1DDWA

Homer evh1 domain unliganded
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
111
structure length
111
Chain Sequence
MGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINSTITPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Homer EVH1 domain-peptide complex reveals a new twist in polyproline recognition.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
molecule keywords GLGF-DOMAIN PROTEIN HOMER
total genus 21
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 1999-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1ddwA00
5J3TA 5C16A 4WJ7A 1Y5OA 5CLLB 5J3YA 4EKUA 2YRYA 4A6FB 2LKOA 1UNQA 2QKLA 2H7DA 1DROA 2M38A 4HB3B 1XR0B 3BINA 2DTCA 1BTKA 1WVHA 2YSZA 3A98B 2Z0PA 2ROZB 3DXCA 2UVMA 2Y8FA 3MDBC 1KI1B 2ADZA 2KCJA 1ISNA 2D11A 1I7AA 1TXDA 2RUKB 4NSWA 1FGZA 4Z2NA 3PZDA 3F0WA 4GPTB 5C5BB 2DHKA 2KGXB 1EGXA 1H10A 2DLWA 3KSYA 2LOXA 1ZSQA 2RSGA 2VRWB 1M7EA 3ODWA 2YT0A 3P6AA 4KHBB 1MK9B 4HATB 5JP4A 2AEHA 2D9ZA 5HE3A 4K17A 3FSSA 2YS3A 2KUPA 1TJ6A 3M1IB 1WJ1A 1Z87A 4MT7A 1EAZA 3PG7A 4HAXB 2J59M 5C79A 3TO1A 2CY4A 5LONB 1WG7A 1ZM0A 1KZGA 1MKEA 3FM8C 3KY9A 2EJ8A 2P0HA 3ODOA 3UZTA 1QQGA 3O96A 1X05A 4YONA 2XQNM 5CLQB 2ZPYA 4HAWB 2L2IA 5HE2A 2D9XA 3SV1A 1U5GA 2LULA 1FAOA 5GOWB 2D9WA 5HE0A 2NZ8B 2UZSA 1XCGA 1X1FA 2LYDA 2BCJA 4PQ0A 2Z0OA 1U2BA 1QC6A 4ZRJA 3WA0A 1EF1A 1UEFA 3TVVA 3U7DA 3U8ZA 2DKPA 1WGQA 2W2XC 5FI1A 2MFQA 2COFA 5KCVA 1N3HA 4EMOA 4A6FA 5L81A 5C5BA 3VOQA 4HB2B 2RVBB 1W1DA 1DBHA 3SO6A 2E2XA 1NTYA 1ZC4B 2X18A 1U5DA 4GMVA 2I5CA 4P7IA 4C0AA 3F5RA 3HW2B 1ZC3B 3SUZA 3A8QA 1LB1A 2I5FA 3T06A 4DBBA 1DDMA 3KZ1A 2JP2A 1GG3A 2LOZA 2YT1A 1PFJA 2K00A 1OQNA 2COAA 2VSZA 2CAYA 1FHXA 2J0KA 4XWXA 1MAIA 1X86A 1WGUA 5JHGA 3PEGA 1V88A 3CIKA 5LOPB 3V5WA 1DYNA 4CHJA 1FGYA 4KHAA 5HE1A 2RGNB 1UPRA 1SHCA 2G35A 1LW3A 4HAZB 1TQZA 1K5GB 4IAPA 1B55A 2ELBA 4A6HA 5D3YA 3D8FA 3PVUA 4A5KA 2FJLA 3RCPA 2UZRA 1OY2A 2IFSA 2H7EA 1V61A 4ZRKA 4MK0A 3HK0A 1P3RA 4D0NB 2DHJA 2Y7BA 2I1KA 2YF0A 4CYEA 1DDVA 3CXBB 1P5TA 3TW1A 1P6SA 4PNKA 2V76A 4GXBA 5D3WA 4H8SA 4DX8A 3SNHA 4HAVB 4F7GA 1BTNA 1V5MA 1GC6A 5DI9B 1Q67A 2M14A 1U5EA 2P0DA 4KAXB 5EFXA 4L6EA 2D9YA 2P0FA 1SGHA 4WVFB 1W1GA 2DN6A 5DIFB 2L1CA 2MWNB 3SYXA 4K2OA 3QIJA 2CODA 3D8EA 3VIAA 1X11A 1UNPA 2DKQA 4EJNA 1NTVA 1W1HA 3WYFB 1AQCA 2R0DA 1UNRA 4CHMA 3OANA 3AJ4A 1PMSA 3PVWA 4KVGB 2ROVA 1RJ2A 2PZ1A 5J3QA 3ML4A 3ULCA 2CRFA 1NI2A 5C6RA 4HHVA 1XODA 2OQBA 2DA0A 2CY5A 4B6HA 4HDQA 4NY0A 1ZVRA 2R09A 2VKIA 1MIXA 2D9VA 4WSFA 5FI0A 4HAUB 4Y94A 2NMBA 3TFMA 2D2QA 3QWMA 2D4QA 2DYQA 2J0MA 2YS5A 1AWEA 2AL6A 4GMXB 1J0WA 4DX90 1I2HA 3N7CA 4GZUA 3P7ZA 3X23A 3DXEA 1OMWA 2YS1A 3KRWA 1XD4A 2P8VA 4TKNA 3D8DA 5D3XA 2D10A 1MIZB 1WJMA 1H4RA 3TCAA 2LG1A 2RLOA 3ZVRA 4HB0B 1KZ7A 2W2XD 1EVHA 2GCLA 2J0JA 1BWNA 2N23A 5KQ1A 3FEHA 1X1GA 5D3VA 1DDWA 2EC1A 4K2PA 1V5UA 3PP2A 2RNRB 1BAKA 2N0YA 4TYZA 1WI1A 1FB8A 1MK7B 2QKMA 3G9WA 2YVCA 4A6KA 1MPHA 