2CAYA

Vps36 n-terminal ph domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
132
structure length
132
Chain Sequence
HHMEYWHYVETTSSGQPLLREGEKDIFIDQSVGLYHGKSKILQRQRGRIFLTSQRIIYIDDAKPTQNSLGLELDDLAYVNYSSGFLTRSPRLILFFKDPSSSTEFVQLSFRKSDGVLFSQATERALENILTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Escrt-I Core and Escrt-II Glue Domain Structures Reveal Role for Glue in Linking to Escrt-I and Membranes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport
molecule keywords VACUOLAR PROTEIN SORTING PROTEIN 36
total genus 31
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11605 Vps36_ESCRT-II Vacuolar protein sorting protein 36 Vps36
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2cayA00
2GCLA 4CHMA 1DDMA 2VKIA 5JHHA 2J0MA 1GG3A 4NSWA 2DYNA 2EC1A 3UZTA 2DKPA 3PSCA 2YS1A 2COFA 1BAKA 1U5FA 2CAYA 2UVMA 4MK0A 1WGUA 4P7IA 2CODA 1DYNA 1FHOA 2RLOA 1NI2A 3TCAA 2K2JA 4B6HA 5L81A 4A5KA 3HQCA 3TO1A 3ODOA 1UPQA 1J19A 2KUPA 3X23A 3U8ZA 5KQ4A 1BWNA 3VIAA 1ZSQA 2R0DA 1TXDA 2AL6A 2LYDA 2DHKA 3ULBA 1U5DA 2YS5A 2CY5A 4IAPA 5J3TA 1ZC4B 4K81A 1U5GA 3ZVRA 3IVFA 4F7GA 3FSSA 2D11A 4NY0A 2RUKB 3CIKA 5C16A 3QWMA 1E5WA 2GCJA 2L1CA 4CHJA 4HB4B 4BBKA 2YSZA 2EJ8A 1U2BA 3CXBB 1X05A 2LOXA 2Q13A 1XODA 1V5MA 2YT0A 2ELBA 5J3YA 4IFSA 4HDOA 1NTYA 3WYFB 3GYPA 3A8PA 3TFMA 2YVCA 3ODXA 3SYXA 1W1GA 3OANA 2MWNB 5D3VA 2R09A 3DXEA 4XWXA 1U5EA 2W2XC 2Z0OA 2D9VA 2NZ8B 1J0WA 2DHJA 1SGHA 5DHFB 5JLJB 5KQ1A 1FOEA 2K00A 4GMVA 1V5UA 4F7UP 3KY9A 1BTKA 1BTNA 4HAXB 4A6HA 1RRPB 4HHVA 2DYQA 2K2UA 1FB8A 5JHGA 5DH9B 1FHXA 2D2QA 1FHWA 2DFKA 1K5DB 5HE2A 2OTXA 3KRWA 2DA0A 2IFSA 4HAVB 4EMOA 1MKEA 2Z0QA 3HK0A 1FGZA 1EAZA 3AJ4A 3A98B 1AWEA 2JP2A 1Y19B 1KZ7A 4MY6A 3TVVA 4YONA 2ZPYA 1PLSA 4H8SA 1TQZA 2NMBA 1FGYA 2X18A 4EKUA 3NSUA 1Y5OA 3U7DA 1I2HA 1V61A 4Z2NA 2XQNM 3PZDA 2H7EA 3P6AA 1OQNA 2I5FA 4Z2MB 1LW3A 1N3HA 1SHCA 2DLWA 1PMSA 2FJLA 1OMWA 4ZRKA 2MDXA 4KAXB 1GC6A 3MDBC 1ZC3B 3KRXA 4KVGB 1M7EA 3SNHA 3HW2B 5CLLB 1K5GB 1XX0A 4GZUA 4DXAB 1EF1A 3BINA 2DX1A 1Q67A 1ISNA 2D9YA 3D8EA 1TJ6A 2DTCA 2L2IA 3QIJA 4F7HA 3P7ZA 4A6FB 1P6SA 1UPRA 5HE3A 3SO6A 2Y7BA 3VOQA 1ZM0A 5C5BB 2GJYA 2ROZB 4K17A 1P3RA 1U29A 2Y8FA 2QKMA 1M7RA 4A6KA 2LKOA 1X1FA 3T06A 4A6FA 4IOYX 2UZSA 2UZRA 2I5CA 3M1IB 2ADZA 1Z87A 2EMSA 1GC7A 2I1KA 1FAOA 2G35A 2YF0A 2W2WA 1OY2A 2P0HA 4HAWB 2W2XD 2YRYA 3ODWA 3RCPA 4KHAA 2D10A 4MT7A 5DIFB 1MIXA 2ELAA 1UNQA 5FI0A 3AU5A 2CRFA 2CY4A 1UEFA 3ULCA 4HAZB 4TYZA 3FM8C 3SUZA 3SV1A 4HATB 1KI1B 2LOZA 4GXBA 1EVHA 2GS0A 3PVUA 5JP4A 1NTVA 4C0AA 1H10A 1KZGA 3TW1A 1LB1A 2D9ZA 4DX90 2KGXB 4HAUB 2COCA 5D3XA 5C6RA 3PEGA 1XCGA 2COAA 1XD4A 3D8DA 1P5TA 1U27A 5KCVA 2EMTA 1X86A 3LJUX 1I7AA 5C5BA 2DN6A 1WJMA 3GYOA 1AQCA 3PP2A 1MPHA 2I1JA 2P0FA 2VSZA 1XR0B 4DBBA 4YL8A 2DHIA 1WG7A 1QC6A 3G9WA 2RSGA 2Z0PA 1MAIA 5J3QA 5D27A 1DDWA 3F5RA 4WSFA 1W1DA 3F0WA 3ML4A 2J59M 1DROA 3DXDA 1EGXA 2Y8GA 5LOPB 3A8QA 5LONB 2HE7A 4L6EA 2ROVA 4ZRJA 