;  4GNK B;  4A6H A;  5C16 A;  1U5F A;  2DKP A;  2Z0P A;  4GZU A;  1U29 A;  2KR0 A;  2P0H A;  5D3Y A;  5JHH A;  2COD A;  1P5T A;  4QXA B;  2DKQ A;  2YT1 A;  2VKI A;  4HAZ B;  5GOW B;  4P7I A;  1SHC A;  5DI9 B;  1BWN A;  2XQN M;  1MIZ B;  5D3V A;  2D10 A;  4H8S A;  3GYO A;  1P3R A;  1WGU A;  2Z0O A;  2LOZ A;  5DHF B;  2DX1 A;  3DXE A;  1ZYI A;  5LON B;  3SUZ A;  2HE7 A;  4NY0 A;  1U2B A;  3VIA A;  3TO1 A;  1PLS A;  4KHB B;  2DFK A;  5CLQ B;  4HDO A;  1ZC4 B;  1Y5O A;  1FGZ A;  4MT7 A;  2KIG A;  3QBV B;  4CHM A;  1WVH A;  3PZD A;  4YON A;  1KZ7 A;  4EMO A;  1NI2 A;  1NU2 A;  3SYX A;  3V5W A;  2YVC A;  2KGX B;  5HE0 A;  2I5F A;  3ML4 A;  1MI1 A;  1ZC3 B;  4PNK A;  1P6S A;  4K2O A;  3SNH A;  4GOU A;  3DCX A;  4HAW B;  1XD4 A;  1GG3 A;  1V88 A;  1XX0 A;  2LOX A;  3U12 A;  2YRY A;  1AWE A;  4KHO A;  3ZDT A;  2RNR B;  2W2W A;  2DLW A;  2RVB B;  2Z4D A;  5JP4 A;  2BCJ A;  1X1G A;  4HB0 B;  2D9W A;  3RCP A;  1NTV A;  3CIK A;  3MPX A;  2R0D A;  5C79 A;  2AL6 A;  2DA0 A;  2I1K A;  1W1G A;  2R2Y A;  4L6E A;  2KIE A;  1UPQ A;  1WG7 A;  4HB2 B;  2I5C A;  4C0A A;  2J0K A;  2P0D A;  2LYD A;  1MIX A;  1Z87 A;  1V61 A;  2MWN B;  4IFS A;  5JLJ B;  1OQN A;  3ODW A;  3KY9 A;  3AU4 A;  3PVW A;  1BAK A;  5KQ1 A;  5M4Y B;  1EF1 A;  5HE3 A;  3MDB C;  3NW8 A;  3P7Z A;  1FHW A;  3O96 A;  4KAX B;  1RRP B;  4L1R A;  1DDM A;  1U5G A;  1XOD A;  2L1C A;  2W2X D;  1K5G B;  2RLO A;  3A8Q A;  3PSC A;  1M7R A;  3TCA A;  1DDV A;  1WJM A;  1U5E A;  4QJ4 B;  1BTK A;  1UPR A;  3F0W A;  3NSU A;  4ZRJ A;  3CXB B;  5FI0 A;  1DBH A;  5D3W A;  3A98 B;  4DBB A;  2GCL A;  4KHB A;  2KUP A;  5HE2 A;  1W1H A;  4ZRI A;  4D6W A;  4B6H A;  1ZM0 A;  2OQB A;  4F7G A;  4XWX A;  3D8D A;  2J0J A;  2Z13 A;  4CSQ A;  4HAT B;  4WJ7 A;  3QWM A;  4DIX A;  2Z59 A;  2QKM A;  4IOY X;  4CHJ A;  5D3X A;  1M7E A;  1I2H A;  2DHI A;  4K81 A;  3TW1 A;  3HIE A;  3HSA A;  3OAN A;  1X1F A;  2D9V A;  2YSZ A;  3HK0 A;  2K8E A;  2RUK B;  4HHV A;  1EAZ A;  1Y19 B;  4Z2M B;  4GMV A;  2VSZ A;  4DXA B;  3BJI A;  4A6F B;  1PFJ A;  2Z0Q A;  2JP2 A;  5C5B B;  4F7H A;  3LJU X;  3PG7 A;  1MK9 B;  2YT2 A;  4HSI A;  2COF A;  4HAX B;  2J0M A;  1UEF A;  1H10 A;  3M1I B;  2EMT A;  4CYE A;  2DN6 A;  4EJN A;  2Y7B A;  3DXD A;  5LG4 B;  1ZSQ A;  2ELA A;  3TFM A;  4A6K A;  3NWF A;  1MPH A;  4HAY B;  1K5D B;  2ROV A;  4OSN A;  2COA A;  4NSW A;  2RRF