2CAYA

Vps36 n-terminal ph domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
132
structure length
132
Chain Sequence
HHMEYWHYVETTSSGQPLLREGEKDIFIDQSVGLYHGKSKILQRQRGRIFLTSQRIIYIDDAKPTQNSLGLELDDLAYVNYSSGFLTRSPRLILFFKDPSSSTEFVQLSFRKSDGVLFSQATERALENILTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Escrt-I Core and Escrt-II Glue Domain Structures Reveal Role for Glue in Linking to Escrt-I and Membranes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport
molecule keywords VACUOLAR PROTEIN SORTING PROTEIN 36
total genus 31
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11605 Vps36_ESCRT-II Vacuolar protein sorting protein 36 Vps36
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2cayA00
1DBHA 2RNRB 3TFMA 1FHXA 2DYNA 3PVLA 4HDQA 5DI9B 2DHIA 2EJ8A 3WYFB 1MPHA 4D0NB 2QKMA 2J59M 1MK9B 1P3RA 4CHJA 3HQCA 2YSZA 2W2WA 1TQZA 4P7IA 1BAKA 2DX1A 5C16A 2Z0QA 1MKEA 1GG3A 1DYNA 1WVHA 4WVFB 1XR0B 5D3XA 3KRWA 1DDVA 1XODA 2J0MA 2MKRA 2MDXA 1X11A 2NZ8B 2CY5A 2DKPA 5DIFB 1MIZB 4Z2MB 2RSGA 2HTHB 5JHHA 2M38A 4GZUA 5HE2A 4DX90 2P0HA 3PZDA 4MT7A 1U5FA 2NMBA 1NTVA 5CLQB 4KAXB 1IRSA 3IVFA 2K00A 4H8SA 1UPRA 1V5MA 2P0FA 5DHFB 2D9XA 4BBKA 3QIJA 4GMXB 3SUZA 3D8FA 5J3TA 1UNRA 1AQCA 3AJ4A 2DYQA 1W1DA 1UNQA 1X1GA 3SO6A 3MDBC 3TO1A 1ISNA 1SGHA 1MAIA 1V61A 5KCVA 4HDOA 2DTCA 5JP4A 1EVHA 1U29A 4GN1A 3AU5A 3FSSA 1XKEA 3TVVA 3RCPA 2RUKB 1OQNA 3ODXA 3NSUA 5LONB 4KHBB 2J0JA 4TKNA 2EMTA 2R0DA 2OQBA 3A98B 2L2IA 2YVCA 2QKLA 1K5GB 3A8QA 3P7ZA 3PG7A 3QBVB 4Y94A 4A6KA 2UZRA 2AEHA 1LW3A 2FJLA 1GC6A 5EFXA 1Y5OA 2W2XC 3A8PA 1U5DA 2VRWB 2P0DA 2COCA 1V5UA 3KRXA 3ODWA 2W2XD 1NI2A 1MK7B 2H7EA 2D9VA 1ZC3B 2RLOA 3GYOA 4GPTB 1FGYA 4DX8A 3GYPA 3ZVRA 4EMOA 5D27A 4ZRJA 5C79A 4GXBA 2LKOA 3BINA 2AL6A 1PFJA 1E5WA 4DXAB 1W1HA 3AU4A 4HB4B 4L6EA 4IAPA 2KGXB 4MK0A 1ZM0A 2LOXA 1QQGA 1PMSA 1U27A 1FHWA 2XQNM 5LOPB 2P8VA 3LJUX 2D2QA 1U5EA 2YS3A 2DFKA 2VKIA 3SNHA 4PQ0A 4HB0B 3DXCA 4A6FA 1ZSQA 5J3YA 1RRPB 1KZ7A 4YL8A 1P5TA 2D9ZA 5HE0A 1WJMA 4HATB 1TJ6A 1WGUA 2Y8GA 2YRYA 4NSWA 2G35A 3ML4A 2M14A 3WA0A 2ELAA 1WGQA 4A6FB 3ZDTA 5J3QA 1Y19B 2IFSA 4C0AA 2I1KA 2VSZA 2MFQA 3OANA 1X86A 3ULCA 3KY9A 1EF1A 4IFSA 1OY2A 3UZTA 2CY4A 1FHOA 1EGXA 1U2BA 1AWEA 1I2HA 5C5BA 2MWNB 2OTXA 1UPQA 1J19A 1FB8A 2K2UA 1TXDA 1K5DB 1DDWA 4IOYX 1J0WA 3U7DA 4HHVA 3DXDA 3HW2B 4HAZB 2GCJA 2UZSA 2Z0OA 1M7RA 3MPXA 5C5BB 1KI1B 4KVGB 1V88A 4WJ7A 5KQ4A 2DLWA 2D10A 4CYEA 4KHAA 2HE7A 1EAZA 2YT0A 2LYDA 1N3HA 1SHCA 2ELBA 1WI1A 5JHGA 4A6HA 3ULBA 5FI0A 2D11A 2X18A 5JLJB 3PVWA 4HB3B 2RVBB 3CXBB 1MIXA 4HAYB 2DX5A 4KHOA 2DN6A 3VIAA 1BTNA 4YONA 1V89A 4A5KA 3F5RA 1BWNA 2Z0PA 2L1CA 2EC1A 5KQ1A 5DHAB 1Z87A 5D3VA 3PEGA 3D8DA 4HAUB 1I7AA 4HB2B 1U5GA 4K17A 5L81A 3SV1A 2DHKA 3U8ZA 2CAYA 5HE1A 2GJYA 4F7UP 1UNPA 2K2JA 1X05A 1OMWA 2LULA 4K2PA 2N23A 5CLLB 2LG1A 4HAWB 3G9WA 1XCGA 3X23A 1QC6A 2ADZA 5FI1A 2R09A 3M1IB 2KCJA 2V76A 2Y8FA 1M7EA 3PP2A 3DXEA 5D3YA 3TW1A 2YS5A 