1DDWA

Homer evh1 domain unliganded
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
111
structure length
111
Chain Sequence
MGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINSTITPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords GLGF-DOMAIN PROTEIN HOMER
publication title Structure of the Homer EVH1 domain-peptide complex reveals a new twist in polyproline recognition.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 21
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 1999-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1ddwA00
2XQNM 2ZPYA 1FHXA 5HE0A 5GOWB 4KAXB 4HB2B 1V5PA 2Y8FA 1BWNA 3TCAA 1Y19B 1H10A 3FSSA 4TKNA 2ELBA 4DX90 3ODWA 5D27A 1GC7A 3QBVB 1ZM0A 3ZDTA 2UZRA 3DXEA 1IRSA 2YT0A 4KHAA 2DX5A 4K17A 3D8FA 4WVFB 2HE7A 1NU2A 4MT7A 1RRPB 2J0MA 3SV1A 4A6HA 4F7HA 1FGYA 2Y8GA 1MK7B 1KI1B 3GYPA 3QWMA 4HB4B 2RVBB 1TXDA 1QQGA 2RSGA 2R0DA 1V61A 3A8PA 4GN1A 1P6SA 1PMSA 1U5EA 1W1HA 4H8SA 4HDQA 4Y94A 1BTKA 2W2WA 2X18A 1E5WA 4GZUA 2LULA 4HB0B 1WI1A 1UEFA 1ZC3B 4GPTB 4CYEA 1U29A 4KVGB 3KSYA 1K5DB 4HAYB 3KY9A 3D8EA 2CY4A 3SUZA 1X11A 1J19A 3A98B 2ROZB 5J3QA 3PVWA 4HAZB 2D11A 2KUPA 3D8DA 1X86A 3PSCA 2D9VA 3CIKA 1TJ6A 2D10A 3TO1A 3PG7A 2LYDA 1AQCA 5HE3A 4NY0A 3ZVRA 1PFJA 5C5BB 4HB3B 3X23A 5C16A 2UZSA 1ZC4B 1DDMA 2VSZA 2OTXA 2DTCA 3ODOA 4F7GA 4BBKA 4DX8A 1M7EA 5FI1A 4DBBA 2DLWA 2IFSA 5C6RA 2JP2A 4ZRIA 2EJ8A 4GMXB 2EMTA 4K2OA 2GS0A 3SO6A 1AWEA 1FHOA 2M14A 4TYZA 4ZRKA 2KCJA 2N0YA 3KRXA 4YL8A 1U2BA 3MPXA 5J3YA 5JHGA 4P7IA 2AEHA 2G35A 2DKPA 2DYQA 1QC6A 3OANA 5KQ1A 2YVCA 1SHCA 3N7CA 4CHJA 5C79A 1FGZA 1XODA 2DHJA 1MPHA 1FB8A 5FI0A 1N3HA 1NTYA 3DXDA 1EGXA 1XR0B 3ULCA 1MIXA 2J0KA 1XKEA 2EC1A 2GJYA 2I5CA 2GCJA 4WJ7A 5CLQB 4A6KA 5HE1A 3PVUA 2COCA 4L6EA 3FEHA 2RNRB 2UVMA 3P6AA 3QIJA 1V89A 1ZVRA 4YONA 1SGHA 1TQZA 5J3TA 3ULBA 3IVFA 2D9YA 4HATB 2J0JA 3A8QA 3WYFB 4NSWA 2LKOA 1UNRA 3M1IB 1BTNA 2DN6A 2VRWB 1WJ1A 1RJ2A 2COAA 4D0NB 3F0WA 2DFKA 1KZGA 1WGQA 4HAUB 3TW1A 2QKLA 5C5BA 3KZ1A 2I1KA 4DXAB 3FM8C 3G9WA 2D9WA 3WA0A 3PP2A 3SYXA 2Z0QA 2QKMA 2NZ8B 4KHOA 4CHMA 2GCLA 2KGXB 4A6FB 2CY5A 1WVHA 4C0AA 3VIAA 5D3YA 1NI2A 2ELAA 2RGNB 3AU4A 1X1FA 3V5WA 1XCGA 1DDWA 2RUKB 4GXBA 3UZTA 1P3RA 3LJUX 4WSFA 1FAOA 2YSZA 5CLLB 2LG1A 2ADZA 3HK0A 4HAWB 1MKEA 4EKUA 1GC6A 2DA0A 4IFSA 1LW3A 2CRFA 2K2JA 1FHWA 1EAZA 1OMWA 4KHBB 3TVVA 4IAPA 5DH9B 3PEGA 2EMSA 3BJIA 4PNKA 1OQNA 3DXCA 1Z87A 2MKRA 4K2PA 2COFA 2D4QA 1XX0A 3O96A 3MDBC 1UPQA 3PVLA 1MK9B 2YF0A 5DI9B 1NTVA 2W2XD 1UPRA 1B55A 1EF1A 1DROA 1OY2A 1WG7A 2VKIA 1M7RA 4ZRJA 2DYNA 2PZ1A 4EJNA 3T06A 2AL6A 2P8VA 3ML4A 3U7DA 1FOEA 4HAVB 4HHVA 1LB1A 3HW2B 5DHAB 1WJMA 4A5KA 3CXBB 3AJ4A 1U5GA 3NSUA 2Q13A 1J0WA 1V88A 2Z0OA 4MK0A 3TFMA 2H7EA 2ROVA 5JP4A 2Z0PA 2K2UA 5JLJB 4K81A 3HQCA 1V5UA 1ISNA 3KRWA 1Q67A 4A6FA 1EVHA 4MY6A 5D3WA 2M38A 2N23A 4HDOA 1ZSQA 3U8ZA 1X1GA 3RCPA 1MIZB 2DX1A 2IYBA 1U5FA 1DYNA 2FJLA 2LOZA 2DKQA 2E2XA 