1XX0A 3LJUX 2I1JA 1M7RA 2K2JA 3IVFA 1RRPB 4YL8A 5KQ4A 3AU5A 3KRXA 2COCA 2Z0QA 2GJYA 3PVLA 4ZRIA 1V5PA 3HQCA 4GN1A 2MKRA 1U27A 4IOYX 2EMTA 5DHFB 5DH9B 3ODXA 2HTHB 2W2WA 4IFSA 2K2UA 2DHIA 4F7HA 4HAYB 2GCJA 4KHOA 1NU2A 5D27A 4BBKA 1FHOA 3PSCA 1IRSA 1U5FA 1UPQA 3AU4A 4F7UP 2MDXA 1Y19B 1V89A 3NSUA 2DFKA 4HB4B 1XKEA 3QBVB 4K81A 2Y8GA 3BJIA 1GC7A 1FOEA 5JHHA 2DYNA 3GYPA 2HE7A 3DXDA 4Z2MB 2GS0A 3ZDTA 1U29A 2EMSA 5DHAB 1PLSA 3A8PA 2DX1A 1E5WA 1FHWA 2OTXA 1J19A 2DX5A 2ELAA 2Q13A 1K5DB 3MPXA 2IYBA 4HDOA 4MY6A 5JLJB 3ULBA 4DXAB 3GYOA
chains in the Genus database with same CATH superfamily
5J3TA 5M4YB 5C16A 4WJ7A 1Y5OA 5CLLB 5J3YA 4EKUA 2YRYA 4A6FB 2LKOA 1UNQA 2QKLA 2H7DA 1DROA 2M38A 4HB3B 1XR0B 3NWFA 3BINA 2DTCA 1BTKA 1WVHA 2YSZA 3A98B 2Z0PA 2ROZB 3DXCA 2KUQA 2UVMA 2Y8FA 3MDBC 1KI1B 2ADZA 2KCJA 1ISNA 2D11A 4KHBA 1I7AA 1TXDA 2RUKB 4NSWA 4OT1A 1FGZA 4Z2NA 3PZDA 1MI1A 3F0WA 4GPTB 5C5BB 2DHKA 4QJ3B 2KGXB 1EGXA 1H10A 2DLWA 3KSYA 2LOXA 1ZSQA 2RSGA 2VRWB 1M7EA 3ODWA 2YT0A 3P6AA 4KHBB 1MK9B 4HATB 5JP4A 2AEHA 2D9ZA 5HE3A 4K17A 3FSSA 2YS3A 2KUPA 1TJ6A 3M1IB 1WJ1A 1Z87A 4MT7A 1EAZA 2K8EA 3PG7A 4HAXB 2J59M 5C79A 3TO1A 2CY4A 4L1RA 5LONB 1WG7A 1ZM0A 1KZGA 1MKEA 3FM8C 3KY9A 2EJ8A 2P0HA 3ODOA 3UZTA 1QQGA 3O96A 1X05A 4YONA 2XQNM 5IRSA 5CLQB 2ZPYA 4GOUA 4HAWB 2L2IA 5HE2A 2GUMA 2D9XA 3SV1A 1U5GA 2LULA 1FAOA 5GOWB 2D9WA 5HE0A 2NZ8B 2UZSA 1XCGA 1X1FA 2LYDA 3OHMB 2BCJA 4PQ0A 2Z0OA 1U2BA 1QC6A 4ZRJA 3WA0A 1EF1A 4GNKB 1UEFA 3TVVA 3U7DA 3U8ZA 2DKPA 1WGQA 2W2XC 5FI1A 2MFQA 2COFA 5KCVA 1N3HA 4EMOA 4A6FA 5L81A 5C5BA 3VOQA 2RVBB 4HB2B 1W1DA 1DBHA 3SO6A 2E2XA 1NTYA 2FJUB 1ZC4B 2X18A 2Z14A 1U5DA 4GMVA 2I5CA 4P7IA 4C0AA 3FVCA 3F5RA 3HW2B 1ZC3B 3SUZA 3A8QA 1LB1A 2I5FA 3T06A 4DBBA 1DDMA 3KZ1A 2JP2A 1GG3A 2LOZA 2YT1A 1PFJA 2K00A 1OQNA 2COAA 4HSIA 2VSZA 2Z13A 2CAYA 1FHXA 2J0KA 4XWXA 5LG4B 1MAIA 1X86A 1WGUA 4CSQA 5JHGA 3PEGA 1V88A 3CIKA 5LOPB 3V5WA 1DYNA 4CHJA 1FGYA 4KHAA 5HE1A 2RGNB 1UPRA 4OSNA 1SHCA 2G35A 4QJ5B 1LW3A 4HAZB 1TQZA 1K5GB 4IAPA 1ZYIA 1B55A 2ELBA 2Z59A 2K49A 4A6HA 5D3YA 3D8FA 3PVUA 4A5KA 2FJLA 3A58A 2KR0A 2UZRA 3RCPA 1OY2A 2IFSA 2H7EA 1V61A 3NW8A 4ZRKA 4MK0A 3HK0A 1P3RA 4D0NB 2DHJA 2Y7BA 2I1KA 2YF0A 4CYEA 1DDVA 3CXBB 1P5TA 3TW1A 1P6SA 4PNKA 2V76A 4GXBA 5D3WA 4H8SA 4DX8A 3SNHA 4HAVB 4F7GA 1BTNA 1V5MA 1T77A 1GC6A 5DI9B 1Q67A 2M14A 1U5EA 2P0DA 4KAXB 5EFXA 3DCXA 4L6EA 2D9YA 2P0FA 1SGHA 4WVFB 1W1GA 2DN6A 5DIFB 2L1CA 2MWNB 3SYXA 4K2OA 3QIJA 3B77A 2CODA 3D8EA 2NBVA 3VIAA 1X11A 1UNPA 2Z4DA 2DKQA 4EJNA 3NWAA 1NTVA 1W1HA 3WYFB 1AQCA 4DIXA 2R0DA 1UNRA 3NWDA 4CHMA 3OANA 3AJ4A 1PMSA 3PVWA 4KVGB 2ROVA 1RJ2A 2PZ1A 5J3QA 3ML4A 3ULCA 2CRFA 1NI2A 5C6RA 4HHVA 1XODA 2OQBA 2DA0A 2CY5A 4B6HA 4HDQA 4NY0A 1ZVRA 2R09A 2VKIA 1MIXA 2D9VA 4WSFA 5FI0A 4HAUB 4Y94A 2NMBA 3TFMA 2D2QA 3QWMA 2D4QA 2DYQA 2J0MA 2YS5A 1AWEA 2AL6A 4GMXB 1J0WA 4DX90 3N7CA 1I2HA 4GZUA 3P7ZA 3X23A 3DXEA 1OMWA 2KIEA 2YS1A 3KRWA 1XD4A 