3SYXA 1W1GA 2ROZB 3O96A 4GMVA 4F7HA 1P6SA 3ODOA 2ZPYA 1GC7A 1RJ2A 3FEHA 4WSFA 2D4QA 1WJ1A 2COFA 2D9YA 1NTYA 3PVUA 2E2XA 4EKUA 4B6HA 1KZGA 2BCJA 3KZ1A 4MY6A 2EMSA 2RGNB 3PSCA 1DROA 3T06A 4CHMA 1BTKA 1FGZA 2GS0A 1UEFA 1V5PA 2DHJA 4HAXB 4TYZA 2LOZA 3FM8C 1NU2A 2KUPA 2YT1A 3V5WA 1LB1A 3QWMA 2COAA 4DBBA 2CRFA 2DKQA 4NY0A 4EJNA 2JP2A 2IYBA 3BJIA 2I5FA 3CIKA 2N0YA 3TCAA 3F0WA 2PZ1A 3P6AA 5C6RA 2GCLA 1FOEA 1XX0A 3KSYA 2H7DA 2I1JA 4ZRIA 2YS1A 2ROVA 2Y7BA 1B55A 2YF0A 4XWXA 4F7GA 1FAOA 1ZC4B 1H10A 2I5CA 4HAVB 3VOQA 1Q67A 2UVMA 2J0KA 4K2OA 3HK0A 1ZVRA 1X1FA 5DH9B 4Z2NA 1PLSA 5GOWB 4PNKA 1WG7A 2DA0A 3D8EA 2CODA 1XD4A 5D3WA 2D9WA 3N7CA 4K81A 1DDMA 5HE3A 2Q13A 1H4RA 4ZRKA
chains in the Genus database with same CATH superfamily
1DBHA 2RNRB 3TFMA 1FHXA 2DYNA 3PVLA 4HDQA 5DI9B 2DHIA 2EJ8A 3WYFB 1MPHA 4D0NB 2QKMA 2J59M 1MK9B 1P3RA 4CHJA 3HQCA 5I2SA 2YSZA 5I2MA 2W2WA 1T77A 1TQZA 4P7IA 1BAKA 2DX1A 5C16A 2Z0QA 1MKEA 1GG3A 1DYNA 1WVHA 4WVFB 1XR0B 5D3XA 3KRWA 1DDVA 1XODA 2J0MA 2MKRA 2MDXA 1X11A 2NZ8B 2CY5A 2DKPA 5DIFB 1MIZB 4Z2MB 2RSGA 2HTHB 5JHHA 2M38A 4GZUA 5HE2A 3U12A 4DX90 2P0HA 3PZDA 4MT7A 1U5FA 2NMBA 1NTVA 5CLQB 4KAXB 1IRSA 3IVFA 2K00A 4H8SA 2Z13A 1UPRA 1V5MA 2P0FA 5DHFB 2GUMA 4DIXA 2D9XA 4BBKA 3QIJA 4GMXB 3SUZA 3D8FA 3HIEA 5J3TA 1UNRA 1AQCA 3AJ4A 2DYQA 1W1DA 1UNQA 1X1GA 3SO6A 3MDBC 3TO1A 1ISNA 2KR0A 1SGHA 1MAIA 1V61A 5KCVA 4HDOA 2DTCA 5JP4A 1EVHA 1U29A 4GN1A 3AU5A 3FSSA 1XKEA 3TVVA 3RCPA 2RUKB 1OQNA 3ODXA 3NSUA 5LONB 4KHBB 2J0JA 4TKNA 2EMTA 2R0DA 4CSQA 2OQBA 3A98B 2L2IA 2YVCA 2QKLA 1K5GB 3A8QA 3P7ZA 3PG7A 3QBVB 4Y94A 4A6KA 2UZRA 2AEHA 1LW3A 2FJLA 1GC6A 5EFXA 2YT2A 1Y5OA 5M4YB 2W2XC 2R2YA 3A8PA 1U5DA 2VRWB 2P0DA 2COCA 1V5UA 3KRXA 3ODWA 2W2XD 1NI2A 1MK7B 2H7EA 2D9VA 1ZC3B 1MI1A 2RLOA 3GYOA 4GPTB 1FGYA 4DX8A 3GYPA 3ZVRA 4EMOA 5D27A 4ZRJA 5C79A 4GXBA 2LKOA 3BINA 2AL6A 1PFJA 4D6WA 1E5WA 3NWFA 4DXAB 1W1HA 3AU4A 4GNKB 4HB4B 4L6EA 4IAPA 2KGXB 4MK0A 1ZM0A 2LOXA 1QQGA 1PMSA 5LG4B 1U27A 1FHWA 2FJUB 2XQNM 2P8VA 5LOPB 3LJUX 3A58A 2D2QA 1U5EA 2YS3A 2DFKA 2VKIA 3SNHA 4PQ0A 4HB0B 3DXCA 4A6FA 1ZSQA 5J3YA 1RRPB 1KZ7A 5IRSA 4YL8A 1P5TA 2D9ZA 5HE0A 1WJMA 4HATB 1TJ6A 1WGUA 2Y8GA 2YRYA 4NSWA 2G35A 3ML4A 2M14A 3WA0A 2ELAA 1WGQA 4A6FB 4QJ3B 3ZDTA 5J3QA 1Y19B 2IFSA 4C0AA 2I1KA 2VSZA 2MFQA 3OANA 1X86A 3ULCA 3KY9A 1EF1A 4IFSA 4OSNA 1OY2A 2Z14A 3OHMB 2CY4A 3UZTA 1FHOA 1EGXA 2NBVA 1U2BA 1AWEA 1I2HA 5C5BA 2MWNB 2OTXA 1UPQA 1J19A 1FB8A 2K2UA 1TXDA 2K49A 3NWAA 1K5DB 1DDWA 4IOYX 1J0WA 4GOUA 3U7DA 4HHVA 3DXDA 4KHBA 3HW2B 4HAZB 2GCJA 2UZSA 2Z0OA 1M7RA 3MPXA 5C5BB 1KI1B 4KVGB 1V88A 4WJ7A 5KQ4A 2DLWA 4L1RA 2D10A 4CYEA 4KHAA 2HE7A 1EAZA 2YT0A 2LYDA 4QXAB 1N3HA 1SHCA 2ELBA 1WI1A 5JHGA 4A6HA 3ULBA 5FI0A 2D11A 2X18A 5JLJB 3PVWA 4HB3B 2RVBB 3CXBB 1MIXA 4HAYB 2DX5A 3HSAA 4KHOA 2DN6A 3VIAA 4QJ4B 2RRFA 1BTNA 4YONA 1V89A 4A5KA 3F5RA 1BWNA 2KUQA 2Z0PA 2L1CA 2EC1A 5KQ1A 5DHAB 4QJ5B 1Z87A 5D3VA 3PEGA 3D8DA 4HAUB 1I7AA 1ZYIA 