2M14A 1PFJA 2J0KA 2D9XA 4CYEA 1H4RA 3PVWA 4KHOA 1V88A 3ZDTA 2LULA 1WI1A 3PVLA 1DDVA 1MK9B 2MFQA 5C79A 2RNRB 4HB0B 3BJIA 2DX5A 2VRWB 5GOWB 1UNPA 3O96A 5DI9B 3WA0A 1WJ1A 1B55A 2V76A 3PG7A 5D3YA 2D9WA 2N0YA 2HTHB 2YT1A 2IYBA 3KZ1A 4Y94A 2QKLA 3QBVB 4K2OA 2PZ1A 5EFXA 4HB3B 2N23A 1NU2A 3AU4A 1XKEA 4KHBB 5D3WA 1IRSA 2H7DA 3DXCA 5CLQB 4HB2B 1WVHA 1MIZB 4DX8A 5HE0A 1UNRA 4PQ0A 4D0NB 3N7CA 4HAYB 2D4QA 2AEHA 4TKNA 1DBHA 3FEHA 2P8VA 3MPXA 5HE1A 4GMXB 1RJ2A 4HDQA 1X1GA 4GN1A 4GPTB 1QQGA 2RVBB 4ZRIA 2E2XA 1W1HA 2DKQA 3D8FA 1ZVRA 2OQBA 2BCJA 2MKRA 1X11A 4WJ7A 1MK7B 1WGQA 2M38A 4EJNA 3KSYA 1V5PA 2YS3A 5FI1A 2J0JA 2RGNB 5DHAB 3V5WA 4WVFB 1V89A 2KCJA 2LG1A 2P0DA 4K2PA 4PNKA
chains in the Genus database with same CATH superfamily
2GCLA 4CHMA 1DDMA 2VKIA 5JHHA 2J0MA 1GG3A 4NSWA 2DYNA 2EC1A 3UZTA 2DKPA 3PSCA 2YS1A 2COFA 1BAKA 1U5FA 2CAYA 2UVMA 4MK0A 4GNKB 1WGUA 4P7IA 2CODA 1DYNA 1FHOA 2RLOA 1NI2A 3TCAA 2K2JA 4B6HA 5L81A 4A5KA 3HQCA 3TO1A 3ODOA 1UPQA 1J19A 2KUPA 3X23A 3U8ZA 5KQ4A 1BWNA 3VIAA 1ZSQA 2R0DA 2GUMA 1TXDA 2AL6A 5LG4B 2LYDA 2DHKA 3ULBA 1U5DA 2YS5A 2CY5A 4IAPA 5J3TA 1ZC4B 2KIGA 4K81A 1U5GA 3ZVRA 3IVFA 4F7GA 3FSSA 2D11A 4NY0A 2ZKMX 2RUKB 3CIKA 5C16A 3QWMA 1E5WA 2GCJA 4KHBA 2L1CA 4CHJA 4HB4B 4BBKA 2YSZA 2EJ8A 4OSNA 1U2BA 3CXBB 1X05A 2LOXA 2Q13A 1XODA 1V5MA 2KR0A 2YT0A 2ELBA 5J3YA 4IFSA 1NTYA 4HDOA 2Z13A 3WYFB 3GYPA 3A8PA 3TFMA 2YVCA 3ODXA 3SYXA 1W1GA 3OANA 2MWNB 5D3VA 2R09A 3DXEA 4XWXA 1U5EA 2W2XC 2Z0OA 2D9VA 2NZ8B 1J0WA 2DHJA 1SGHA 4DIXA 5DHFB 5JLJB 5KQ1A 5IRSA 1FOEA 2K00A 4GMVA 1V5UA 4F7UP 1ZYIA 3KY9A 1BTKA 1BTNA 4HAXB 4A6HA 1RRPB 4HHVA 2DYQA 3NWAA 2K2UA 3U12A 1FB8A 2K8EA 5JHGA 5DH9B 1FHXA 2D2QA 1FHWA 2DFKA 1K5DB 5HE2A 2OTXA 3KRWA 2DA0A 2IFSA 4HAVB 4EMOA 2R2YA 1MKEA 2Z0QA 3NW8A 3HK0A 1FGZA 1EAZA 3AJ4A 3A98B 1AWEA 2JP2A 1Y19B 1KZ7A 4MY6A 3TVVA 4CSQA 4YONA 2ZPYA 4L1RA 1PLSA 4H8SA 1TQZA 2NMBA 1FGYA 2X18A 4EKUA 3NSUA 1Y5OA 3U7DA 1I2HA 1V61A 4Z2NA 2XQNM 3PZDA 2H7EA 3P6AA 1OQNA 2I5FA 4Z2MB 1LW3A 1N3HA 1SHCA 2DLWA 3HIEA 1PMSA 2FJLA 1OMWA 4ZRKA 2MDXA 4KAXB 1GC6A 3MDBC 1ZC3B 3KRXA 4KVGB 1M7EA 3SNHA 3HW2B 5CLLB 1K5GB 1XX0A 4GZUA 4DXAB 1EF1A 3BINA 2DX1A 1Q67A 2KUQA 1ISNA 2D9YA 3D8EA 1TJ6A 2DTCA 2L2IA 3QIJA 4F7HA 3P7ZA 4A6FB 3B77A 1P6SA 1UPRA 5HE3A 3SO6A 2Y7BA 3VOQA 1ZM0A 5C5BB 2GJYA 2ROZB 4K17A 1P3RA 1U29A 2Y8FA 2QKMA 1M7RA 4A6KA 2LKOA 1X1FA 3T06A 4A6FA 4IOYX 2UZSA 2UZRA 2I5CA 3M1IB 2ADZA 1Z87A 2Z14A 2EMSA 1GC7A 2I1KA 1FAOA 2G35A 2YF0A 2W2WA 1OY2A 2P0HA 4HAWB 2W2XD 2YRYA 4QJ4B 3ODWA 5M4YB 3RCPA 4KHAA 2D10A 4MT7A 5DIFB 1MIXA 2ELAA 1UNQA 3OHMB 5FI0A 3AU5A 2CRFA 2CY4A 4QJ3B 1UEFA 3ULCA 4HAZB 4TYZA 3FM8C 3SUZA 3SV1A 4HATB 1KI1B 2LOZA 4GXBA 1EVHA 2GS0A 3PVUA 2K49A 5JP4A 1NTVA 3FVCA 4C0AA 1H10A 1KZGA 3TW1A 1LB1A 2D9ZA 2RRFA 4DX90 2KGXB 4HAUB 2COCA 5D3XA 4D6WA 5C6RA 3PEGA 1XCGA 2COAA 3DCXA 1XD4A 3D8DA 4HSIA 1P5TA 1U27A 5KCVA 2EMTA 1X86A 3LJUX 1I7AA 5C5BA 2DN6A 3GYOA 1WJMA 1AQCA 3PP2A 1MPHA 