2P8VA 4TKNA 3D8DA 5D3XA 2D10A 1MIZB 1WJMA 1H4RA 3TCAA 2LG1A 2RLOA 4D6WA 3ZVRA 2YT2A 4HB0B 1KZ7A 2W2XD 1EVHA 2GCLA 2J0JA 1BWNA 2N23A 5KQ1A 2KIGA 3FEHA 1X1GA 5D3VA 1DDWA 2EC1A 2RRFA 4K2PA 1V5UA 3PP2A 2RNRB 1BAKA 2N0YA 4TYZA 1WI1A 1FB8A 1MK7B 2QKMA 3G9WA 2YVCA 4A6KA 3HSAA 1MPHA 1XX0A 3LJUX 2I1JA 1M7RA 2K2JA 3IVFA 1RRPB 4YL8A 5KQ4A 3AU5A 3KRXA 2COCA 5I2SA 2Z0QA 2GJYA 3PVLA 4ZRIA 2R2YA 1V5PA 3HQCA 4GN1A 2MKRA 1U27A 4IOYX 2EMTA 5DHFB 5DH9B 3ODXA 2HTHB 2W2WA 4IFSA 2K2UA 2DHIA 4F7HA 4HAYB 2GCJA 4KHOA 1NU2A 5D27A 4BBKA 1FHOA 3PSCA 1IRSA 1U5FA 1UPQA 3AU4A 4F7UP 2MDXA 1Y19B 1V89A 3NSUA 5I2MA 2DFKA 4HB4B 1XKEA 3QBVB 4K81A 2Y8GA 3BJIA 1GC7A 1FOEA 5JHHA 2DYNA 3GYPA 2HE7A 3DXDA 4Z2MB 2GS0A 3ZDTA 1U29A 2EMSA 5DHAB 1PLSA 3A8PA 2DX1A 1E5WA 4QJ4B 1FHWA 2OTXA 2ZKMX 1J19A 2DX5A 2ELAA 2Q13A 1K5DB 3U12A 3MPXA 2IYBA 4HDOA 3HIEA 4QXAB 4MY6A 5JLJB 3ULBA 4DXAB 3GYOA
chains in the Genus database with same CATH topology
5J3TA 5C16A 4WJ7A 1Y5OA 5CLLB 5J3YA 4EKUA 2YRYA 4A6FB 2LKOA 1UNQA 2QKLA 2H7DA 1DROA 2M38A 4HB3B 1XR0B 3BINA 2DTCA 1BTKA 1WVHA 2YSZA 3A98B 2Z0PA 2ROZB 3DXCA 2UVMA 2Y8FA 3MDBC 1KI1B 2ADZA 2KCJA 1ISNA 2D11A 1I7AA 1TXDA 2RUKB 4NSWA 1FGZA 4Z2NA 3PZDA 3F0WA 4GPTB 5C5BB 2DHKA 2KGXB 1EGXA 1H10A 2DLWA 3KSYA 2LOXA 1ZSQA 2RSGA 2VRWB 1M7EA 3ODWA 2YT0A 3P6AA 4KHBB 1MK9B 4HATB 5JP4A 2AEHA 2D9ZA 5HE3A 4K17A 3FSSA 2YS3A 2KUPA 1TJ6A 3M1IB 1WJ1A 1Z87A 4MT7A 1EAZA 3PG7A 4HAXB 2J59M 5C79A 3TO1A 2CY4A 5LONB 1WG7A 1ZM0A 1KZGA 1MKEA 3FM8C 3KY9A 2EJ8A 2P0HA 3ODOA 3UZTA 1QQGA 3O96A 1X05A 4YONA 2XQNM 5CLQB 2ZPYA 4HAWB 2L2IA 5HE2A 2D9XA 3SV1A 1U5GA 2LULA 1FAOA 5GOWB 2D9WA 5HE0A 2NZ8B 2UZSA 1XCGA 1X1FA 2LYDA 2BCJA 4PQ0A 2Z0OA 1U2BA 1QC6A 4ZRJA 3WA0A 1EF1A 1UEFA 3TVVA 3U7DA 3U8ZA 2DKPA 1WGQA 2W2XC 5FI1A 2MFQA 2COFA 5KCVA 1N3HA 4EMOA 4A6FA 5L81A 5C5BA 3VOQA 4HB2B 2RVBB 1W1DA 1DBHA 3SO6A 2E2XA 1NTYA 1ZC4B 2X18A 1U5DA 4GMVA 2I5CA 4P7IA 4C0AA 3F5RA 3HW2B 1ZC3B 3SUZA 3A8QA 1LB1A 2I5FA 3T06A 4DBBA 1DDMA 3KZ1A 2JP2A 1GG3A 2LOZA 2YT1A 1PFJA 2K00A 1OQNA 2COAA 2VSZA 2CAYA 1FHXA 2J0KA 4XWXA 1MAIA 1X86A 1WGUA 5JHGA 3PEGA 1V88A 3CIKA 5LOPB 3V5WA 1DYNA 4CHJA 1FGYA 4KHAA 5HE1A 2RGNB 1UPRA 1SHCA 2G35A 1LW3A 4HAZB 1TQZA 1K5GB 4IAPA 1B55A 2ELBA 4A6HA 5D3YA 3D8FA 3PVUA 4A5KA 2FJLA 3RCPA 2UZRA 1OY2A 2IFSA 2H7EA 1V61A 4ZRKA 4MK0A 3HK0A 1P3RA 4D0NB 2DHJA 2Y7BA 2I1KA 2YF0A 4CYEA 1DDVA 3CXBB 1P5TA 3TW1A 1P6SA 4PNKA 2V76A 4GXBA 5D3WA 4H8SA 4DX8A 3SNHA 4HAVB 4F7GA 1BTNA 1V5MA 1GC6A 5DI9B 1Q67A 2M14A 1U5EA 2P0DA 4KAXB 5EFXA 4L6EA 2D9YA 2P0FA 1SGHA 4WVFB 1W1GA 2DN6A 5DIFB 2L1CA 2MWNB 3SYXA 4K2OA 3QIJA 2CODA 3D8EA 3VIAA 1X11A 1UNPA 2DKQA 4EJNA 1NTVA 1W1HA 3WYFB 1AQCA 2R0DA 1UNRA 4CHMA 3OANA 3AJ4A 1PMSA 3PVWA 4KVGB 2ROVA 1RJ2A 2PZ1A 5J3QA 3ML4A 3ULCA 2CRFA 1NI2A 5C6RA 4HHVA 1XODA 2OQBA 2DA0A 2CY5A 4B6HA 4HDQA 4NY0A 1ZVRA 2R09A 2VKIA 1MIXA 2D9VA 4WSFA 5FI0A 4HAUB 4Y94A 2NMBA 3TFMA 2D2QA 3QWMA 2D4QA 2DYQA 