1DDWA

Homer evh1 domain unliganded
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
111
structure length
111
Chain Sequence
MGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINSTITPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLGF-DOMAIN PROTEIN HOMER
publication title Structure of the Homer EVH1 domain-peptide complex reveals a new twist in polyproline recognition.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 21
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 1999-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1ddwA00
1ZC3B 1X86A 4NSWA 1WI1A 2OTXA 2RVBB 3PVUA 3A8PA 3GYOA 2KCJA 2PZ1A 1MAIA 2CY5A 3BINA 5D3YA 2COFA 2D9ZA 3VOQA 4PNKA 2IYBA 2RLOA 3HW2B 3TFMA 5C6RA 2OQBA 2DX5A 1XR0B 4XWXA 1FAOA 3T06A 3SNHA 1XD4A 3DXEA 1GC7A 1I2HA 1M7EA 1WVHA 3O96A 1V88A 1QQGA 2J0MA 2M14A 4YL8A 1OY2A 2L2IA 1IRSA 1X11A 2K2UA 4HAWB 1WGQA 1I7AA 2EMSA 1QC6A 2DLWA 2ELAA 4F7GA 3OANA 1K5DB 1MPHA 2KUPA 1LW3A 4TKNA 1U29A 2Y7BA 4K17A 1ZVRA 1V61A 4HATB 5DHAB 1KI1B 1OMWA 1BAKA 2COAA 1SHCA 1NTVA 1PLSA 1XKEA 2YSZA 4TYZA 1AQCA 3WYFB 2GCJA 1GC6A 4HDQA 4CHJA 2Z0QA 2HE7A 1TQZA 4HAXB 4GPTB 1FGYA 2LOZA 2ELBA 3ODWA 3KRWA 2H7DA 1DDMA 2YS5A 4DXAB 1V5MA 3DXCA 2CY4A 3FEHA 2RGNB 4PQ0A 4H8SA 3U8ZA 4KVGB 4ZRKA 3TO1A 2MWNB 4ZRIA 1MIZB 4GMXB 5FI0A 3ODOA 2DA0A 3HQCA 2I1KA 3BJIA 2ROVA 2LYDA 5J3TA 4GZUA 1P6SA 3PZDA 3VIAA 3DXDA 1UNRA 3X23A 1V5PA 3A98B 1X1FA 1RRPB 3CIKA 4A6HA 2D9VA 2DTCA 2VSZA 2AEHA 2D9XA 4Z2MB 1J0WA 3PP2A 2DKPA 2DFKA 1WGUA 2DX1A 2NZ8B 2W2WA 3SO6A 1DBHA 1UNPA 4P7IA 4IOYX 3SYXA 5D3VA 2EJ8A 1UPRA 1XX0A 2QKMA 3AJ4A 5DH9B 2DHJA 1OQNA 2I5CA 1DDVA 4DBBA 2I5FA 2AL6A 2RNRB 3QIJA 1XODA 4K81A 3F5RA 3QBVB 2ADZA 5D27A 1NU2A 1WJ1A 2P8VA 4HB4B 4Y94A 3TW1A 4KHBB 5LONB 2UZSA 2P0DA 4IAPA 5FI1A 2P0HA 1U27A 2N0YA 4A6FA 2CAYA 2K2JA 3P7ZA 3NSUA 4F7UP 3KRXA 2D4QA 2LOXA 2D10A 3ZDTA 1MK9B 3F0WA 2H7EA 4HAVB 1UEFA 2RUKB 2VKIA 4B6HA 2N23A 4HAZB 4DX8A 2UVMA 2V76A 2EMTA 3PSCA 1M7RA 2LG1A 2JP2A 5JLJB 1DDWA 3ULCA 3PEGA 1PFJA 4HB3B 5C5BA 4A6FB 4IFSA 1U2BA 3WA0A 3MPXA 3D8FA 3ODXA 5HE0A 4L6EA 1J19A 1X05A 1ISNA 3HK0A 4K2PA 2X18A 2D11A 2L1CA 2I1JA 2D2QA 3RCPA 2KGXB 1H4RA 1U5FA 1K5GB 4WSFA 4MY6A 2LULA 2MKRA 3GYPA 1NTYA 5EFXA 1LB1A 1TJ6A 4EJNA 4A5KA 1BTKA 4C0AA 2J59M 2DYQA 5C5BB 3ML4A 2YT1A 4KHOA 1BWNA 3FM8C 1P5TA 2ZPYA 1MIXA 1Y19B 1KZ7A 1AWEA 2D9WA 2ROZB 4NY0A 5DIFB 2GS0A 3D8DA 5KCVA 1P3RA 1PMSA 2HTHB 2FJLA 1BTNA 1W1GA 4EKUA 2Z0PA 2P0FA 2UZRA 3KY9A 2Q13A 2W2XC 1DYNA 2CRFA 2XQNM 3PG7A 1TXDA 3A8QA 2D9YA 1U5DA 1FHXA 2GCLA 1FOEA 4D0NB 3KSYA 2DHIA 1X1GA 2QKLA 3SUZA 1UNQA 1W1DA 5JHHA 2Y8GA 5HE3A 1EF1A 1MK7B 2E2XA 3FSSA 4MK0A 2R0DA 5HE2A 1FHWA 5C16A 3TCAA 2CODA 1B55A 1U5EA 4WVFB 5DI9B 2M38A 2G35A 4BBKA 1DROA 4KHAA 2Z0OA 4HAUB 4GXBA 3AU4A 2GJYA 2YT0A 1EGXA 1E5WA 3U7DA 4ZRJA 4CYEA 5LOPB 1Y5OA 2K00A 4HB2B 1Z87A 2IFSA 1H10A 1FB8A 1U5GA 2DHKA 2MDXA 2BCJA 2YVCA 1ZSQA 3ULBA 5D3XA 1WJMA 5JHGA 