1DDWA

Homer evh1 domain unliganded
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
111
structure length
111
Chain Sequence
MGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINSTITPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Homer EVH1 domain-peptide complex reveals a new twist in polyproline recognition.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
molecule keywords GLGF-DOMAIN PROTEIN HOMER
total genus 21
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 1999-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1ddwA00
1X05A 2K00A 4K2OA 2M14A 5D3VA 3TW1A 2DYNA 1N3HA 4F7GA 1OY2A 4GMXB 1GC6A 1WI1A 2DX5A 2CY5A 3X23A 3MPXA 2P0HA 4HAWB 3KY9A 5C5BB 4CHJA 2ZPYA 2DA0A 5HE1A 1ZVRA 4IOYX 5GOWB 3QIJA 5DHAB 1OMWA 2CY4A 4DX8A 1LW3A 1P3RA 1XD4A 3WYFB 5LOPB 1Y5OA 4ZRKA 5HE2A 2BCJA 2LG1A 3BJIA 4MY6A 1W1HA 4F7UP 1FB8A 1UNQA 2H7DA 3KZ1A 2D9ZA 2COAA 2ADZA 4K17A 1OQNA 2YS3A 2LOZA 3FSSA 1V5MA 1WGQA 2COFA 3CIKA 3UZTA 2P0DA 1DBHA 3VOQA 2IYBA 3A98B 3SO6A 2DN6A 4C0AA 4WJ7A 3PG7A 5C16A 2Z0PA 4NY0A 3D8EA 2DKPA 4Z2MB 5J3TA 2Z0QA 3TVVA 4WVFB 1UNRA 4A6FA 3U7DA 2P8VA 2YRYA 1RRPB 1RJ2A 3SYXA 4DXAB 4H8SA 2XQNM 5D3WA 2V76A 4HAZB 4HAXB 5JHHA 4KHAA 3DXDA 5CLLB 1NTYA 1I7AA 4A6FB 4PQ0A 2D11A 1ISNA 3MDBC 2D4QA 2Y8FA 1FGZA 1LB1A 4HDOA 2X18A 2W2XC 4Y94A 1Z87A 2COCA 4HAUB 2L1CA 4NSWA 2R09A 1NTVA 3SNHA 2DKQA 2D2QA 5DIFB 4MT7A 5JLJB 2EC1A 1FHXA 2YSZA 2DFKA 4EKUA 2AL6A 1U5FA 2D9WA 2ELBA 4KVGB 2J0KA 2I1KA 3U8ZA 2VRWB 1X1FA 2RVBB 3DXEA 1ZC3B 4B6HA 2QKMA 3P6AA 1TXDA 1DYNA 1MAIA 1V61A 2CRFA 2W2XD 3G9WA 2E2XA 3FM8C 1FHWA 3PP2A 5EFXA 2HTHB 1EF1A 1KZ7A 2D9YA 2JP2A 4HB2B 4HAYB 2MWNB 2YVCA 1XR0B 4EMOA 1V5UA 3SV1A 4HHVA 1K5DB 3AU5A 2G35A 2CAYA 3ML4A 1U27A 4DX90 2LKOA 3O96A 3DXCA 2J59M 3ODOA 4TKNA 2ROVA 1PMSA 1M7EA 3NSUA 4HATB 2MFQA 2OTXA 5HE0A 1U5EA 3ULBA 4CHMA 4GN1A 4KHBB 1X11A 2VKIA 2D9XA 1QQGA 3BINA 3KRWA 2LOXA 1MK7B 2P0FA 2YF0A 4MK0A 2PZ1A 3T06A 4PNKA 2H7EA 1H10A 5FI1A 3V5WA 2DTCA 3D8FA 2L2IA 2Y7BA 1FHOA 4WSFA 1KZGA 4GZUA 4BBKA 2R0DA 3VIAA 5D3YA 2VSZA 1QC6A 3PVWA 1E5WA 2J0JA 1ZC4B 4K2PA 5DH9B 2ELAA 2Y8GA 3LJUX 3ULCA 2UZSA 2CODA 1PFJA 2RGNB 1P5TA 3QBVB 2KCJA 2KGXB 1MIZB 2W2WA 3HQCA 3SUZA 1H4RA 4A6HA 1WGUA 3GYOA 4L6EA 1B55A 3IVFA 5DI9B 1XKEA 3D8DA 4HB4B 1IRSA 2J0MA 4IAPA 1TJ6A 1BAKA 1XODA 5JHGA 1FOEA 2MDXA 1FAOA 2ROZB 3PVUA 3WA0A 2RLOA 1K5GB 2DLWA 1Q67A 1V5PA 1XX0A 5C79A 1DDVA 2N23A 3A8QA 2D10A 1DDMA 2YS1A 4HAVB 2DHIA 4P7IA 1V88A 2DHJA 1ZM0A 1V89A 2NMBA 4Z2NA 3F5RA 1I2HA 3KRXA 3P7ZA 3ODXA 4F7HA 2KUPA 1KI1B 4K81A 3KSYA 5LONB 2YT0A 4TYZA 4GPTB 4ZRJA 3ODWA 1MK9B 2M38A 4YL8A 3TO1A 2GCLA 2RNRB 2D9VA 2NZ8B 4A5KA 1MKEA 1W1GA 1GC7A 5D3XA 2MKRA 1W1DA 1ZSQA 5L81A 4A6KA 2UZRA 3PSCA 4D0NB 1X1GA 3CXBB 4GMVA 2DX1A 3TCAA 4IFSA 2LYDA 2OQBA 3GYPA 5D27A 1J0WA 1U29A 1MPHA 1UNPA 1PLSA 4KHOA 4HB3B 2N0YA 4DBBA 2EJ8A 2GCJA 4EJNA 1NI2A 3AU4A 2RUKB 3PZDA 1GG3A 1EVHA 1EGXA 5KQ4A 