2J0MA 2YS5A 1AWEA 2AL6A 4GMXB 1J0WA 4DX90 1I2HA 3N7CA 4GZUA 3P7ZA 3X23A 3DXEA 1OMWA 2YS1A 3KRWA 1XD4A 2P8VA 4TKNA 3D8DA 5D3XA 2D10A 1MIZB 1WJMA 1H4RA 3TCAA 2LG1A 2RLOA 3ZVRA 4HB0B 1KZ7A 2W2XD 1EVHA 2GCLA 2J0JA 1BWNA 2N23A 5KQ1A 3FEHA 1X1GA 5D3VA 1DDWA 2EC1A 4K2PA 1V5UA 3PP2A 2RNRB 1BAKA 2N0YA 4TYZA 1WI1A 1FB8A 1MK7B 2QKMA 3G9WA 2YVCA 4A6KA 1MPHA 1XX0A 3LJUX 2I1JA 1M7RA 2K2JA 3IVFA 1RRPB 4YL8A 5KQ4A 3AU5A 3KRXA 2COCA 2Z0QA 2GJYA 3PVLA 4ZRIA 1V5PA 3HQCA 4GN1A 2MKRA 1U27A 4IOYX 2EMTA 5DHFB 5DH9B 3ODXA 2HTHB 2W2WA 4IFSA 2K2UA 2DHIA 4F7HA 4HAYB 2GCJA 4KHOA 1NU2A 5D27A 4BBKA 1FHOA 3PSCA 1IRSA 1U5FA 1UPQA 3AU4A 4F7UP 2MDXA 1Y19B 1V89A 3NSUA 2DFKA 4HB4B 1XKEA 3QBVB 4K81A 2Y8GA 3BJIA 1GC7A 1FOEA 5JHHA 2DYNA 3GYPA 2HE7A 3DXDA 4Z2MB 2GS0A 3ZDTA 1U29A 2EMSA 5DHAB 1PLSA 3A8PA 2DX1A 1E5WA 1FHWA 2OTXA 1J19A 2DX5A 2ELAA 2Q13A 1K5DB 3MPXA 2IYBA 4HDOA 4MY6A 5JLJB 3ULBA 4DXAB 3GYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J3T A;  5C16 A;  4WJ7 A;  1Y5O A;  5CLL B;  5J3Y A;  4EKU A;  2YRY A;  4A6F B;  2LKO A;  1UNQ A;  2QKL A;  2H7D A;  1DRO A;  2M38 A;  4HB3 B;  1XR0 B;  3BIN A;  2DTC A;  1BTK A;  1WVH A;  2YSZ A;  3A98 B;  2Z0P A;  2ROZ B;  3DXC A;  2UVM A;  2Y8F A;  3MDB C;  1KI1 B;  2ADZ A;  2KCJ A;  1ISN A;  2D11 A;  1I7A A;  1TXD A;  2RUK B;  4NSW A;  1FGZ A;  4Z2N A;  3PZD A;  3F0W A;  4GPT B;  5C5B B;  2DHK A;  2KGX B;  1EGX A;  1H10 A;  2DLW A;  3KSY A;  2LOX A;  1ZSQ A;  2RSG A;  2VRW B;  1M7E A;  3ODW A;  2YT0 A;  3P6A A;  4KHB B;  1MK9 B;  4HAT B;  5JP4 A;  2AEH A;  2D9Z A;  5HE3 A;  4K17 A;  3FSS A;  2YS3 A;  2KUP A;  1TJ6 A;  3M1I B;  1WJ1 A;  1Z87 A;  4MT7 A;  1EAZ A;  3PG7 A;  4HAX B;  2J59 M;  5C79 A;  3TO1 A;  2CY4 A;  5LON B;  1WG7 A;  1ZM0 A;  1KZG A;  1MKE A;  3FM8 C;  3KY9 A;  2EJ8 A;  2P0H A;  3ODO A;  3UZT A;  1QQG A;  3O96 A;  1X05 A;  4YON A;  2XQN M;  5CLQ B;  2ZPY A;  4HAW B;  2L2I A;  5HE2 A;  2D9X A;  3SV1 A;  1U5G A;  2LUL A;  1FAO A;  5GOW B;  2D9W A;  5HE0 A;  2NZ8 B;  2UZS A;  1XCG A;  1X1F A;  2LYD A;  2BCJ A;  4PQ0 A;  2Z0O A;  1U2B A;  1QC6 A;  4ZRJ A;  3WA0 A;  1EF1 A;  1UEF A;  3TVV A;  3U7D A;  3U8Z A;  2DKP A;  1WGQ A;  2W2X C;  5FI1 A;  2MFQ A;  2COF A;  5KCV A;  1N3H A;  4EMO A;  4A6F A;  5L81 A;  5C5B A;  3VOQ A;  4HB2 B;  2RVB B;  1W1D A;  1DBH A;  3SO6 A;  2E2X A;  1NTY A;  1ZC4 B;  2X18 A;  1U5D A;  4GMV A;  2I5C A;  4P7I A;  4C0A A;  3F5R A;  3HW2 B;  1ZC3 B;  3SUZ A;  3A8Q A;  1LB1 A;  2I5F A;  3T06 A;  4DBB A;  1DDM A;  3KZ1 A;  2JP2 A;  1GG3 A;  2LOZ A;  2YT1 A;  1PFJ A;  2K00 A;  1OQN A;  2COA A;  2VSZ A;  2CAY A;  1FHX A;  2J0K A;  4XWX A;  1MAI A;  1X86 A;  1WGU A;  5JHG A;  3PEG A;  1V88 A;  3CIK A;  5LOP B;  3V5W A;  1DYN A;  4CHJ A;  1FGY A;  4KHA A;  5HE1 A;  2RGN B;  1UPR A;  1SHC A;  2G35 A;  1LW3 A;  4HAZ B;  1TQZ A;  1K5G B;  4IAP A;  1B55 A;  2ELB A;  4A6H A;  5D3Y A;  3D8F A;  3PVU A;  