2CAYA

Vps36 n-terminal ph domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
132
structure length
132
Chain Sequence
HHMEYWHYVETTSSGQPLLREGEKDIFIDQSVGLYHGKSKILQRQRGRIFLTSQRIIYIDDAKPTQNSLGLELDDLAYVNYSSGFLTRSPRLILFFKDPSSSTEFVQLSFRKSDGVLFSQATERALENILTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport
molecule keywords VACUOLAR PROTEIN SORTING PROTEIN 36
publication title Escrt-I Core and Escrt-II Glue Domain Structures Reveal Role for Glue in Linking to Escrt-I and Membranes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 31
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11605 Vps36_ESCRT-II Vacuolar protein sorting protein 36 Vps36
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2cayA00
4CHMA 5D3VA 2YS1A 1QC6A 3ODXA 3A8QA 1OY2A 2OQBA 2LG1A 1DROA 3X23A 4HATB 3GYPA 5KQ4A 1GC7A 2VSZA 2K00A 1MK9B 3PZDA 5J3TA 3PEGA 4ZRJA 2J0KA 3NSUA 3PG7A 1X11A 1FB8A 2H7EA 3KSYA 4IAPA 2DLWA 2UZSA 4GMVA 3AJ4A 3G9WA 1MIXA 2D11A 2DKQA 2K2UA 4L6EA 2EMSA 5D27A 2E2XA 3P7ZA 2OTXA 1XCGA 4NSWA 2AEHA 3FSSA 3WA0A 3U8ZA 5KCVA 1AQCA 2DN6A 2KCJA 3SUZA 2X18A 2D9WA 3RCPA 1XKEA 2HTHB 4Y94A 5DH9B 2YT1A 1WJMA 5DI9B 1Y19B 2P0FA 1V5MA 3SNHA 2Q13A 2FJLA 2JP2A 1RJ2A 3WYFB 2CODA 2D4QA 3BINA 3ML4A 2DFKA 2YF0A 2QKLA 2P8VA 1WI1A 5HE2A 2I1JA 2CAYA 1FHWA 4HAXB 2GCJA 3HW2B 1EF1A 3PVLA 1H10A 2L1CA 1U5DA 3SYXA 3HK0A 1OQNA 4EMOA 5JHHA 2COFA 4BBKA 3ODOA 2LOXA 1U29A 3VOQA 5C5BB 1W1GA 3PVWA 1DDWA 4MK0A 2YRYA 1I2HA 1DDMA 4HDOA 1X05A 5J3QA 4KVGB 3CXBB 4IOYX 1XODA 2DX1A 4KHAA 1GG3A 2P0HA 2ELBA 1QQGA 1AWEA 4EKUA 2MWNB 4MY6A 1ZM0A 5DHAB 1PLSA 3PP2A 1FGYA 1MK7B 3GYOA 2I1KA 4KAXB 1ZC3B 1ZC4B 2EC1A 1PFJA 1BWNA 1BTNA 3D8EA 1KZGA 3KY9A 4K81A 1V61A 2IFSA 2LOZA 2CRFA 2Y8GA 1KZ7A 3QBVB 2ELAA 5C6RA 2DHIA 4HB2B 2PZ1A 4GN1A 1LB1A 2DTCA 2GS0A 2D9VA 2L2IA 1ZVRA 2YS3A 1RRPB 3P6AA 3A8PA 2IYBA 3F5RA 5HE3A 1DYNA 5HE0A 3A98B 2GJYA 1I7AA 2D2QA 2DYNA 5JHGA 4GXBA 2H7DA 2MDXA 2Y7BA 2W2XD 4HAVB 2NMBA 2DHKA 4HB3B 1TXDA 1BAKA 2I5FA 1EAZA 3OANA 1WGQA 3DXCA 1Q67A 1V88A 1X1GA 3F0WA 5GOWB 2ROZB 2Y8FA 4A6FB 3TCAA 4Z2MB 1XD4A 1K5DB 4DX90 2KGXB 5CLQB 1WG7A 1H4RA 3D8FA 1P3RA 1J0WA 1ISNA 2VRWB 3U7DA 2RLOA 3ULBA 2RVBB 3LJUX 2AL6A 1TQZA 3ZDTA 1J19A 4KHBB 1Z87A 1FOEA 1NTYA 1V89A 4IFSA 4NY0A 3TW1A 4HAYB 1XR0B 4ZRIA 1FHOA 2R09A 1MIZB 2R0DA 2J0JA 2K2JA 2ADZA 2DHJA 3TO1A 4HDQA 2YS5A 2I5CA 4WJ7A 1MKEA 3MPXA 5DHFB 3CIKA 4A6KA 5CLLB 2V76A 1X86A 3AU4A 4A5KA 1LW3A 2Z0QA 2D9ZA 4A6HA 5D3WA 4TKNA 4XWXA 3O96A 3BJIA 5C5BA 2D10A 4K17A 3PSCA 1N3HA 1EGXA 5EFXA 4P7IA 2NZ8B 2D9XA 1MAIA 2UZRA 4PQ0A 1V5UA 4F7GA 4B6HA 4GPTB 2RGNB 2EMTA 3KRXA 2Z0PA 2M38A 3V5WA 1WGUA 2W2XC 2QKMA 3MDBC 4C0AA 1WJ1A 1DDVA 1FHXA 1U5GA 1EVHA 3T06A 5D3YA 5KQ1A 3DXDA 2DX5A 2DA0A 5C79A 1WVHA 1UPRA 3HQCA 2LYDA 2P0DA 4D0NB 2Z0OA 4TYZA 2YVCA 3SO6A 1P5TA 4WSFA 4KHOA 1B55A 2N0YA 2MKRA 3FM8C 1U2BA 2M14A 1GC6A 4K2PA 4F7HA 1U27A 4GZUA 3FEHA 1PMSA 1NU2A 3D8DA 5L81A 2J0MA 4HAZB 1NTVA 