1WJMA 1Y19B 5CLQB 1SHCA 2DHKA 2I5FA 2K2UA 3ZDTA 3HK0A 3TFMA 1DROA 1UPQA 5C5BA 3PVLA 1TQZA 1BWNA 1WG7A 5JP4A 5C6RA 1AWEA 3A8PA 2K2JA 5HE3A 3ZVRA 5KCVA 1UEFA 5DHFB 1BTKA 1FGYA 1P6SA 2FJLA 2EMTA 1X86A 2DYQA 4CYEA 4GXBA 1BTNA 4HDQA 1U2BA 3AJ4A 2YS5A 3QWMA 3RCPA 5FI0A 3F0WA 2HE7A 2GS0A 1NU2A 2GJYA 2Z0OA 4HB0B 2EMSA 3N7CA 3OANA 5J3QA 1M7RA 2LULA 1WJ1A 1MIXA 3HW2B 1DDWA 2IFSA 1U5DA 1UPRA 2I5CA 3M1IB 2Q13A 5J3YA 2RSGA 1U5GA 4KAXB 1SGHA 1XCGA 4YONA 5KQ1A 2AEHA 3FEHA 1AQCA 1WVHA 4XWXA 2YT1A 1EAZA 4ZRIA 2UVMA 2QKLA 3PEGA 2I1JA 1J19A
chains in the Genus database with same CATH superfamily
1X05A 2K00A 4K2OA 2M14A 5D3VA 3TW1A 2DYNA 1N3HA 4F7GA 1OY2A 4GMXB 1GC6A 1WI1A 2DX5A 2CY5A 3X23A 2ZKMX 3MPXA 2P0HA 4HAWB 3KY9A 5C5BB 4CHJA 2ZPYA 2DA0A 5HE1A 1ZVRA 4IOYX 5I2SA 5GOWB 3U12A 4HSIA 3QIJA 5DHAB 1OMWA 2CY4A 4DX8A 1LW3A 1P3RA 1XD4A 4OSNA 3WYFB 5LOPB 4KHBA 1Y5OA 4ZRKA 5HE2A 2BCJA 2LG1A 3BJIA 4MY6A 1W1HA 4F7UP 1FB8A 1UNQA 2H7DA 3KZ1A 2D9ZA 2COAA 2ADZA 4K17A 1OQNA 2YS3A 2LOZA 3FSSA 1V5MA 1WGQA 2COFA 3CIKA 3UZTA 2P0DA 1DBHA 3VOQA 2IYBA 3A98B 3SO6A 2DN6A 4C0AA 4QXAB 4WJ7A 3PG7A 5C16A 2Z0PA 4NY0A 4DIXA 3D8EA 2DKPA 4Z2MB 5J3TA 2Z0QA 3B77A 3TVVA 4WVFB 1UNRA 4A6FA 3U7DA 2P8VA 2YRYA 1RRPB 4D6WA 1RJ2A 3SYXA 4DXAB 4H8SA 2XQNM 5D3WA 2V76A 4HAZB 4HAXB 5JHHA 4KHAA 3DXDA 5CLLB 1NTYA 1I7AA 4A6FB 4PQ0A 2D11A 1ISNA 3MDBC 2D4QA 2Y8FA 5M4YB 1FGZA 1LB1A 4HDOA 2X18A 2W2XC 4Y94A 1Z87A 2COCA 4HAUB 2L1CA 4NSWA 2R09A 1NTVA 3SNHA 2DKQA 2D2QA 5DIFB 4MT7A 5JLJB 2EC1A 4GOUA 3NWFA 1FHXA 2YSZA 2DFKA 4EKUA 2AL6A 1U5FA 2D9WA 2ELBA 4KVGB 2J0KA 2I1KA 3U8ZA 2VRWB 1X1FA 2RVBB 3DXEA 1ZC3B 4B6HA 2QKMA 3P6AA 1TXDA 1DYNA 1MAIA 1V61A 2CRFA 2W2XD 3G9WA 2E2XA 3FM8C 1FHWA 3PP2A 5EFXA 2HTHB 1EF1A 1KZ7A 2D9YA 2JP2A 4HB2B 4HAYB 2MWNB 2YVCA 1XR0B 4EMOA 1V5UA 3SV1A 4HHVA 1K5DB 3AU5A 2R2YA 2G35A 2CAYA 3ML4A 1U27A 4DX90 2LKOA 2GUMA 3O96A 3DXCA 2J59M 3ODOA 4TKNA 2ROVA 1PMSA 1M7EA 3NSUA 4HATB 3NWDA 2MFQA 2OTXA 5HE0A 1U5EA 3ULBA 4CHMA 4GN1A 4KHBB 1X11A 2VKIA 2Z13A 2D9XA 1QQGA 3BINA 3KRWA 4CSQA 1MI1A 2LOXA 1MK7B 2P0FA 2YF0A 4MK0A 2PZ1A 3T06A 4PNKA 2H7EA 1H10A 5FI1A 2Z59A 3V5WA 2DTCA 3D8FA 2L2IA 4QJ5B 2Y7BA 1FHOA 4WSFA 1KZGA 4GZUA 4BBKA 2R0DA 3VIAA 5D3YA 2VSZA 1QC6A 3PVWA 2Z14A 1E5WA 2J0JA 1ZC4B 4K2PA 5DH9B 3HIEA 2ELAA 2Y8GA 3LJUX 3ULCA 2UZSA 2CODA 2KIEA 1PFJA 2RGNB 1P5TA 3QBVB 2KCJA 2KGXB 4GNKB 1MIZB 5I2MA 2W2WA 3HQCA 3SUZA 1H4RA 2FJUB 4A6HA 1WGUA 3GYOA 4L6EA 4OT1A 1B55A 3IVFA 5DI9B 1XKEA 3D8DA 4HB4B 1IRSA 2J0MA 4IAPA 1TJ6A 1BAKA 1XODA 5JHGA 1FOEA 2MDXA 1FAOA 2ROZB 3PVUA 3WA0A 2KIGA 2RLOA 1K5GB 2DLWA 1Q67A 1V5PA 4L1RA 1XX0A 5C79A 1DDVA 2N23A 2K8EA 3A8QA 2D10A 1DDMA 4QJ3B 2YS1A 4HAVB 2DHIA 2Z4DA 1V88A 2DHJA 4P7IA 1ZM0A 1V89A 2NMBA 4Z2NA 5IRSA 3F5RA 1I2HA 3KRXA 3P7ZA 3ODXA 4F7HA 2KUPA 1KI1B 4K81A 3KSYA 5LONB 3OHMB 2YT0A 4TYZA 4GPTB 4ZRJA 5LG4B 3ODWA 1MK9B 2YT2A 2M38A 4YL8A 3TO1A 2GCLA 2RNRB 2D9VA 2NZ8B 4A5KA 1MKEA 1W1GA 