2I1JA 2P0FA 2VSZA 1XR0B 4DBBA 4YL8A 2DHIA 1WG7A 1QC6A 3G9WA 2RSGA 2Z0PA 1MAIA 2KIEA 5J3QA 5D27A 1DDWA 3F5RA 4QJ5B 4WSFA 1W1DA 3F0WA 3NWDA 3ML4A 2J59M 4GOUA 1DROA 3DXDA 1EGXA 2Y8GA 5LOPB 2NBVA 3A8QA 5LONB 2HE7A 4L6EA 2ROVA 2YT2A 4ZRJA 2M14A 1PFJA 2J0KA 2D9XA 4CYEA 1H4RA 3PVWA 4KHOA 1V88A 3ZDTA 2LULA 1WI1A 3HSAA 3PVLA 1DDVA 1MK9B 2MFQA 5C79A 1T77A 2RNRB 4HB0B 3BJIA 2DX5A 2VRWB 5GOWB 1UNPA 3O96A 5DI9B 5I2SA 3WA0A 1WJ1A 1B55A 2V76A 3PG7A 5D3YA 2D9WA 2N0YA 2HTHB 2YT1A 2IYBA 3KZ1A 4Y94A 2QKLA 3QBVB 4K2OA 4OT1A 2PZ1A 5EFXA 4HB3B 2N23A 1NU2A 3AU4A 1XKEA 4KHBB 5D3WA 1IRSA 2H7DA 3DXCA 3A58A 5CLQB 4HB2B 1WVHA 1MIZB 4DX8A 5HE0A 1UNRA 4PQ0A 4D0NB 3N7CA 4HAYB 2D4QA 2AEHA 4TKNA 1DBHA 3FEHA 2P8VA 3MPXA 5HE1A 4GMXB 1RJ2A 4HDQA 1MI1A 1X1GA 4GN1A 4GPTB 1QQGA 2RVBB 4ZRIA 2E2XA 1W1HA 2DKQA 3D8FA 1ZVRA 2OQBA 2BCJA 2MKRA 1X11A 4WJ7A 1MK7B 1WGQA 2M38A 4EJNA 4QXAB 3KSYA 1V5PA 4PNKA 5I2MA 2YS3A 5FI1A 2J0JA 2Z59A 2RGNB 5DHAB 3V5WA 4WVFB 3NWFA 1V89A 2FJUB 2KCJA 2LG1A 2P0DA 4K2PA 2Z4DA
chains in the Genus database with same CATH topology
2GCLA 4CHMA 1DDMA 2VKIA 5JHHA 2J0MA 1GG3A 4NSWA 2DYNA 2EC1A 3UZTA 2DKPA 3PSCA 2YS1A 2COFA 1BAKA 1U5FA 2CAYA 2UVMA 4MK0A 1WGUA 4P7IA 2CODA 1DYNA 1FHOA 2RLOA 1NI2A 3TCAA 2K2JA 4B6HA 5L81A 4A5KA 3HQCA 3TO1A 3ODOA 1UPQA 1J19A 2KUPA 3X23A 3U8ZA 5KQ4A 1BWNA 3VIAA 1ZSQA 2R0DA 1TXDA 2AL6A 2LYDA 2DHKA 3ULBA 1U5DA 2YS5A 2CY5A 4IAPA 5J3TA 1ZC4B 4K81A 1U5GA 3ZVRA 3IVFA 4F7GA 3FSSA 2D11A 4NY0A 2RUKB 3CIKA 5C16A 3QWMA 1E5WA 2GCJA 2L1CA 4CHJA 4HB4B 4BBKA 2YSZA 2EJ8A 1U2BA 3CXBB 1X05A 2LOXA 2Q13A 1XODA 1V5MA 2YT0A 2ELBA 5J3YA 4IFSA 4HDOA 1NTYA 3WYFB 3GYPA 3A8PA 3TFMA 2YVCA 3ODXA 3SYXA 1W1GA 3OANA 2MWNB 5D3VA 2R09A 3DXEA 4XWXA 1U5EA 2W2XC 2Z0OA 2D9VA 2NZ8B 1J0WA 2DHJA 1SGHA 5DHFB 5JLJB 5KQ1A 1FOEA 2K00A 4GMVA 1V5UA 4F7UP 3KY9A 1BTKA 1BTNA 4HAXB 4A6HA 1RRPB 4HHVA 2DYQA 2K2UA 1FB8A 5JHGA 5DH9B 1FHXA 2D2QA 1FHWA 2DFKA 1K5DB 5HE2A 2OTXA 3KRWA 2DA0A 2IFSA 4HAVB 4EMOA 1MKEA 2Z0QA 3HK0A 1FGZA 1EAZA 3AJ4A 3A98B 1AWEA 2JP2A 1Y19B 1KZ7A 4MY6A 3TVVA 4YONA 2ZPYA 1PLSA 4H8SA 1TQZA 2NMBA 1FGYA 2X18A 4EKUA 3NSUA 1Y5OA 3U7DA 1I2HA 1V61A 4Z2NA 2XQNM 3PZDA 2H7EA 3P6AA 1OQNA 2I5FA 4Z2MB 1LW3A 1N3HA 1SHCA 2DLWA 1PMSA 2FJLA 1OMWA 4ZRKA 2MDXA 4KAXB 1GC6A 3MDBC 1ZC3B 3KRXA 4KVGB 1M7EA 3SNHA 3HW2B 5CLLB 1K5GB 1XX0A 4GZUA 4DXAB 1EF1A 3BINA 2DX1A 1Q67A 1ISNA 2D9YA 3D8EA 1TJ6A 2DTCA 2L2IA 3QIJA 4F7HA 3P7ZA 4A6FB 1P6SA 1UPRA 5HE3A 3SO6A 2Y7BA 3VOQA 1ZM0A 5C5BB 2GJYA 2ROZB 4K17A 1P3RA 1U29A 2Y8FA 2QKMA 1M7RA 4A6KA 2LKOA 1X1FA 3T06A 4A6FA 4IOYX 2UZSA 2UZRA 2I5CA 3M1IB 2ADZA 1Z87A 2EMSA 1GC7A 2I1KA 1FAOA 2G35A 2YF0A 2W2WA 1OY2A 2P0HA 4HAWB 2W2XD 2YRYA 3ODWA 3RCPA 4KHAA 2D10A 4MT7A 5DIFB 1MIXA 2ELAA 1UNQA 5FI0A 3AU5A 2CRFA 2CY4A 1UEFA 3ULCA 4HAZB 4TYZA 3FM8C 3SUZA 3SV1A 4HATB 1KI1B 2LOZA 4GXBA 1EVHA 2GS0A 3PVUA 5JP4A 1NTVA 4C0AA 1H10A 1KZGA 3TW1A 1LB1A 2D9ZA 4DX90 2KGXB 4HAUB 2COCA 5D3XA 5C6RA 3PEGA 