4HB2B 4OT1A 1U5GA 4K17A 5L81A 3SV1A 2DHKA 3U8ZA 2CAYA 5HE1A 2GJYA 4F7UP 1UNPA 2K2JA 1X05A 1OMWA 2LULA 4K2PA 2N23A 5CLLB 2LG1A 4HAWB 3G9WA 1XCGA 3X23A 1QC6A 2ADZA 5FI1A 2R09A 3M1IB 2KCJA 2V76A 2Y8FA 1M7EA 3PP2A 3DXEA 5D3YA 3TW1A 2YS5A 3SYXA 1W1GA 2ROZB 3O96A 4GMVA 4F7HA 1P6SA 3ODOA 2ZPYA 1GC7A 1RJ2A 3FEHA 4WSFA 2D4QA 1WJ1A 2COFA 2D9YA 1NTYA 3PVUA 4HSIA 2E2XA 4EKUA 4B6HA 1KZGA 2BCJA 3KZ1A 4MY6A 2EMSA 2RGNB 3PSCA 1DROA 3T06A 4CHMA 1BTKA 1FGZA 2GS0A 2KIEA 1UEFA 1V5PA 2DHJA 4HAXB 4TYZA 2LOZA 3FM8C 1NU2A 2KUPA 2YT1A 3V5WA 1LB1A 3QWMA 2COAA 4DBBA 2CRFA 2DKQA 2KIGA 4NY0A 4EJNA 2JP2A 2Z59A 2IYBA 3BJIA 2I5FA 3CIKA 2N0YA 3TCAA 3F0WA 2PZ1A 2K8EA 3P6AA 5C6RA 2GCLA 1FOEA 1XX0A 3KSYA 2H7DA 3DCXA 2I1JA 4ZRIA 2YS1A 2ROVA 2Y7BA 2Z4DA 1B55A 2YF0A 4XWXA 4F7GA 1FAOA 2ZKMX 1ZC4B 1H10A 2I5CA 4HAVB 3VOQA 1Q67A 2UVMA 2J0KA 4K2OA 3HK0A 3FVCA 1ZVRA 3NW8A 1X1FA 5DH9B 4Z2NA 1PLSA 5GOWB 4PNKA 1WG7A 2DA0A 3D8EA 2CODA 1XD4A 5D3WA 2D9WA 3NWDA 3B77A 3N7CA 4K81A 1DDMA 5HE3A 2Q13A 1H4RA 4ZRKA
chains in the Genus database with same CATH topology
1DBHA 2RNRB 3TFMA 1FHXA 2DYNA 3PVLA 4HDQA 5DI9B 2DHIA 2EJ8A 3WYFB 1MPHA 4D0NB 2QKMA 2J59M 1MK9B 1P3RA 4CHJA 3HQCA 2YSZA 2W2WA 1TQZA 4P7IA 1BAKA 2DX1A 5C16A 2Z0QA 1MKEA 1GG3A 1DYNA 1WVHA 4WVFB 1XR0B 5D3XA 3KRWA 1DDVA 1XODA 2J0MA 2MKRA 2MDXA 1X11A 2NZ8B 2CY5A 2DKPA 5DIFB 1MIZB 4Z2MB 2RSGA 2HTHB 5JHHA 2M38A 4GZUA 5HE2A 4DX90 2P0HA 3PZDA 4MT7A 1U5FA 2NMBA 1NTVA 5CLQB 4KAXB 1IRSA 3IVFA 2K00A 4H8SA 1UPRA 1V5MA 2P0FA 5DHFB 2D9XA 4BBKA 3QIJA 4GMXB 3SUZA 3D8FA 5J3TA 1UNRA 1AQCA 3AJ4A 2DYQA 1W1DA 1UNQA 1X1GA 3SO6A 3MDBC 3TO1A 1ISNA 1SGHA 1MAIA 1V61A 5KCVA 4HDOA 2DTCA 5JP4A 1EVHA 1U29A 4GN1A 3AU5A 3FSSA 1XKEA 3TVVA 3RCPA 2RUKB 1OQNA 3ODXA 3NSUA 5LONB 4KHBB 2J0JA 4TKNA 2EMTA 2R0DA 2OQBA 3A98B 2L2IA 2YVCA 2QKLA 1K5GB 3A8QA 3P7ZA 3PG7A 3QBVB 4Y94A 4A6KA 2UZRA 2AEHA 1LW3A 2FJLA 1GC6A 5EFXA 1Y5OA 2W2XC 3A8PA 1U5DA 2VRWB 2P0DA 2COCA 1V5UA 3KRXA 3ODWA 2W2XD 1NI2A 1MK7B 2H7EA 2D9VA 1ZC3B 2RLOA 3GYOA 4GPTB 1FGYA 4DX8A 3GYPA 3ZVRA 4EMOA 5D27A 4ZRJA 5C79A 4GXBA 2LKOA 3BINA 2AL6A 1PFJA 1E5WA 4DXAB 1W1HA 3AU4A 4HB4B 4L6EA 4IAPA 2KGXB 4MK0A 1ZM0A 2LOXA 1QQGA 1PMSA 1U27A 1FHWA 2XQNM 5LOPB 2P8VA 3LJUX 2D2QA 1U5EA 2YS3A 2DFKA 2VKIA 3SNHA 4PQ0A 4HB0B 3DXCA 4A6FA 1ZSQA 5J3YA 1RRPB 1KZ7A 4YL8A 1P5TA 2D9ZA 5HE0A 1WJMA 4HATB 1TJ6A 1WGUA 2Y8GA 2YRYA 4NSWA 2G35A 3ML4A 2M14A 3WA0A 2ELAA 1WGQA 4A6FB 3ZDTA 5J3QA 1Y19B 2IFSA 4C0AA 2I1KA 2VSZA 2MFQA 3OANA 1X86A 3ULCA 3KY9A 1EF1A 4IFSA 1OY2A 3UZTA 2CY4A 1FHOA 1EGXA 1U2BA 1AWEA 1I2HA 5C5BA 2MWNB 2OTXA 1UPQA 1J19A 1FB8A 2K2UA 1TXDA 1K5DB 1DDWA 4IOYX 1J0WA 3U7DA 4HHVA 3DXDA 3HW2B 4HAZB 2GCJA 2UZSA 2Z0OA 1M7RA 3MPXA 5C5BB 1KI1B 4KVGB 1V88A 4WJ7A 5KQ4A 2DLWA 2D10A 4CYEA 4KHAA 2HE7A 1EAZA 2YT0A 2LYDA 1N3HA 1SHCA 2ELBA 1WI1A 5JHGA 4A6HA 3ULBA 5FI0A 2D11A 2X18A 5JLJB 3PVWA 4HB3B 2RVBB 3CXBB 1MIXA 4HAYB 2DX5A 4KHOA 2DN6A 3VIAA 1BTNA 4YONA 1V89A 4A5KA 