1GC7A 5D3XA 2MKRA 1W1DA 1ZSQA 5L81A 4A6KA 2UZRA 3A58A 3PSCA 4D0NB 1X1GA 3CXBB 4GMVA 2DX1A 3TCAA 4IFSA 2LYDA 2OQBA 3GYPA 5D27A 1J0WA 1U29A 3NWAA 1MPHA 1UNPA 1PLSA 4KHOA 4HB3B 2N0YA 4DBBA 2EJ8A 2GCJA 4EJNA 3NW8A 4QJ4B 1NI2A 3AU4A 2RUKB 3PZDA 1GG3A 1EVHA 1T77A 1EGXA 5KQ4A 1WJMA 1Y19B 5CLQB 1SHCA 2DHKA 2I5FA 2K2UA 3ZDTA 3HK0A 3TFMA 1DROA 1UPQA 5C5BA 3PVLA 1TQZA 1BWNA 1WG7A 5JP4A 5C6RA 1AWEA 3A8PA 2K2JA 5HE3A 3ZVRA 5KCVA 1UEFA 5DHFB 1BTKA 1FGYA 1P6SA 2FJLA 2EMTA 2K49A 1X86A 2RRFA 2DYQA 4CYEA 4GXBA 1BTNA 4HDQA 1U2BA 3AJ4A 2YS5A 3QWMA 3RCPA 5FI0A 3F0WA 1ZYIA 2HE7A 2GS0A 1NU2A 2GJYA 2Z0OA 2NBVA 3FVCA 2EMSA 3N7CA 4HB0B 3OANA 5J3QA 1M7RA 2LULA 1WJ1A 1MIXA 3DCXA 2KR0A 1DDWA 2IFSA 3HW2B 1U5DA 1UPRA 2I5CA 3M1IB 2Q13A 5J3YA 2RSGA 2KUQA 1U5GA 4KAXB 1SGHA 1XCGA 4YONA 5KQ1A 2AEHA 3FEHA 1AQCA 1WVHA 4XWXA 2YT1A 1EAZA 4ZRIA 2UVMA 3HSAA 2QKLA 3PEGA 2I1JA 1J19A
chains in the Genus database with same CATH topology
1X05A 2K00A 4K2OA 2M14A 5D3VA 3TW1A 2DYNA 1N3HA 4F7GA 1OY2A 4GMXB 1GC6A 1WI1A 2DX5A 2CY5A 3X23A 3MPXA 2P0HA 4HAWB 3KY9A 5C5BB 4CHJA 2ZPYA 2DA0A 5HE1A 1ZVRA 4IOYX 5GOWB 3QIJA 5DHAB 1OMWA 2CY4A 4DX8A 1LW3A 1P3RA 1XD4A 3WYFB 5LOPB 1Y5OA 4ZRKA 5HE2A 2BCJA 2LG1A 3BJIA 4MY6A 1W1HA 4F7UP 1FB8A 1UNQA 2H7DA 3KZ1A 2D9ZA 2COAA 2ADZA 4K17A 1OQNA 2YS3A 2LOZA 3FSSA 1V5MA 1WGQA 2COFA 3CIKA 3UZTA 2P0DA 1DBHA 3VOQA 2IYBA 3A98B 3SO6A 2DN6A 4C0AA 4WJ7A 3PG7A 5C16A 2Z0PA 4NY0A 3D8EA 2DKPA 4Z2MB 5J3TA 2Z0QA 3TVVA 4WVFB 1UNRA 4A6FA 3U7DA 2P8VA 2YRYA 1RRPB 1RJ2A 3SYXA 4DXAB 4H8SA 2XQNM 5D3WA 2V76A 4HAZB 4HAXB 5JHHA 4KHAA 3DXDA 5CLLB 1NTYA 1I7AA 4A6FB 4PQ0A 2D11A 1ISNA 3MDBC 2D4QA 2Y8FA 1FGZA 1LB1A 4HDOA 2X18A 2W2XC 4Y94A 1Z87A 2COCA 4HAUB 2L1CA 4NSWA 2R09A 1NTVA 3SNHA 2DKQA 2D2QA 5DIFB 4MT7A 5JLJB 2EC1A 1FHXA 2YSZA 2DFKA 4EKUA 2AL6A 1U5FA 2D9WA 2ELBA 4KVGB 2J0KA 2I1KA 3U8ZA 2VRWB 1X1FA 2RVBB 3DXEA 1ZC3B 4B6HA 2QKMA 3P6AA 1TXDA 1DYNA 1MAIA 1V61A 2CRFA 2W2XD 3G9WA 2E2XA 3FM8C 1FHWA 3PP2A 5EFXA 2HTHB 1EF1A 1KZ7A 2D9YA 2JP2A 4HB2B 4HAYB 2MWNB 2YVCA 1XR0B 4EMOA 1V5UA 3SV1A 4HHVA 1K5DB 3AU5A 2G35A 2CAYA 3ML4A 1U27A 4DX90 2LKOA 3O96A 3DXCA 2J59M 3ODOA 4TKNA 2ROVA 1PMSA 1M7EA 3NSUA 4HATB 2MFQA 2OTXA 5HE0A 1U5EA 3ULBA 4CHMA 4GN1A 4KHBB 1X11A 2VKIA 2D9XA 1QQGA 3BINA 3KRWA 2LOXA 1MK7B 2P0FA 2YF0A 4MK0A 2PZ1A 3T06A 4PNKA 2H7EA 1H10A 5FI1A 3V5WA 2DTCA 3D8FA 2L2IA 2Y7BA 1FHOA 4WSFA 1KZGA 4GZUA 4BBKA 2R0DA 3VIAA 5D3YA 2VSZA 1QC6A 3PVWA 1E5WA 2J0JA 1ZC4B 4K2PA 5DH9B 2ELAA 2Y8GA 3LJUX 3ULCA 2UZSA 2CODA 1PFJA 2RGNB 1P5TA 3QBVB 2KCJA 2KGXB 1MIZB 2W2WA 3HQCA 3SUZA 1H4RA 4A6HA 1WGUA 3GYOA 4L6EA 1B55A 3IVFA 5DI9B 1XKEA 3D8DA 4HB4B 1IRSA 2J0MA 4IAPA 1TJ6A 1BAKA 1XODA 5JHGA 1FOEA 2MDXA 1FAOA 2ROZB 3PVUA 3WA0A 2RLOA 1K5GB 2DLWA 1Q67A 1V5PA 1XX0A 5C79A 1DDVA 2N23A 3A8QA 2D10A 1DDMA 2YS1A 4HAVB 2DHIA 4P7IA 1V88A 2DHJA 1ZM0A 1V89A 2NMBA 4Z2NA 3F5RA 1I2HA 3KRXA 3P7ZA 3ODXA 4F7HA 2KUPA 1KI1B 4K81A 