1XCGA 2COAA 1XD4A 3D8DA 1P5TA 1U27A 5KCVA 2EMTA 1X86A 3LJUX 1I7AA 5C5BA 2DN6A 1WJMA 3GYOA 1AQCA 3PP2A 1MPHA 2I1JA 2P0FA 2VSZA 1XR0B 4DBBA 4YL8A 2DHIA 1WG7A 1QC6A 3G9WA 2RSGA 2Z0PA 1MAIA 5J3QA 5D27A 1DDWA 3F5RA 4WSFA 1W1DA 3F0WA 3ML4A 2J59M 1DROA 3DXDA 1EGXA 2Y8GA 5LOPB 3A8QA 5LONB 2HE7A 4L6EA 2ROVA 4ZRJA 2M14A 1PFJA 2J0KA 2D9XA 4CYEA 1H4RA 3PVWA 4KHOA 1V88A 3ZDTA 2LULA 1WI1A 3PVLA 1DDVA 1MK9B 2MFQA 5C79A 2RNRB 4HB0B 3BJIA 2DX5A 2VRWB 5GOWB 1UNPA 3O96A 5DI9B 3WA0A 1WJ1A 1B55A 2V76A 3PG7A 5D3YA 2D9WA 2N0YA 2HTHB 2YT1A 2IYBA 3KZ1A 4Y94A 2QKLA 3QBVB 4K2OA 2PZ1A 5EFXA 4HB3B 2N23A 1NU2A 3AU4A 1XKEA 4KHBB 5D3WA 1IRSA 2H7DA 3DXCA 5CLQB 4HB2B 1WVHA 1MIZB 4DX8A 5HE0A 1UNRA 4PQ0A 4D0NB 3N7CA 4HAYB 2D4QA 2AEHA 4TKNA 1DBHA 3FEHA 2P8VA 3MPXA 5HE1A 4GMXB 1RJ2A 4HDQA 1X1GA 4GN1A 4GPTB 1QQGA 2RVBB 4ZRIA 2E2XA 1W1HA 2DKQA 3D8FA 1ZVRA 2OQBA 2BCJA 2MKRA 1X11A 4WJ7A 1MK7B 1WGQA 2M38A 4EJNA 3KSYA 1V5PA 2YS3A 5FI1A 2J0JA 2RGNB 5DHAB 3V5WA 4WVFB 1V89A 2KCJA 2LG1A 2P0DA 4K2PA 4PNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GCL A;  4CHM A;  1DDM A;  2VKI A;  5JHH A;  2J0M A;  1GG3 A;  4NSW A;  2DYN A;  2EC1 A;  3UZT A;  2DKP A;  3PSC A;  2YS1 A;  2COF A;  1BAK A;  1U5F A;  2CAY A;  2UVM A;  4MK0 A;  1WGU A;  4P7I A;  2COD A;  1DYN A;  1FHO A;  2RLO A;  1NI2 A;  3TCA A;  2K2J A;  4B6H A;  5L81 A;  4A5K A;  3HQC A;  3TO1 A;  3ODO A;  1UPQ A;  1J19 A;  2KUP A;  3X23 A;  3U8Z A;  5KQ4 A;  1BWN A;  3VIA A;  1ZSQ A;  2R0D A;  1TXD A;  2AL6 A;  2LYD A;  2DHK A;  3ULB A;  1U5D A;  2YS5 A;  2CY5 A;  4IAP A;  5J3T A;  1ZC4 B;  4K81 A;  1U5G A;  3ZVR A;  3IVF A;  4F7G A;  3FSS A;  2D11 A;  4NY0 A;  2RUK B;  3CIK A;  5C16 A;  3QWM A;  1E5W A;  2GCJ A;  2L1C A;  4CHJ A;  4HB4 B;  4BBK A;  2YSZ A;  2EJ8 A;  1U2B A;  3CXB B;  1X05 A;  2LOX A;  2Q13 A;  1XOD A;  1V5M A;  2YT0 A;  2ELB A;  5J3Y A;  4IFS A;  4HDO A;  1NTY A;  3WYF B;  3GYP A;  3A8P A;  3TFM A;  2YVC A;  3ODX A;  3SYX A;  1W1G A;  3OAN A;  2MWN B;  5D3V A;  2R09 A;  3DXE A;  4XWX A;  1U5E A;  2W2X C;  2Z0O A;  2D9V A;  2NZ8 B;  1J0W A;  2DHJ A;  1SGH A;  5DHF B;  5JLJ B;  5KQ1 A;  1FOE A;  2K00 A;  4GMV A;  1V5U A;  4F7U P;  3KY9 A;  1BTK A;  1BTN A;  4HAX B;  4A6H A;  1RRP B;  4HHV A;  2DYQ A;  2K2U A;  1FB8 A;  5JHG A;  5DH9 B;  1FHX A;  2D2Q A;  1FHW A;  2DFK A;  1K5D B;  5HE2 A;  2OTX A;  3KRW A;  2DA0 A;  2IFS A;  4HAV B;  4EMO A;  1MKE A;  2Z0Q A;  3HK0 A;  1FGZ A;  1EAZ A;  3AJ4 A;  3A98 B;  1AWE A;  2JP2 A;  1Y19 B;  1KZ7 A;  4MY6 A;  3TVV A;  4YON A;  2ZPY A;  1PLS A;  4H8S A;  1TQZ A;  2NMB A;  1FGY A;  2X18 A;  4EKU A;  3NSU A;  1Y5O A;  3U7D A;  1I2H A;  1V61 A;  4Z2N A;  2XQN M;  3PZD A;  2H7E A;  3P6A A;  1OQN A;  2I5F A;  4Z2M B;  1LW3 A;  1N3H A;  1SHC A;  2DLW A;  1PMS A;  2FJL A;  1OMW A;  4ZRK A;  2MDX A;  4KAX B;  1GC6 A;  3MDB C;  1ZC3 B;  3KRX A;  4KVG B;  1M7E A;  3SNH A;  3HW2 B;  5CLL B;  1K5G B;  