3F5RA 1BWNA 2Z0PA 2L1CA 2EC1A 5KQ1A 5DHAB 1Z87A 5D3VA 3PEGA 3D8DA 4HAUB 1I7AA 4HB2B 1U5GA 4K17A 5L81A 3SV1A 2DHKA 3U8ZA 2CAYA 5HE1A 2GJYA 4F7UP 1UNPA 2K2JA 1X05A 1OMWA 2LULA 4K2PA 2N23A 5CLLB 2LG1A 4HAWB 3G9WA 1XCGA 3X23A 1QC6A 2ADZA 5FI1A 2R09A 3M1IB 2KCJA 2V76A 2Y8FA 1M7EA 3PP2A 3DXEA 5D3YA 3TW1A 2YS5A 3SYXA 1W1GA 2ROZB 3O96A 4GMVA 4F7HA 1P6SA 3ODOA 2ZPYA 1GC7A 1RJ2A 3FEHA 4WSFA 2D4QA 1WJ1A 2COFA 2D9YA 1NTYA 3PVUA 2E2XA 4EKUA 4B6HA 1KZGA 2BCJA 3KZ1A 4MY6A 2EMSA 2RGNB 3PSCA 1DROA 3T06A 4CHMA 1BTKA 1FGZA 2GS0A 1UEFA 1V5PA 2DHJA 4HAXB 4TYZA 2LOZA 3FM8C 1NU2A 2KUPA 2YT1A 3V5WA 1LB1A 3QWMA 2COAA 4DBBA 2CRFA 2DKQA 4NY0A 4EJNA 2JP2A 2IYBA 3BJIA 2I5FA 3CIKA 2N0YA 3TCAA 3F0WA 2PZ1A 3P6AA 5C6RA 2GCLA 1FOEA 1XX0A 3KSYA 2H7DA 2I1JA 4ZRIA 2YS1A 2ROVA 2Y7BA 1B55A 2YF0A 4XWXA 4F7GA 1FAOA 1ZC4B 1H10A 2I5CA 4HAVB 3VOQA 1Q67A 2UVMA 2J0KA 4K2OA 3HK0A 1ZVRA 1X1FA 5DH9B 4Z2NA 1PLSA 5GOWB 4PNKA 1WG7A 2DA0A 3D8EA 2CODA 1XD4A 5D3WA 2D9WA 3N7CA 4K81A 1DDMA 5HE3A 2Q13A 1H4RA 4ZRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DBH A;  2RNR B;  3TFM A;  1FHX A;  2DYN A;  3PVL A;  4HDQ A;  5DI9 B;  2DHI A;  2EJ8 A;  3WYF B;  1MPH A;  4D0N B;  2QKM A;  2J59 M;  1MK9 B;  1P3R A;  4CHJ A;  3HQC A;  2YSZ A;  2W2W A;  1TQZ A;  4P7I A;  1BAK A;  2DX1 A;  5C16 A;  2Z0Q A;  1MKE A;  1GG3 A;  1DYN A;  1WVH A;  4WVF B;  1XR0 B;  5D3X A;  3KRW A;  1DDV A;  1XOD A;  2J0M A;  2MKR A;  2MDX A;  1X11 A;  2NZ8 B;  2CY5 A;  2DKP A;  5DIF B;  1MIZ B;  4Z2M B;  2RSG A;  2HTH B;  5JHH A;  2M38 A;  4GZU A;  5HE2 A;  4DX9 0;  2P0H A;  3PZD A;  4MT7 A;  1U5F A;  2NMB A;  1NTV A;  5CLQ B;  4KAX B;  1IRS A;  3IVF A;  2K00 A;  4H8S A;  1UPR A;  1V5M A;  2P0F A;  5DHF B;  2D9X A;  4BBK A;  3QIJ A;  4GMX B;  3SUZ A;  3D8F A;  5J3T A;  1UNR A;  1AQC A;  3AJ4 A;  2DYQ A;  1W1D A;  1UNQ A;  1X1G A;  3SO6 A;  3MDB C;  3TO1 A;  1ISN A;  1SGH A;  1MAI A;  1V61 A;  5KCV A;  4HDO A;  2DTC A;  5JP4 A;  1EVH A;  1U29 A;  4GN1 A;  3AU5 A;  3FSS A;  1XKE A;  3TVV A;  3RCP A;  2RUK B;  1OQN A;  3ODX A;  3NSU A;  5LON B;  4KHB B;  2J0J A;  4TKN A;  2EMT A;  2R0D A;  2OQB A;  3A98 B;  2L2I A;  2YVC A;  2QKL A;  1K5G B;  3A8Q A;  3P7Z A;  3PG7 A;  3QBV B;  4Y94 A;  4A6K A;  2UZR A;  2AEH A;  1LW3 A;  2FJL A;  1GC6 A;  5EFX A;  1Y5O A;  2W2X C;  3A8P A;  1U5D A;  2VRW B;  2P0D A;  2COC A;  1V5U A;  3KRX A;  3ODW A;  2W2X D;  1NI2 A;  1MK7 B;  2H7E A;  2D9V A;  1ZC3 B;  2RLO A;  3GYO A;  4GPT B;  1FGY A;  4DX8 A;  3GYP A;  3ZVR A;  4EMO A;  5D27 A;  4ZRJ A;  5C79 A;  4GXB A;  2LKO A;  3BIN A;  2AL6 A;  1PFJ A;  1E5W A;  4DXA B;  1W1H A;  3AU4 A;  4HB4 B;  4L6E A;  4IAP A;  2KGX B;  4MK0 A;  1ZM0 A;  2LOX A;  1QQG A;  1PMS A;  1U27 A;  1FHW A;  2XQN M;  5LOP B;  2P8V A;  3LJU X;  2D2Q A;  1U5E A;  2YS3 A;  2DFK A;  2VKI A;  3SNH A;  4PQ0 A;  4HB0 B;  3DXC A;  4A6F A;  1ZSQ A;  5J3Y A;  1RRP B;  1KZ7 A;  4YL8 A;  1P5T A;  