3KSYA 5LONB 2YT0A 4TYZA 4GPTB 4ZRJA 3ODWA 1MK9B 2M38A 4YL8A 3TO1A 2GCLA 2RNRB 2D9VA 2NZ8B 4A5KA 1MKEA 1W1GA 1GC7A 5D3XA 2MKRA 1W1DA 1ZSQA 5L81A 4A6KA 2UZRA 3PSCA 4D0NB 1X1GA 3CXBB 4GMVA 2DX1A 3TCAA 4IFSA 2LYDA 2OQBA 3GYPA 5D27A 1J0WA 1U29A 1MPHA 1UNPA 1PLSA 4KHOA 4HB3B 2N0YA 4DBBA 2EJ8A 2GCJA 4EJNA 1NI2A 3AU4A 2RUKB 3PZDA 1GG3A 1EVHA 1EGXA 5KQ4A 1WJMA 1Y19B 5CLQB 1SHCA 2DHKA 2I5FA 2K2UA 3ZDTA 3HK0A 3TFMA 1DROA 1UPQA 5C5BA 3PVLA 1TQZA 1BWNA 1WG7A 5JP4A 5C6RA 1AWEA 3A8PA 2K2JA 5HE3A 3ZVRA 5KCVA 1UEFA 5DHFB 1BTKA 1FGYA 1P6SA 2FJLA 2EMTA 1X86A 2DYQA 4CYEA 4GXBA 1BTNA 4HDQA 1U2BA 3AJ4A 2YS5A 3QWMA 3RCPA 5FI0A 3F0WA 2HE7A 2GS0A 1NU2A 2GJYA 2Z0OA 4HB0B 2EMSA 3N7CA 3OANA 5J3QA 1M7RA 2LULA 1WJ1A 1MIXA 3HW2B 1DDWA 2IFSA 1U5DA 1UPRA 2I5CA 3M1IB 2Q13A 5J3YA 2RSGA 1U5GA 4KAXB 1SGHA 1XCGA 4YONA 5KQ1A 2AEHA 3FEHA 1AQCA 1WVHA 4XWXA 2YT1A 1EAZA 4ZRIA 2UVMA 2QKLA 3PEGA 2I1JA 1J19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X05 A;  2K00 A;  4K2O A;  2M14 A;  5D3V A;  3TW1 A;  2DYN A;  1N3H A;  4F7G A;  1OY2 A;  4GMX B;  1GC6 A;  1WI1 A;  2DX5 A;  2CY5 A;  3X23 A;  3MPX A;  2P0H A;  4HAW B;  3KY9 A;  5C5B B;  4CHJ A;  2ZPY A;  2DA0 A;  5HE1 A;  1ZVR A;  4IOY X;  5GOW B;  3QIJ A;  5DHA B;  1OMW A;  2CY4 A;  4DX8 A;  1LW3 A;  1P3R A;  1XD4 A;  3WYF B;  5LOP B;  1Y5O A;  4ZRK A;  5HE2 A;  2BCJ A;  2LG1 A;  3BJI A;  4MY6 A;  1W1H A;  4F7U P;  1FB8 A;  1UNQ A;  2H7D A;  3KZ1 A;  2D9Z A;  2COA A;  2ADZ A;  4K17 A;  1OQN A;  2YS3 A;  2LOZ A;  3FSS A;  1V5M A;  1WGQ A;  2COF A;  3CIK A;  3UZT A;  2P0D A;  1DBH A;  3VOQ A;  2IYB A;  3A98 B;  3SO6 A;  2DN6 A;  4C0A A;  4WJ7 A;  3PG7 A;  5C16 A;  2Z0P A;  4NY0 A;  3D8E A;  2DKP A;  4Z2M B;  5J3T A;  2Z0Q A;  3TVV A;  4WVF B;  1UNR A;  4A6F A;  3U7D A;  2P8V A;  2YRY A;  1RRP B;  1RJ2 A;  3SYX A;  4DXA B;  4H8S A;  2XQN M;  5D3W A;  2V76 A;  4HAZ B;  4HAX B;  5JHH A;  4KHA A;  3DXD A;  5CLL B;  1NTY A;  1I7A A;  4A6F B;  4PQ0 A;  2D11 A;  1ISN A;  3MDB C;  2D4Q A;  2Y8F A;  1FGZ A;  1LB1 A;  4HDO A;  2X18 A;  2W2X C;  4Y94 A;  1Z87 A;  2COC A;  4HAU B;  2L1C A;  4NSW A;  2R09 A;  1NTV A;  3SNH A;  2DKQ A;  2D2Q A;  5DIF B;  4MT7 A;  5JLJ B;  2EC1 A;  1FHX A;  2YSZ A;  2DFK A;  4EKU A;  2AL6 A;  1U5F A;  2D9W A;  2ELB A;  4KVG B;  2J0K A;  2I1K A;  3U8Z A;  2VRW B;  1X1F A;  2RVB B;  3DXE A;  1ZC3 B;  4B6H A;  2QKM A;  3P6A A;  1TXD A;  1DYN A;  1MAI A;  1V61 A;  2CRF A;  2W2X D;  3G9W A;  2E2X A;  3FM8 C;  1FHW A;  3PP2 A;  5EFX A;  2HTH B;  1EF1 A;  1KZ7 A;  2D9Y A;  2JP2 A;  4HB2 B;  4HAY B;  2MWN B;  2YVC A;  1XR0 B;  4EMO A;  1V5U A;  3SV1 A;  4HHV A;  1K5D B;  3AU5 A;  2G35 A;  2CAY A;  3ML4 A;  1U27 A;  4DX9 0;  2LKO A;  3O96 A;  3DXC A;  2J59 M;  3ODO A;  4TKN A;  2ROV A;  1PMS A;  1M7E A;  3NSU A;  4HAT B;  2MFQ A;  2OTX A;  5HE0 A;  1U5E A;  3ULB A;  4CHM A;  4GN1 A;  4KHB B;  1X11 A;  2VKI A;  2D9X A;  