2YS5A 1XD4A 1V5MA 1U5DA 1GG3A 1W1DA 2H7DA 2V76A 1DBHA 5JHHA 2K00A 1UNQA 3VOQA 2LOXA 4B6HA 2HTHB 3P7ZA 2DHKA 4IOYX 5D3VA 1WGUA 2W2XC 2MDXA 4F7UP 2YS1A 1DDVA 1W1GA 3AU5A 5KQ4A 2MWNB 2D9ZA 4GMVA 2CODA 2YT1A 4PQ0A 3PZDA 4Z2MB 2YS3A 1PLSA 2BCJA 1I7AA 1I2HA 1KZ7A 1P5TA 5KCVA 5LOPB 2P0FA 2CAYA 3ODXA 5DHFB 5D3XA 2NMBA 2I1JA 4XWXA 2J59M 2Y7BA 2D2QA 3GYOA 1X05A 5LONB 1Y5OA 5HE2A 4Z2NA 2D9XA 2L2IA 2OQBA 1BAKA 2DHIA 2YRYA 1U27A 2R09A 5EFXA 2P0DA 2L1CA 4EMOA 3BINA 5DIFB 2P0HA 1UNPA 2MFQA 1K5GB 5L81A 1H4RA 3F5RA 1MAIA 2I5FA 2RLOA 4HAXB 3SNHA
chains in the Genus database with same CATH superfamily
2XQNM 2ZPYA 1FHXA 5HE0A 5GOWB 4KAXB 4HB2B 1V5PA 2Y8FA 1BWNA 3TCAA 1Y19B 1H10A 3FSSA 4TKNA 2ELBA 4DX90 3ODWA 5D27A 1GC7A 3QBVB 3NWFA 1ZM0A 3ZDTA 2UZRA 3DXEA 1IRSA 2YT0A 4KHAA 2DX5A 4K17A 3D8FA 4WVFB 2HE7A 1NU2A 4MT7A 1RRPB 2J0MA 3SV1A 4A6HA 4F7HA 1FGYA 2Y8GA 1MK7B 1KI1B 3GYPA 3QWMA 4HB4B 2RVBB 1TXDA 1QQGA 2RSGA 3NW8A 2R0DA 1V61A 5LG4B 3A8PA 4GN1A 1P6SA 1PMSA 1U5EA 1W1HA 4H8SA 4HDQA 4Y94A 3FVCA 1BTKA 2W2WA 2X18A 2Z4DA 1E5WA 4GZUA 2LULA 4HB0B 1WI1A 1UEFA 1ZC3B 4KHBA 4GPTB 4CYEA 1U29A 4KVGB 3KSYA 1K5DB 2R2YA 3KY9A 4HAYB 3D8EA 2CY4A 3SUZA 1X11A 1J19A 3A98B 2ROZB 5J3QA 1MI1A 3PVWA 4HAZB 2D11A 2KUPA 3D8DA 1X86A 3PSCA 4HSIA 4GOUA 3HSAA 4GNKB 2D9VA 3CIKA 1TJ6A 2D10A 3TO1A 3PG7A 2LYDA 1AQCA 5HE3A 4NY0A 3ZVRA 3OHMB 1PFJA 5C5BB 4HB3B 3X23A 5C16A 2UZSA 1ZC4B 4QJ4B 2VSZA 1DDMA 2OTXA 2DTCA 3ODOA 4F7GA 4BBKA 4DX8A 1M7EA 5FI1A 4DBBA 2DLWA 2IFSA 5C6RA 2JP2A 4ZRIA 2EJ8A 2ZKMX 4GMXB 2EMTA 4K2OA 2GS0A 3SO6A 1AWEA 4OSNA 1FHOA 2M14A 4TYZA 4ZRKA 2KCJA 2N0YA 3KRXA 4YL8A 1U2BA 3MPXA 5J3YA 5JHGA 4P7IA 2AEHA 2G35A 2DKPA 2DYQA 1QC6A 3OANA 5KQ1A 2YVCA 1SHCA 3N7CA 4CHJA 5C79A 1FGZA 2K49A 1XODA 2DHJA 1MPHA 2Z14A 4OT1A 1FB8A 5FI0A 1N3HA 1NTYA 3DXDA 1EGXA 2FJUB 1XR0B 3ULCA 1MIXA 2J0KA 1XKEA 2EC1A 2GJYA 2I5CA 2GCJA 4WJ7A 5CLQB 5I2MA 4A6KA 5HE1A 3PVUA 2COCA 4L6EA 3HIEA 3FEHA 2RNRB 2UVMA 3P6AA 3QIJA 1V89A 4QJ5B 1ZVRA 4YONA 1SGHA 1TQZA 5J3TA 3ULBA 3IVFA 2D9YA 4HATB 2J0JA 3A8QA 3WYFB 4NSWA 2LKOA 1UNRA 3M1IB 4L1RA 1BTNA 2DN6A 2VRWB 1WJ1A 1RJ2A 2COAA 2KIGA 4D0NB 3F0WA 2DFKA 2RRFA 1KZGA 1WGQA 4HAUB 3TW1A 2QKLA 5C5BA 3KZ1A 3U12A 2I1KA 4DXAB 3FM8C 3G9WA 2D9WA 3WA0A 3PP2A 3SYXA 2Z0QA 2QKMA 2NZ8B 4KHOA 4CHMA 2GCLA 2KGXB 4A6FB 2CY5A 1WVHA 2K8EA 4C0AA 3VIAA 5D3YA 1NI2A 4CSQA 1T77A 2ELAA 2RGNB 3AU4A 1X1FA 3V5WA 1XCGA 1DDWA 2RUKB 4GXBA 5IRSA 3UZTA 1P3RA 3LJUX 4WSFA 1FAOA 2YSZA 5CLLB 3DCXA 2LG1A 2GUMA 2ADZA 3HK0A 4HAWB 1MKEA 4EKUA 1GC6A 2DA0A 4IFSA 1LW3A 2CRFA 2K2JA 2YT2A 1FHWA 1EAZA 1OMWA 4KHBB 3TVVA 4IAPA 5DH9B 4D6WA 3PEGA 2EMSA 3BJIA 4PNKA 1OQNA 3A58A 3DXCA 1Z87A 2MKRA 4K2PA 2COFA 2D4QA 1XX0A 3O96A 3MDBC 3NWDA 1UPQA 3PVLA 1MK9B 2YF0A 5DI9B 1NTVA 2W2XD 1UPRA 1B55A 1EF1A 1DROA 1OY2A 1WG7A 2VKIA 1M7RA 4ZRJA 2DYNA 2PZ1A 4EJNA 3T06A 2AL6A 2P8VA 3ML4A 3U7DA 1FOEA 4HAVB 4HHVA 1LB1A 3HW2B 5DHAB 1WJMA 4A5KA 3CXBB 