4A5K A;  2FJL A;  3RCP A;  2UZR A;  1OY2 A;  2IFS A;  2H7E A;  1V61 A;  4ZRK A;  4MK0 A;  3HK0 A;  1P3R A;  4D0N B;  2DHJ A;  2Y7B A;  2I1K A;  2YF0 A;  4CYE A;  1DDV A;  3CXB B;  1P5T A;  3TW1 A;  1P6S A;  4PNK A;  2V76 A;  4GXB A;  5D3W A;  4H8S A;  4DX8 A;  3SNH A;  4HAV B;  4F7G A;  1BTN A;  1V5M A;  1GC6 A;  5DI9 B;  1Q67 A;  2M14 A;  1U5E A;  2P0D A;  4KAX B;  5EFX A;  4L6E A;  2D9Y A;  2P0F A;  1SGH A;  4WVF B;  1W1G A;  2DN6 A;  5DIF B;  2L1C A;  2MWN B;  3SYX A;  4K2O A;  3QIJ A;  2COD A;  3D8E A;  3VIA A;  1X11 A;  1UNP A;  2DKQ A;  4EJN A;  1NTV A;  1W1H A;  3WYF B;  1AQC A;  2R0D A;  1UNR A;  4CHM A;  3OAN A;  3AJ4 A;  1PMS A;  3PVW A;  4KVG B;  2ROV A;  1RJ2 A;  2PZ1 A;  5J3Q A;  3ML4 A;  3ULC A;  2CRF A;  1NI2 A;  5C6R A;  4HHV A;  1XOD A;  2OQB A;  2DA0 A;  2CY5 A;  4B6H A;  4HDQ A;  4NY0 A;  1ZVR A;  2R09 A;  2VKI A;  1MIX A;  2D9V A;  4WSF A;  5FI0 A;  4HAU B;  4Y94 A;  2NMB A;  3TFM A;  2D2Q A;  3QWM A;  2D4Q A;  2DYQ A;  2J0M A;  2YS5 A;  1AWE A;  2AL6 A;  4GMX B;  1J0W A;  4DX9 0;  1I2H A;  3N7C A;  4GZU A;  3P7Z A;  3X23 A;  3DXE A;  1OMW A;  2YS1 A;  3KRW A;  1XD4 A;  2P8V A;  4TKN A;  3D8D A;  5D3X A;  2D10 A;  1MIZ B;  1WJM A;  1H4R A;  3TCA A;  2LG1 A;  2RLO A;  3ZVR A;  4HB0 B;  1KZ7 A;  2W2X D;  1EVH A;  2GCL A;  2J0J A;  1BWN A;  2N23 A;  5KQ1 A;  3FEH A;  1X1G A;  5D3V A;  1DDW A;  2EC1 A;  4K2P A;  1V5U A;  3PP2 A;  2RNR B;  1BAK A;  2N0Y A;  4TYZ A;  1WI1 A;  1FB8 A;  1MK7 B;  2QKM A;  3G9W A;  2YVC A;  4A6K A;  1MPH A;  1XX0 A;  3LJU X;  2I1J A;  1M7R A;  2K2J A;  3IVF A;  1RRP B;  4YL8 A;  5KQ4 A;  3AU5 A;  3KRX A;  2COC A;  2Z0Q A;  2GJY A;  3PVL A;  4ZRI A;  1V5P A;  3HQC A;  4GN1 A;  2MKR A;  1U27 A;  4IOY X;  2EMT A;  5DHF B;  5DH9 B;  3ODX A;  2HTH B;  2W2W A;  4IFS A;  2K2U A;  2DHI A;  4F7H A;  4HAY B;  2GCJ A;  4KHO A;  1NU2 A;  5D27 A;  4BBK A;  1FHO A;  3PSC A;  1IRS A;  1U5F A;  1UPQ A;  3AU4 A;  4F7U P;  2MDX A;  1Y19 B;  1V89 A;  3NSU A;  2DFK A;  4HB4 B;  1XKE A;  3QBV B;  4K81 A;  2Y8G A;  3BJI A;  1GC7 A;  1FOE A;  5JHH A;  2DYN A;  3GYP A;  2HE7 A;  3DXD A;  4Z2M B;  2GS0 A;  3ZDT A;  1U29 A;  2EMS A;  5DHA B;  1PLS A;  3A8P A;  2DX1 A;  1E5W A;  1FHW A;  2OTX A;  1J19 A;  2DX5 A;  2ELA A;  2Q13 A;  1K5D B;  3MPX A;  2IYB A;  4HDO A;  4MY6 A;  5JLJ B;  3ULB A;  4DXA B;  3GYO A; 
#chains in the Genus database with same CATH topology
 5J3T A;  5M4Y B;  5C16 A;  4WJ7 A;  1Y5O A;  5CLL B;  5J3Y A;  4EKU A;  2YRY A;  4A6F B;  2LKO A;  1UNQ A;  2QKL A;  2H7D A;  1DRO A;  2M38 A;  4HB3 B;  1XR0 B;  3NWF A;  3BIN A;  2DTC A;  1BTK A;  1WVH A;  2YSZ A;  3A98 B;  2Z0P A;  2ROZ B;  3DXC A;  2KUQ A;  2UVM A;  2Y8F A;  3MDB C;  1KI1 B;  2ADZ A;  2KCJ A;  1ISN A;  2D11 A;  4KHB A;  1I7A A;  1TXD A;  2RUK B;  4NSW A;  4OT1 A;  1FGZ A;  4Z2N A;  3PZD A;  1MI1 A;  3F0W A;  4GPT B;  5C5B B;  2DHK A;  4QJ3 