1QQG A;  3BIN A;  3KRW A;  2LOX A;  1MK7 B;  2P0F A;  2YF0 A;  4MK0 A;  2PZ1 A;  3T06 A;  4PNK A;  2H7E A;  1H10 A;  5FI1 A;  3V5W A;  2DTC A;  3D8F A;  2L2I A;  2Y7B A;  1FHO A;  4WSF A;  1KZG A;  4GZU A;  4BBK A;  2R0D A;  3VIA A;  5D3Y A;  2VSZ A;  1QC6 A;  3PVW A;  1E5W A;  2J0J A;  1ZC4 B;  4K2P A;  5DH9 B;  2ELA A;  2Y8G A;  3LJU X;  3ULC A;  2UZS A;  2COD A;  1PFJ A;  2RGN B;  1P5T A;  3QBV B;  2KCJ A;  2KGX B;  1MIZ B;  2W2W A;  3HQC A;  3SUZ A;  1H4R A;  4A6H A;  1WGU A;  3GYO A;  4L6E A;  1B55 A;  3IVF A;  5DI9 B;  1XKE A;  3D8D A;  4HB4 B;  1IRS A;  2J0M A;  4IAP A;  1TJ6 A;  1BAK A;  1XOD A;  5JHG A;  1FOE A;  2MDX A;  1FAO A;  2ROZ B;  3PVU A;  3WA0 A;  2RLO A;  1K5G B;  2DLW A;  1Q67 A;  1V5P A;  1XX0 A;  5C79 A;  1DDV A;  2N23 A;  3A8Q A;  2D10 A;  1DDM A;  2YS1 A;  4HAV B;  2DHI A;  4P7I A;  1V88 A;  2DHJ A;  1ZM0 A;  1V89 A;  2NMB A;  4Z2N A;  3F5R A;  1I2H A;  3KRX A;  3P7Z A;  3ODX A;  4F7H A;  2KUP A;  1KI1 B;  4K81 A;  3KSY A;  5LON B;  2YT0 A;  4TYZ A;  4GPT B;  4ZRJ A;  3ODW A;  1MK9 B;  2M38 A;  4YL8 A;  3TO1 A;  2GCL A;  2RNR B;  2D9V A;  2NZ8 B;  4A5K A;  1MKE A;  1W1G A;  1GC7 A;  5D3X A;  2MKR A;  1W1D A;  1ZSQ A;  5L81 A;  4A6K A;  2UZR A;  3PSC A;  4D0N B;  1X1G A;  3CXB B;  4GMV A;  2DX1 A;  3TCA A;  4IFS A;  2LYD A;  2OQB A;  3GYP A;  5D27 A;  1J0W A;  1U29 A;  1MPH A;  1UNP A;  1PLS A;  4KHO A;  4HB3 B;  2N0Y A;  4DBB A;  2EJ8 A;  2GCJ A;  4EJN A;  1NI2 A;  3AU4 A;  2RUK B;  3PZD A;  1GG3 A;  1EVH A;  1EGX A;  5KQ4 A;  1WJM A;  1Y19 B;  5CLQ B;  1SHC A;  2DHK A;  2I5F A;  2K2U A;  3ZDT A;  3HK0 A;  3TFM A;  1DRO A;  1UPQ A;  5C5B A;  3PVL A;  1TQZ A;  1BWN A;  1WG7 A;  5JP4 A;  5C6R A;  1AWE A;  3A8P A;  2K2J A;  5HE3 A;  3ZVR A;  5KCV A;  1UEF A;  5DHF B;  1BTK A;  1FGY A;  1P6S A;  2FJL A;  2EMT A;  1X86 A;  2DYQ A;  4CYE A;  4GXB A;  1BTN A;  4HDQ A;  1U2B A;  3AJ4 A;  2YS5 A;  3QWM A;  3RCP A;  5FI0 A;  3F0W A;  2HE7 A;  2GS0 A;  1NU2 A;  2GJY A;  2Z0O A;  4HB0 B;  2EMS A;  3N7C A;  3OAN A;  5J3Q A;  1M7R A;  2LUL A;  1WJ1 A;  1MIX A;  3HW2 B;  1DDW A;  2IFS A;  1U5D A;  1UPR A;  2I5C A;  3M1I B;  2Q13 A;  5J3Y A;  2RSG A;  1U5G A;  4KAX B;  1SGH A;  1XCG A;  4YON A;  5KQ1 A;  2AEH A;  3FEH A;  1AQC A;  1WVH A;  4XWX A;  2YT1 A;  1EAZ A;  4ZRI A;  2UVM A;  2QKL A;  3PEG A;  2I1J A;  1J19 A; 
#chains in the Genus database with same CATH topology
 1X05 A;  2K00 A;  4K2O A;  2M14 A;  5D3V A;  3TW1 A;  2DYN A;  1N3H A;  4F7G A;  1OY2 A;  4GMX B;  1GC6 A;  1WI1 A;  2DX5 A;  2CY5 A;  3X23 A;  2ZKM X;  3MPX A;  2P0H A;  4HAW B;  3KY9 A;  5C5B B;  4CHJ A;  2ZPY A;  2DA0 A;  5HE1 A;  1ZVR A;  4IOY X;  5I2S A;  5GOW B;  3U12 A;  4HSI A;  3QIJ A;  5DHA B;  1OMW A;  2CY4 A;  4DX8 A;  1LW3 A;  1P3R A;  1XD4 A;  4OSN A;  3WYF B;  5LOP B;  4KHB A;  1Y5O A;  4ZRK A;  5HE2 A;  2BCJ A;  2LG1 A;  3BJI A;  4MY6 A;  1W1H