2D9Z A;  5HE0 A;  1WJM A;  4HAT B;  1TJ6 A;  1WGU A;  2Y8G A;  2YRY A;  4NSW A;  2G35 A;  3ML4 A;  2M14 A;  3WA0 A;  2ELA A;  1WGQ A;  4A6F B;  3ZDT A;  5J3Q A;  1Y19 B;  2IFS A;  4C0A A;  2I1K A;  2VSZ A;  2MFQ A;  3OAN A;  1X86 A;  3ULC A;  3KY9 A;  1EF1 A;  4IFS A;  1OY2 A;  3UZT A;  2CY4 A;  1FHO A;  1EGX A;  1U2B A;  1AWE A;  1I2H A;  5C5B A;  2MWN B;  2OTX A;  1UPQ A;  1J19 A;  1FB8 A;  2K2U A;  1TXD A;  1K5D B;  1DDW A;  4IOY X;  1J0W A;  3U7D A;  4HHV A;  3DXD A;  3HW2 B;  4HAZ B;  2GCJ A;  2UZS A;  2Z0O A;  1M7R A;  3MPX A;  5C5B B;  1KI1 B;  4KVG B;  1V88 A;  4WJ7 A;  5KQ4 A;  2DLW A;  2D10 A;  4CYE A;  4KHA A;  2HE7 A;  1EAZ A;  2YT0 A;  2LYD A;  1N3H A;  1SHC A;  2ELB A;  1WI1 A;  5JHG A;  4A6H A;  3ULB A;  5FI0 A;  2D11 A;  2X18 A;  5JLJ B;  3PVW A;  4HB3 B;  2RVB B;  3CXB B;  1MIX A;  4HAY B;  2DX5 A;  4KHO A;  2DN6 A;  3VIA A;  1BTN A;  4YON A;  1V89 A;  4A5K A;  3F5R A;  1BWN A;  2Z0P A;  2L1C A;  2EC1 A;  5KQ1 A;  5DHA B;  1Z87 A;  5D3V A;  3PEG A;  3D8D A;  4HAU B;  1I7A A;  4HB2 B;  1U5G A;  4K17 A;  5L81 A;  3SV1 A;  2DHK A;  3U8Z A;  2CAY A;  5HE1 A;  2GJY A;  4F7U P;  1UNP A;  2K2J A;  1X05 A;  1OMW A;  2LUL A;  4K2P A;  2N23 A;  5CLL B;  2LG1 A;  4HAW B;  3G9W A;  1XCG A;  3X23 A;  1QC6 A;  2ADZ A;  5FI1 A;  2R09 A;  3M1I B;  2KCJ A;  2V76 A;  2Y8F A;  1M7E A;  3PP2 A;  3DXE A;  5D3Y A;  3TW1 A;  2YS5 A;  3SYX A;  1W1G A;  2ROZ B;  3O96 A;  4GMV A;  4F7H A;  1P6S A;  3ODO A;  2ZPY A;  1GC7 A;  1RJ2 A;  3FEH A;  4WSF A;  2D4Q A;  1WJ1 A;  2COF A;  2D9Y A;  1NTY A;  3PVU A;  2E2X A;  4EKU A;  4B6H A;  1KZG A;  2BCJ A;  3KZ1 A;  4MY6 A;  2EMS A;  2RGN B;  3PSC A;  1DRO A;  3T06 A;  4CHM A;  1BTK A;  1FGZ A;  2GS0 A;  1UEF A;  1V5P A;  2DHJ A;  4HAX B;  4TYZ A;  2LOZ A;  3FM8 C;  1NU2 A;  2KUP A;  2YT1 A;  3V5W A;  1LB1 A;  3QWM A;  2COA A;  4DBB A;  2CRF A;  2DKQ A;  4NY0 A;  4EJN A;  2JP2 A;  2IYB A;  3BJI A;  2I5F A;  3CIK A;  2N0Y A;  3TCA A;  3F0W A;  2PZ1 A;  3P6A A;  5C6R A;  2GCL A;  1FOE A;  1XX0 A;  3KSY A;  2H7D A;  2I1J A;  4ZRI A;  2YS1 A;  2ROV A;  2Y7B A;  1B55 A;  2YF0 A;  4XWX A;  4F7G A;  1FAO A;  1ZC4 B;  1H10 A;  2I5C A;  4HAV B;  3VOQ A;  1Q67 A;  2UVM A;  2J0K A;  4K2O A;  3HK0 A;  1ZVR A;  1X1F A;  5DH9 B;  4Z2N A;  1PLS A;  5GOW B;  4PNK A;  1WG7 A;  2DA0 A;  3D8E A;  2COD A;  1XD4 A;  5D3W A;  2D9W A;  3N7C A;  4K81 A;  1DDM A;  5HE3 A;  2Q13 A;  1H4R A;  4ZRK A; 
#chains in the Genus database with same CATH topology