3AJ4A 1U5GA 2NBVA 3NSUA 2Q13A 1J0WA 1V88A 2Z0OA 4MK0A 3TFMA 2H7EA 2ROVA 5JP4A 2Z59A 4QJ3B 2Z0PA 2K2UA 5JLJB 4K81A 3HQCA 1V5UA 1ISNA 3KRWA 1Q67A 4A6FA 1EVHA 4MY6A 5D3WA 4QXAB 2M38A 2N23A 4HDOA 1ZSQA 3U8ZA 1X1GA 3RCPA 1MIZB 2DX1A 2IYBA 1U5FA 1ZYIA 1DYNA 2FJLA 2Z13A 2LOZA 2DKQA 2E2XA 2YS5A 5I2SA 1XD4A 1V5MA 1U5DA 1GG3A 1W1DA 2H7DA 2V76A 1DBHA 5JHHA 2K00A 2KR0A 1UNQA 3VOQA 2LOXA 4B6HA 2HTHB 3P7ZA 2DHKA 4IOYX 5D3VA 1WGUA 2W2XC 2MDXA 4F7UP 2YS1A 1DDVA 1W1GA 3AU5A 5KQ4A 2MWNB 2D9ZA 4GMVA 2CODA 2YT1A 4PQ0A 3PZDA 4Z2MB 2YS3A 1PLSA 2BCJA 1I7AA 1I2HA 1KZ7A 1P5TA 5KCVA 5LOPB 2KUQA 3B77A 2P0FA 2CAYA 3ODXA 5DHFB 5D3XA 2NMBA 2I1JA 4XWXA 5M4YB 2J59M 2Y7BA 2D2QA 3GYOA 1X05A 5LONB 1Y5OA 5HE2A 4Z2NA 2D9XA 2L2IA 2OQBA 1BAKA 2DHIA 2YRYA 1U27A 3NWAA 2R09A 2KIEA 5EFXA 2P0DA 2L1CA 4EMOA 3BINA 5DIFB 2P0HA 1UNPA 2MFQA 1K5GB 5L81A 1H4RA 4DIXA 3F5RA 1MAIA 2I5FA 2RLOA 4HAXB 3SNHA
chains in the Genus database with same CATH topology
2XQNM 2ZPYA 1FHXA 5HE0A 5GOWB 4KAXB 4HB2B 1V5PA 2Y8FA 1BWNA 3TCAA 1Y19B 1H10A 3FSSA 4TKNA 2ELBA 4DX90 3ODWA 5D27A 1GC7A 3QBVB 1ZM0A 3ZDTA 2UZRA 3DXEA 1IRSA 2YT0A 4KHAA 2DX5A 4K17A 3D8FA 4WVFB 2HE7A 1NU2A 4MT7A 1RRPB 2J0MA 3SV1A 4A6HA 4F7HA 1FGYA 2Y8GA 1MK7B 1KI1B 3GYPA 3QWMA 4HB4B 2RVBB 1TXDA 1QQGA 2RSGA 2R0DA 1V61A 3A8PA 4GN1A 1P6SA 1PMSA 1U5EA 1W1HA 4H8SA 4HDQA 4Y94A 1BTKA 2W2WA 2X18A 1E5WA 4GZUA 2LULA 4HB0B 1WI1A 1UEFA 1ZC3B 4GPTB 4CYEA 1U29A 4KVGB 3KSYA 1K5DB 4HAYB 3KY9A 3D8EA 2CY4A 3SUZA 1X11A 1J19A 3A98B 2ROZB 5J3QA 3PVWA 4HAZB 2D11A 2KUPA 3D8DA 1X86A 3PSCA 2D9VA 3CIKA 1TJ6A 2D10A 3TO1A 3PG7A 2LYDA 1AQCA 5HE3A 4NY0A 3ZVRA 1PFJA 5C5BB 4HB3B 3X23A 5C16A 2UZSA 1ZC4B 1DDMA 2VSZA 2OTXA 2DTCA 3ODOA 4F7GA 4BBKA 4DX8A 1M7EA 5FI1A 4DBBA 2DLWA 2IFSA 5C6RA 2JP2A 4ZRIA 2EJ8A 4GMXB 2EMTA 4K2OA 2GS0A 3SO6A 1AWEA 1FHOA 2M14A 4TYZA 4ZRKA 2KCJA 2N0YA 3KRXA 4YL8A 1U2BA 3MPXA 5J3YA 5JHGA 4P7IA 2AEHA 2G35A 2DKPA 2DYQA 1QC6A 3OANA 5KQ1A 2YVCA 1SHCA 3N7CA 4CHJA 5C79A 1FGZA 1XODA 2DHJA 1MPHA 1FB8A 5FI0A 1N3HA 1NTYA 3DXDA 1EGXA 1XR0B 3ULCA 1MIXA 2J0KA 1XKEA 2EC1A 2GJYA 2I5CA 2GCJA 4WJ7A 5CLQB 4A6KA 5HE1A 3PVUA 2COCA 4L6EA 3FEHA 2RNRB 2UVMA 3P6AA 3QIJA 1V89A 1ZVRA 4YONA 1SGHA 1TQZA 5J3TA 3ULBA 3IVFA 2D9YA 4HATB 2J0JA 3A8QA 3WYFB 4NSWA 2LKOA 1UNRA 3M1IB 1BTNA 2DN6A 2VRWB 1WJ1A 1RJ2A 2COAA 4D0NB 3F0WA 2DFKA 1KZGA 1WGQA 4HAUB 3TW1A 2QKLA 5C5BA 3KZ1A 2I1KA 4DXAB 3FM8C 3G9WA 2D9WA 3WA0A 3PP2A 3SYXA 2Z0QA 2QKMA 2NZ8B 4KHOA 4CHMA 2GCLA 2KGXB 4A6FB 2CY5A 1WVHA 4C0AA 3VIAA 5D3YA 1NI2A 2ELAA 2RGNB 3AU4A 1X1FA 3V5WA 1XCGA 1DDWA 2RUKB 4GXBA 3UZTA 1P3RA 3LJUX 4WSFA 1FAOA 2YSZA 5CLLB 2LG1A 2ADZA 3HK0A 4HAWB 1MKEA 4EKUA 1GC6A 2DA0A 4IFSA 1LW3A 2CRFA 2K2JA 1FHWA 1EAZA 1OMWA 4KHBB 3TVVA 4IAPA 5DH9B 3PEGA 2EMSA 3BJIA 4PNKA 1OQNA 3DXCA 1Z87A 2MKRA 4K2PA 2COFA 2D4QA 1XX0A 3O96A 3MDBC 1UPQA 3PVLA 1MK9B 2YF0A 5DI9B 1NTVA 2W2XD 1UPRA 1B55A 1EF1A 1DROA 1OY2A 1WG7A 2VKIA 1M7RA 4ZRJA 