A;  4F7U P;  1FB8 A;  1UNQ A;  2H7D A;  3KZ1 A;  2D9Z A;  2COA A;  2ADZ A;  4K17 A;  1OQN A;  2YS3 A;  2LOZ A;  3FSS A;  1V5M A;  1WGQ A;  2COF A;  3CIK A;  3UZT A;  2P0D A;  1DBH A;  3VOQ A;  2IYB A;  3A98 B;  3SO6 A;  2DN6 A;  4C0A A;  4QXA B;  4WJ7 A;  3PG7 A;  5C16 A;  2Z0P A;  4NY0 A;  4DIX A;  3D8E A;  2DKP A;  4Z2M B;  5J3T A;  2Z0Q A;  3B77 A;  3TVV A;  4WVF B;  1UNR A;  4A6F A;  3U7D A;  2P8V A;  2YRY A;  1RRP B;  4D6W A;  1RJ2 A;  3SYX A;  4DXA B;  4H8S A;  2XQN M;  5D3W A;  2V76 A;  4HAZ B;  4HAX B;  5JHH A;  4KHA A;  3DXD A;  5CLL B;  1NTY A;  1I7A A;  4A6F B;  4PQ0 A;  2D11 A;  1ISN A;  3MDB C;  2D4Q A;  2Y8F A;  5M4Y B;  1FGZ A;  1LB1 A;  4HDO A;  2X18 A;  2W2X C;  4Y94 A;  1Z87 A;  2COC A;  4HAU B;  2L1C A;  4NSW A;  2R09 A;  1NTV A;  3SNH A;  2DKQ A;  2D2Q A;  5DIF B;  4MT7 A;  5JLJ B;  2EC1 A;  4GOU A;  3NWF A;  1FHX A;  2YSZ A;  2DFK A;  4EKU A;  2AL6 A;  1U5F A;  2D9W A;  2ELB A;  4KVG B;  2J0K A;  2I1K A;  3U8Z A;  2VRW B;  1X1F A;  2RVB B;  3DXE A;  1ZC3 B;  4B6H A;  2QKM A;  3P6A A;  1TXD A;  1DYN A;  1MAI A;  1V61 A;  2CRF A;  2W2X D;  3G9W A;  2E2X A;  3FM8 C;  1FHW A;  3PP2 A;  5EFX A;  2HTH B;  1EF1 A;  1KZ7 A;  2D9Y A;  2JP2 A;  4HB2 B;  4HAY B;  2MWN B;  2YVC A;  1XR0 B;  4EMO A;  1V5U A;  3SV1 A;  4HHV A;  1K5D B;  3AU5 A;  2R2Y A;  2G35 A;  2CAY A;  3ML4 A;  1U27 A;  4DX9 0;  2LKO A;  2GUM A;  3O96 A;  3DXC A;  2J59 M;  3ODO A;  4TKN A;  2ROV A;  1PMS A;  1M7E A;  3NSU A;  4HAT B;  3NWD A;  2MFQ A;  2OTX A;  5HE0 A;  1U5E A;  3ULB A;  4CHM A;  4GN1 A;  4KHB B;  1X11 A;  2VKI A;  2Z13 A;  2D9X A;  1QQG A;  3BIN A;  3KRW A;  4CSQ A;  1MI1 A;  2LOX A;  1MK7 B;  2P0F A;  2YF0 A;  4MK0 A;  2PZ1 A;  3T06 A;  4PNK A;  2H7E A;  1H10 A;  5FI1 A;  2Z59 A;  3V5W A;  2DTC A;  3D8F A;  2L2I A;  4QJ5 B;  2Y7B A;  1FHO A;  4WSF A;  1KZG A;  4GZU A;  4BBK A;  2R0D A;  3VIA A;  5D3Y A;  2VSZ A;  1QC6 A;  3PVW A;  2Z14 A;  1E5W A;  2J0J A;  1ZC4 B;  4K2P A;  5DH9 B;  3HIE A;  2ELA A;  2Y8G A;  3LJU X;  3ULC A;  2UZS A;  2COD A;  2KIE A;  1PFJ A;  2RGN B;  1P5T A;  3QBV B;  2KCJ A;  2KGX B;  4GNK B;  1MIZ B;  5I2M A;  2W2W A;  3HQC A;  3SUZ A;  1H4R A;  2FJU B;  4A6H A;  1WGU A;  3GYO A;  4L6E A;  4OT1 A;  1B55 A;  3IVF A;  5DI9 B;  1XKE A;  3D8D A;  4HB4 B;  1IRS A;  2J0M A;  4IAP A;  1TJ6 A;  1BAK A;  1XOD A;  5JHG A;  1FOE A;  2MDX A;  1FAO A;  2ROZ B;  3PVU A;  3WA0 A;  2KIG A;  2RLO A;  1K5G B;  2DLW A;  1Q67 A;  1V5P A;  4L1R A;  1XX0 A;  5C79 A;  1DDV A;  2N23 A;  2K8E A;  3A8Q A;  2D10 A;  1DDM A;  4QJ3 B;  2YS1 A;  4HAV B;  2DHI A;  2Z4D A;  1V88 A;  2DHJ A;  4P7I A;  1ZM0 A;  1V89 A;  2NMB A;  4Z2N A;  5IRS A;  3F5R A;  1I2H A;  3KRX A;  3P7Z A;  3ODX A;  4F7H A;  2KUP A;  1KI1 B;  4K81 A;  3KSY A;  5LON B;  3OHM B;  2YT0 A;  4TYZ A;  4GPT B;  4ZRJ A;  5LG4 B;  3ODW A;  1MK9 B;  2YT2 A;  2M38 A;  4YL8 A;  3TO1 A;  2GCL