 1DBH A;  2RNR B;  3TFM A;  1FHX A;  2DYN A;  3PVL A;  4HDQ A;  5DI9 B;  2DHI A;  2EJ8 A;  3WYF B;  1MPH A;  4D0N B;  2QKM A;  2J59 M;  1MK9 B;  1P3R A;  4CHJ A;  3HQC A;  5I2S A;  2YSZ A;  5I2M A;  2W2W A;  1T77 A;  1TQZ A;  4P7I A;  1BAK A;  2DX1 A;  5C16 A;  2Z0Q A;  1MKE A;  1GG3 A;  1DYN A;  1WVH A;  4WVF B;  1XR0 B;  5D3X A;  3KRW A;  1DDV A;  1XOD A;  2J0M A;  2MKR A;  2MDX A;  1X11 A;  2NZ8 B;  2CY5 A;  2DKP A;  5DIF B;  1MIZ B;  4Z2M B;  2RSG A;  2HTH B;  5JHH A;  2M38 A;  4GZU A;  5HE2 A;  3U12 A;  4DX9 0;  2P0H A;  3PZD A;  4MT7 A;  1U5F A;  2NMB A;  1NTV A;  5CLQ B;  4KAX B;  1IRS A;  3IVF A;  2K00 A;  4H8S A;  2Z13 A;  1UPR A;  1V5M A;  2P0F A;  5DHF B;  2GUM A;  4DIX A;  2D9X A;  4BBK A;  3QIJ A;  4GMX B;  3SUZ A;  3D8F A;  3HIE A;  5J3T A;  1UNR A;  1AQC A;  3AJ4 A;  2DYQ A;  1W1D A;  1UNQ A;  1X1G A;  3SO6 A;  3MDB C;  3TO1 A;  1ISN A;  2KR0 A;  1SGH A;  1MAI A;  1V61 A;  5KCV A;  4HDO A;  2DTC A;  5JP4 A;  1EVH A;  1U29 A;  4GN1 A;  3AU5 A;  3FSS A;  1XKE A;  3TVV A;  3RCP A;  2RUK B;  1OQN A;  3ODX A;  3NSU A;  5LON B;  4KHB B;  2J0J A;  4TKN A;  2EMT A;  2R0D A;  4CSQ A;  2OQB A;  3A98 B;  2L2I A;  2YVC A;  2QKL A;  1K5G B;  3A8Q A;  3P7Z A;  3PG7 A;  3QBV B;  4Y94 A;  4A6K A;  2UZR A;  2AEH A;  1LW3 A;  2FJL A;  1GC6 A;  5EFX A;  2YT2 A;  1Y5O A;  5M4Y B;  2W2X C;  2R2Y A;  3A8P A;  1U5D A;  2VRW B;  2P0D A;  2COC A;  1V5U A;  3KRX A;  3ODW A;  2W2X D;  1NI2 A;  1MK7 B;  2H7E A;  2D9V A;  1ZC3 B;  1MI1 A;  2RLO A;  3GYO A;  4GPT B;  1FGY A;  4DX8 A;  3GYP A;  3ZVR A;  4EMO A;  5D27 A;  4ZRJ A;  5C79 A;  4GXB A;  2LKO A;  3BIN A;  2AL6 A;  1PFJ A;  4D6W A;  1E5W A;  3NWF A;  4DXA B;  1W1H A;  3AU4 A;  4GNK B;  4HB4 B;  4L6E A;  4IAP A;  2KGX B;  4MK0 A;  1ZM0 A;  2LOX A;  1QQG A;  1PMS A;  5LG4 B;  1U27 A;  1FHW A;  2FJU B;  2XQN M;  2P8V A;  5LOP B;  3LJU X;  3A58 A;  2D2Q A;  1U5E A;  2YS3 A;  2DFK A;  2VKI A;  3SNH A;  4PQ0 A;  4HB0 B;  3DXC A;  4A6F A;  1ZSQ A;  5J3Y A;  1RRP B;  1KZ7 A;  5IRS A;  4YL8 A;  1P5T A;  2D9Z A;  5HE0 A;  1WJM A;  4HAT B;  1TJ6 A;  1WGU A;  2Y8G A;  2YRY A;  4NSW A;  2G35 A;  3ML4 A;  2M14 A;  3WA0 A;  2ELA A;  1WGQ A;  4A6F B;  4QJ3 B;  3ZDT A;  5J3Q A;  1Y19 B;  2IFS A;  4C0A A;  2I1K A;  2VSZ A;  2MFQ A;  3OAN A;  1X86 A;  3ULC A;  3KY9 A;  1EF1 A;  4IFS A;  4OSN A;  1OY2 A;  2Z14 A;  3OHM B;  2CY4 A;  3UZT A;  1FHO A;  1EGX A;  2NBV A;  1U2B A;  1AWE A;  1I2H A;  5C5B A;  2MWN B;  2OTX A;  1UPQ A;  1J19 A;  1FB8 A;  2K2U A;  1TXD A;  2K49 A;  3NWA A;  1K5D B;  1DDW A;  4IOY X;  1J0W A;  4GOU A;  3U7D A;  4HHV A;  3DXD A;  4KHB A;  3HW2 B;  4HAZ B;  2GCJ A;  2UZS A;  2Z0O A;  1M7R A;  3MPX A;  5C5B B;  1KI1 B;  4KVG B;  1V88 A;  4WJ7 A;  5KQ4 A;  2DLW A;  4L1R A;  2D10 A;  4CYE A;  4KHA A;  2HE7 A;  1EAZ A;  2YT0 A;  2LYD A;  4QXA B;  1N3H A;  1SHC A;  2ELB A;  1WI1 A;  5JHG A;  4A6H A;  3ULB A;  5FI0 A;  2D11 A;  2X18 A;  5JLJ B;  3PVW A;  4HB3 B;  2RVB B;  3CXB B;  1MIX A;  4HAY B;  2DX5 A;  3HSA A;  4KHO A;  2DN6 A;  3VIA A;  4QJ4 B;  2RRF A;  1BTN A;  4YON A;  1V89 A;  4A5K A;  3F5R A;  1BWN A;  2KUQ A;  2Z0P A;  2L1C A;  2EC1 A;  5KQ1 A;  5DHA B;  4QJ5 B;  1Z87 A;  5D3V A;  3PEG A;  3D8D A;  4HAU B;  1I7A A;  1ZYI A;  4HB2 B;  4OT1 A;  1U5G A;  4K17 A;  5L81 A;  3SV1 A;  2DHK A;  3U8Z A;  2CAY A;  