A;  1J19 A;  1FHX A;  5L81 A;  3HQC A;  2Y8G A;  1I7A A;  2Z14 A;  1Q67 A;  1EVH A;  3U8Z A;  1WGQ A;  4TYZ A;  1T77 A;  1DRO A;  3PVL A;  1WI1 A;  2RSG A;  1X86 A;  2E2X A;  2VRW B;  2ZKM X;  2KUQ A;  3KSY A;  1X05 A;  3KZ1 A;  3ODO A;  4YL8 A;  4QJ5 B;  3ULB A;  4Y94 A;  3T06 A;  4QJ3 B;  4HB3 B;  3N7C A;  2GS0 A;  1GC7 A;  2V76 A;  4D0N B;  1WJ1 A; 
#chains in the Genus database with same CATH homology
 1FB8 A;  3PEG A;  3SV1 A;  2D9Y A;  5KQ4 A;  2L2I A;  2CY5 A;  2RGN B;  1XR0 B;  1E5W A;  4WSF A;  3AU5 A;  3G9W A;  1NTY A;  2KCJ A;  1FHO A;  5J3T A;  4HAV B;  2DHJ A;  4HDQ A;  1FOE A;  2EJ8 A;  5JHG A;  1UNR A;  2CAY A;  3ULC A;  1TXD A;  1TJ6 A;  2K00 A;  2DYQ A;  1MKE A;  4A6F A;  3X23 A;  2EC1 A;  2MFQ A;  3U7D A;  5C5B A;  2GJY A;  2UVM A;  1KI1 B;  5J3Y A;  3VOQ A;  3GYP A;  2N23 A;  2R09 A;  2P8V A;  1DYN A;  3P6A A;  1IRS A;  4DX8 A;  4EKU A;  2LG1 A;  3KRX A;  4HB4 B;  1H4R A;  2I1J A;  4PQ0 A;  2K2J A;  1U27 A;  2YS3 A;  1DDW A;  2HTH B;  2H7E A;  1GC6 A;  3DXC A;  5FI1 A;  1V5P A;  4HAU B;  2M38 A;  2YT0 A;  5HE1 A;  3FM8 C;  2CY4 A;  1W1D A;  5KCV A;  1V89 A;  1N3H A;  5J3Q A;  2AEH A;  4GPT B;  4Z2N A;  2MDX A;  1FGY A;  2M14 A;  4GN1 A;  2MKR A;  1U5D A;  3IVF A;  2ROZ B;  4ZRK A;  5DIF B;  2N0Y A;  1XCG A;  2NZ8 B;  3PP2 A;  4DX9 0;  5EFX A;  4K17 A;  2COC A;  2Y8F A;  1QC6 A;  2D4Q A;  2PZ1 A;  3ODX A;  3ZVR A;  1LW3 A;  1KZG A;  2YS1 A;  1XKE A;  1TQZ A;  2ADZ A;  2H7D A;  2G35 A;  1AQC A;  2D9Z A;  2UZR A;  1RJ2 A;  1UNP A;  2LKO A;  1BTN A;  2ZPY A;  4MK0 A;  2ELB A;  2DHK A;  2GCJ A;  2D9X A;  2P0F A;  3WA0 A;  5C6R A;  3A8P A;  2DYN A;  2X18 A;  2UZS A;  4GMX B;  3FEH A;  1UNQ A;  2DX5 A;  4MY6 A;  2J59 M;  3AJ4 A;  3WYF B;  2K2U A;  2YF0 A;  1ISN A;  4IAP A;  5DHA B;  1V5U A;  3D8F A;  4K2P A;  1SGH A;  2D11 A;  1MK7 B;  3QIJ A;  1ZVR A;  5LOP B;  2IFS A;  4A5K A;  3KRW A;  2YS5 A;  4BBK A;  1LB1 A;  2IYB A;  1FAO A;  5CLL B;  1V5M A;  1J0W A;  2CRF A;  4F7U P;  2D2Q A;  3D8E A;  1OY2 A;  3UZT A;  4KVG B;  3PVU A;  3HW2 B;  4TKN A;  1OMW A;  1QQG A;  2W2X C;  5D27 A;  3SO6 A;  2EMS A;  2DTC A;  3F5R A;  1B55 A;  1EGX A;  2Q13 A;  1MAI A;  2NMB A;  2OTX A;  4KHA A;  4WVF B;  3FSS A;  1PMS A;  3TVV A;  4GXB A;  5DH9 B;  1X11 A;  2FJL A;  3BIN A;  2QKL A;  2LUL A;  4A6H A;  5C16 A;  1U5F A;  2DKP A;  2Z0P A;  4GZU A;  1U29 A;  2P0H