A;  2RNR B;  2D9V A;  2NZ8 B;  4A5K A;  1MKE A;  1W1G A;  1GC7 A;  5D3X A;  2MKR A;  1W1D A;  1ZSQ A;  5L81 A;  4A6K A;  2UZR A;  3A58 A;  3PSC A;  4D0N B;  1X1G A;  3CXB B;  4GMV A;  2DX1 A;  3TCA A;  4IFS A;  2LYD A;  2OQB A;  3GYP A;  5D27 A;  1J0W A;  1U29 A;  3NWA A;  1MPH A;  1UNP A;  1PLS A;  4KHO A;  4HB3 B;  2N0Y A;  4DBB A;  2EJ8 A;  2GCJ A;  4EJN A;  3NW8 A;  4QJ4 B;  1NI2 A;  3AU4 A;  2RUK B;  3PZD A;  1GG3 A;  1EVH A;  1T77 A;  1EGX A;  5KQ4 A;  1WJM A;  1Y19 B;  5CLQ B;  1SHC A;  2DHK A;  2I5F A;  2K2U A;  3ZDT A;  3HK0 A;  3TFM A;  1DRO A;  1UPQ A;  5C5B A;  3PVL A;  1TQZ A;  1BWN A;  1WG7 A;  5JP4 A;  5C6R A;  1AWE A;  3A8P A;  2K2J A;  5HE3 A;  3ZVR A;  5KCV A;  1UEF A;  5DHF B;  1BTK A;  1FGY A;  1P6S A;  2FJL A;  2EMT A;  2K49 A;  1X86 A;  2RRF A;  2DYQ A;  4CYE A;  4GXB A;  1BTN A;  4HDQ A;  1U2B A;  3AJ4 A;  2YS5 A;  3QWM A;  3RCP A;  5FI0 A;  3F0W A;  1ZYI A;  2HE7 A;  2GS0 A;  1NU2 A;  2GJY A;  2Z0O A;  2NBV A;  3FVC A;  2EMS A;  3N7C A;  4HB0 B;  3OAN A;  5J3Q A;  1M7R A;  2LUL A;  1WJ1 A;  1MIX A;  3DCX A;  2KR0 A;  1DDW A;  2IFS A;  3HW2 B;  1U5D A;  1UPR A;  2I5C A;  3M1I B;  2Q13 A;  5J3Y A;  2RSG A;  2KUQ A;  1U5G A;  4KAX B;  1SGH A;  1XCG A;  4YON A;  5KQ1 A;  2AEH A;  3FEH A;  1AQC A;  1WVH A;  4XWX A;  2YT1 A;  1EAZ A;  4ZRI A;  2UVM A;  3HSA A;  2QKL A;  3PEG A;  2I1J A;  1J19 A; 
#chains in the Genus database with same CATH homology
 1X05 A;  2K00 A;  4K2O A;  2M14 A;  5D3V A;  3TW1 A;  2DYN A;  1N3H A;  4F7G A;  1OY2 A;  4GMX B;  1GC6 A;  1WI1 A;  2DX5 A;  2CY5 A;  3X23 A;  3MPX A;  2P0H A;  4HAW B;  3KY9 A;  5C5B B;  4CHJ A;  2ZPY A;  2DA0 A;  5HE1 A;  1ZVR A;  4IOY X;  5GOW B;  3QIJ A;  5DHA B;  1OMW A;  2CY4 A;  4DX8 A;  1LW3 A;  1P3R A;  1XD4 A;  3WYF B;  5LOP B;  1Y5O A;  4ZRK A;  5HE2 A;  2BCJ A;  2LG1 A;  3BJI A;  4MY6 A;  1W1H A;  4F7U P;  1FB8 A;  1UNQ A;  2H7D A;  3KZ1 A;  2D9Z A;  2COA A;  2ADZ A;  4K17 A;  1OQN A;  2YS3 A;  2LOZ A;  3FSS A;  1V5M A;  1WGQ A;  2COF A;  3CIK A;  3UZT A;  2P0D A;  1DBH A;  3VOQ A;  2IYB A;  3A98 B;  3SO6 A;  2DN6 A;  4C0A A;  4WJ7 A;  3PG7 A;  5C16 A;  2Z0P A;  4NY0 A;  3D8E A;  2DKP A;  4Z2M B;  5J3T A;  2Z0Q A;  3TVV A;  4WVF B;  1UNR A;  4A6F A;  3U7D A;  2P8V A;  2YRY A;  1RRP B;  1RJ2 A;  3SYX A;  4DXA B;  4H8S A;  2XQN M;  5D3W A;  2V76 A;  4HAZ B;  4HAX B;  5JHH A;  4KHA A;  3DXD A;  5CLL B;  1NTY A;  1I7A A;  4A6F B;  4PQ0 A;  2D11 A;  1ISN A;  3MDB C;  2D4Q A;  2Y8F A;  1FGZ A;  1LB1 A;  4HDO A;  2X18 A;  2W2X C;  4Y94 A;  1Z87 A;  2COC A;  4HAU B;  2L1C A;  4NSW A;  2R09 A;  1NTV A;  3SNH A;  2DKQ A;  2D2Q A;  5DIF B;  4MT7 A;  5JLJ B;  2EC1 A;  1FHX A;  2YSZ A;  2DFK A;  4EKU A;  2AL6 A;  1U5F A;  2D9W A;  2ELB A;  4KVG B;  2J0K A;  2I1K A;  3U8Z A;  2VRW B;  1X1F A;  2RVB B;  3DXE A;  1ZC3 B;  4B6H A;  2QKM A;  3P6A A;  1TXD A;  1DYN A;  1MAI A;  