B;  2KGX B;  1EGX A;  1H10 A;  2DLW A;  3KSY A;  2LOX A;  1ZSQ A;  2RSG A;  2VRW B;  1M7E A;  3ODW A;  2YT0 A;  3P6A A;  4KHB B;  1MK9 B;  4HAT B;  5JP4 A;  2AEH A;  2D9Z A;  5HE3 A;  4K17 A;  3FSS A;  2YS3 A;  2KUP A;  1TJ6 A;  3M1I B;  1WJ1 A;  1Z87 A;  4MT7 A;  1EAZ A;  2K8E A;  3PG7 A;  4HAX B;  2J59 M;  5C79 A;  3TO1 A;  2CY4 A;  4L1R A;  5LON B;  1WG7 A;  1ZM0 A;  1KZG A;  1MKE A;  3FM8 C;  3KY9 A;  2EJ8 A;  2P0H A;  3ODO A;  3UZT A;  1QQG A;  3O96 A;  1X05 A;  4YON A;  2XQN M;  5IRS A;  5CLQ B;  2ZPY A;  4GOU A;  4HAW B;  2L2I A;  5HE2 A;  2GUM A;  2D9X A;  3SV1 A;  1U5G A;  2LUL A;  1FAO A;  5GOW B;  2D9W A;  5HE0 A;  2NZ8 B;  2UZS A;  1XCG A;  1X1F A;  2LYD A;  3OHM B;  2BCJ A;  4PQ0 A;  2Z0O A;  1U2B A;  1QC6 A;  4ZRJ A;  3WA0 A;  1EF1 A;  4GNK B;  1UEF A;  3TVV A;  3U7D A;  3U8Z A;  2DKP A;  1WGQ A;  2W2X C;  5FI1 A;  2MFQ A;  2COF A;  5KCV A;  1N3H A;  4EMO A;  4A6F A;  5L81 A;  5C5B A;  3VOQ A;  2RVB B;  4HB2 B;  1W1D A;  1DBH A;  3SO6 A;  2E2X A;  1NTY A;  2FJU B;  1ZC4 B;  2X18 A;  2Z14 A;  1U5D A;  4GMV A;  2I5C A;  4P7I A;  4C0A A;  3FVC A;  3F5R A;  3HW2 B;  1ZC3 B;  3SUZ A;  3A8Q A;  1LB1 A;  2I5F A;  3T06 A;  4DBB A;  1DDM A;  3KZ1 A;  2JP2 A;  1GG3 A;  2LOZ A;  2YT1 A;  1PFJ A;  2K00 A;  1OQN A;  2COA A;  4HSI A;  2VSZ A;  2Z13 A;  2CAY A;  1FHX A;  2J0K A;  4XWX A;  5LG4 B;  1MAI A;  1X86 A;  1WGU A;  4CSQ A;  5JHG A;  3PEG A;  1V88 A;  3CIK A;  5LOP B;  3V5W A;  1DYN A;  4CHJ A;  1FGY A;  4KHA A;  5HE1 A;  2RGN B;  1UPR A;  4OSN A;  1SHC A;  2G35 A;  4QJ5 B;  1LW3 A;  4HAZ B;  1TQZ A;  1K5G B;  4IAP A;  1ZYI A;  1B55 A;  2ELB A;  2Z59 A;  2K49 A;  4A6H A;  5D3Y A;  3D8F A;  3PVU A;  4A5K A;  2FJL A;  3A58 A;  2KR0 A;  2UZR A;  3RCP A;  1OY2 A;  2IFS A;  2H7E A;  1V61 A;  3NW8 A;  4ZRK A;  4MK0 A;  3HK0 A;  1P3R A;  4D0N B;  2DHJ A;  2Y7B A;  2I1K A;  2YF0 A;  4CYE A;  1DDV A;  3CXB B;  1P5T A;  3TW1 A;  1P6S A;  4PNK A;  2V76 A;  4GXB A;  5D3W A;  4H8S A;  4DX8 A;  3SNH A;  4HAV B;  4F7G A;  1BTN A;  1V5M A;  1T77 A;  1GC6 A;  5DI9 B;  1Q67 A;  2M14 A;  1U5E A;  2P0D A;  4KAX B;  5EFX A;  3DCX A;  4L6E A;  2D9Y A;  2P0F A;  1SGH A;  4WVF B;  1W1G A;  2DN6 A;  5DIF B;  2L1C A;  2MWN B;  3SYX A;  4K2O A;  3QIJ A;  3B77 A;  2COD A;  3D8E A;  2NBV A;  3VIA A;  1X11 A;  1UNP A;  2Z4D A;  2DKQ A;  4EJN A;  3NWA A;  1NTV A;  1W1H A;  3WYF B;  1AQC A;  4DIX A;  2R0D A;  1UNR A;  3NWD A;  4CHM A;  3OAN A;  3AJ4 A;  1PMS A;  3PVW A;  4KVG B;  2ROV A;  1RJ2 A;  2PZ1 A;  5J3Q A;  3ML4 A;  3ULC A;  2CRF A;  1NI2 A;  5C6R A;  4HHV A;  1XOD A;  2OQB A;  2DA0 A;  2CY5 A;  4B6H A;  4HDQ A;  4NY0 A;  1ZVR A;  2R09 A;  2VKI A;  1MIX A;  2D9V A;  4WSF A;  5FI0 A;  4HAU B;  4Y94 A;  2NMB A;  3TFM A;  2D2Q A;  3QWM A;  2D4Q A;  2DYQ A;  2J0M A;  2YS5 A;  1AWE A;  2AL6 A;  4GMX B;  1J0W A;  4DX9 0;  3N7C A;  1I2H A;  4GZU A;  3P7Z A;  3X23 