2DYNA 2PZ1A 4EJNA 3T06A 2AL6A 2P8VA 3ML4A 3U7DA 1FOEA 4HAVB 4HHVA 1LB1A 3HW2B 5DHAB 1WJMA 4A5KA 3CXBB 3AJ4A 1U5GA 3NSUA 2Q13A 1J0WA 1V88A 2Z0OA 4MK0A 3TFMA 2H7EA 2ROVA 5JP4A 2Z0PA 2K2UA 5JLJB 4K81A 3HQCA 1V5UA 1ISNA 3KRWA 1Q67A 4A6FA 1EVHA 4MY6A 5D3WA 2M38A 2N23A 4HDOA 1ZSQA 3U8ZA 1X1GA 3RCPA 1MIZB 2DX1A 2IYBA 1U5FA 1DYNA 2FJLA 2LOZA 2DKQA 2E2XA 2YS5A 1XD4A 1V5MA 1U5DA 1GG3A 1W1DA 2H7DA 2V76A 1DBHA 5JHHA 2K00A 1UNQA 3VOQA 2LOXA 4B6HA 2HTHB 3P7ZA 2DHKA 4IOYX 5D3VA 1WGUA 2W2XC 2MDXA 4F7UP 2YS1A 1DDVA 1W1GA 3AU5A 5KQ4A 2MWNB 2D9ZA 4GMVA 2CODA 2YT1A 4PQ0A 3PZDA 4Z2MB 2YS3A 1PLSA 2BCJA 1I7AA 1I2HA 1KZ7A 1P5TA 5KCVA 5LOPB 2P0FA 2CAYA 3ODXA 5DHFB 5D3XA 2NMBA 2I1JA 4XWXA 2J59M 2Y7BA 2D2QA 3GYOA 1X05A 5LONB 1Y5OA 5HE2A 4Z2NA 2D9XA 2L2IA 2OQBA 1BAKA 2DHIA 2YRYA 1U27A 2R09A 5EFXA 2P0DA 2L1CA 4EMOA 3BINA 5DIFB 2P0HA 1UNPA 2MFQA 1K5GB 5L81A 1H4RA 3F5RA 1MAIA 2I5FA 2RLOA 4HAXB 3SNHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XQN M;  2ZPY A;  1FHX A;  5HE0 A;  5GOW B;  4KAX B;  4HB2 B;  1V5P A;  2Y8F A;  1BWN A;  3TCA A;  1Y19 B;  1H10 A;  3FSS A;  4TKN A;  2ELB A;  4DX9 0;  3ODW A;  5D27 A;  1GC7 A;  3QBV B;  1ZM0 A;  3ZDT A;  2UZR A;  3DXE A;  1IRS A;  2YT0 A;  4KHA A;  2DX5 A;  4K17 A;  3D8F A;  4WVF B;  2HE7 A;  1NU2 A;  4MT7 A;  1RRP B;  2J0M A;  3SV1 A;  4A6H A;  4F7H A;  1FGY A;  2Y8G A;  1MK7 B;  1KI1 B;  3GYP A;  3QWM A;  4HB4 B;  2RVB B;  1TXD A;  1QQG A;  2RSG A;  2R0D A;  1V61 A;  3A8P A;  4GN1 A;  1P6S A;  1PMS A;  1U5E A;  1W1H A;  4H8S A;  4HDQ A;  4Y94 A;  1BTK A;  2W2W A;  2X18 A;  1E5W A;  4GZU A;  2LUL A;  4HB0 B;  1WI1 A;  1UEF A;  1ZC3 B;  4GPT B;  4CYE A;  1U29 A;  4KVG B;  3KSY A;  1K5D B;  4HAY B;  3KY9 A;  3D8E A;  2CY4 A;  3SUZ A;  1X11 A;  1J19 A;  3A98 B;  2ROZ B;  5J3Q A;  3PVW A;  4HAZ B;  2D11 A;  2KUP A;  3D8D A;  1X86 A;  3PSC A;  2D9V A;  3CIK A;  1TJ6 A;  2D10 A;  3TO1 A;  3PG7 A;  2LYD A;  1AQC A;  5HE3 A;  4NY0 A;  3ZVR A;  1PFJ A;  5C5B B;  4HB3 B;  3X23 A;  5C16 A;  2UZS A;  1ZC4 B;  1DDM A;  2VSZ A;  2OTX A;  2DTC A;  3ODO A;  4F7G A;  4BBK A;  4DX8 A;  1M7E A;  5FI1 A;  4DBB A;  2DLW A;  2IFS A;  5C6R A;  2JP2 A;  4ZRI A;  2EJ8 A;  4GMX B;  2EMT A;  4K2O A;  2GS0 A;  3SO6 A;  1AWE A;  1FHO A;  2M14 A;  4TYZ A;  4ZRK A;  2KCJ A;  2N0Y A;  3KRX A;  4YL8 A;  1U2B A;  3MPX A;  5J3Y A;  5JHG A;  4P7I A;  2AEH A;  2G35 A;  2DKP A;  2DYQ A;  1QC6 A;  3OAN A;  5KQ1 A;  2YVC A;  1SHC A;  3N7C A;  4CHJ A;  5C79 A;  1FGZ A;  1XOD A;  2DHJ A;  1MPH A;  1FB8 A;  5FI0 A;  1N3H A;  1NTY A;  3DXD A;  1EGX A;  1XR0 B;  3ULC A;  1MIX A;  2J0K A;  1XKE A;  2EC1 A;  2GJY A;  2I5C A;  2GCJ A;  4WJ7 A;  5CLQ B;  4A6K A;  5HE1 A;  3PVU A;  2COC A;  4L6E A;  3FEH A;  2RNR B;  2UVM A;  3P6A A;  3QIJ A;  1V89 A;  1ZVR A;  4YON A;  1SGH A;  1TQZ A;  5J3T A;  3ULB A;  3IVF A;  2D9Y A;  4HAT B;  2J0J A;  3A8Q A;  3WYF B;  4NSW A;  2LKO