1KZGA 5J3YA 3ZVRA 1RJ2A 3AU5A 2NMBA 1EAZA 1WG7A 2COCA 5KQ1A 5JP4A 2MFQA 2YS1A 2YRYA 2RSGA 2LKOA 3LJUX 5L81A 3MDBC 3PVWA 3QWMA 4EMOA 5DHFB 2YS3A 5C79A 3IVFA 4WJ7A 5CLQB 2J0KA 2W2XD 1GG3A 3M1IB 1V89A 5CLLB 1ZM0A 3SV1A 2DN6A 4A6KA 4HHVA 3P6AA 1SGHA 5GOWB 3V5WA 2EC1A 2YF0A 3KZ1A 2J0JA 4K2OA 4GN1A 5KQ4A 1ZC4B 3PVLA 1FHOA 1MKEA 3CXBB 1N3HA 2DKQA 3UZTA 2R09A 4Z2NA 3TVVA 4CHMA 5D3WA 3D8EA 2Y8FA 1UPQA 1W1HA 1NI2A 4GMVA 1Q67A 3N7CA 4KAXB 5HE1A 4YONA 1EVHA 3G9WA 1FGZA 4HB0B 1XCGA 4HAYB 4MT7A 2DYNA 5J3QA 4DX90 4HDOA 4F7HA 2VRWB 1V5UA
chains in the Genus database with same CATH superfamily
1ZC3B 2ZKMX 1X86A 3U12A 2KIGA 2RRFA 4NSWA 1WI1A 2OTXA 2RVBB 3HSAA 3PVUA 3A8PA 3GYOA 2KCJA 2PZ1A 1MAIA 2CY5A 2FJUB 3BINA 5D3YA 2COFA 2D9ZA 3VOQA 2R2YA 4PNKA 2IYBA 2RLOA 3HW2B 3TFMA 5C6RA 2OQBA 2DX5A 1XR0B 4XWXA 1FAOA 3T06A 3SNHA 1XD4A 3DXEA 1GC7A 1I2HA 1M7EA 1WVHA 3O96A 2KIEA 2YT2A 3NWFA 1V88A 1QQGA 2J0MA 2M14A 4YL8A 1OY2A 4CSQA 2L2IA 1IRSA 1X11A 2K2UA 4HAWB 1WGQA 1I7AA 2EMSA 1QC6A 2DLWA 2ELAA 4F7GA 3OANA 1K5DB 1MPHA 2KUPA 1LW3A 4TKNA 1U29A 2Y7BA 4K17A 3B77A 4QJ4B 1ZVRA 1V61A 2GUMA 4HATB 5DHAB 5M4YB 1KI1B 1OMWA 1BAKA 2COAA 1SHCA 1NTVA 1PLSA 1XKEA 2YSZA 4TYZA 4GNKB 1AQCA 3WYFB 2GCJA 1GC6A 4HDQA 4CHJA 2Z0QA 2HE7A 1TQZA 4HAXB 4GPTB 1FGYA 2LOZA 5LG4B 2ELBA 3ODWA 3KRWA 2H7DA 1DDMA 2YS5A 4GOUA 4DXAB 1V5MA 3DXCA 2CY4A 3FEHA 2RGNB 4OT1A 4PQ0A 4H8SA 3U8ZA 4KVGB 4ZRKA 3TO1A 2MWNB 4ZRIA 1MIZB 4GMXB 5FI0A 3ODOA 2DA0A 3HQCA 2I1KA 3BJIA 2ROVA 2LYDA 5J3TA 4GZUA 1P6SA 3PZDA 3VIAA 3DXDA 1UNRA 3X23A 3HIEA 2KUQA 1V5PA 4L1RA 5I2SA 3A98B 1X1FA 1RRPB 3CIKA 4A6HA 2D9VA 2DTCA 2NBVA 2VSZA 2AEHA 2D9XA 4Z2MB 3NWDA 1J0WA 3PP2A 2DKPA 2DFKA 1WGUA 2DX1A 2NZ8B 2W2WA 3SO6A 4KHBA 1DBHA 1UNPA 4P7IA 4IOYX 3SYXA 5D3VA 2EJ8A 1MI1A 1UPRA 1XX0A 2QKMA 5I2MA 2Z13A 3AJ4A 5DH9B 2DHJA 1OQNA 2I5CA 1DDVA 4DBBA 2I5FA 2AL6A 2RNRB 2K49A 3QIJA 1XODA 3NW8A 4K81A 3F5RA 3QBVB 2ADZA 5D27A 1NU2A 1T77A 1WJ1A 2P8VA 4HB4B 4OSNA 4Y94A 3TW1A 4KHBB 5LONB 2UZSA 2P0DA 4IAPA 5FI1A 2P0HA 1U27A 2N0YA 4A6FA 2CAYA 2K2JA 3P7ZA 3NSUA 4F7UP 3KRXA 2D4QA 1ZYIA 2LOXA 2D10A 3ZDTA 1MK9B 3F0WA 2H7EA 4HAVB 1UEFA 2RUKB 2VKIA 4B6HA 2N23A 4HAZB 4DX8A 2UVMA 2V76A 2EMTA 3PSCA 1M7RA 2LG1A 2JP2A 3DCXA 5JLJB 1DDWA 3ULCA 3PEGA 1PFJA 4HB3B 5C5BA 4A6FB 4IFSA 1U2BA 3WA0A 3MPXA 3D8FA 3ODXA 5IRSA 5HE0A 4L6EA 1J19A 1X05A 1ISNA 3HK0A 4K2PA 2X18A 2D11A 2L1CA 2I1JA 2D2QA 3RCPA 2KGXB 1H4RA 1U5FA 1K5GB 4WSFA 4MY6A 2LULA 2Z59A 2MKRA 3NWAA 3GYPA 1NTYA 5EFXA 1LB1A 1TJ6A 4EJNA 4A5KA 1BTKA 4C0AA 2J59M 2DYQA 5C5BB 3ML4A 2YT1A 4KHOA 1BWNA 3FM8C 1P5TA 2ZPYA 1MIXA 1Y19B 1KZ7A 1AWEA 2D9WA 2ROZB 4NY0A 2K8EA 2Z4DA 5DIFB 2GS0A 3D8DA 5KCVA 1P3RA 1PMSA 2HTHB 2FJLA 1BTNA 1W1GA 4EKUA 2Z0PA 2P0FA 2UZRA 3KY9A 2Q13A 2W2XC 1DYNA 2CRFA 3A58A 2XQNM 3PG7A 2KR0A 1TXDA 3A8QA 2D9YA 1U5DA 1FHXA 2GCLA 1FOEA 4D0NB 3KSYA 2DHIA 1X1GA 2QKLA 3SUZA 1UNQA 1W1DA 5JHHA 2Y8GA 5HE3A 1EF1A 1MK7B 2E2XA 