1UNRA 1OMWA 1Y5OA 2BCJA 2YSZA 5LONB 2MFQA 3QWMA 4WVFB 2G35A 5LOPB 1W1HA 5C16A 2YT0A 1IRSA 1U5EA 2ZPYA 2W2WA 4YL8A 2J59M 2LKOA 4A6FA 4HAUB 1TJ6A 3ULCA 5DIFB 2N23A 4Z2NA 2XQNM 4CHJA 3UZTA 4CYEA 3DXEA 3KRWA 3ZVRA 1M7RA 3ODWA 2ROVA 2D9YA 2CY4A 4DX8A 3KZ1A 2EJ8A 3M1IB 3TFMA 4YONA 4F7UP 4HB4B 1MPHA 5D3XA 1UNQA 3VIAA 1U5FA 4H8SA 3TVVA 1E5WA 3AU5A 5HE1A 1SGHA 1KI1B 2COAA 2VKIA 4DBBA 4ZRKA 2RNRB 1FGZA 2GCLA 1SHCA 1UEFA 3N7CA 1BTKA 4EJNA 4HAWB 1NI2A 1UNPA 4MT7A 2CY5A 1XX0A 4GMXB 1FAOA 4HB0B 1M7EA 3PVUA 1DBHA 5FI1A 3QIJA 1K5GB 1W1DA 2COCA 4HHVA 1ZSQA 2KUPA 2RUKB 2RSGA 2UVMA 1V5PA 4K2OA 3IVFA 1UPQA 4DXAB 5JLJB 2DKPA 1P6SA 2HE7A 2DYQA 5JP4A 1X1FA 5FI0A 4PNKA 5J3YA 2LULA 3SV1A
chains in the Genus database with same CATH superfamily
4CHMA 5D3VA 2YS1A 1QC6A 3ODXA 3A8QA 1OY2A 2OQBA 2LG1A 1DROA 3X23A 2Z13A 4HATB 3GYPA 5KQ4A 1GC7A 2VSZA 2K00A 1MK9B 3PZDA 5J3TA 3PEGA 4ZRJA 2J0KA 3NSUA 3PG7A 1X11A 4OSNA 1FB8A 2H7EA 3KSYA 4IAPA 2DLWA 2UZSA 4GMVA 3AJ4A 3G9WA 1MIXA 4QJ4B 2D11A 2NBVA 2DKQA 2K2UA 4L6EA 2EMSA 5D27A 2E2XA 3P7ZA 2OTXA 1XCGA 4NSWA 2AEHA 3FSSA 3WA0A 3U8ZA 5KCVA 1AQCA 2DN6A 2KCJA 3SUZA 2X18A 2D9WA 3RCPA 3NW8A 4OT1A 1XKEA 2HTHB 4Y94A 5DH9B 5IRSA 2YT1A 1WJMA 5DI9B 2YT2A 1Y19B 2P0FA 1V5MA 3SNHA 2Q13A 2FJLA 2JP2A 1RJ2A 3OHMB 3WYFB 2CODA 2D4QA 3BINA 3ML4A 2DFKA 2YF0A 4L1RA 2QKLA 2P8VA 1WI1A 5HE2A 2I1JA 2CAYA 4GNKB 1FHWA 4HAXB 2KR0A 2GCJA 3HW2B 1EF1A 3PVLA 1H10A 2L1CA 5I2MA 1U5DA 2ZKMX 3SYXA 3HK0A 2K49A 1OQNA 4EMOA 5JHHA 2COFA 4BBKA 4HSIA 3ODOA 2LOXA 1U29A 3VOQA 5C5BB 1W1GA 3PVWA 1DDWA 4MK0A 2YRYA 1I2HA 1DDMA 4HDOA 1X05A 5J3QA 4KVGB 3CXBB 4IOYX 1XODA 2DX1A 4KHAA 1GG3A 2P0HA 2ELBA 1QQGA 2GUMA 1AWEA 4EKUA 2MWNB 4MY6A 1ZM0A 5DHAB 1PLSA 3PP2A 1FGYA 1MK7B 3GYOA 2I1KA 4KAXB 1ZC3B 1ZC4B 2EC1A 1PFJA 1BWNA 1BTNA 3D8EA 1KZGA 3KY9A 4K81A 1V61A 2IFSA 2LOZA 2CRFA 2Y8GA 1KZ7A 3QBVB 2ELAA 4QJ3B 5C6RA 2DHIA 4HB2B 2PZ1A 4GN1A 1LB1A 2DTCA 2GS0A 2D9VA 2L2IA 1ZVRA 2YS3A 1RRPB 3P6AA 3A8PA 2IYBA 3F5RA 2FJUB 5HE3A 1DYNA 5HE0A 3A98B 2GJYA 1I7AA 2D2QA 2DYNA 5JHGA 4GXBA 2H7DA 2MDXA 2Y7BA 2W2XD 4QJ5B 5LG4B 4HAVB 2NMBA 2DHKA 4HB3B 1TXDA 1BAKA 2I5FA 1EAZA 3OANA 1WGQA 3DXCA 1Q67A 1V88A 1X1GA 3F0WA 5GOWB 2ROZB 2Y8FA 4A6FB 3TCAA 4Z2MB 1XD4A 1K5DB 4DX90 2KGXB 5CLQB 2Z59A 1WG7A 1H4RA 1T77A 3D8FA 3FVCA 1P3RA 1J0WA 1ISNA 2VRWB 3U7DA 2RLOA 3ULBA 2RVBB 3LJUX 2AL6A 1TQZA 3ZDTA 1J19A 4KHBB 2RRFA 1Z87A 1FOEA 1NTYA 1V89A 4IFSA 4NY0A 3TW1A 4HAYB 1XR0B 4ZRIA 1FHOA 2R09A 1MIZB 2R0DA 2J0JA 2K2JA 2ADZA 2DHJA 3TO1A 4HDQA 2YS5A 2I5CA 4WJ7A 1MKEA 3MPXA 5DHFB 3CIKA 4A6KA 5CLLB 5M4YB 2V76A 1X86A 3AU4A 4A5KA 1LW3A 2Z0QA 2D9ZA 4A6HA 5D3WA 4TKNA 4XWXA 3O96A 3BJIA 5C5BA 2D10A 3DCXA 4K17A 3PSCA 1N3HA 1EGXA 5EFXA 3NWAA 4DIXA 4P7IA 2NZ8B 2D9XA 5I2SA 1MAIA 2UZRA 4PQ0A 1V5UA 4F7GA 4B6HA 2Z4DA 4GPTB 2RGNB 2EMTA 3KRXA 2Z0PA 2M38A 3V5WA 1WGUA 2W2XC 2QKMA 3MDBC 4C0AA 1WJ1A 1DDVA 2R2YA 1FHXA 1U5GA 1EVHA 3T06A 5D3YA 3B77A 5KQ1A 3DXDA 2DX5A 2DA0A 