A;  1UNR A;  3M1I B;  1BTN A;  2DN6 A;  2VRW B;  1WJ1 A;  1RJ2 A;  2COA A;  4D0N B;  3F0W A;  2DFK A;  1KZG A;  1WGQ A;  4HAU B;  3TW1 A;  2QKL A;  5C5B A;  3KZ1 A;  2I1K A;  4DXA B;  3FM8 C;  3G9W A;  2D9W A;  3WA0 A;  3PP2 A;  3SYX A;  2Z0Q A;  2QKM A;  2NZ8 B;  4KHO A;  4CHM A;  2GCL A;  2KGX B;  4A6F B;  2CY5 A;  1WVH A;  4C0A A;  3VIA A;  5D3Y A;  1NI2 A;  2ELA A;  2RGN B;  3AU4 A;  1X1F A;  3V5W A;  1XCG A;  1DDW A;  2RUK B;  4GXB A;  3UZT A;  1P3R A;  3LJU X;  4WSF A;  1FAO A;  2YSZ A;  5CLL B;  2LG1 A;  2ADZ A;  3HK0 A;  4HAW B;  1MKE A;  4EKU A;  1GC6 A;  2DA0 A;  4IFS A;  1LW3 A;  2CRF A;  2K2J A;  1FHW A;  1EAZ A;  1OMW A;  4KHB B;  3TVV A;  4IAP A;  5DH9 B;  3PEG A;  2EMS A;  3BJI A;  4PNK A;  1OQN A;  3DXC A;  1Z87 A;  2MKR A;  4K2P A;  2COF A;  2D4Q A;  1XX0 A;  3O96 A;  3MDB C;  1UPQ A;  3PVL A;  1MK9 B;  2YF0 A;  5DI9 B;  1NTV A;  2W2X D;  1UPR A;  1B55 A;  1EF1 A;  1DRO A;  1OY2 A;  1WG7 A;  2VKI A;  1M7R A;  4ZRJ A;  2DYN A;  2PZ1 A;  4EJN A;  3T06 A;  2AL6 A;  2P8V A;  3ML4 A;  3U7D A;  1FOE A;  4HAV B;  4HHV A;  1LB1 A;  3HW2 B;  5DHA B;  1WJM A;  4A5K A;  3CXB B;  3AJ4 A;  1U5G A;  3NSU A;  2Q13 A;  1J0W A;  1V88 A;  2Z0O A;  4MK0 A;  3TFM A;  2H7E A;  2ROV A;  5JP4 A;  2Z0P A;  2K2U A;  5JLJ B;  4K81 A;  3HQC A;  1V5U A;  1ISN A;  3KRW A;  1Q67 A;  4A6F A;  1EVH A;  4MY6 A;  5D3W A;  2M38 A;  2N23 A;  4HDO A;  1ZSQ A;  3U8Z A;  1X1G A;  3RCP A;  1MIZ B;  2DX1 A;  2IYB A;  1U5F A;  1DYN A;  2FJL A;  2LOZ A;  2DKQ A;  2E2X A;  2YS5 A;  1XD4 A;  1V5M A;  1U5D A;  1GG3 A;  1W1D A;  2H7D A;  2V76 A;  1DBH A;  5JHH A;  2K00 A;  1UNQ A;  3VOQ A;  2LOX A;  4B6H A;  2HTH B;  3P7Z A;  2DHK A;  4IOY X;  5D3V A;  1WGU A;  2W2X C;  2MDX A;  4F7U P;  2YS1 A;  1DDV A;  1W1G A;  3AU5 A;  5KQ4 A;  2MWN B;  2D9Z A;  4GMV A;  2COD A;  2YT1 A;  4PQ0 A;  3PZD A;  4Z2M B;  2YS3 A;  1PLS A;  2BCJ A;  1I7A A;  1I2H A;  1KZ7 A;  1P5T A;  5KCV A;  5LOP B;  2P0F A;  2CAY A;  3ODX A;  5DHF B;  5D3X A;  2NMB A;  2I1J A;  4XWX A;  2J59 M;  2Y7B A;  2D2Q A;  3GYO A;  1X05 A;  5LON B;  1Y5O A;  5HE2 A;  4Z2N A;  2D9X A;  2L2I A;  2OQB A;  1BAK A;  2DHI A;  2YRY A;  1U27 A;  2R09 A;  5EFX A;  2P0D A;  2L1C A;  4EMO A;  3BIN A;  5DIF B;  2P0H A;  1UNP A;  2MFQ A;  1K5G B;  5L81 A;  1H4R A;  3F5R A;  1MAI A;  2I5F A;  2RLO A;  4HAX B;  3SNH A; 
#chains in the Genus database with same CATH topology
 2XQN M;  2ZPY A;  1FHX A;  5HE0 A;  5GOW B;  4KAX B;  4HB2 B;  1V5P A;  2Y8F A;  1BWN A;  3TCA A;  1Y19 B;  1H10 A;  3FSS A;  4TKN A;  2ELB A;  4DX9 0;  3ODW A;  5D27 A;  1GC7 A;  3QBV B;  3NWF A;  1ZM0 A;  3ZDT A;  2UZR A;  3DXE A;  1IRS A;  2YT0 A;  4KHA A;  2DX5 A;  4K17 A;  3D8F A;  4WVF B;  2HE7 A;  1NU2 A;  4MT7 A;  1RRP B;  2J0M A;  3SV1 A;  4A6H A;  4F7H A;  1FGY A;  2Y8G A;  1MK7 B;  1KI1 B;  3GYP A;  3QWM A;  4HB4 B;  2RVB B;  1TXD A;  1QQG A;  