1V61 A;  2CRF A;  2W2X D;  3G9W A;  2E2X A;  3FM8 C;  1FHW A;  3PP2 A;  5EFX A;  2HTH B;  1EF1 A;  1KZ7 A;  2D9Y A;  2JP2 A;  4HB2 B;  4HAY B;  2MWN B;  2YVC A;  1XR0 B;  4EMO A;  1V5U A;  3SV1 A;  4HHV A;  1K5D B;  3AU5 A;  2G35 A;  2CAY A;  3ML4 A;  1U27 A;  4DX9 0;  2LKO A;  3O96 A;  3DXC A;  2J59 M;  3ODO A;  4TKN A;  2ROV A;  1PMS A;  1M7E A;  3NSU A;  4HAT B;  2MFQ A;  2OTX A;  5HE0 A;  1U5E A;  3ULB A;  4CHM A;  4GN1 A;  4KHB B;  1X11 A;  2VKI A;  2D9X A;  1QQG A;  3BIN A;  3KRW A;  2LOX A;  1MK7 B;  2P0F A;  2YF0 A;  4MK0 A;  2PZ1 A;  3T06 A;  4PNK A;  2H7E A;  1H10 A;  5FI1 A;  3V5W A;  2DTC A;  3D8F A;  2L2I A;  2Y7B A;  1FHO A;  4WSF A;  1KZG A;  4GZU A;  4BBK A;  2R0D A;  3VIA A;  5D3Y A;  2VSZ A;  1QC6 A;  3PVW A;  1E5W A;  2J0J A;  1ZC4 B;  4K2P A;  5DH9 B;  2ELA A;  2Y8G A;  3LJU X;  3ULC A;  2UZS A;  2COD A;  1PFJ A;  2RGN B;  1P5T A;  3QBV B;  2KCJ A;  2KGX B;  1MIZ B;  2W2W A;  3HQC A;  3SUZ A;  1H4R A;  4A6H A;  1WGU A;  3GYO A;  4L6E A;  1B55 A;  3IVF A;  5DI9 B;  1XKE A;  3D8D A;  4HB4 B;  1IRS A;  2J0M A;  4IAP A;  1TJ6 A;  1BAK A;  1XOD A;  5JHG A;  1FOE A;  2MDX A;  1FAO A;  2ROZ B;  3PVU A;  3WA0 A;  2RLO A;  1K5G B;  2DLW A;  1Q67 A;  1V5P A;  1XX0 A;  5C79 A;  1DDV A;  2N23 A;  3A8Q A;  2D10 A;  1DDM A;  2YS1 A;  4HAV B;  2DHI A;  4P7I A;  1V88 A;  2DHJ A;  1ZM0 A;  1V89 A;  2NMB A;  4Z2N A;  3F5R A;  1I2H A;  3KRX A;  3P7Z A;  3ODX A;  4F7H A;  2KUP A;  1KI1 B;  4K81 A;  3KSY A;  5LON B;  2YT0 A;  4TYZ A;  4GPT B;  4ZRJ A;  3ODW A;  1MK9 B;  2M38 A;  4YL8 A;  3TO1 A;  2GCL A;  2RNR B;  2D9V A;  2NZ8 B;  4A5K A;  1MKE A;  1W1G A;  1GC7 A;  5D3X A;  2MKR A;  1W1D A;  1ZSQ A;  5L81 A;  4A6K A;  2UZR A;  3PSC A;  4D0N B;  1X1G A;  3CXB B;  4GMV A;  2DX1 A;  3TCA A;  4IFS A;  2LYD A;  2OQB A;  3GYP A;  5D27 A;  1J0W A;  1U29 A;  1MPH A;  1UNP A;  1PLS A;  4KHO A;  4HB3 B;  2N0Y A;  4DBB A;  2EJ8 A;  2GCJ A;  4EJN A;  1NI2 A;  3AU4 A;  2RUK B;  3PZD A;  1GG3 A;  1EVH A;  1EGX A;  5KQ4 A;  1WJM A;  1Y19 B;  5CLQ B;  1SHC A;  2DHK A;  2I5F A;  2K2U A;  3ZDT A;  3HK0 A;  3TFM A;  1DRO A;  1UPQ A;  5C5B A;  3PVL A;  1TQZ A;  1BWN A;  1WG7 A;  5JP4 A;  5C6R A;  1AWE A;  3A8P A;  2K2J A;  5HE3 A;  3ZVR A;  5KCV A;  1UEF A;  5DHF B;  1BTK A;  1FGY A;  1P6S A;  2FJL A;  2EMT A;  1X86 A;  2DYQ A;  4CYE A;  4GXB A;  1BTN A;  4HDQ A;  1U2B A;  3AJ4 A;  2YS5 A;  3QWM A;  3RCP A;  5FI0 A;  3F0W A;  2HE7 A;  2GS0 A;  1NU2 A;  2GJY A;  2Z0O A;  4HB0 B;  2EMS A;  3N7C A;  3OAN A;  5J3Q A;  1M7R A;  2LUL A;  1WJ1 A;  1MIX A;  3HW2 B;  1DDW A;  2IFS A;  1U5D A;  1UPR A;  2I5C A;  3M1I B;  2Q13 A;  5J3Y A;  2RSG A;  1U5G A;  4KAX B;  1SGH A;  1XCG A;  4YON A;  5KQ1 A;  2AEH A;  3FEH A;  1AQC A;  1WVH A;  4XWX A;  2YT1 A;  1EAZ A;  4ZRI A;  2UVM A;  2QKL A;  3PEG A;  2I1J A;  1J19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...