5C79A 1WVHA 3U12A 1UPRA 3HQCA 2LYDA 2KIGA 3NWDA 2P0DA 4D0NB 2Z0OA 4TYZA 2YVCA 3SO6A 1P5TA 4WSFA 4KHOA 1B55A 2N0YA 2MKRA 3FM8C 1U2BA 2M14A 1GC6A 4K2PA 4F7HA 1U27A 4GZUA 3FEHA 1PMSA 1NU2A 3D8DA 5L81A 2KUQA 2J0MA 4HAZB 1NTVA 1UNRA 1OMWA 1Y5OA 2BCJA 2YSZA 5LONB 2MFQA 3QWMA 4WVFB 2G35A 5LOPB 1W1HA 5C16A 2YT0A 3HSAA 1IRSA 1U5EA 2ZPYA 2W2WA 4YL8A 2Z14A 2J59M 2LKOA 4A6FA 4HAUB 1TJ6A 3ULCA 5DIFB 2N23A 3NWFA 4Z2NA 2XQNM 4CHJA 3UZTA 4CYEA 3DXEA 3KRWA 3ZVRA 1M7RA 3ODWA 2ROVA 2D9YA 2CY4A 3HIEA 4DX8A 3KZ1A 2EJ8A 4KHBA 3M1IB 3TFMA 4YONA 4F7UP 4HB4B 1MPHA 5D3XA 2KIEA 1UNQA 3VIAA 1U5FA 4H8SA 3TVVA 1E5WA 3AU5A 5HE1A 1SGHA 1KI1B 2COAA 2VKIA 4DBBA 4ZRKA 4D6WA 1ZYIA 2RNRB 3A58A 1FGZA 2GCLA 1SHCA 1UEFA 3N7CA 1BTKA 4EJNA 4HAWB 1NI2A 1UNPA 4MT7A 2CY5A 1XX0A 4GMXB 1FAOA 4HB0B 1M7EA 3PVUA 1DBHA 5FI1A 3QIJA 1K5GB 2K8EA 1W1DA 2COCA 4HHVA 1ZSQA 2KUPA 2RUKB 2RSGA 4QXAB 2UVMA 1V5PA 4K2OA 3IVFA 1UPQA 4DXAB 4CSQA 5JLJB 2DKPA 1P6SA 2HE7A 4GOUA 2DYQA 5JP4A 1X1FA 5FI0A 4PNKA 5J3YA 2LULA 3SV1A 1MI1A
chains in the Genus database with same CATH topology
4CHMA 5D3VA 2YS1A 1QC6A 3ODXA 3A8QA 1OY2A 2OQBA 2LG1A 1DROA 3X23A 4HATB 3GYPA 5KQ4A 1GC7A 2VSZA 2K00A 1MK9B 3PZDA 5J3TA 3PEGA 4ZRJA 2J0KA 3NSUA 3PG7A 1X11A 1FB8A 2H7EA 3KSYA 4IAPA 2DLWA 2UZSA 4GMVA 3AJ4A 3G9WA 1MIXA 2D11A 2DKQA 2K2UA 4L6EA 2EMSA 5D27A 2E2XA 3P7ZA 2OTXA 1XCGA 4NSWA 2AEHA 3FSSA 3WA0A 3U8ZA 5KCVA 1AQCA 2DN6A 2KCJA 3SUZA 2X18A 2D9WA 3RCPA 1XKEA 2HTHB 4Y94A 5DH9B 2YT1A 1WJMA 5DI9B 1Y19B 2P0FA 1V5MA 3SNHA 2Q13A 2FJLA 2JP2A 1RJ2A 3WYFB 2CODA 2D4QA 3BINA 3ML4A 2DFKA 2YF0A 2QKLA 2P8VA 1WI1A 5HE2A 2I1JA 2CAYA 1FHWA 4HAXB 2GCJA 3HW2B 1EF1A 3PVLA 1H10A 2L1CA 1U5DA 3SYXA 3HK0A 1OQNA 4EMOA 5JHHA 2COFA 4BBKA 3ODOA 2LOXA 1U29A 3VOQA 5C5BB 1W1GA 3PVWA 1DDWA 4MK0A 2YRYA 1I2HA 1DDMA 4HDOA 1X05A 5J3QA 4KVGB 3CXBB 4IOYX 1XODA 2DX1A 4KHAA 1GG3A 2P0HA 2ELBA 1QQGA 1AWEA 4EKUA 2MWNB 4MY6A 1ZM0A 5DHAB 1PLSA 3PP2A 1FGYA 1MK7B 3GYOA 2I1KA 4KAXB 1ZC3B 1ZC4B 2EC1A 1PFJA 1BWNA 1BTNA 3D8EA 1KZGA 3KY9A 4K81A 1V61A 2IFSA 2LOZA 2CRFA 2Y8GA 1KZ7A 3QBVB 2ELAA 5C6RA 2DHIA 4HB2B 2PZ1A 4GN1A 1LB1A 2DTCA 2GS0A 2D9VA 2L2IA 1ZVRA 2YS3A 1RRPB 3P6AA 3A8PA 2IYBA 3F5RA 5HE3A 1DYNA 5HE0A 3A98B 2GJYA 1I7AA 2D2QA 2DYNA 5JHGA 4GXBA 2H7DA 2MDXA 2Y7BA 2W2XD 4HAVB 2NMBA 2DHKA 4HB3B 1TXDA 1BAKA 2I5FA 1EAZA 3OANA 1WGQA 3DXCA 1Q67A 1V88A 1X1GA 3F0WA 5GOWB 2ROZB 2Y8FA 4A6FB 3TCAA 4Z2MB 1XD4A 1K5DB 4DX90 2KGXB 5CLQB 1WG7A 1H4RA 3D8FA 1P3RA 1J0WA 1ISNA 2VRWB 3U7DA 2RLOA 3ULBA 2RVBB 3LJUX 2AL6A 1TQZA 3ZDTA 1J19A 4KHBB 1Z87A 1FOEA 1NTYA 1V89A 4IFSA 4NY0A 3TW1A 4HAYB 1XR0B 4ZRIA 1FHOA 2R09A 1MIZB 2R0DA 2J0JA 2K2JA 2ADZA 2DHJA 3TO1A 4HDQA 2YS5A 2I5CA 4WJ7A 1MKEA 3MPXA 5DHFB 3CIKA 4A6KA 5CLLB 2V76A 1X86A 3AU4A 4A5KA 1LW3A 2Z0QA 2D9ZA 4A6HA 5D3WA 4TKNA 4XWXA 3O96A 3BJIA 5C5BA 2D10A 4K17A 3PSCA 1N3HA 1EGXA 5EFXA 4P7IA 2NZ8B 2D9XA 1MAIA 2UZRA 4PQ0A 1V5UA 4F7GA 4B6HA 4GPTB 2RGNB 2EMTA 3KRXA 2Z0PA 