2RSG A;  3NW8 A;  2R0D A;  1V61 A;  5LG4 B;  3A8P A;  4GN1 A;  1P6S A;  1PMS A;  1U5E A;  1W1H A;  4H8S A;  4HDQ A;  4Y94 A;  3FVC A;  1BTK A;  2W2W A;  2X18 A;  2Z4D A;  1E5W A;  4GZU A;  2LUL A;  4HB0 B;  1WI1 A;  1UEF A;  1ZC3 B;  4KHB A;  4GPT B;  4CYE A;  1U29 A;  4KVG B;  3KSY A;  1K5D B;  2R2Y A;  3KY9 A;  4HAY B;  3D8E A;  2CY4 A;  3SUZ A;  1X11 A;  1J19 A;  3A98 B;  2ROZ B;  5J3Q A;  1MI1 A;  3PVW A;  4HAZ B;  2D11 A;  2KUP A;  3D8D A;  1X86 A;  3PSC A;  4HSI A;  4GOU A;  3HSA A;  4GNK B;  2D9V A;  3CIK A;  1TJ6 A;  2D10 A;  3TO1 A;  3PG7 A;  2LYD A;  1AQC A;  5HE3 A;  4NY0 A;  3ZVR A;  3OHM B;  1PFJ A;  5C5B B;  4HB3 B;  3X23 A;  5C16 A;  2UZS A;  1ZC4 B;  4QJ4 B;  2VSZ A;  1DDM A;  2OTX A;  2DTC A;  3ODO A;  4F7G A;  4BBK A;  4DX8 A;  1M7E A;  5FI1 A;  4DBB A;  2DLW A;  2IFS A;  5C6R A;  2JP2 A;  4ZRI A;  2EJ8 A;  2ZKM X;  4GMX B;  2EMT A;  4K2O A;  2GS0 A;  3SO6 A;  1AWE A;  4OSN A;  1FHO A;  2M14 A;  4TYZ A;  4ZRK A;  2KCJ A;  2N0Y A;  3KRX A;  4YL8 A;  1U2B A;  3MPX A;  5J3Y A;  5JHG A;  4P7I A;  2AEH A;  2G35 A;  2DKP A;  2DYQ A;  1QC6 A;  3OAN A;  5KQ1 A;  2YVC A;  1SHC A;  3N7C A;  4CHJ A;  5C79 A;  1FGZ A;  2K49 A;  1XOD A;  2DHJ A;  1MPH A;  2Z14 A;  4OT1 A;  1FB8 A;  5FI0 A;  1N3H A;  1NTY A;  3DXD A;  1EGX A;  2FJU B;  1XR0 B;  3ULC A;  1MIX A;  2J0K A;  1XKE A;  2EC1 A;  2GJY A;  2I5C A;  2GCJ A;  4WJ7 A;  5CLQ B;  5I2M A;  4A6K A;  5HE1 A;  3PVU A;  2COC A;  4L6E A;  3HIE A;  3FEH A;  2RNR B;  2UVM A;  3P6A A;  3QIJ A;  1V89 A;  4QJ5 B;  1ZVR A;  4YON A;  1SGH A;  1TQZ A;  5J3T A;  3ULB A;  3IVF A;  2D9Y A;  4HAT B;  2J0J A;  3A8Q A;  3WYF B;  4NSW A;  2LKO A;  1UNR A;  3M1I B;  4L1R A;  1BTN A;  2DN6 A;  2VRW B;  1WJ1 A;  1RJ2 A;  2COA A;  2KIG A;  4D0N B;  3F0W A;  2DFK A;  2RRF A;  1KZG A;  1WGQ A;  4HAU B;  3TW1 A;  2QKL A;  5C5B A;  3KZ1 A;  3U12 A;  2I1K A;  4DXA B;  3FM8 C;  3G9W A;  2D9W A;  3WA0 A;  3PP2 A;  3SYX A;  2Z0Q A;  2QKM A;  2NZ8 B;  4KHO A;  4CHM A;  2GCL A;  2KGX B;  4A6F B;  2CY5 A;  1WVH A;  2K8E A;  4C0A A;  3VIA A;  5D3Y A;  1NI2 A;  4CSQ A;  1T77 A;  2ELA A;  2RGN B;  3AU4 A;  1X1F A;  3V5W A;  1XCG A;  1DDW A;  2RUK B;  4GXB A;  5IRS A;  3UZT A;  1P3R A;  3LJU X;  4WSF A;  1FAO A;  2YSZ A;  5CLL B;  3DCX A;  2LG1 A;  2GUM A;  2ADZ A;  3HK0 A;  4HAW B;  1MKE A;  4EKU A;  1GC6 A;  2DA0 A;  4IFS A;  1LW3 A;  2CRF A;  2K2J A;  2YT2 A;  1FHW A;  1EAZ A;  1OMW A;  4KHB B;  3TVV A;  4IAP A;  5DH9 B;  4D6W A;  3PEG A;  2EMS A;  3BJI A;  4PNK A;  1OQN A;  3A58 A;  3DXC A;  1Z87 A;  2MKR A;  4K2P A;  2COF A;  2D4Q A;  1XX0 A;  3O96 A;  3MDB C;  3NWD A;  1UPQ A;  3PVL A;  1MK9 B;  2YF0 A;  5DI9 B;  1NTV A;  2W2X D;  1UPR A;  1B55 A;  1EF1 A;  1DRO A;  1OY2 A;  1WG7 A;  2VKI A;  1M7R A;  4ZRJ A;  2DYN A;  2PZ1 A;  4EJN A;  3T06 A;  2AL6 A;  2P8V A;  3ML4 A;  3U7D A;  1FOE A;  4HAV B;  4HHV A;  1LB1 A;  