A;  3DXE A;  1OMW A;  2KIE A;  2YS1 A;  3KRW A;  1XD4 A;  2P8V A;  4TKN A;  3D8D A;  5D3X A;  2D10 A;  1MIZ B;  1WJM A;  1H4R A;  3TCA A;  2LG1 A;  2RLO A;  4D6W A;  3ZVR A;  2YT2 A;  4HB0 B;  1KZ7 A;  2W2X D;  1EVH A;  2GCL A;  2J0J A;  1BWN A;  2N23 A;  5KQ1 A;  2KIG A;  3FEH A;  1X1G A;  5D3V A;  1DDW A;  2EC1 A;  2RRF A;  4K2P A;  1V5U A;  3PP2 A;  2RNR B;  1BAK A;  2N0Y A;  4TYZ A;  1WI1 A;  1FB8 A;  1MK7 B;  2QKM A;  3G9W A;  2YVC A;  4A6K A;  3HSA A;  1MPH A;  1XX0 A;  3LJU X;  2I1J A;  1M7R A;  2K2J A;  3IVF A;  1RRP B;  4YL8 A;  5KQ4 A;  3AU5 A;  3KRX A;  2COC A;  5I2S A;  2Z0Q A;  2GJY A;  3PVL A;  4ZRI A;  2R2Y A;  1V5P A;  3HQC A;  4GN1 A;  2MKR A;  1U27 A;  4IOY X;  2EMT A;  5DHF B;  5DH9 B;  3ODX A;  2HTH B;  2W2W A;  4IFS A;  2K2U A;  2DHI A;  4F7H A;  4HAY B;  2GCJ A;  4KHO A;  1NU2 A;  5D27 A;  4BBK A;  1FHO A;  3PSC A;  1IRS A;  1U5F A;  1UPQ A;  3AU4 A;  4F7U P;  2MDX A;  1Y19 B;  1V89 A;  3NSU A;  5I2M A;  2DFK A;  4HB4 B;  1XKE A;  3QBV B;  4K81 A;  2Y8G A;  3BJI A;  1GC7 A;  1FOE A;  5JHH A;  2DYN A;  3GYP A;  2HE7 A;  3DXD A;  4Z2M B;  2GS0 A;  3ZDT A;  1U29 A;  2EMS A;  5DHA B;  1PLS A;  3A8P A;  2DX1 A;  1E5W A;  4QJ4 B;  1FHW A;  2OTX A;  2ZKM X;  1J19 A;  2DX5 A;  2ELA A;  2Q13 A;  1K5D B;  3U12 A;  3MPX A;  2IYB A;  4HDO A;  3HIE A;  4QXA B;  4MY6 A;  5JLJ B;  3ULB A;  4DXA B;  3GYO A; 
#chains in the Genus database with same CATH homology
 5J3T A;  5C16 A;  4WJ7 A;  1Y5O A;  5CLL B;  5J3Y A;  4EKU A;  2YRY A;  4A6F B;  2LKO A;  1UNQ A;  2QKL A;  2H7D A;  1DRO A;  2M38 A;  4HB3 B;  1XR0 B;  3BIN A;  2DTC A;  1BTK A;  1WVH A;  2YSZ A;  3A98 B;  2Z0P A;  2ROZ B;  3DXC A;  2UVM A;  2Y8F A;  3MDB C;  1KI1 B;  2ADZ A;  2KCJ A;  1ISN A;  2D11 A;  1I7A A;  1TXD A;  2RUK B;  4NSW A;  1FGZ A;  4Z2N A;  3PZD A;  3F0W A;  4GPT B;  5C5B B;  2DHK A;  2KGX B;  1EGX A;  1H10 A;  2DLW A;  3KSY A;  2LOX A;  1ZSQ A;  2RSG A;  2VRW B;  1M7E A;  3ODW A;  2YT0 A;  3P6A A;  4KHB B;  1MK9 B;  4HAT B;  5JP4 A;  2AEH A;  2D9Z A;  5HE3 A;  4K17 A;  3FSS A;  2YS3 A;  2KUP A;  1TJ6 A;  3M1I B;  1WJ1 A;  1Z87 A;  4MT7 A;  1EAZ A;  3PG7 A;  4HAX B;  2J59 M;  5C79 A;  3TO1 A;  2CY4 A;  5LON B;  1WG7 A;  1ZM0 A;  1KZG A;  1MKE A;  3FM8 C;  3KY9 A;  2EJ8 A;  2P0H A;  3ODO A;  3UZT A;  1QQG A;  3O96 A;  1X05 A;  4YON A;  2XQN M;  5CLQ B;  2ZPY A;  4HAW B;  2L2I A;  5HE2 A;  2D9X A;  3SV1 A;  1U5G A;  2LUL A;  1FAO A;  5GOW B;  2D9W A;  5HE0 A;  2NZ8 B;  2UZS A;  1XCG A;  1X1F A;  2LYD A;  2BCJ A;  4PQ0 A;  2Z0O A;  1U2B A;  1QC6 A;  4ZRJ A;  3WA0 A;  1EF1 A;  1UEF A;  3TVV A;  3U7D A;  3U8Z A;  2DKP A;  1WGQ A;  2W2X C;  5FI1 A;  2MFQ A;  2COF A;  5KCV A;  1N3H A;  4EMO A;  4A6F A;  5L81 A;  5C5B A;  3VOQ A;  4HB2 B;  2RVB B;  1W1D A;  1DBH A;  3SO6 A;  2E2X A;  1NTY A;  1ZC4 B;  2X18 A;  1U5D A;  4GMV A;  2I5C A;  4P7I A;  4C0A A;  3F5R A;  