1XX0 A;  4GZU A;  4DXA B;  1EF1 A;  3BIN A;  2DX1 A;  1Q67 A;  1ISN A;  2D9Y A;  3D8E A;  1TJ6 A;  2DTC A;  2L2I A;  3QIJ A;  4F7H A;  3P7Z A;  4A6F B;  1P6S A;  1UPR A;  5HE3 A;  3SO6 A;  2Y7B A;  3VOQ A;  1ZM0 A;  5C5B B;  2GJY A;  2ROZ B;  4K17 A;  1P3R A;  1U29 A;  2Y8F A;  2QKM A;  1M7R A;  4A6K A;  2LKO A;  1X1F A;  3T06 A;  4A6F A;  4IOY X;  2UZS A;  2UZR A;  2I5C A;  3M1I B;  2ADZ A;  1Z87 A;  2EMS A;  1GC7 A;  2I1K A;  1FAO A;  2G35 A;  2YF0 A;  2W2W A;  1OY2 A;  2P0H A;  4HAW B;  2W2X D;  2YRY A;  3ODW A;  3RCP A;  4KHA A;  2D10 A;  4MT7 A;  5DIF B;  1MIX A;  2ELA A;  1UNQ A;  5FI0 A;  3AU5 A;  2CRF A;  2CY4 A;  1UEF A;  3ULC A;  4HAZ B;  4TYZ A;  3FM8 C;  3SUZ A;  3SV1 A;  4HAT B;  1KI1 B;  2LOZ A;  4GXB A;  1EVH A;  2GS0 A;  3PVU A;  5JP4 A;  1NTV A;  4C0A A;  1H10 A;  1KZG A;  3TW1 A;  1LB1 A;  2D9Z A;  4DX9 0;  2KGX B;  4HAU B;  2COC A;  5D3X A;  5C6R A;  3PEG A;  1XCG A;  2COA A;  1XD4 A;  3D8D A;  1P5T A;  1U27 A;  5KCV A;  2EMT A;  1X86 A;  3LJU X;  1I7A A;  5C5B A;  2DN6 A;  1WJM A;  3GYO A;  1AQC A;  3PP2 A;  1MPH A;  2I1J A;  2P0F A;  2VSZ A;  1XR0 B;  4DBB A;  4YL8 A;  2DHI A;  1WG7 A;  1QC6 A;  3G9W A;  2RSG A;  2Z0P A;  1MAI A;  5J3Q A;  5D27 A;  1DDW A;  3F5R A;  4WSF A;  1W1D A;  3F0W A;  3ML4 A;  2J59 M;  1DRO A;  3DXD A;  1EGX A;  2Y8G A;  5LOP B;  3A8Q A;  5LON B;  2HE7 A;  4L6E A;  2ROV A;  4ZRJ A;  2M14 A;  1PFJ A;  2J0K A;  2D9X A;  4CYE A;  1H4R A;  3PVW A;  4KHO A;  1V88 A;  3ZDT A;  2LUL A;  1WI1 A;  3PVL A;  1DDV A;  1MK9 B;  2MFQ A;  5C79 A;  2RNR B;  4HB0 B;  3BJI A;  2DX5 A;  2VRW B;  5GOW B;  1UNP A;  3O96 A;  5DI9 B;  3WA0 A;  1WJ1 A;  1B55 A;  2V76 A;  3PG7 A;  5D3Y A;  2D9W A;  2N0Y A;  2HTH B;  2YT1 A;  2IYB A;  3KZ1 A;  4Y94 A;  2QKL A;  3QBV B;  4K2O A;  2PZ1 A;  5EFX A;  4HB3 B;  2N23 A;  1NU2 A;  3AU4 A;  1XKE A;  4KHB B;  5D3W A;  1IRS A;  2H7D A;  3DXC A;  5CLQ B;  4HB2 B;  1WVH A;  1MIZ B;  4DX8 A;  5HE0 A;  1UNR A;  4PQ0 A;  4D0N B;  3N7C A;  4HAY B;  2D4Q A;  2AEH A;  4TKN A;  1DBH A;  3FEH A;  2P8V A;  3MPX A;  5HE1 A;  4GMX B;  1RJ2 A;  4HDQ A;  1X1G A;  4GN1 A;  4GPT B;  1QQG A;  2RVB B;  4ZRI A;  2E2X A;  1W1H A;  2DKQ A;  3D8F A;  1ZVR A;  2OQB A;  2BCJ A;  2MKR A;  1X11 A;  4WJ7 A;  1MK7 B;  1WGQ A;  2M38 A;  4EJN A;  3KSY A;  1V5P A;  2YS3 A;  5FI1 A;  2J0J A;  2RGN B;  5DHA B;  3V5W A;  4WVF B;  1V89 A;  2KCJ A;  2LG1 A;  2P0D A;  4K2P A;  4PNK A; 
#chains in the Genus database with same CATH topology