2M38A 3V5WA 1WGUA 2W2XC 2QKMA 3MDBC 4C0AA 1WJ1A 1DDVA 1FHXA 1U5GA 1EVHA 3T06A 5D3YA 5KQ1A 3DXDA 2DX5A 2DA0A 5C79A 1WVHA 1UPRA 3HQCA 2LYDA 2P0DA 4D0NB 2Z0OA 4TYZA 2YVCA 3SO6A 1P5TA 4WSFA 4KHOA 1B55A 2N0YA 2MKRA 3FM8C 1U2BA 2M14A 1GC6A 4K2PA 4F7HA 1U27A 4GZUA 3FEHA 1PMSA 1NU2A 3D8DA 5L81A 2J0MA 4HAZB 1NTVA 1UNRA 1OMWA 1Y5OA 2BCJA 2YSZA 5LONB 2MFQA 3QWMA 4WVFB 2G35A 5LOPB 1W1HA 5C16A 2YT0A 1IRSA 1U5EA 2ZPYA 2W2WA 4YL8A 2J59M 2LKOA 4A6FA 4HAUB 1TJ6A 3ULCA 5DIFB 2N23A 4Z2NA 2XQNM 4CHJA 3UZTA 4CYEA 3DXEA 3KRWA 3ZVRA 1M7RA 3ODWA 2ROVA 2D9YA 2CY4A 4DX8A 3KZ1A 2EJ8A 3M1IB 3TFMA 4YONA 4F7UP 4HB4B 1MPHA 5D3XA 1UNQA 3VIAA 1U5FA 4H8SA 3TVVA 1E5WA 3AU5A 5HE1A 1SGHA 1KI1B 2COAA 2VKIA 4DBBA 4ZRKA 2RNRB 1FGZA 2GCLA 1SHCA 1UEFA 3N7CA 1BTKA 4EJNA 4HAWB 1NI2A 1UNPA 4MT7A 2CY5A 1XX0A 4GMXB 1FAOA 4HB0B 1M7EA 3PVUA 1DBHA 5FI1A 3QIJA 1K5GB 1W1DA 2COCA 4HHVA 1ZSQA 2KUPA 2RUKB 2RSGA 2UVMA 1V5PA 4K2OA 3IVFA 1UPQA 4DXAB 5JLJB 2DKPA 1P6SA 2HE7A 2DYQA 5JP4A 1X1FA 5FI0A 4PNKA 5J3YA 2LULA 3SV1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CHM A;  5D3V A;  2YS1 A;  1QC6 A;  3ODX A;  3A8Q A;  1OY2 A;  2OQB A;  2LG1 A;  1DRO A;  3X23 A;  4HAT B;  3GYP A;  5KQ4 A;  1GC7 A;  2VSZ A;  2K00 A;  1MK9 B;  3PZD A;  5J3T A;  3PEG A;  4ZRJ A;  2J0K A;  3NSU A;  3PG7 A;  1X11 A;  1FB8 A;  2H7E A;  3KSY A;  4IAP A;  2DLW A;  2UZS A;  4GMV A;  3AJ4 A;  3G9W A;  1MIX A;  2D11 A;  2DKQ A;  2K2U A;  4L6E A;  2EMS A;  5D27 A;  2E2X A;  3P7Z A;  2OTX A;  1XCG A;  4NSW A;  2AEH A;  3FSS A;  3WA0 A;  3U8Z A;  5KCV A;  1AQC A;  2DN6 A;  2KCJ A;  3SUZ A;  2X18 A;  2D9W A;  3RCP A;  1XKE A;  2HTH B;  4Y94 A;  5DH9 B;  2YT1 A;  1WJM A;  5DI9 B;  1Y19 B;  2P0F A;  1V5M A;  3SNH A;  2Q13 A;  2FJL A;  2JP2 A;  1RJ2 A;  3WYF B;  2COD A;  2D4Q A;  3BIN A;  3ML4 A;  2DFK A;  2YF0 A;  2QKL A;  2P8V A;  1WI1 A;  5HE2 A;  2I1J A;  2CAY A;  1FHW A;  4HAX B;  2GCJ A;  3HW2 B;  1EF1 A;  3PVL A;  1H10 A;  2L1C A;  1U5D A;  3SYX A;  3HK0 A;  1OQN A;  4EMO A;  5JHH A;  2COF A;  4BBK A;  3ODO A;  2LOX A;  1U29 A;  3VOQ A;  5C5B B;  1W1G A;  3PVW A;  1DDW A;  4MK0 A;  2YRY A;  1I2H A;  1DDM A;  4HDO A;  1X05 A;  5J3Q A;  4KVG B;  3CXB B;  4IOY X;  1XOD A;  2DX1 A;  4KHA A;  1GG3 A;  2P0H A;  2ELB A;  1QQG A;  1AWE A;  4EKU A;  2MWN B;  4MY6 A;  1ZM0 A;  5DHA B;  1PLS A;  3PP2 A;  1FGY A;  1MK7 B;  3GYO A;  2I1K A;  4KAX B;  1ZC3 B;  1ZC4 B;  2EC1 A;  1PFJ A;  1BWN A;  1BTN A;  3D8E A;  1KZG A;  3KY9 A;  4K81 A;  1V61 A;  2IFS A;  2LOZ A;  2CRF A;  2Y8G A;  1KZ7 A;  3QBV B;  2ELA A;  5C6R A;  2DHI A;  4HB2 B;  2PZ1 A;  4GN1 A;  1LB1 A;  2DTC A;  2GS0 A;  2D9V A;  2L2I A;  1ZVR A;  2YS3 A;  1RRP B;  3P6A A;  3A8P A;  2IYB A;  3F5R A;  5HE3 A;  1DYN A;  5HE0 A;  3A98 B;  2GJY A;  1I7A A;  2D2Q A;  2DYN A;  5JHG A;  4GXB A;  2H7D A;  2MDX A;  2Y7B A;  2W2X D;  4HAV B;  2NMB A;  2DHK A;  4HB3 B;  1TXD A;  1BAK A;  2I5F A;  1EAZ A;  