3HW2 B;  5DHA B;  1WJM A;  4A5K A;  3CXB B;  3AJ4 A;  1U5G A;  2NBV A;  3NSU A;  2Q13 A;  1J0W A;  1V88 A;  2Z0O A;  4MK0 A;  3TFM A;  2H7E A;  2ROV A;  5JP4 A;  2Z59 A;  4QJ3 B;  2Z0P A;  2K2U A;  5JLJ B;  4K81 A;  3HQC A;  1V5U A;  1ISN A;  3KRW A;  1Q67 A;  4A6F A;  1EVH A;  4MY6 A;  5D3W A;  4QXA B;  2M38 A;  2N23 A;  4HDO A;  1ZSQ A;  3U8Z A;  1X1G A;  3RCP A;  1MIZ B;  2DX1 A;  2IYB A;  1U5F A;  1ZYI A;  1DYN A;  2FJL A;  2Z13 A;  2LOZ A;  2DKQ A;  2E2X A;  2YS5 A;  5I2S A;  1XD4 A;  1V5M A;  1U5D A;  1GG3 A;  1W1D A;  2H7D A;  2V76 A;  1DBH A;  5JHH A;  2K00 A;  2KR0 A;  1UNQ A;  3VOQ A;  2LOX A;  4B6H A;  2HTH B;  3P7Z A;  2DHK A;  4IOY X;  5D3V A;  1WGU A;  2W2X C;  2MDX A;  4F7U P;  2YS1 A;  1DDV A;  1W1G A;  3AU5 A;  5KQ4 A;  2MWN B;  2D9Z A;  4GMV A;  2COD A;  2YT1 A;  4PQ0 A;  3PZD A;  4Z2M B;  2YS3 A;  1PLS A;  2BCJ A;  1I7A A;  1I2H A;  1KZ7 A;  1P5T A;  5KCV A;  5LOP B;  2KUQ A;  3B77 A;  2P0F A;  2CAY A;  3ODX A;  5DHF B;  5D3X A;  2NMB A;  2I1J A;  4XWX A;  5M4Y B;  2J59 M;  2Y7B A;  2D2Q A;  3GYO A;  1X05 A;  5LON B;  1Y5O A;  5HE2 A;  4Z2N A;  2D9X A;  2L2I A;  2OQB A;  1BAK A;  2DHI A;  2YRY A;  1U27 A;  3NWA A;  2R09 A;  2KIE A;  5EFX A;  2P0D A;  2L1C A;  4EMO A;  3BIN A;  5DIF B;  2P0H A;  1UNP A;  2MFQ A;  1K5G B;  5L81 A;  1H4R A;  4DIX A;  3F5R A;  1MAI A;  2I5F A;  2RLO A;  4HAX B;  3SNH A; 
#chains in the Genus database with same CATH homology
 2XQN M;  2ZPY A;  1FHX A;  5HE0 A;  5GOW B;  4KAX B;  4HB2 B;  1V5P A;  2Y8F A;  1BWN A;  3TCA A;  1Y19 B;  1H10 A;  3FSS A;  4TKN A;  2ELB A;  4DX9 0;  3ODW A;  5D27 A;  1GC7 A;  3QBV B;  1ZM0 A;  3ZDT A;  2UZR A;  3DXE A;  1IRS A;  2YT0 A;  4KHA A;  2DX5 A;  4K17 A;  3D8F A;  4WVF B;  2HE7 A;  1NU2 A;  4MT7 A;  1RRP B;  2J0M A;  3SV1 A;  4A6H A;  4F7H A;  1FGY A;  2Y8G A;  1MK7 B;  1KI1 B;  3GYP A;  3QWM A;  4HB4 B;  2RVB B;  1TXD A;  1QQG A;  2RSG A;  2R0D A;  1V61 A;  3A8P A;  4GN1 A;  1P6S A;  1PMS A;  1U5E A;  1W1H A;  4H8S A;  4HDQ A;  4Y94 A;  1BTK A;  2W2W A;  2X18 A;  1E5W A;  4GZU A;  2LUL A;  4HB0 B;  1WI1 A;  1UEF A;  1ZC3 B;  4GPT B;  4CYE A;  1U29 A;  4KVG B;  3KSY A;  1K5D B;  4HAY B;  3KY9 A;  3D8E A;  2CY4 A;  3SUZ A;  1X11 A;  1J19 A;  3A98 B;  2ROZ B;  5J3Q A;  3PVW A;  4HAZ B;  2D11 A;  2KUP A;  3D8D A;  1X86 A;  3PSC A;  2D9V A;  3CIK A;  1TJ6 A;  2D10 A;  3TO1 A;  3PG7 A;  2LYD A;  1AQC A;  5HE3 A;  4NY0 A;  3ZVR A;  1PFJ A;  5C5B B;  4HB3 B;  3X23 A;  5C16 A;  2UZS A;  1ZC4 B;  1DDM A;  2VSZ A;  2OTX A;  2DTC A;  3ODO A;  4F7G A;  4BBK A;  4DX8 A;  1M7E A;  5FI1 A;  4DBB A;  2DLW A;  2IFS A;  5C6R A;  2JP2 A;  4ZRI A;  2EJ8 A;  4GMX B;  2EMT A;  4K2O A;  2GS0 A;  3SO6 A;  1AWE A;  1FHO A;  2M14 A;  4TYZ A;  4ZRK A;  2KCJ A;  2N0Y A;  3KRX A;  4YL8 A;  1U2B A;  3MPX A;  5J3Y A;  5JHG A;  4P7I A;  2AEH A;  2G35 A;  2DKP A;  2DYQ A;  1QC6 A;  3OAN A;  