A;  5D3Y A;  5JHH A;  2COD A;  1P5T A;  2DKQ A;  2YT1 A;  2VKI A;  4HAZ B;  5GOW B;  4P7I A;  1SHC A;  5DI9 B;  1BWN A;  2XQN M;  1MIZ B;  5D3V A;  2D10 A;  4H8S A;  3GYO A;  1P3R A;  1WGU A;  2Z0O A;  2LOZ A;  5DHF B;  2DX1 A;  3DXE A;  5LON B;  3SUZ A;  2HE7 A;  4NY0 A;  1U2B A;  3VIA A;  3TO1 A;  1PLS A;  4KHB B;  2DFK A;  5CLQ B;  4HDO A;  1ZC4 B;  1Y5O A;  1FGZ A;  4MT7 A;  3QBV B;  4CHM A;  1WVH A;  3PZD A;  4YON A;  1KZ7 A;  4EMO A;  1NI2 A;  1NU2 A;  3SYX A;  3V5W A;  2YVC A;  2KGX B;  5HE0 A;  2I5F A;  3ML4 A;  1ZC3 B;  4PNK A;  1P6S A;  4K2O A;  3SNH A;  4HAW B;  1XD4 A;  1GG3 A;  1V88 A;  1XX0 A;  2LOX A;  2YRY A;  1AWE A;  4KHO A;  3ZDT A;  2RNR B;  2W2W A;  2DLW A;  2RVB B;  5JP4 A;  2BCJ A;  1X1G A;  4HB0 B;  2D9W A;  3RCP A;  1NTV A;  3CIK A;  3MPX A;  2R0D A;  5C79 A;  2AL6 A;  2DA0 A;  2I1K A;  1W1G A;  4L6E A;  1UPQ A;  1WG7 A;  4HB2 B;  2I5C A;  4C0A A;  2J0K A;  2P0D A;  2LYD A;  1MIX A;  1Z87 A;  1V61 A;  2MWN B;  4IFS A;  5JLJ B;  1OQN A;  3ODW A;  3KY9 A;  3AU4 A;  3PVW A;  1BAK A;  5KQ1 A;  1EF1 A;  5HE3 A;  3MDB C;  3P7Z A;  1FHW A;  3O96 A;  4KAX B;  1RRP B;  1DDM A;  1U5G A;  1XOD A;  2L1C A;  2W2X D;  1K5G B;  3PSC A;  2RLO A;  3A8Q A;  1M7R A;  3TCA A;  1DDV A;  1WJM A;  1U5E A;  1BTK A;  1UPR A;  3F0W A;  3NSU A;  4ZRJ A;  3CXB B;  5FI0 A;  1DBH A;  5D3W A;  3A98 B;  4DBB A;  2GCL A;  5HE2 A;  2KUP A;  1W1H A;  4ZRI A;  4B6H A;  1ZM0 A;  2OQB A;  4F7G A;  4XWX A;  3D8D A;  2J0J A;  4HAT B;  4WJ7 A;  3QWM A;  2QKM A;  4IOY X;  4CHJ A;  5D3X A;  1M7E A;  1I2H A;  2DHI A;  4K81 A;  3TW1 A;  3OAN A;  1X1F A;  2D9V A;  2YSZ A;  3HK0 A;  2RUK B;  4HHV A;  1EAZ A;  1Y19 B;  4Z2M B;  4GMV A;  2VSZ A;  4DXA B;  3BJI A;  4A6F B;  1PFJ A;  2Z0Q A;  2JP2 A;  5C5B B;  4F7H A;  3LJU X;  3PG7 A;  1MK9 B;  2COF A;  4HAX B;  2J0M A;  1UEF A;  1H10 A;  3M1I B;  2EMT A;  4CYE A;  2DN6 A;  4EJN A;  2Y7B A;  3DXD A;  1ZSQ A;  2ELA A;  3TFM A;  4A6K A;  1MPH A;  4HAY B;  1K5D B;  2ROV A;  2COA A;  4NSW A;  1J19 A;  1FHX A;  5L81 A;  3HQC A;  2Y8G A;  1I7A A;  1Q67 A;  1EVH A;  3U8Z A;  1WGQ A;  4TYZ A;  1DRO A;  3PVL A;  1WI1 A;  2RSG A;  1X86 A;  2E2X A;  2VRW B;  3KSY A;  1X05 A;  3KZ1 A;  3ODO A;  4YL8 A;  3ULB A;  4Y94 A;  3T06 A;  4HB3 B;  3N7C A;  2GS0 A;  1GC7 A;  2V76 A;  4D0N B;  1WJ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...