3HW2 B;  1ZC3 B;  3SUZ A;  3A8Q A;  1LB1 A;  2I5F A;  3T06 A;  4DBB A;  1DDM A;  3KZ1 A;  2JP2 A;  1GG3 A;  2LOZ A;  2YT1 A;  1PFJ A;  2K00 A;  1OQN A;  2COA A;  2VSZ A;  2CAY A;  1FHX A;  2J0K A;  4XWX A;  1MAI A;  1X86 A;  1WGU A;  5JHG A;  3PEG A;  1V88 A;  3CIK A;  5LOP B;  3V5W A;  1DYN A;  4CHJ A;  1FGY A;  4KHA A;  5HE1 A;  2RGN B;  1UPR A;  1SHC A;  2G35 A;  1LW3 A;  4HAZ B;  1TQZ A;  1K5G B;  4IAP A;  1B55 A;  2ELB A;  4A6H A;  5D3Y A;  3D8F A;  3PVU A;  4A5K A;  2FJL A;  3RCP A;  2UZR A;  1OY2 A;  2IFS A;  2H7E A;  1V61 A;  4ZRK A;  4MK0 A;  3HK0 A;  1P3R A;  4D0N B;  2DHJ A;  2Y7B A;  2I1K A;  2YF0 A;  4CYE A;  1DDV A;  3CXB B;  1P5T A;  3TW1 A;  1P6S A;  4PNK A;  2V76 A;  4GXB A;  5D3W A;  4H8S A;  4DX8 A;  3SNH A;  4HAV B;  4F7G A;  1BTN A;  1V5M A;  1GC6 A;  5DI9 B;  1Q67 A;  2M14 A;  1U5E A;  2P0D A;  4KAX B;  5EFX A;  4L6E A;  2D9Y A;  2P0F A;  1SGH A;  4WVF B;  1W1G A;  2DN6 A;  5DIF B;  2L1C A;  2MWN B;  3SYX A;  4K2O A;  3QIJ A;  2COD A;  3D8E A;  3VIA A;  1X11 A;  1UNP A;  2DKQ A;  4EJN A;  1NTV A;  1W1H A;  3WYF B;  1AQC A;  2R0D A;  1UNR A;  4CHM A;  3OAN A;  3AJ4 A;  1PMS A;  3PVW A;  4KVG B;  2ROV A;  1RJ2 A;  2PZ1 A;  5J3Q A;  3ML4 A;  3ULC A;  2CRF A;  1NI2 A;  5C6R A;  4HHV A;  1XOD A;  2OQB A;  2DA0 A;  2CY5 A;  4B6H A;  4HDQ A;  4NY0 A;  1ZVR A;  2R09 A;  2VKI A;  1MIX A;  2D9V A;  4WSF A;  5FI0 A;  4HAU B;  4Y94 A;  2NMB A;  3TFM A;  2D2Q A;  3QWM A;  2D4Q A;  2DYQ A;  2J0M A;  2YS5 A;  1AWE A;  2AL6 A;  4GMX B;  1J0W A;  4DX9 0;  1I2H A;  3N7C A;  4GZU A;  3P7Z A;  3X23 A;  3DXE A;  1OMW A;  2YS1 A;  3KRW A;  1XD4 A;  2P8V A;  4TKN A;  3D8D A;  5D3X A;  2D10 A;  1MIZ B;  1WJM A;  1H4R A;  3TCA A;  2LG1 A;  2RLO A;  3ZVR A;  4HB0 B;  1KZ7 A;  2W2X D;  1EVH A;  2GCL A;  2J0J A;  1BWN A;  2N23 A;  5KQ1 A;  3FEH A;  1X1G A;  5D3V A;  1DDW A;  2EC1 A;  4K2P A;  1V5U A;  3PP2 A;  2RNR B;  1BAK A;  2N0Y A;  4TYZ A;  1WI1 A;  1FB8 A;  1MK7 B;  2QKM A;  3G9W A;  2YVC A;  4A6K A;  1MPH A;  1XX0 A;  3LJU X;  2I1J A;  1M7R A;  2K2J A;  3IVF A;  1RRP B;  4YL8 A;  5KQ4 A;  3AU5 A;  3KRX A;  2COC A;  2Z0Q A;  2GJY A;  3PVL A;  4ZRI A;  1V5P A;  3HQC A;  4GN1 A;  2MKR A;  1U27 A;  4IOY X;  2EMT A;  5DHF B;  5DH9 B;  3ODX A;  2HTH B;  2W2W A;  4IFS A;  2K2U A;  2DHI A;  4F7H A;  4HAY B;  2GCJ A;  4KHO A;  1NU2 A;  5D27 A;  4BBK A;  1FHO A;  3PSC A;  1IRS A;  1U5F A;  1UPQ A;  3AU4 A;  4F7U P;  2MDX A;  1Y19 B;  1V89 A;  3NSU A;  2DFK A;  4HB4 B;  1XKE A;  3QBV B;  4K81 A;  2Y8G A;  3BJI A;  1GC7 A;  1FOE A;  5JHH A;  2DYN A;  3GYP A;  2HE7 A;  3DXD A;  4Z2M B;  2GS0 A;  3ZDT A;  1U29 A;  2EMS A;  5DHA B;  1PLS A;  3A8P A;  2DX1 A;  1E5W A;  1FHW A;  2OTX A;  1J19 A;  2DX5 A;  2ELA A;  2Q13 A;  1K5D B;  3MPX A;  2IYB A;  4HDO A;  4MY6 A;  5JLJ B;  3ULB A;  4DXA B;  3GYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...