5KQ1 A;  2YVC A;  1SHC A;  3N7C A;  4CHJ A;  5C79 A;  1FGZ A;  1XOD A;  2DHJ A;  1MPH A;  1FB8 A;  5FI0 A;  1N3H A;  1NTY A;  3DXD A;  1EGX A;  1XR0 B;  3ULC A;  1MIX A;  2J0K A;  1XKE A;  2EC1 A;  2GJY A;  2I5C A;  2GCJ A;  4WJ7 A;  5CLQ B;  4A6K A;  5HE1 A;  3PVU A;  2COC A;  4L6E A;  3FEH A;  2RNR B;  2UVM A;  3P6A A;  3QIJ A;  1V89 A;  1ZVR A;  4YON A;  1SGH A;  1TQZ A;  5J3T A;  3ULB A;  3IVF A;  2D9Y A;  4HAT B;  2J0J A;  3A8Q A;  3WYF B;  4NSW A;  2LKO A;  1UNR A;  3M1I B;  1BTN A;  2DN6 A;  2VRW B;  1WJ1 A;  1RJ2 A;  2COA A;  4D0N B;  3F0W A;  2DFK A;  1KZG A;  1WGQ A;  4HAU B;  3TW1 A;  2QKL A;  5C5B A;  3KZ1 A;  2I1K A;  4DXA B;  3FM8 C;  3G9W A;  2D9W A;  3WA0 A;  3PP2 A;  3SYX A;  2Z0Q A;  2QKM A;  2NZ8 B;  4KHO A;  4CHM A;  2GCL A;  2KGX B;  4A6F B;  2CY5 A;  1WVH A;  4C0A A;  3VIA A;  5D3Y A;  1NI2 A;  2ELA A;  2RGN B;  3AU4 A;  1X1F A;  3V5W A;  1XCG A;  1DDW A;  2RUK B;  4GXB A;  3UZT A;  1P3R A;  3LJU X;  4WSF A;  1FAO A;  2YSZ A;  5CLL B;  2LG1 A;  2ADZ A;  3HK0 A;  4HAW B;  1MKE A;  4EKU A;  1GC6 A;  2DA0 A;  4IFS A;  1LW3 A;  2CRF A;  2K2J A;  1FHW A;  1EAZ A;  1OMW A;  4KHB B;  3TVV A;  4IAP A;  5DH9 B;  3PEG A;  2EMS A;  3BJI A;  4PNK A;  1OQN A;  3DXC A;  1Z87 A;  2MKR A;  4K2P A;  2COF A;  2D4Q A;  1XX0 A;  3O96 A;  3MDB C;  1UPQ A;  3PVL A;  1MK9 B;  2YF0 A;  5DI9 B;  1NTV A;  2W2X D;  1UPR A;  1B55 A;  1EF1 A;  1DRO A;  1OY2 A;  1WG7 A;  2VKI A;  1M7R A;  4ZRJ A;  2DYN A;  2PZ1 A;  4EJN A;  3T06 A;  2AL6 A;  2P8V A;  3ML4 A;  3U7D A;  1FOE A;  4HAV B;  4HHV A;  1LB1 A;  3HW2 B;  5DHA B;  1WJM A;  4A5K A;  3CXB B;  3AJ4 A;  1U5G A;  3NSU A;  2Q13 A;  1J0W A;  1V88 A;  2Z0O A;  4MK0 A;  3TFM A;  2H7E A;  2ROV A;  5JP4 A;  2Z0P A;  2K2U A;  5JLJ B;  4K81 A;  3HQC A;  1V5U A;  1ISN A;  3KRW A;  1Q67 A;  4A6F A;  1EVH A;  4MY6 A;  5D3W A;  2M38 A;  2N23 A;  4HDO A;  1ZSQ A;  3U8Z A;  1X1G A;  3RCP A;  1MIZ B;  2DX1 A;  2IYB A;  1U5F A;  1DYN A;  2FJL A;  2LOZ A;  2DKQ A;  2E2X A;  2YS5 A;  1XD4 A;  1V5M A;  1U5D A;  1GG3 A;  1W1D A;  2H7D A;  2V76 A;  1DBH A;  5JHH A;  2K00 A;  1UNQ A;  3VOQ A;  2LOX A;  4B6H A;  2HTH B;  3P7Z A;  2DHK A;  4IOY X;  5D3V A;  1WGU A;  2W2X C;  2MDX A;  4F7U P;  2YS1 A;  1DDV A;  1W1G A;  3AU5 A;  5KQ4 A;  2MWN B;  2D9Z A;  4GMV A;  2COD A;  2YT1 A;  4PQ0 A;  3PZD A;  4Z2M B;  2YS3 A;  1PLS A;  2BCJ A;  1I7A A;  1I2H A;  1KZ7 A;  1P5T A;  5KCV A;  5LOP B;  2P0F A;  2CAY A;  3ODX A;  5DHF B;  5D3X A;  2NMB A;  2I1J A;  4XWX A;  2J59 M;  2Y7B A;  2D2Q A;  3GYO A;  1X05 A;  5LON B;  1Y5O A;  5HE2 A;  4Z2N A;  2D9X A;  2L2I A;  2OQB A;  1BAK A;  2DHI A;  2YRY A;  1U27 A;  2R09 A;  5EFX A;  2P0D A;  2L1C A;  4EMO A;  3BIN A;  5DIF B;  2P0H A;  1UNP A;  2MFQ A;  1K5G B;  5L81 A;  1H4R A;  3F5R A;  1MAI A;  2I5F A;  2RLO A;  4HAX B;  3SNH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...