3FSSA 4MK0A 2R0DA 5HE2A 4DIXA 1FHWA 5C16A 3TCAA 2CODA 1B55A 1U5EA 4WVFB 5DI9B 2M38A 2G35A 4BBKA 1DROA 4KHAA 2Z0OA 4HAUB 4GXBA 3AU4A 2GJYA 3OHMB 2YT0A 1EGXA 1E5WA 3U7DA 4ZRJA 4CYEA 5LOPB 1Y5OA 2K00A 4HB2B 1Z87A 2IFSA 1H10A 1FB8A 1U5GA 2DHKA 2MDXA 2BCJA 4QXAB 2YVCA 4HSIA 1ZSQA 3ULBA 5D3XA 1WJMA 5JHGA 1KZGA 5J3YA 3ZVRA 1RJ2A 3AU5A 2NMBA 1EAZA 1WG7A 2COCA 5KQ1A 5JP4A 2MFQA 2YS1A 4QJ5B 2YRYA 2RSGA 4D6WA 2LKOA 3LJUX 5L81A 3MDBC 3PVWA 3QWMA 4EMOA 5DHFB 4QJ3B 2YS3A 5C79A 3IVFA 4WJ7A 5CLQB 2J0KA 2W2XD 1GG3A 3M1IB 1V89A 5CLLB 1ZM0A 3SV1A 2DN6A 4A6KA 4HHVA 3P6AA 1SGHA 5GOWB 3V5WA 2EC1A 2YF0A 3KZ1A 2J0JA 2Z14A 4GN1A 4K2OA 5KQ4A 1ZC4B 3PVLA 1FHOA 1MKEA 3CXBB 1N3HA 2DKQA 3UZTA 2R09A 4Z2NA 3TVVA 3FVCA 4CHMA 5D3WA 3D8EA 2Y8FA 1UPQA 1W1HA 1NI2A 4GMVA 1Q67A 3N7CA 4KAXB 5HE1A 4YONA 1EVHA 3G9WA 1FGZA 4HB0B 1XCGA 4HAYB 4MT7A 2DYNA 5J3QA 4DX90 4HDOA 4F7HA 2VRWB 1V5UA
chains in the Genus database with same CATH topology
1ZC3B 1X86A 4NSWA 1WI1A 2OTXA 2RVBB 3PVUA 3A8PA 3GYOA 2KCJA 2PZ1A 1MAIA 2CY5A 3BINA 5D3YA 2COFA 2D9ZA 3VOQA 4PNKA 2IYBA 2RLOA 3HW2B 3TFMA 5C6RA 2OQBA 2DX5A 1XR0B 4XWXA 1FAOA 3T06A 3SNHA 1XD4A 3DXEA 1GC7A 1I2HA 1M7EA 1WVHA 3O96A 1V88A 1QQGA 2J0MA 2M14A 4YL8A 1OY2A 2L2IA 1IRSA 1X11A 2K2UA 4HAWB 1WGQA 1I7AA 2EMSA 1QC6A 2DLWA 2ELAA 4F7GA 3OANA 1K5DB 1MPHA 2KUPA 1LW3A 4TKNA 1U29A 2Y7BA 4K17A 1ZVRA 1V61A 4HATB 5DHAB 1KI1B 1OMWA 1BAKA 2COAA 1SHCA 1NTVA 1PLSA 1XKEA 2YSZA 4TYZA 1AQCA 3WYFB 2GCJA 1GC6A 4HDQA 4CHJA 2Z0QA 2HE7A 1TQZA 4HAXB 4GPTB 1FGYA 2LOZA 2ELBA 3ODWA 3KRWA 2H7DA 1DDMA 2YS5A 4DXAB 1V5MA 3DXCA 2CY4A 3FEHA 2RGNB 4PQ0A 4H8SA 3U8ZA 4KVGB 4ZRKA 3TO1A 2MWNB 4ZRIA 1MIZB 4GMXB 5FI0A 3ODOA 2DA0A 3HQCA 2I1KA 3BJIA 2ROVA 2LYDA 5J3TA 4GZUA 1P6SA 3PZDA 3VIAA 3DXDA 1UNRA 3X23A 1V5PA 3A98B 1X1FA 1RRPB 3CIKA 4A6HA 2D9VA 2DTCA 2VSZA 2AEHA 2D9XA 4Z2MB 1J0WA 3PP2A 2DKPA 2DFKA 1WGUA 2DX1A 2NZ8B 2W2WA 3SO6A 1DBHA 1UNPA 4P7IA 4IOYX 3SYXA 5D3VA 2EJ8A 1UPRA 1XX0A 2QKMA 3AJ4A 5DH9B 2DHJA 1OQNA 2I5CA 1DDVA 4DBBA 2I5FA 2AL6A 2RNRB 3QIJA 1XODA 4K81A 3F5RA 3QBVB 2ADZA 5D27A 1NU2A 1WJ1A 2P8VA 4HB4B 4Y94A 3TW1A 4KHBB 5LONB 2UZSA 2P0DA 4IAPA 5FI1A 2P0HA 1U27A 2N0YA 4A6FA 2CAYA 2K2JA 3P7ZA 3NSUA 4F7UP 3KRXA 2D4QA 2LOXA 2D10A 3ZDTA 1MK9B 3F0WA 2H7EA 4HAVB 1UEFA 2RUKB 2VKIA 4B6HA 2N23A 4HAZB 4DX8A 2UVMA 2V76A 2EMTA 3PSCA 1M7RA 2LG1A 2JP2A 5JLJB 1DDWA 3ULCA 3PEGA 1PFJA 4HB3B 5C5BA 4A6FB 4IFSA 1U2BA 3WA0A 3MPXA 3D8FA 3ODXA 5HE0A 4L6EA 1J19A 1X05A 1ISNA 3HK0A 4K2PA 2X18A 2D11A 2L1CA 2I1JA 2D2QA 3RCPA 2KGXB 1H4RA 1U5FA 1K5GB 4WSFA 4MY6A 2LULA 2MKRA 3GYPA 1NTYA 5EFXA 1LB1A 1TJ6A 4EJNA 4A5KA 1BTKA 4C0AA 2J59M 2DYQA 5C5BB 3ML4A 2YT1A 4KHOA 1BWNA 3FM8C 1P5TA 2ZPYA 1MIXA 1Y19B 1KZ7A 1AWEA 2D9WA 2ROZB 4NY0A 5DIFB 2GS0A 3D8DA 5KCVA 1P3RA 1PMSA 2HTHB 2FJLA 1BTNA 1W1GA 4EKUA 2Z0PA 2P0FA 2UZRA 3KY9A 2Q13A 2W2XC 1DYNA 2CRFA 2XQNM 3PG7A 1TXDA 3A8QA 2D9YA 1U5DA 1FHXA 2GCLA 1FOEA 4D0NB 3KSYA 