 2GCL A;  4CHM A;  1DDM A;  2VKI A;  5JHH A;  2J0M A;  1GG3 A;  4NSW A;  2DYN A;  2EC1 A;  3UZT A;  2DKP A;  3PSC A;  2YS1 A;  2COF A;  1BAK A;  1U5F A;  2CAY A;  2UVM A;  4MK0 A;  4GNK B;  1WGU A;  4P7I A;  2COD A;  1DYN A;  1FHO A;  2RLO A;  1NI2 A;  3TCA A;  2K2J A;  4B6H A;  5L81 A;  4A5K A;  3HQC A;  3TO1 A;  3ODO A;  1UPQ A;  1J19 A;  2KUP A;  3X23 A;  3U8Z A;  5KQ4 A;  1BWN A;  3VIA A;  1ZSQ A;  2R0D A;  2GUM A;  1TXD A;  2AL6 A;  5LG4 B;  2LYD A;  2DHK A;  3ULB A;  1U5D A;  2YS5 A;  2CY5 A;  4IAP A;  5J3T A;  1ZC4 B;  2KIG A;  4K81 A;  1U5G A;  3ZVR A;  3IVF A;  4F7G A;  3FSS A;  2D11 A;  4NY0 A;  2ZKM X;  2RUK B;  3CIK A;  5C16 A;  3QWM A;  1E5W A;  2GCJ A;  4KHB A;  2L1C A;  4CHJ A;  4HB4 B;  4BBK A;  2YSZ A;  2EJ8 A;  4OSN A;  1U2B A;  3CXB B;  1X05 A;  2LOX A;  2Q13 A;  1XOD A;  1V5M A;  2KR0 A;  2YT0 A;  2ELB A;  5J3Y A;  4IFS A;  1NTY A;  4HDO A;  2Z13 A;  3WYF B;  3GYP A;  3A8P A;  3TFM A;  2YVC A;  3ODX A;  3SYX A;  1W1G A;  3OAN A;  2MWN B;  5D3V A;  2R09 A;  3DXE A;  4XWX A;  1U5E A;  2W2X C;  2Z0O A;  2D9V A;  2NZ8 B;  1J0W A;  2DHJ A;  1SGH A;  4DIX A;  5DHF B;  5JLJ B;  5KQ1 A;  5IRS A;  1FOE A;  2K00 A;  4GMV A;  1V5U A;  4F7U P;  1ZYI A;  3KY9 A;  1BTK A;  1BTN A;  4HAX B;  4A6H A;  1RRP B;  4HHV A;  2DYQ A;  3NWA A;  2K2U A;  3U12 A;  1FB8 A;  2K8E A;  5JHG A;  5DH9 B;  1FHX A;  2D2Q A;  1FHW A;  2DFK A;  1K5D B;  5HE2 A;  2OTX A;  3KRW A;  2DA0 A;  2IFS A;  4HAV B;  4EMO A;  2R2Y A;  1MKE A;  2Z0Q A;  3NW8 A;  3HK0 A;  1FGZ A;  1EAZ A;  3AJ4 A;  3A98 B;  1AWE A;  2JP2 A;  1Y19 B;  1KZ7 A;  4MY6 A;  3TVV A;  4CSQ A;  4YON A;  2ZPY A;  4L1R A;  1PLS A;  4H8S A;  1TQZ A;  2NMB A;  1FGY A;  2X18 A;  4EKU A;  3NSU A;  1Y5O A;  3U7D A;  1I2H A;  1V61 A;  4Z2N A;  2XQN M;  3PZD A;  2H7E A;  3P6A A;  1OQN A;  2I5F A;  4Z2M B;  1LW3 A;  1N3H A;  1SHC A;  2DLW A;  3HIE A;  1PMS A;  2FJL A;  1OMW A;  4ZRK A;  2MDX A;  4KAX B;  1GC6 A;  3MDB C;  1ZC3 B;  3KRX A;  4KVG B;  1M7E A;  3SNH A;  3HW2 B;  5CLL B;  1K5G B;  1XX0 A;  4GZU A;  4DXA B;  1EF1 A;  3BIN A;  2DX1 A;  1Q67 A;  2KUQ A;  1ISN A;  2D9Y A;  3D8E A;  1TJ6 A;  2DTC A;  2L2I A;  3QIJ A;  4F7H A;  3P7Z A;  4A6F B;  3B77 A;  1P6S A;  1UPR A;  5HE3 A;  3SO6 A;  2Y7B A;  3VOQ A;  1ZM0 A;  5C5B B;  2GJY A;  2ROZ B;  4K17 A;  1P3R A;  1U29 A;  2Y8F A;  2QKM A;  1M7R A;  4A6K A;  2LKO A;  1X1F A;  3T06 A;  4A6F A;  4IOY X;  2UZS A;  2UZR A;  2I5C A;  3M1I B;  2ADZ A;  1Z87 A;  2Z14 A;  2EMS A;  1GC7 A;  2I1K A;  1FAO A;  2G35 A;  2YF0 A;  2W2W A;  1OY2 A;  2P0H A;  4HAW B;  2W2X D;  2YRY A;  4QJ4 B;  3ODW A;  5M4Y B;  3RCP A;  4KHA A;  2D10 A;  4MT7 A;  5DIF B;  1MIX A;  2ELA A;  1UNQ A;  3OHM B;  5FI0 A;  3AU5 A;  2CRF A;  2CY4 A;  4QJ3 B;  1UEF A;  3ULC A;  4HAZ B;  4TYZ A;  3FM8 C;  3SUZ A;  3SV1 A;  4HAT B;  1KI1 B;  2LOZ A;  4GXB A;  1EVH A;  2GS0 A;  3PVU A;  2K49 A;  5JP4 A;  1NTV A;  3FVC A;  4C0A A;  1H10 A;  1KZG A;  3TW1 A;  1LB1 A;  2D9Z A;  2RRF A;  4DX9 0;  2KGX B;  4HAU B;  2COC A;  5D3X A;  4D6W A;  5C6R A;  3PEG A;  1XCG A;  2COA A;  3DCX A;  1XD4 A;  3D8D A;  4HSI A;  1P5T A;  1U27 A;  5KCV A;  2EMT A;  1X86 A;  3LJU X;  1I7A A;  5C5B A;  2DN6 A;  3GYO A;  1WJM A;  1AQC A;  3PP2 A;  1MPH A;  2I1J A;  2P0F A;  2VSZ A;  1XR0 B;  4DBB A;  4YL8 A;  2DHI A;  1WG7 A;  1QC6 A;  