3OAN A;  1WGQ A;  3DXC A;  1Q67 A;  1V88 A;  1X1G A;  3F0W A;  5GOW B;  2ROZ B;  2Y8F A;  4A6F B;  3TCA A;  4Z2M B;  1XD4 A;  1K5D B;  4DX9 0;  2KGX B;  5CLQ B;  1WG7 A;  1H4R A;  3D8F A;  1P3R A;  1J0W A;  1ISN A;  2VRW B;  3U7D A;  2RLO A;  3ULB A;  2RVB B;  3LJU X;  2AL6 A;  1TQZ A;  3ZDT A;  1J19 A;  4KHB B;  1Z87 A;  1FOE A;  1NTY A;  1V89 A;  4IFS A;  4NY0 A;  3TW1 A;  4HAY B;  1XR0 B;  4ZRI A;  1FHO A;  2R09 A;  1MIZ B;  2R0D A;  2J0J A;  2K2J A;  2ADZ A;  2DHJ A;  3TO1 A;  4HDQ A;  2YS5 A;  2I5C A;  4WJ7 A;  1MKE A;  3MPX A;  5DHF B;  3CIK A;  4A6K A;  5CLL B;  2V76 A;  1X86 A;  3AU4 A;  4A5K A;  1LW3 A;  2Z0Q A;  2D9Z A;  4A6H A;  5D3W A;  4TKN A;  4XWX A;  3O96 A;  3BJI A;  5C5B A;  2D10 A;  4K17 A;  3PSC A;  1N3H A;  1EGX A;  5EFX A;  4P7I A;  2NZ8 B;  2D9X A;  1MAI A;  2UZR A;  4PQ0 A;  1V5U A;  4F7G A;  4B6H A;  4GPT B;  2RGN B;  2EMT A;  3KRX A;  2Z0P A;  2M38 A;  3V5W A;  1WGU A;  2W2X C;  2QKM A;  3MDB C;  4C0A A;  1WJ1 A;  1DDV A;  1FHX A;  1U5G A;  1EVH A;  3T06 A;  5D3Y A;  5KQ1 A;  3DXD A;  2DX5 A;  2DA0 A;  5C79 A;  1WVH A;  1UPR A;  3HQC A;  2LYD A;  2P0D A;  4D0N B;  2Z0O A;  4TYZ A;  2YVC A;  3SO6 A;  1P5T A;  4WSF A;  4KHO A;  1B55 A;  2N0Y A;  2MKR A;  3FM8 C;  1U2B A;  2M14 A;  1GC6 A;  4K2P A;  4F7H A;  1U27 A;  4GZU A;  3FEH A;  1PMS A;  1NU2 A;  3D8D A;  5L81 A;  2J0M A;  4HAZ B;  1NTV A;  1UNR A;  1OMW A;  1Y5O A;  2BCJ A;  2YSZ A;  5LON B;  2MFQ A;  3QWM A;  4WVF B;  2G35 A;  5LOP B;  1W1H A;  5C16 A;  2YT0 A;  1IRS A;  1U5E A;  2ZPY A;  2W2W A;  4YL8 A;  2J59 M;  2LKO A;  4A6F A;  4HAU B;  1TJ6 A;  3ULC A;  5DIF B;  2N23 A;  4Z2N A;  2XQN M;  4CHJ A;  3UZT A;  4CYE A;  3DXE A;  3KRW A;  3ZVR A;  1M7R A;  3ODW A;  2ROV A;  2D9Y A;  2CY4 A;  4DX8 A;  3KZ1 A;  2EJ8 A;  3M1I B;  3TFM A;  4YON A;  4F7U P;  4HB4 B;  1MPH A;  5D3X A;  1UNQ A;  3VIA A;  1U5F A;  4H8S A;  3TVV A;  1E5W A;  3AU5 A;  5HE1 A;  1SGH A;  1KI1 B;  2COA A;  2VKI A;  4DBB A;  4ZRK A;  2RNR B;  1FGZ A;  2GCL A;  1SHC A;  1UEF A;  3N7C A;  1BTK A;  4EJN A;  4HAW B;  1NI2 A;  1UNP A;  4MT7 A;  2CY5 A;  1XX0 A;  4GMX B;  1FAO A;  4HB0 B;  1M7E A;  3PVU A;  1DBH A;  5FI1 A;  3QIJ A;  1K5G B;  1W1D A;  2COC A;  4HHV A;  1ZSQ A;  2KUP A;  2RUK B;  2RSG A;  2UVM A;  1V5P A;  4K2O A;  3IVF A;  1UPQ A;  4DXA B;  5JLJ B;  2DKP A;  1P6S A;  2HE7 A;  2DYQ A;  5JP4 A;  1X1F A;  5FI0 A;  4PNK A;  5J3Y A;  2LUL A;  3SV1 A; 
#chains in the Genus database with same CATH topology