2DHIA 1X1GA 2QKLA 3SUZA 1UNQA 1W1DA 5JHHA 2Y8GA 5HE3A 1EF1A 1MK7B 2E2XA 3FSSA 4MK0A 2R0DA 5HE2A 1FHWA 5C16A 3TCAA 2CODA 1B55A 1U5EA 4WVFB 5DI9B 2M38A 2G35A 4BBKA 1DROA 4KHAA 2Z0OA 4HAUB 4GXBA 3AU4A 2GJYA 2YT0A 1EGXA 1E5WA 3U7DA 4ZRJA 4CYEA 5LOPB 1Y5OA 2K00A 4HB2B 1Z87A 2IFSA 1H10A 1FB8A 1U5GA 2DHKA 2MDXA 2BCJA 2YVCA 1ZSQA 3ULBA 5D3XA 1WJMA 5JHGA 1KZGA 5J3YA 3ZVRA 1RJ2A 3AU5A 2NMBA 1EAZA 1WG7A 2COCA 5KQ1A 5JP4A 2MFQA 2YS1A 2YRYA 2RSGA 2LKOA 3LJUX 5L81A 3MDBC 3PVWA 3QWMA 4EMOA 5DHFB 2YS3A 5C79A 3IVFA 4WJ7A 5CLQB 2J0KA 2W2XD 1GG3A 3M1IB 1V89A 5CLLB 1ZM0A 3SV1A 2DN6A 4A6KA 4HHVA 3P6AA 1SGHA 5GOWB 3V5WA 2EC1A 2YF0A 3KZ1A 2J0JA 4K2OA 4GN1A 5KQ4A 1ZC4B 3PVLA 1FHOA 1MKEA 3CXBB 1N3HA 2DKQA 3UZTA 2R09A 4Z2NA 3TVVA 4CHMA 5D3WA 3D8EA 2Y8FA 1UPQA 1W1HA 1NI2A 4GMVA 1Q67A 3N7CA 4KAXB 5HE1A 4YONA 1EVHA 3G9WA 1FGZA 4HB0B 1XCGA 4HAYB 4MT7A 2DYNA 5J3QA 4DX90 4HDOA 4F7HA 2VRWB 1V5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZC3 B;  1X86 A;  4NSW A;  1WI1 A;  2OTX A;  2RVB B;  3PVU A;  3A8P A;  3GYO A;  2KCJ A;  2PZ1 A;  1MAI A;  2CY5 A;  3BIN A;  5D3Y A;  2COF A;  2D9Z A;  3VOQ A;  4PNK A;  2IYB A;  2RLO A;  3HW2 B;  3TFM A;  5C6R A;  2OQB A;  2DX5 A;  1XR0 B;  4XWX A;  1FAO A;  3T06 A;  3SNH A;  1XD4 A;  3DXE A;  1GC7 A;  1I2H A;  1M7E A;  1WVH A;  3O96 A;  1V88 A;  1QQG A;  2J0M A;  2M14 A;  4YL8 A;  1OY2 A;  2L2I A;  1IRS A;  1X11 A;  2K2U A;  4HAW B;  1WGQ A;  1I7A A;  2EMS A;  1QC6 A;  2DLW A;  2ELA A;  4F7G A;  3OAN A;  1K5D B;  1MPH A;  2KUP A;  1LW3 A;  4TKN A;  1U29 A;  2Y7B A;  4K17 A;  1ZVR A;  1V61 A;  4HAT B;  5DHA B;  1KI1 B;  1OMW A;  1BAK A;  2COA A;  1SHC A;  1NTV A;  1PLS A;  1XKE A;  2YSZ A;  4TYZ A;  1AQC A;  3WYF B;  2GCJ A;  1GC6 A;  4HDQ A;  4CHJ A;  2Z0Q A;  2HE7 A;  1TQZ A;  4HAX B;  4GPT B;  1FGY A;  2LOZ A;  2ELB A;  3ODW A;  3KRW A;  2H7D A;  1DDM A;  2YS5 A;  4DXA B;  1V5M A;  3DXC A;  2CY4 A;  3FEH A;  2RGN B;  4PQ0 A;  4H8S A;  3U8Z A;  4KVG B;  4ZRK A;  3TO1 A;  2MWN B;  4ZRI A;  1MIZ B;  4GMX B;  5FI0 A;  3ODO A;  2DA0 A;  3HQC A;  2I1K A;  3BJI A;  2ROV A;  2LYD A;  5J3T A;  4GZU A;  1P6S A;  3PZD A;  3VIA A;  3DXD A;  1UNR A;  3X23 A;  1V5P A;  3A98 B;  1X1F A;  1RRP B;  3CIK A;  4A6H A;  2D9V A;  2DTC A;  2VSZ A;  2AEH A;  2D9X A;  4Z2M B;  1J0W A;  3PP2 A;  2DKP A;  2DFK A;  1WGU A;  2DX1 A;  2NZ8 B;  2W2W A;  3SO6 A;  1DBH A;  1UNP A;  4P7I A;  4IOY X;  3SYX A;  5D3V A;  2EJ8 A;  1UPR A;  1XX0 A;  2QKM A;  3AJ4 A;  5DH9 B;  2DHJ A;  1OQN A;  2I5C A;  1DDV A;  4DBB A;  2I5F A;  2AL6 A;  2RNR B;  3QIJ A;  1XOD A;  4K81 A;  3F5R A;  3QBV B;  2ADZ A;  5D27 A;  1NU2 A;  1WJ1 A;  2P8V A;  4HB4 B;  4Y94 A;  3TW1 A;  4KHB B;  5LON B;  2UZS A;  2P0D A;  4IAP A;  5FI1 A;  2P0H A;  1U27 A;  2N0Y A;  4A6F A;  2CAY A;  2K2J A;  3P7Z A;  3NSU A;  4F7U P;  3KRX A;  2D4Q A;  2LOX A;  2D10 A;  3ZDT A;  1MK9 B;  3F0W A;  2H7E A;  