5HE1 A;  2GJY A;  4F7U P;  1UNP A;  2K2J A;  1X05 A;  1OMW A;  2LUL A;  4K2P A;  2N23 A;  5CLL B;  2LG1 A;  4HAW B;  3G9W A;  1XCG A;  3X23 A;  1QC6 A;  2ADZ A;  5FI1 A;  2R09 A;  3M1I B;  2KCJ A;  2V76 A;  2Y8F A;  1M7E A;  3PP2 A;  3DXE A;  5D3Y A;  3TW1 A;  2YS5 A;  3SYX A;  1W1G A;  2ROZ B;  3O96 A;  4GMV A;  4F7H A;  1P6S A;  3ODO A;  2ZPY A;  1GC7 A;  1RJ2 A;  3FEH A;  4WSF A;  2D4Q A;  1WJ1 A;  2COF A;  2D9Y A;  1NTY A;  3PVU A;  4HSI A;  2E2X A;  4EKU A;  4B6H A;  1KZG A;  2BCJ A;  3KZ1 A;  4MY6 A;  2EMS A;  2RGN B;  3PSC A;  1DRO A;  3T06 A;  4CHM A;  1BTK A;  1FGZ A;  2GS0 A;  2KIE A;  1UEF A;  1V5P A;  2DHJ A;  4HAX B;  4TYZ A;  2LOZ A;  3FM8 C;  1NU2 A;  2KUP A;  2YT1 A;  3V5W A;  1LB1 A;  3QWM A;  2COA A;  4DBB A;  2CRF A;  2DKQ A;  2KIG A;  4NY0 A;  4EJN A;  2JP2 A;  2Z59 A;  2IYB A;  3BJI A;  2I5F A;  3CIK A;  2N0Y A;  3TCA A;  3F0W A;  2PZ1 A;  2K8E A;  3P6A A;  5C6R A;  2GCL A;  1FOE A;  1XX0 A;  3KSY A;  2H7D A;  3DCX A;  2I1J A;  4ZRI A;  2YS1 A;  2ROV A;  2Y7B A;  2Z4D A;  1B55 A;  2YF0 A;  4XWX A;  4F7G A;  1FAO A;  2ZKM X;  1ZC4 B;  1H10 A;  2I5C A;  4HAV B;  3VOQ A;  1Q67 A;  2UVM A;  2J0K A;  4K2O A;  3HK0 A;  3FVC A;  1ZVR A;  3NW8 A;  1X1F A;  5DH9 B;  4Z2N A;  1PLS A;  5GOW B;  4PNK A;  1WG7 A;  2DA0 A;  3D8E A;  2COD A;  1XD4 A;  5D3W A;  2D9W A;  3NWD A;  3B77 A;  3N7C A;  4K81 A;  1DDM A;  5HE3 A;  2Q13 A;  1H4R A;  4ZRK A; 
#chains in the Genus database with same CATH homology
 1DBH A;  2RNR B;  3TFM A;  1FHX A;  2DYN A;  3PVL A;  4HDQ A;  5DI9 B;  2DHI A;  2EJ8 A;  3WYF B;  1MPH A;  4D0N B;  2QKM A;  2J59 M;  1MK9 B;  1P3R A;  4CHJ A;  3HQC A;  2YSZ A;  2W2W A;  1TQZ A;  4P7I A;  1BAK A;  2DX1 A;  5C16 A;  2Z0Q A;  1MKE A;  1GG3 A;  1DYN A;  1WVH A;  4WVF B;  1XR0 B;  5D3X A;  3KRW A;  1DDV A;  1XOD A;  2J0M A;  2MKR A;  2MDX A;  1X11 A;  2NZ8 B;  2CY5 A;  2DKP A;  5DIF B;  1MIZ B;  4Z2M B;  2RSG A;  2HTH B;  5JHH A;  2M38 A;  4GZU A;  5HE2 A;  4DX9 0;  2P0H A;  3PZD A;  4MT7 A;  1U5F A;  2NMB A;  1NTV A;  5CLQ B;  4KAX B;  1IRS A;  3IVF A;  2K00 A;  4H8S A;  1UPR A;  1V5M A;  2P0F A;  5DHF B;  2D9X A;  4BBK A;  3QIJ A;  4GMX B;  3SUZ A;  3D8F A;  5J3T A;  1UNR A;  1AQC A;  3AJ4 A;  2DYQ A;  1W1D A;  1UNQ A;  1X1G A;  3SO6 A;  3MDB C;  3TO1 A;  1ISN A;  1SGH A;  1MAI A;  1V61 A;  5KCV A;  4HDO A;  2DTC A;  5JP4 A;  1EVH A;  1U29 A;  4GN1 A;  3AU5 A;  3FSS A;  1XKE A;  3TVV A;  3RCP A;  2RUK B;  1OQN A;  3ODX A;  3NSU A;  5LON B;  4KHB B;  2J0J A;  4TKN A;  2EMT A;  2R0D A;  2OQB A;  3A98 B;  2L2I A;  2YVC A;  2QKL A;  1K5G B;  3A8Q A;  3P7Z A;  3PG7 A;  3QBV B;  4Y94 A;  4A6K A;  2UZR A;  2AEH A;  1LW3 A;  2FJL A;  1GC6 A;  5EFX A;  1Y5O A;  2W2X C;  3A8P A;  1U5D A;  2VRW B;  2P0D A;  2COC A;  1V5U A;  3KRX A;  3ODW A;  2W2X D;  1NI2 A;  1MK7 B;  2H7E A;  2D9V A;  1ZC3 B;  2RLO A;  3GYO A;  4GPT B;  1FGY A;  4DX8 A;  3GYP