3G9W A;  2RSG A;  2Z0P A;  1MAI A;  2KIE A;  5J3Q A;  5D27 A;  1DDW A;  3F5R A;  4QJ5 B;  4WSF A;  1W1D A;  3F0W A;  3NWD A;  3ML4 A;  2J59 M;  4GOU A;  1DRO A;  3DXD A;  1EGX A;  2Y8G A;  5LOP B;  2NBV A;  3A8Q A;  5LON B;  2HE7 A;  4L6E A;  2ROV A;  2YT2 A;  4ZRJ A;  2M14 A;  1PFJ A;  2J0K A;  2D9X A;  4CYE A;  1H4R A;  3PVW A;  4KHO A;  1V88 A;  3ZDT A;  2LUL A;  1WI1 A;  3HSA A;  3PVL A;  1DDV A;  1MK9 B;  2MFQ A;  5C79 A;  1T77 A;  2RNR B;  4HB0 B;  3BJI A;  2DX5 A;  2VRW B;  5GOW B;  1UNP A;  3O96 A;  5DI9 B;  5I2S A;  3WA0 A;  1WJ1 A;  1B55 A;  2V76 A;  3PG7 A;  5D3Y A;  2D9W A;  2N0Y A;  2HTH B;  2YT1 A;  2IYB A;  3KZ1 A;  4Y94 A;  2QKL A;  3QBV B;  4K2O A;  4OT1 A;  2PZ1 A;  5EFX A;  4HB3 B;  2N23 A;  1NU2 A;  3AU4 A;  1XKE A;  4KHB B;  5D3W A;  1IRS A;  2H7D A;  3DXC A;  3A58 A;  5CLQ B;  4HB2 B;  1WVH A;  1MIZ B;  4DX8 A;  5HE0 A;  1UNR A;  4PQ0 A;  4D0N B;  3N7C A;  4HAY B;  2D4Q A;  2AEH A;  4TKN A;  1DBH A;  3FEH A;  2P8V A;  3MPX A;  5HE1 A;  4GMX B;  1RJ2 A;  4HDQ A;  1MI1 A;  1X1G A;  4GN1 A;  4GPT B;  1QQG A;  2RVB B;  4ZRI A;  2E2X A;  1W1H A;  2DKQ A;  3D8F A;  1ZVR A;  2OQB A;  2BCJ A;  2MKR A;  1X11 A;  4WJ7 A;  1MK7 B;  1WGQ A;  2M38 A;  4EJN A;  4QXA B;  3KSY A;  1V5P A;  4PNK A;  5I2M A;  2YS3 A;  5FI1 A;  2J0J A;  2Z59 A;  2RGN B;  5DHA B;  3V5W A;  4WVF B;  3NWF A;  1V89 A;  2FJU B;  2KCJ A;  2LG1 A;  2P0D A;  4K2P A;  2Z4D A; 
#chains in the Genus database with same CATH homology
 2GCL A;  4CHM A;  1DDM A;  2VKI A;  5JHH A;  2J0M A;  1GG3 A;  4NSW A;  2DYN A;  2EC1 A;  3UZT A;  2DKP A;  3PSC A;  2YS1 A;  2COF A;  1BAK A;  1U5F A;  2CAY A;  2UVM A;  4MK0 A;  1WGU A;  4P7I A;  2COD A;  1DYN A;  1FHO A;  2RLO A;  1NI2 A;  3TCA A;  2K2J A;  4B6H A;  5L81 A;  4A5K A;  3HQC A;  3TO1 A;  3ODO A;  1UPQ A;  1J19 A;  2KUP A;  3X23 A;  3U8Z A;  5KQ4 A;  1BWN A;  3VIA A;  1ZSQ A;  2R0D A;  1TXD A;  2AL6 A;  2LYD A;  2DHK A;  3ULB A;  1U5D A;  2YS5 A;  2CY5 A;  4IAP A;  5J3T A;  1ZC4 B;  4K81 A;  1U5G A;  3ZVR A;  3IVF A;  4F7G A;  3FSS A;  2D11 A;  4NY0 A;  2RUK B;  3CIK A;  5C16 A;  3QWM A;  1E5W A;  2GCJ A;  2L1C A;  4CHJ A;  4HB4 B;  4BBK A;  2YSZ A;  2EJ8 A;  1U2B A;  3CXB B;  1X05 A;  2LOX A;  2Q13 A;  1XOD A;  1V5M A;  2YT0 A;  2ELB A;  5J3Y A;  4IFS A;  4HDO A;  1NTY A;  3WYF B;  3GYP A;  3A8P A;  3TFM A;  2YVC A;  3ODX A;  3SYX A;  1W1G A;  3OAN A;  2MWN B;  5D3V A;  2R09 A;  3DXE A;  4XWX A;  1U5E A;  2W2X C;  2Z0O A;  2D9V A;  2NZ8 B;  1J0W A;  2DHJ A;  1SGH A;  5DHF B;  5JLJ B;  5KQ1 A;  1FOE A;  2K00 A;  4GMV A;  1V5U A;  4F7U P;  3KY9 A;  1BTK A;  1BTN A;  4HAX B;  4A6H A;  1RRP B;  4HHV A;  2DYQ A;  2K2U A;  1FB8 A;  5JHG A;  5DH9 B;  1FHX A;  2D2Q A;  1FHW A;  2DFK A;  1K5D B;  5HE2 A;  2OTX A;  3KRW A;  2DA0 A;  2IFS A;  4HAV B;  4EMO A;  1MKE A;  2Z0Q A;  3HK0 A;  1FGZ A;  1EAZ A;  3AJ4 A;  3A98 B;  1AWE A;  2JP2 A;  1Y19 