4HAV B;  1UEF A;  2RUK B;  2VKI A;  4B6H A;  2N23 A;  4HAZ B;  4DX8 A;  2UVM A;  2V76 A;  2EMT A;  3PSC A;  1M7R A;  2LG1 A;  2JP2 A;  5JLJ B;  1DDW A;  3ULC A;  3PEG A;  1PFJ A;  4HB3 B;  5C5B A;  4A6F B;  4IFS A;  1U2B A;  3WA0 A;  3MPX A;  3D8F A;  3ODX A;  5HE0 A;  4L6E A;  1J19 A;  1X05 A;  1ISN A;  3HK0 A;  4K2P A;  2X18 A;  2D11 A;  2L1C A;  2I1J A;  2D2Q A;  3RCP A;  2KGX B;  1H4R A;  1U5F A;  1K5G B;  4WSF A;  4MY6 A;  2LUL A;  2MKR A;  3GYP A;  1NTY A;  5EFX A;  1LB1 A;  1TJ6 A;  4EJN A;  4A5K A;  1BTK A;  4C0A A;  2J59 M;  2DYQ A;  5C5B B;  3ML4 A;  2YT1 A;  4KHO A;  1BWN A;  3FM8 C;  1P5T A;  2ZPY A;  1MIX A;  1Y19 B;  1KZ7 A;  1AWE A;  2D9W A;  2ROZ B;  4NY0 A;  5DIF B;  2GS0 A;  3D8D A;  5KCV A;  1P3R A;  1PMS A;  2HTH B;  2FJL A;  1BTN A;  1W1G A;  4EKU A;  2Z0P A;  2P0F A;  2UZR A;  3KY9 A;  2Q13 A;  2W2X C;  1DYN A;  2CRF A;  2XQN M;  3PG7 A;  1TXD A;  3A8Q A;  2D9Y A;  1U5D A;  1FHX A;  2GCL A;  1FOE A;  4D0N B;  3KSY A;  2DHI A;  1X1G A;  2QKL A;  3SUZ A;  1UNQ A;  1W1D A;  5JHH A;  2Y8G A;  5HE3 A;  1EF1 A;  1MK7 B;  2E2X A;  3FSS A;  4MK0 A;  2R0D A;  5HE2 A;  1FHW A;  5C16 A;  3TCA A;  2COD A;  1B55 A;  1U5E A;  4WVF B;  5DI9 B;  2M38 A;  2G35 A;  4BBK A;  1DRO A;  4KHA A;  2Z0O A;  4HAU B;  4GXB A;  3AU4 A;  2GJY A;  2YT0 A;  1EGX A;  1E5W A;  3U7D A;  4ZRJ A;  4CYE A;  5LOP B;  1Y5O A;  2K00 A;  4HB2 B;  1Z87 A;  2IFS A;  1H10 A;  1FB8 A;  1U5G A;  2DHK A;  2MDX A;  2BCJ A;  2YVC A;  1ZSQ A;  3ULB A;  5D3X A;  1WJM A;  5JHG A;  1KZG A;  5J3Y A;  3ZVR A;  1RJ2 A;  3AU5 A;  2NMB A;  1EAZ A;  1WG7 A;  2COC A;  5KQ1 A;  5JP4 A;  2MFQ A;  2YS1 A;  2YRY A;  2RSG A;  2LKO A;  3LJU X;  5L81 A;  3MDB C;  3PVW A;  3QWM A;  4EMO A;  5DHF B;  2YS3 A;  5C79 A;  3IVF A;  4WJ7 A;  5CLQ B;  2J0K A;  2W2X D;  1GG3 A;  3M1I B;  1V89 A;  5CLL B;  1ZM0 A;  3SV1 A;  2DN6 A;  4A6K A;  4HHV A;  3P6A A;  1SGH A;  5GOW B;  3V5W A;  2EC1 A;  2YF0 A;  3KZ1 A;  2J0J A;  4K2O A;  4GN1 A;  5KQ4 A;  1ZC4 B;  3PVL A;  1FHO A;  1MKE A;  3CXB B;  1N3H A;  2DKQ A;  3UZT A;  2R09 A;  4Z2N A;  3TVV A;  4CHM A;  5D3W A;  3D8E A;  2Y8F A;  1UPQ A;  1W1H A;  1NI2 A;  4GMV A;  1Q67 A;  3N7C A;  4KAX B;  5HE1 A;  4YON A;  1EVH A;  3G9W A;  1FGZ A;  4HB0 B;  1XCG A;  4HAY B;  4MT7 A;  2DYN A;  5J3Q A;  4DX9 0;  4HDO A;  4F7H A;  2VRW B;  1V5U A; 
#chains in the Genus database with same CATH topology
 1ZC3 B;  2ZKM X;  1X86 A;  3U12 A;  2KIG A;  2RRF A;  4NSW A;  1WI1 A;  2OTX A;  2RVB B;  3HSA A;  3PVU A;  3A8P A;  3GYO A;  2KCJ A;  2PZ1 A;  1MAI A;  2CY5 A;  2FJU B;  3BIN A;  5D3Y A;  2COF A;  2D9Z A;  3VOQ A;  2R2Y A;  4PNK A;  2IYB A;  2RLO A;  3HW2 B;  3TFM A;  5C6R A;  2OQB A;  2DX5 A;  1XR0 B;  4XWX A;  1FAO A;  3T06 A;  3SNH A;  1XD4 A;  3DXE A;  1GC7 A;  1I2H A;  1M7E A;  1WVH A;  3O96 A;  2KIE A;  2YT2 A;  3NWF A;  1V88 A;  1QQG A;  2J0M A;  2M14 