A;  3ZVR A;  4EMO A;  5D27 A;  4ZRJ A;  5C79 A;  4GXB A;  2LKO A;  3BIN A;  2AL6 A;  1PFJ A;  1E5W A;  4DXA B;  1W1H A;  3AU4 A;  4HB4 B;  4L6E A;  4IAP A;  2KGX B;  4MK0 A;  1ZM0 A;  2LOX A;  1QQG A;  1PMS A;  1U27 A;  1FHW A;  2XQN M;  5LOP B;  2P8V A;  3LJU X;  2D2Q A;  1U5E A;  2YS3 A;  2DFK A;  2VKI A;  3SNH A;  4PQ0 A;  4HB0 B;  3DXC A;  4A6F A;  1ZSQ A;  5J3Y A;  1RRP B;  1KZ7 A;  4YL8 A;  1P5T A;  2D9Z A;  5HE0 A;  1WJM A;  4HAT B;  1TJ6 A;  1WGU A;  2Y8G A;  2YRY A;  4NSW A;  2G35 A;  3ML4 A;  2M14 A;  3WA0 A;  2ELA A;  1WGQ A;  4A6F B;  3ZDT A;  5J3Q A;  1Y19 B;  2IFS A;  4C0A A;  2I1K A;  2VSZ A;  2MFQ A;  3OAN A;  1X86 A;  3ULC A;  3KY9 A;  1EF1 A;  4IFS A;  1OY2 A;  3UZT A;  2CY4 A;  1FHO A;  1EGX A;  1U2B A;  1AWE A;  1I2H A;  5C5B A;  2MWN B;  2OTX A;  1UPQ A;  1J19 A;  1FB8 A;  2K2U A;  1TXD A;  1K5D B;  1DDW A;  4IOY X;  1J0W A;  3U7D A;  4HHV A;  3DXD A;  3HW2 B;  4HAZ B;  2GCJ A;  2UZS A;  2Z0O A;  1M7R A;  3MPX A;  5C5B B;  1KI1 B;  4KVG B;  1V88 A;  4WJ7 A;  5KQ4 A;  2DLW A;  2D10 A;  4CYE A;  4KHA A;  2HE7 A;  1EAZ A;  2YT0 A;  2LYD A;  1N3H A;  1SHC A;  2ELB A;  1WI1 A;  5JHG A;  4A6H A;  3ULB A;  5FI0 A;  2D11 A;  2X18 A;  5JLJ B;  3PVW A;  4HB3 B;  2RVB B;  3CXB B;  1MIX A;  4HAY B;  2DX5 A;  4KHO A;  2DN6 A;  3VIA A;  1BTN A;  4YON A;  1V89 A;  4A5K A;  3F5R A;  1BWN A;  2Z0P A;  2L1C A;  2EC1 A;  5KQ1 A;  5DHA B;  1Z87 A;  5D3V A;  3PEG A;  3D8D A;  4HAU B;  1I7A A;  4HB2 B;  1U5G A;  4K17 A;  5L81 A;  3SV1 A;  2DHK A;  3U8Z A;  2CAY A;  5HE1 A;  2GJY A;  4F7U P;  1UNP A;  2K2J A;  1X05 A;  1OMW A;  2LUL A;  4K2P A;  2N23 A;  5CLL B;  2LG1 A;  4HAW B;  3G9W A;  1XCG A;  3X23 A;  1QC6 A;  2ADZ A;  5FI1 A;  2R09 A;  3M1I B;  2KCJ A;  2V76 A;  2Y8F A;  1M7E A;  3PP2 A;  3DXE A;  5D3Y A;  3TW1 A;  2YS5 A;  3SYX A;  1W1G A;  2ROZ B;  3O96 A;  4GMV A;  4F7H A;  1P6S A;  3ODO A;  2ZPY A;  1GC7 A;  1RJ2 A;  3FEH A;  4WSF A;  2D4Q A;  1WJ1 A;  2COF A;  2D9Y A;  1NTY A;  3PVU A;  2E2X A;  4EKU A;  4B6H A;  1KZG A;  2BCJ A;  3KZ1 A;  4MY6 A;  2EMS A;  2RGN B;  3PSC A;  1DRO A;  3T06 A;  4CHM A;  1BTK A;  1FGZ A;  2GS0 A;  1UEF A;  1V5P A;  2DHJ A;  4HAX B;  4TYZ A;  2LOZ A;  3FM8 C;  1NU2 A;  2KUP A;  2YT1 A;  3V5W A;  1LB1 A;  3QWM A;  2COA A;  4DBB A;  2CRF A;  2DKQ A;  4NY0 A;  4EJN A;  2JP2 A;  2IYB A;  3BJI A;  2I5F A;  3CIK A;  2N0Y A;  3TCA A;  3F0W A;  2PZ1 A;  3P6A A;  5C6R A;  2GCL A;  1FOE A;  1XX0 A;  3KSY A;  2H7D A;  2I1J A;  4ZRI A;  2YS1 A;  2ROV A;  2Y7B A;  1B55 A;  2YF0 A;  4XWX A;  4F7G A;  1FAO A;  1ZC4 B;  1H10 A;  2I5C A;  4HAV B;  3VOQ A;  1Q67 A;  2UVM A;  2J0K A;  4K2O A;  3HK0 A;  1ZVR A;  1X1F A;  5DH9 B;  4Z2N A;  1PLS A;  5GOW B;  4PNK A;  1WG7 A;  2DA0 A;  3D8E A;  2COD A;  1XD4 A;  5D3W A;  2D9W A;  3N7C A;  4K81 A;  1DDM A;  5HE3 A;  2Q13 A;  1H4R A;  4ZRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...