 4CHM A;  5D3V A;  2YS1 A;  1QC6 A;  3ODX A;  3A8Q A;  1OY2 A;  2OQB A;  2LG1 A;  1DRO A;  3X23 A;  2Z13 A;  4HAT B;  3GYP A;  5KQ4 A;  1GC7 A;  2VSZ A;  2K00 A;  1MK9 B;  3PZD A;  5J3T A;  3PEG A;  4ZRJ A;  2J0K A;  3NSU A;  3PG7 A;  1X11 A;  4OSN A;  1FB8 A;  2H7E A;  3KSY A;  4IAP A;  2DLW A;  2UZS A;  4GMV A;  3AJ4 A;  3G9W A;  1MIX A;  4QJ4 B;  2D11 A;  2NBV A;  2DKQ A;  2K2U A;  4L6E A;  2EMS A;  5D27 A;  2E2X A;  3P7Z A;  2OTX A;  1XCG A;  4NSW A;  2AEH A;  3FSS A;  3WA0 A;  3U8Z A;  5KCV A;  1AQC A;  2DN6 A;  2KCJ A;  3SUZ A;  2X18 A;  2D9W A;  3RCP A;  3NW8 A;  4OT1 A;  1XKE A;  2HTH B;  4Y94 A;  5DH9 B;  5IRS A;  2YT1 A;  1WJM A;  5DI9 B;  2YT2 A;  1Y19 B;  2P0F A;  1V5M A;  3SNH A;  2Q13 A;  2FJL A;  2JP2 A;  1RJ2 A;  3OHM B;  3WYF B;  2COD A;  2D4Q A;  3BIN A;  3ML4 A;  2DFK A;  2YF0 A;  4L1R A;  2QKL A;  2P8V A;  1WI1 A;  5HE2 A;  2I1J A;  2CAY A;  4GNK B;  1FHW A;  4HAX B;  2KR0 A;  2GCJ A;  3HW2 B;  1EF1 A;  3PVL A;  1H10 A;  2L1C A;  5I2M A;  1U5D A;  2ZKM X;  3SYX A;  3HK0 A;  2K49 A;  1OQN A;  4EMO A;  5JHH A;  2COF A;  4BBK A;  4HSI A;  3ODO A;  2LOX A;  1U29 A;  3VOQ A;  5C5B B;  1W1G A;  3PVW A;  1DDW A;  4MK0 A;  2YRY A;  1I2H A;  1DDM A;  4HDO A;  1X05 A;  5J3Q A;  4KVG B;  3CXB B;  4IOY X;  1XOD A;  2DX1 A;  4KHA A;  1GG3 A;  2P0H A;  2ELB A;  1QQG A;  2GUM A;  1AWE A;  4EKU A;  2MWN B;  4MY6 A;  1ZM0 A;  5DHA B;  1PLS A;  3PP2 A;  1FGY A;  1MK7 B;  3GYO A;  2I1K A;  4KAX B;  1ZC3 B;  1ZC4 B;  2EC1 A;  1PFJ A;  1BWN A;  1BTN A;  3D8E A;  1KZG A;  3KY9 A;  4K81 A;  1V61 A;  2IFS A;  2LOZ A;  2CRF A;  2Y8G A;  1KZ7 A;  3QBV B;  2ELA A;  4QJ3 B;  5C6R A;  2DHI A;  4HB2 B;  2PZ1 A;  4GN1 A;  1LB1 A;  2DTC A;  2GS0 A;  2D9V A;  2L2I A;  1ZVR A;  2YS3 A;  1RRP B;  3P6A A;  3A8P A;  2IYB A;  3F5R A;  2FJU B;  5HE3 A;  1DYN A;  5HE0 A;  3A98 B;  2GJY A;  1I7A A;  2D2Q A;  2DYN A;  5JHG A;  4GXB A;  2H7D A;  2MDX A;  2Y7B A;  2W2X D;  4QJ5 B;  5LG4 B;  4HAV B;  2NMB A;  2DHK A;  4HB3 B;  1TXD A;  1BAK A;  2I5F A;  1EAZ A;  3OAN A;  1WGQ A;  3DXC A;  1Q67 A;  1V88 A;  1X1G A;  3F0W A;  5GOW B;  2ROZ B;  2Y8F A;  4A6F B;  3TCA A;  4Z2M B;  1XD4 A;  1K5D B;  4DX9 0;  2KGX B;  5CLQ B;  2Z59 A;  1WG7 A;  1H4R A;  1T77 A;  3D8F A;  3FVC A;  1P3R A;  1J0W A;  1ISN A;  2VRW B;  3U7D A;  2RLO A;  3ULB A;  2RVB B;  3LJU X;  2AL6 A;  1TQZ A;  3ZDT A;  1J19 A;  4KHB B;  2RRF A;  1Z87 A;  1FOE A;  1NTY A;  1V89 A;  4IFS A;  4NY0 A;  3TW1 A;  4HAY B;  1XR0 B;  4ZRI A;  1FHO A;  2R09 A;  1MIZ B;  2R0D A;  2J0J A;  2K2J A;  2ADZ A;  2DHJ A;  3TO1 A;  4HDQ A;  2YS5 A;  2I5C A;  4WJ7 A;  1MKE A;  3MPX A;  5DHF B;  3CIK A;  4A6K A;  5CLL B;  5M4Y B;  2V76 A;  1X86 A;  3AU4 A;  4A5K A;  1LW3 A;  2Z0Q A;  2D9Z A;  4A6H A;  5D3W A;  4TKN A;  4XWX A;  3O96 A;  3BJI A;  5C5B A;  2D10 A;  3DCX A;  4K17 A;  3PSC A;  1N3H A;  1EGX A;  5EFX A;  3NWA A;  4DIX A;  4P7I A;  2NZ8 B;  2D9X A;  5I2S A;  1MAI A;  2UZR A;  4PQ0 A;  1V5U A;  4F7G A;  4B6H A;  2Z4D A;  4GPT B;  2RGN B;  2EMT A;  3KRX A;  2Z0P A;  2M38 A;  3V5W A;  1WGU A;  2W2X C;  2QKM A;  3MDB C;  4C0A A;  1WJ1 A;  1DDV A;  2R2Y A;  1FHX A;  1U5G A;  1EVH A;  3T06 A;  5D3Y A;  3B77 A;  5KQ1 A;  3DXD A;  2DX5 A;  2DA0 A;  5C79 A;  1WVH A;  3U12 A;  1UPR A;  3HQC A;  2LYD A;  2KIG A;  3NWD A;  2P0D A;  4D0N