A;  4YL8 A;  1OY2 A;  4CSQ A;  2L2I A;  1IRS A;  1X11 A;  2K2U A;  4HAW B;  1WGQ A;  1I7A A;  2EMS A;  1QC6 A;  2DLW A;  2ELA A;  4F7G A;  3OAN A;  1K5D B;  1MPH A;  2KUP A;  1LW3 A;  4TKN A;  1U29 A;  2Y7B A;  4K17 A;  3B77 A;  4QJ4 B;  1ZVR A;  1V61 A;  2GUM A;  4HAT B;  5DHA B;  5M4Y B;  1KI1 B;  1OMW A;  1BAK A;  2COA A;  1SHC A;  1NTV A;  1PLS A;  1XKE A;  2YSZ A;  4TYZ A;  4GNK B;  1AQC A;  3WYF B;  2GCJ A;  1GC6 A;  4HDQ A;  4CHJ A;  2Z0Q A;  2HE7 A;  1TQZ A;  4HAX B;  4GPT B;  1FGY A;  2LOZ A;  5LG4 B;  2ELB A;  3ODW A;  3KRW A;  2H7D A;  1DDM A;  2YS5 A;  4GOU A;  4DXA B;  1V5M A;  3DXC A;  2CY4 A;  3FEH A;  2RGN B;  4OT1 A;  4PQ0 A;  4H8S A;  3U8Z A;  4KVG B;  4ZRK A;  3TO1 A;  2MWN B;  4ZRI A;  1MIZ B;  4GMX B;  5FI0 A;  3ODO A;  2DA0 A;  3HQC A;  2I1K A;  3BJI A;  2ROV A;  2LYD A;  5J3T A;  4GZU A;  1P6S A;  3PZD A;  3VIA A;  3DXD A;  1UNR A;  3X23 A;  3HIE A;  2KUQ A;  1V5P A;  4L1R A;  5I2S A;  3A98 B;  1X1F A;  1RRP B;  3CIK A;  4A6H A;  2D9V A;  2DTC A;  2NBV A;  2VSZ A;  2AEH A;  2D9X A;  4Z2M B;  3NWD A;  1J0W A;  3PP2 A;  2DKP A;  2DFK A;  1WGU A;  2DX1 A;  2NZ8 B;  2W2W A;  3SO6 A;  4KHB A;  1DBH A;  1UNP A;  4P7I A;  4IOY X;  3SYX A;  5D3V A;  2EJ8 A;  1MI1 A;  1UPR A;  1XX0 A;  2QKM A;  5I2M A;  2Z13 A;  3AJ4 A;  5DH9 B;  2DHJ A;  1OQN A;  2I5C A;  1DDV A;  4DBB A;  2I5F A;  2AL6 A;  2RNR B;  2K49 A;  3QIJ A;  1XOD A;  3NW8 A;  4K81 A;  3F5R A;  3QBV B;  2ADZ A;  5D27 A;  1NU2 A;  1T77 A;  1WJ1 A;  2P8V A;  4HB4 B;  4OSN A;  4Y94 A;  3TW1 A;  4KHB B;  5LON B;  2UZS A;  2P0D A;  4IAP A;  5FI1 A;  2P0H A;  1U27 A;  2N0Y A;  4A6F A;  2CAY A;  2K2J A;  3P7Z A;  3NSU A;  4F7U P;  3KRX A;  2D4Q A;  1ZYI A;  2LOX A;  2D10 A;  3ZDT A;  1MK9 B;  3F0W A;  2H7E A;  4HAV B;  1UEF A;  2RUK B;  2VKI A;  4B6H A;  2N23 A;  4HAZ B;  4DX8 A;  2UVM A;  2V76 A;  2EMT A;  3PSC A;  1M7R A;  2LG1 A;  2JP2 A;  3DCX A;  5JLJ B;  1DDW A;  3ULC A;  3PEG A;  1PFJ A;  4HB3 B;  5C5B A;  4A6F B;  4IFS A;  1U2B A;  3WA0 A;  3MPX A;  3D8F A;  3ODX A;  5IRS A;  5HE0 A;  4L6E A;  1J19 A;  1X05 A;  1ISN A;  3HK0 A;  4K2P A;  2X18 A;  2D11 A;  2L1C A;  2I1J A;  2D2Q A;  3RCP A;  2KGX B;  1H4R A;  1U5F A;  1K5G B;  4WSF A;  4MY6 A;  2LUL A;  2Z59 A;  2MKR A;  3NWA A;  3GYP A;  1NTY A;  5EFX A;  1LB1 A;  1TJ6 A;  4EJN A;  4A5K A;  1BTK A;  4C0A A;  2J59 M;  2DYQ A;  5C5B B;  3ML4 A;  2YT1 A;  4KHO A;  1BWN A;  3FM8 C;  1P5T A;  2ZPY A;  1MIX A;  1Y19 B;  1KZ7 A;  1AWE A;  2D9W A;  2ROZ B;  4NY0 A;  2K8E A;  2Z4D A;  5DIF B;  2GS0 A;  3D8D A;  5KCV A;  1P3R A;  1PMS A;  2HTH B;  2FJL A;  1BTN A;  1W1G A;  4EKU A;  2Z0P A;  2P0F A;  2UZR A;  3KY9 A;  2Q13 A;  2W2X C;  1DYN A;  2CRF A;  3A58 A;  2XQN M;  3PG7 A;  2KR0 A;  1TXD A;  3A8Q A;  2D9Y A;  1U5D A;  1FHX A;  2GCL A;  1FOE A;  4D0N B;  3KSY A;  2DHI A;  1X1G A;  2QKL A;  3SUZ A;  1UNQ A;  1W1D A;  