B;  1KZ7 A;  4MY6 A;  3TVV A;  4YON A;  2ZPY A;  1PLS A;  4H8S A;  1TQZ A;  2NMB A;  1FGY A;  2X18 A;  4EKU A;  3NSU A;  1Y5O A;  3U7D A;  1I2H A;  1V61 A;  4Z2N A;  2XQN M;  3PZD A;  2H7E A;  3P6A A;  1OQN A;  2I5F A;  4Z2M B;  1LW3 A;  1N3H A;  1SHC A;  2DLW A;  1PMS A;  2FJL A;  1OMW A;  4ZRK A;  2MDX A;  4KAX B;  1GC6 A;  3MDB C;  1ZC3 B;  3KRX A;  4KVG B;  1M7E A;  3SNH A;  3HW2 B;  5CLL B;  1K5G B;  1XX0 A;  4GZU A;  4DXA B;  1EF1 A;  3BIN A;  2DX1 A;  1Q67 A;  1ISN A;  2D9Y A;  3D8E A;  1TJ6 A;  2DTC A;  2L2I A;  3QIJ A;  4F7H A;  3P7Z A;  4A6F B;  1P6S A;  1UPR A;  5HE3 A;  3SO6 A;  2Y7B A;  3VOQ A;  1ZM0 A;  5C5B B;  2GJY A;  2ROZ B;  4K17 A;  1P3R A;  1U29 A;  2Y8F A;  2QKM A;  1M7R A;  4A6K A;  2LKO A;  1X1F A;  3T06 A;  4A6F A;  4IOY X;  2UZS A;  2UZR A;  2I5C A;  3M1I B;  2ADZ A;  1Z87 A;  2EMS A;  1GC7 A;  2I1K A;  1FAO A;  2G35 A;  2YF0 A;  2W2W A;  1OY2 A;  2P0H A;  4HAW B;  2W2X D;  2YRY A;  3ODW A;  3RCP A;  4KHA A;  2D10 A;  4MT7 A;  5DIF B;  1MIX A;  2ELA A;  1UNQ A;  5FI0 A;  3AU5 A;  2CRF A;  2CY4 A;  1UEF A;  3ULC A;  4HAZ B;  4TYZ A;  3FM8 C;  3SUZ A;  3SV1 A;  4HAT B;  1KI1 B;  2LOZ A;  4GXB A;  1EVH A;  2GS0 A;  3PVU A;  5JP4 A;  1NTV A;  4C0A A;  1H10 A;  1KZG A;  3TW1 A;  1LB1 A;  2D9Z A;  4DX9 0;  2KGX B;  4HAU B;  2COC A;  5D3X A;  5C6R A;  3PEG A;  1XCG A;  2COA A;  1XD4 A;  3D8D A;  1P5T A;  1U27 A;  5KCV A;  2EMT A;  1X86 A;  3LJU X;  1I7A A;  5C5B A;  2DN6 A;  1WJM A;  3GYO A;  1AQC A;  3PP2 A;  1MPH A;  2I1J A;  2P0F A;  2VSZ A;  1XR0 B;  4DBB A;  4YL8 A;  2DHI A;  1WG7 A;  1QC6 A;  3G9W A;  2RSG A;  2Z0P A;  1MAI A;  5J3Q A;  5D27 A;  1DDW A;  3F5R A;  4WSF A;  1W1D A;  3F0W A;  3ML4 A;  2J59 M;  1DRO A;  3DXD A;  1EGX A;  2Y8G A;  5LOP B;  3A8Q A;  5LON B;  2HE7 A;  4L6E A;  2ROV A;  4ZRJ A;  2M14 A;  1PFJ A;  2J0K A;  2D9X A;  4CYE A;  1H4R A;  3PVW A;  4KHO A;  1V88 A;  3ZDT A;  2LUL A;  1WI1 A;  3PVL A;  1DDV A;  1MK9 B;  2MFQ A;  5C79 A;  2RNR B;  4HB0 B;  3BJI A;  2DX5 A;  2VRW B;  5GOW B;  1UNP A;  3O96 A;  5DI9 B;  3WA0 A;  1WJ1 A;  1B55 A;  2V76 A;  3PG7 A;  5D3Y A;  2D9W A;  2N0Y A;  2HTH B;  2YT1 A;  2IYB A;  3KZ1 A;  4Y94 A;  2QKL A;  3QBV B;  4K2O A;  2PZ1 A;  5EFX A;  4HB3 B;  2N23 A;  1NU2 A;  3AU4 A;  1XKE A;  4KHB B;  5D3W A;  1IRS A;  2H7D A;  3DXC A;  5CLQ B;  4HB2 B;  1WVH A;  1MIZ B;  4DX8 A;  5HE0 A;  1UNR A;  4PQ0 A;  4D0N B;  3N7C A;  4HAY B;  2D4Q A;  2AEH A;  4TKN A;  1DBH A;  3FEH A;  2P8V A;  3MPX A;  5HE1 A;  4GMX B;  1RJ2 A;  4HDQ A;  1X1G A;  4GN1 A;  4GPT B;  1QQG A;  2RVB B;  4ZRI A;  2E2X A;  1W1H A;  2DKQ A;  3D8F A;  1ZVR A;  2OQB A;  2BCJ A;  2MKR A;  1X11 A;  4WJ7 A;  1MK7 B;  1WGQ A;  2M38 A;  4EJN A;  3KSY A;  1V5P A;  2YS3 A;  5FI1 A;  2J0J A;  2RGN B;  5DHA B;  3V5W A;  4WVF B;  1V89 A;  2KCJ A;  2LG1 A;  2P0D A;  4K2P A;  4PNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...