B;  2Z0O A;  4TYZ A;  2YVC A;  3SO6 A;  1P5T A;  4WSF A;  4KHO A;  1B55 A;  2N0Y A;  2MKR A;  3FM8 C;  1U2B A;  2M14 A;  1GC6 A;  4K2P A;  4F7H A;  1U27 A;  4GZU A;  3FEH A;  1PMS A;  1NU2 A;  3D8D A;  5L81 A;  2KUQ A;  2J0M A;  4HAZ B;  1NTV A;  1UNR A;  1OMW A;  1Y5O A;  2BCJ A;  2YSZ A;  5LON B;  2MFQ A;  3QWM A;  4WVF B;  2G35 A;  5LOP B;  1W1H A;  5C16 A;  2YT0 A;  3HSA A;  1IRS A;  1U5E A;  2ZPY A;  2W2W A;  4YL8 A;  2Z14 A;  2J59 M;  2LKO A;  4A6F A;  4HAU B;  1TJ6 A;  3ULC A;  5DIF B;  2N23 A;  3NWF A;  4Z2N A;  2XQN M;  4CHJ A;  3UZT A;  4CYE A;  3DXE A;  3KRW A;  3ZVR A;  1M7R A;  3ODW A;  2ROV A;  2D9Y A;  2CY4 A;  3HIE A;  4DX8 A;  3KZ1 A;  2EJ8 A;  4KHB A;  3M1I B;  3TFM A;  4YON A;  4F7U P;  4HB4 B;  1MPH A;  5D3X A;  2KIE A;  1UNQ A;  3VIA A;  1U5F A;  4H8S A;  3TVV A;  1E5W A;  3AU5 A;  5HE1 A;  1SGH A;  1KI1 B;  2COA A;  2VKI A;  4DBB A;  4ZRK A;  4D6W A;  1ZYI A;  2RNR B;  3A58 A;  1FGZ A;  2GCL A;  1SHC A;  1UEF A;  3N7C A;  1BTK A;  4EJN A;  4HAW B;  1NI2 A;  1UNP A;  4MT7 A;  2CY5 A;  1XX0 A;  4GMX B;  1FAO A;  4HB0 B;  1M7E A;  3PVU A;  1DBH A;  5FI1 A;  3QIJ A;  1K5G B;  2K8E A;  1W1D A;  2COC A;  4HHV A;  1ZSQ A;  2KUP A;  2RUK B;  2RSG A;  4QXA B;  2UVM A;  1V5P A;  4K2O A;  3IVF A;  1UPQ A;  4DXA B;  4CSQ A;  5JLJ B;  2DKP A;  1P6S A;  2HE7 A;  4GOU A;  2DYQ A;  5JP4 A;  1X1F A;  5FI0 A;  4PNK A;  5J3Y A;  2LUL A;  3SV1 A;  1MI1 A; 
#chains in the Genus database with same CATH homology
 4CHM A;  5D3V A;  2YS1 A;  1QC6 A;  3ODX A;  3A8Q A;  1OY2 A;  2OQB A;  2LG1 A;  1DRO A;  3X23 A;  4HAT B;  3GYP A;  5KQ4 A;  1GC7 A;  2VSZ A;  2K00 A;  1MK9 B;  3PZD A;  5J3T A;  3PEG A;  4ZRJ A;  2J0K A;  3NSU A;  3PG7 A;  1X11 A;  1FB8 A;  2H7E A;  3KSY A;  4IAP A;  2DLW A;  2UZS A;  4GMV A;  3AJ4 A;  3G9W A;  1MIX A;  2D11 A;  2DKQ A;  2K2U A;  4L6E A;  2EMS A;  5D27 A;  2E2X A;  3P7Z A;  2OTX A;  1XCG A;  4NSW A;  2AEH A;  3FSS A;  3WA0 A;  3U8Z A;  5KCV A;  1AQC A;  2DN6 A;  2KCJ A;  3SUZ A;  2X18 A;  2D9W A;  3RCP A;  1XKE A;  2HTH B;  4Y94 A;  5DH9 B;  2YT1 A;  1WJM A;  5DI9 B;  1Y19 B;  2P0F A;  1V5M A;  3SNH A;  2Q13 A;  2FJL A;  2JP2 A;  1RJ2 A;  3WYF B;  2COD A;  2D4Q A;  3BIN A;  3ML4 A;  2DFK A;  2YF0 A;  2QKL A;  2P8V A;  1WI1 A;  5HE2 A;  2I1J A;  2CAY A;  1FHW A;  4HAX B;  2GCJ A;  3HW2 B;  1EF1 A;  3PVL A;  1H10 A;  2L1C A;  1U5D A;  3SYX A;  3HK0 A;  1OQN A;  4EMO A;  5JHH A;  2COF A;  4BBK A;  3ODO A;  2LOX A;  1U29 A;  3VOQ A;  5C5B B;  1W1G A;  3PVW A;  1DDW A;  4MK0 A;  2YRY A;  1I2H A;  1DDM A;  4HDO A;  1X05 A;  5J3Q A;  4KVG B;  3CXB B;  4IOY X;  1XOD A;  2DX1 A;  4KHA A;  1GG3 A;  2P0H A;  2ELB A;  1QQG A;  1AWE A;  4EKU A;  2MWN B;  4MY6 A;  1ZM0 A;  5DHA B;  1PLS A;  3PP2 A;  1FGY A;  1MK7 B;  3GYO A;  2I1K A;  4KAX B;  1ZC3 B;  1ZC4 B;  2EC1 A;  1PFJ A;  1BWN A;  1BTN A;  3D8E A;  1KZG A;  3KY9 A;  4K81 A;  1V61 A;  2IFS