5JHH A;  2Y8G A;  5HE3 A;  1EF1 A;  1MK7 B;  2E2X A;  3FSS A;  4MK0 A;  2R0D A;  5HE2 A;  4DIX A;  1FHW A;  5C16 A;  3TCA A;  2COD A;  1B55 A;  1U5E A;  4WVF B;  5DI9 B;  2M38 A;  2G35 A;  4BBK A;  1DRO A;  4KHA A;  2Z0O A;  4HAU B;  4GXB A;  3AU4 A;  2GJY A;  3OHM B;  2YT0 A;  1EGX A;  1E5W A;  3U7D A;  4ZRJ A;  4CYE A;  5LOP B;  1Y5O A;  2K00 A;  4HB2 B;  1Z87 A;  2IFS A;  1H10 A;  1FB8 A;  1U5G A;  2DHK A;  2MDX A;  2BCJ A;  4QXA B;  2YVC A;  4HSI A;  1ZSQ A;  3ULB A;  5D3X A;  1WJM A;  5JHG A;  1KZG A;  5J3Y A;  3ZVR A;  1RJ2 A;  3AU5 A;  2NMB A;  1EAZ A;  1WG7 A;  2COC A;  5KQ1 A;  5JP4 A;  2MFQ A;  2YS1 A;  4QJ5 B;  2YRY A;  2RSG A;  4D6W A;  2LKO A;  3LJU X;  5L81 A;  3MDB C;  3PVW A;  3QWM A;  4EMO A;  5DHF B;  4QJ3 B;  2YS3 A;  5C79 A;  3IVF A;  4WJ7 A;  5CLQ B;  2J0K A;  2W2X D;  1GG3 A;  3M1I B;  1V89 A;  5CLL B;  1ZM0 A;  3SV1 A;  2DN6 A;  4A6K A;  4HHV A;  3P6A A;  1SGH A;  5GOW B;  3V5W A;  2EC1 A;  2YF0 A;  3KZ1 A;  2J0J A;  2Z14 A;  4GN1 A;  4K2O A;  5KQ4 A;  1ZC4 B;  3PVL A;  1FHO A;  1MKE A;  3CXB B;  1N3H A;  2DKQ A;  3UZT A;  2R09 A;  4Z2N A;  3TVV A;  3FVC A;  4CHM A;  5D3W A;  3D8E A;  2Y8F A;  1UPQ A;  1W1H A;  1NI2 A;  4GMV A;  1Q67 A;  3N7C A;  4KAX B;  5HE1 A;  4YON A;  1EVH A;  3G9W A;  1FGZ A;  4HB0 B;  1XCG A;  4HAY B;  4MT7 A;  2DYN A;  5J3Q A;  4DX9 0;  4HDO A;  4F7H A;  2VRW B;  1V5U A; 
#chains in the Genus database with same CATH homology
 1ZC3 B;  1X86 A;  4NSW A;  1WI1 A;  2OTX A;  2RVB B;  3PVU A;  3A8P A;  3GYO A;  2KCJ A;  2PZ1 A;  1MAI A;  2CY5 A;  3BIN A;  5D3Y A;  2COF A;  2D9Z A;  3VOQ A;  4PNK A;  2IYB A;  2RLO A;  3HW2 B;  3TFM A;  5C6R A;  2OQB A;  2DX5 A;  1XR0 B;  4XWX A;  1FAO A;  3T06 A;  3SNH A;  1XD4 A;  3DXE A;  1GC7 A;  1I2H A;  1M7E A;  1WVH A;  3O96 A;  1V88 A;  1QQG A;  2J0M A;  2M14 A;  4YL8 A;  1OY2 A;  2L2I A;  1IRS A;  1X11 A;  2K2U A;  4HAW B;  1WGQ A;  1I7A A;  2EMS A;  1QC6 A;  2DLW A;  2ELA A;  4F7G A;  3OAN A;  1K5D B;  1MPH A;  2KUP A;  1LW3 A;  4TKN A;  1U29 A;  2Y7B A;  4K17 A;  1ZVR A;  1V61 A;  4HAT B;  5DHA B;  1KI1 B;  1OMW A;  1BAK A;  2COA A;  1SHC A;  1NTV A;  1PLS A;  1XKE A;  2YSZ A;  4TYZ A;  1AQC A;  3WYF B;  2GCJ A;  1GC6 A;  4HDQ A;  4CHJ A;  2Z0Q A;  2HE7 A;  1TQZ A;  4HAX B;  4GPT B;  1FGY A;  2LOZ A;  2ELB A;  3ODW A;  3KRW A;  2H7D A;  1DDM A;  2YS5 A;  4DXA B;  1V5M A;  3DXC A;  2CY4 A;  3FEH A;  2RGN B;  4PQ0 A;  4H8S A;  3U8Z A;  4KVG B;  4ZRK A;  3TO1 A;  2MWN B;  4ZRI A;  1MIZ B;  4GMX B;  5FI0 A;  3ODO A;  2DA0 A;  3HQC A;  2I1K A;  3BJI A;  2ROV A;  2LYD A;  5J3T A;  4GZU A;  1P6S A;  3PZD A;  3VIA A;  3DXD A;  1UNR A;  3X23 A;  1V5P A;  3A98 B;  1X1F A;  1RRP B;  3CIK A;  4A6H A;  2D9V A;  2DTC A;  2VSZ A;  2AEH A;  2D9X A;  4Z2M B;  1J0W A;  3PP2 A;  2DKP A;  2DFK A;  1WGU A;  2DX1 A;  2NZ8 B;  2W2W A;  3SO6 A;  1DBH A;  1UNP A;  4P7I A;  4IOY X;  3SYX A;  5D3V A;  2EJ8 A;  1UPR A;  1XX0 A;  2QKM A;  3AJ4 A;  5DH9 B;  2DHJ A;  1OQN A;  2I5C A;  1DDV A;  4DBB A;  2I5F A;  2AL6 A;  2RNR B;  3QIJ A;  1XOD A;  4K81 A;  3F5R A;  3QBV B;  2ADZ A;  5D27 A;  1NU2 A;  1WJ1 A;  2P8V A;  4HB4 B;  4Y94 A;  3TW1 A;  4KHB B;  5LON B;  2UZS A;  2P0D A;  4IAP A;  5FI1 A;  2P0H A;  1U27 A;  2N0Y A;  4A6F A;  2CAY A;  2K2J A;  3P7Z A;  3NSU A;  4F7U P;  3KRX A;  2D4Q A;  2LOX A;  2D10 A;  3ZDT A;  1MK9 B;  3F0W A;  2H7E A;  4HAV B;  1UEF A;  2RUK B;  2VKI A;  4B6H A;  2N23 A;  4HAZ B;  4DX8 A;  2UVM A;  2V76 A;  2EMT A;  3PSC A;  1M7R A;  2LG1 A;  2JP2 A;  5JLJ B;  1DDW A;  3ULC A;  3PEG A;  1PFJ A;  4HB3 B;  5C5B A;  4A6F B;  4IFS A;  1U2B A;  3WA0 A;  3MPX A;  3D8F A;  3ODX A;  5HE0 A;  4L6E A;  1J19 A;  1X05 A;  1ISN A;  3HK0 A;  4K2P A;  2X18 A;  2D11 A;  2L1C A;  2I1J A;  2D2Q A;  3RCP A;  2KGX B;  1H4R A;  1U5F A;  1K5G B;  4WSF A;  4MY6 A;  2LUL A;  2MKR A;  3GYP A;  1NTY A;  5EFX A;  1LB1 A;  1TJ6 A;  4EJN A;  4A5K A;  1BTK A;  4C0A A;  2J59 M;  2DYQ A;  5C5B B;  3ML4 A;  2YT1 A;  4KHO A;  1BWN A;  3FM8 C;  1P5T A;  2ZPY A;  1MIX A;  1Y19 B;  1KZ7 A;  1AWE A;  2D9W A;  2ROZ B;  4NY0 A;  5DIF B;  2GS0 A;  3D8D A;  5KCV A;  1P3R A;  1PMS A;  2HTH B;  2FJL A;  1BTN A;  1W1G A;  4EKU A;  2Z0P A;  2P0F A;  2UZR A;  3KY9 A;  2Q13 A;  2W2X C;  1DYN A;  2CRF A;  2XQN M;  3PG7 A;  1TXD A;  3A8Q A;  2D9Y A;  1U5D A;  1FHX A;  2GCL A;  1FOE A;  4D0N B;  3KSY A;  2DHI A;  1X1G A;  2QKL A;  3SUZ A;  1UNQ A;  1W1D A;  5JHH A;  2Y8G A;  5HE3 A;  1EF1 A;  1MK7 B;  2E2X A;  3FSS A;  4MK0 A;  2R0D A;  5HE2 A;  1FHW A;  5C16 A;  3TCA A;  2COD A;  1B55 A;  1U5E A;  4WVF B;  5DI9 B;  2M38 A;  2G35 A;  4BBK A;  1DRO A;  4KHA A;  2Z0O A;  4HAU B;  4GXB A;  3AU4 A;  2GJY A;  2YT0 A;  1EGX A;  1E5W A;  3U7D A;  4ZRJ A;  4CYE A;  5LOP B;  1Y5O A;  2K00 A;  4HB2 B;  1Z87 A;  2IFS A;  1H10 A;  1FB8 A;  1U5G A;  2DHK A;  2MDX A;  2BCJ A;  2YVC A;  1ZSQ A;  3ULB A;  5D3X A;  1WJM A;  5JHG A;  1KZG A;  5J3Y A;  3ZVR A;  1RJ2 A;  3AU5 A;  2NMB A;  1EAZ A;  1WG7 A;  2COC A;  5KQ1 A;  5JP4 A;  2MFQ A;  2YS1 A;  2YRY A;  2RSG A;  2LKO A;  3LJU X;  5L81 A;  3MDB C;  3PVW A;  3QWM A;  4EMO A;  5DHF B;  2YS3 A;  5C79 A;  3IVF A;  4WJ7 A;  5CLQ B;  2J0K A;  2W2X D;  1GG3 A;  3M1I B;  1V89 A;  5CLL B;  1ZM0 A;  3SV1 A;  2DN6 A;  4A6K A;  4HHV A;  3P6A A;  1SGH A;  5GOW B;  3V5W A;  2EC1 A;  2YF0 A;  3KZ1 A;  2J0J A;  4K2O A;  4GN1 A;  5KQ4 A;  1ZC4 B;  3PVL A;  1FHO A;  1MKE A;  3CXB B;  1N3H A;  2DKQ A;  3UZT A;  2R09 A;  4Z2N A;  3TVV A;  4CHM A;  5D3W A;  3D8E A;  2Y8F A;  1UPQ A;  1W1H A;  1NI2 A;  4GMV A;  1Q67 A;  3N7C A;  4KAX B;  5HE1 A;  4YON A;  1EVH A;  3G9W A;  1FGZ A;  4HB0 B;  1XCG A;  4HAY B;  4MT7 A;  2DYN A;  5J3Q A;  4DX9 0;  4HDO A;  4F7H A;  2VRW B;  1V5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...