A;  2LOZ A;  2CRF A;  2Y8G A;  1KZ7 A;  3QBV B;  2ELA A;  5C6R A;  2DHI A;  4HB2 B;  2PZ1 A;  4GN1 A;  1LB1 A;  2DTC A;  2GS0 A;  2D9V A;  2L2I A;  1ZVR A;  2YS3 A;  1RRP B;  3P6A A;  3A8P A;  2IYB A;  3F5R A;  5HE3 A;  1DYN A;  5HE0 A;  3A98 B;  2GJY A;  1I7A A;  2D2Q A;  2DYN A;  5JHG A;  4GXB A;  2H7D A;  2MDX A;  2Y7B A;  2W2X D;  4HAV B;  2NMB A;  2DHK A;  4HB3 B;  1TXD A;  1BAK A;  2I5F A;  1EAZ A;  3OAN A;  1WGQ A;  3DXC A;  1Q67 A;  1V88 A;  1X1G A;  3F0W A;  5GOW B;  2ROZ B;  2Y8F A;  4A6F B;  3TCA A;  4Z2M B;  1XD4 A;  1K5D B;  4DX9 0;  2KGX B;  5CLQ B;  1WG7 A;  1H4R A;  3D8F A;  1P3R A;  1J0W A;  1ISN A;  2VRW B;  3U7D A;  2RLO A;  3ULB A;  2RVB B;  3LJU X;  2AL6 A;  1TQZ A;  3ZDT A;  1J19 A;  4KHB B;  1Z87 A;  1FOE A;  1NTY A;  1V89 A;  4IFS A;  4NY0 A;  3TW1 A;  4HAY B;  1XR0 B;  4ZRI A;  1FHO A;  2R09 A;  1MIZ B;  2R0D A;  2J0J A;  2K2J A;  2ADZ A;  2DHJ A;  3TO1 A;  4HDQ A;  2YS5 A;  2I5C A;  4WJ7 A;  1MKE A;  3MPX A;  5DHF B;  3CIK A;  4A6K A;  5CLL B;  2V76 A;  1X86 A;  3AU4 A;  4A5K A;  1LW3 A;  2Z0Q A;  2D9Z A;  4A6H A;  5D3W A;  4TKN A;  4XWX A;  3O96 A;  3BJI A;  5C5B A;  2D10 A;  4K17 A;  3PSC A;  1N3H A;  1EGX A;  5EFX A;  4P7I A;  2NZ8 B;  2D9X A;  1MAI A;  2UZR A;  4PQ0 A;  1V5U A;  4F7G A;  4B6H A;  4GPT B;  2RGN B;  2EMT A;  3KRX A;  2Z0P A;  2M38 A;  3V5W A;  1WGU A;  2W2X C;  2QKM A;  3MDB C;  4C0A A;  1WJ1 A;  1DDV A;  1FHX A;  1U5G A;  1EVH A;  3T06 A;  5D3Y A;  5KQ1 A;  3DXD A;  2DX5 A;  2DA0 A;  5C79 A;  1WVH A;  1UPR A;  3HQC A;  2LYD A;  2P0D A;  4D0N B;  2Z0O A;  4TYZ A;  2YVC A;  3SO6 A;  1P5T A;  4WSF A;  4KHO A;  1B55 A;  2N0Y A;  2MKR A;  3FM8 C;  1U2B A;  2M14 A;  1GC6 A;  4K2P A;  4F7H A;  1U27 A;  4GZU A;  3FEH A;  1PMS A;  1NU2 A;  3D8D A;  5L81 A;  2J0M A;  4HAZ B;  1NTV A;  1UNR A;  1OMW A;  1Y5O A;  2BCJ A;  2YSZ A;  5LON B;  2MFQ A;  3QWM A;  4WVF B;  2G35 A;  5LOP B;  1W1H A;  5C16 A;  2YT0 A;  1IRS A;  1U5E A;  2ZPY A;  2W2W A;  4YL8 A;  2J59 M;  2LKO A;  4A6F A;  4HAU B;  1TJ6 A;  3ULC A;  5DIF B;  2N23 A;  4Z2N A;  2XQN M;  4CHJ A;  3UZT A;  4CYE A;  3DXE A;  3KRW A;  3ZVR A;  1M7R A;  3ODW A;  2ROV A;  2D9Y A;  2CY4 A;  4DX8 A;  3KZ1 A;  2EJ8 A;  3M1I B;  3TFM A;  4YON A;  4F7U P;  4HB4 B;  1MPH A;  5D3X A;  1UNQ A;  3VIA A;  1U5F A;  4H8S A;  3TVV A;  1E5W A;  3AU5 A;  5HE1 A;  1SGH A;  1KI1 B;  2COA A;  2VKI A;  4DBB A;  4ZRK A;  2RNR B;  1FGZ A;  2GCL A;  1SHC A;  1UEF A;  3N7C A;  1BTK A;  4EJN A;  4HAW B;  1NI2 A;  1UNP A;  4MT7 A;  2CY5 A;  1XX0 A;  4GMX B;  1FAO A;  4HB0 B;  1M7E A;  3PVU A;  1DBH A;  5FI1 A;  3QIJ A;  1K5G B;  1W1D A;  2COC A;  4HHV A;  1ZSQ A;  2KUP A;  2RUK B;  2RSG A;  2UVM A;  1V5P A;  4K2O A;  3IVF A;  1UPQ A;  4DXA B;  5JLJ B;  2DKP A;  1P6S A;  2HE7 A;  2DYQ A;  5JP4 A;  1X1F A;  5FI0 A;  4PNK A;  5J3Y A;  2LUL A;  3SV1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...