2CAYA

Vps36 n-terminal ph domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
132
structure length
132
Chain Sequence
HHMEYWHYVETTSSGQPLLREGEKDIFIDQSVGLYHGKSKILQRQRGRIFLTSQRIIYIDDAKPTQNSLGLELDDLAYVNYSSGFLTRSPRLILFFKDPSSSTEFVQLSFRKSDGVLFSQATERALENILTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VACUOLAR PROTEIN SORTING PROTEIN 36
publication title Escrt-I Core and Escrt-II Glue Domain Structures Reveal Role for Glue in Linking to Escrt-I and Membranes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport
total genus 31
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11605 Vps36_ESCRT-II Vacuolar protein sorting protein 36 Vps36
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2cayA00
2ROZB 3QWMA 5C6RA 2Y8GA 1FOEA 1UNRA 1GG3A 4DX90 4WVFB 1B55A 2KGXB 1MAIA 5LONB 3PEGA 2YS3A 5C79A 1WGQA 3PVUA 4Z2NA 2LOZA 3KZ1A 4MK0A 4ZRIA 2DFKA 4HAXB 5D27A 1GC6A 4CHMA 1DDWA 5C16A 5J3TA 3MDBC 1QC6A 1EF1A 2RUKB 1MIXA 1NTVA 1X11A 2J0KA 1FGZA 1ZC4B 5HE2A 3X23A 4HDOA 5D3XA 3RCPA 2JP2A 2EMTA 4GZUA 3PVLA 5KQ1A 3UZTA 2RSGA 4ZRKA 4EMOA 5FI1A 2LG1A 2J0JA 2ZPYA 4B6HA 3PSCA 5KQ4A 4HB0B 4PNKA 4P7IA 1KI1B 2D2QA 1UPRA 2DX1A 3P7ZA 2UVMA 1W1DA 1UEFA 3ML4A 2H7EA 3CIKA 1DROA 5D3YA 2RVBB 5DH9B 1DYNA 1PLSA 2CAYA 5GOWB 5C5BB 1WJMA 1FHOA 3VIAA 2GJYA 1U5EA 1I7AA 1X86A 4EJNA 2L2IA 1UNQA 2YSZA 4A6FB 4D0NB 3KRWA 2YVCA 2K2JA 3NSUA 2NZ8B 3U7DA 1OMWA 2D9XA 2R09A 2YF0A 1MKEA 3PP2A 1ZC3B 3P6AA 1QQGA 4KHOA 4NY0A 3WYFB 3FM8C 4DX8A 2YT1A 2COCA 1DDVA 1DDMA 3SO6A 2RGNB 3O96A 3LJUX 2MWNB 4MT7A 4IFSA 2J0MA 3GYOA 3M1IB 1V5PA 2DA0A 2DKQA 1PMSA 5KCVA 1PFJA 1P5TA 2M38A 1LB1A 3SNHA 2YS5A 3TCAA 4CHJA 1M7EA 2P8VA 1ZVRA 2P0DA 2K00A 1M7RA 4HAUB 4HAWB 4HAYB 2QKMA 4L6EA 3QBVB 3PVWA 3AU4A 2YS1A 4KAXB 2I1KA 2G35A 5D3WA 2ADZA 2V76A 3DXDA 1BAKA 1NTYA 4YL8A 2CY5A 2DKPA 1V5MA 4Z2MB 3MPXA 3D8DA 1XKEA 3PG7A 2COAA 1X1GA 2HTHB 2OQBA 1MPHA 1H4RA 4HB2B 2CODA 2W2XC 1BTNA 3ODWA 2Z0PA 3KRXA 2MDXA 1NU2A 1IRSA 2CY4A 3SUZA 5L81A 1Y19B 2LOXA 2R0DA 1XX0A 1ISNA 3ULCA 3QIJA 2L1CA 1WI1A 1P6SA 2DN6A 2CRFA 2YRYA 1BTKA 1FB8A 2KCJA 1WG7A 1V61A 2ELAA 3OANA 4KVGB 1BWNA 5DHFB 4F7GA 2UZSA 3AU5A 2GCJA 3VOQA 4GXBA 3DXEA 3KSYA 2D11A 2KUPA 3A8QA 4A6HA 1ZSQA 3A8PA 1KZ7A 2MKRA 4DBBA 2NMBA 4KHAA 4A6KA 1AQCA 2W2XD 3SV1A 2DHKA 3TO1A 2EMSA 1K5GB 2DYQA 1SHCA 2FJLA 2BCJA 1TXDA 2HE7A 4XWXA 4A5KA 2I5CA 2D9VA 2LYDA 3GYPA 1P3RA 2Y8FA 5LOPB 2E2XA 1U5DA 4BBKA 3F5RA 3A98B 3CXBB 1OQNA 4GMVA 2X18A 2UZRA 1FHWA 5DIFB 5JHHA 1X05A 3WA0A 4MY6A 1W1HA 3DXCA 2K2UA 4GN1A 2Z0QA 4EKUA 2D9WA 5J3YA 1U5GA 2XQNM 1U5FA 4K2PA 2AL6A 4HATB 1N3HA 4NSWA 4GPTB 5D3VA 1RRPB 4F7HA 1Q67A 1DBHA 1J0WA 1WVHA 4WJ7A 4K81A 1FHXA 3ODXA 1UPQA 2GS0A 1XR0B 2N23A 1OY2A 5HE0A 1Y5OA 2D10A 2VKIA 3BINA 4CYEA 3T06A 2DYNA 2Y7BA 4Y94A 5JHGA 2Q13A 4HDQA 1TJ6A 5JLJB 2DLWA 2D4QA 1WGUA 3ZDTA 1XD4A 1WJ1A 1MK9B 1I2HA 2AEHA 2EC1A 2D9ZA 3TVVA 3AJ4A 4H8SA 1W1GA 2IFSA 1U29A 2YT0A 1V88A 1NI2A 4F7UP 4IOYX 3N7CA 3TFMA 1X1FA 4IAPA 1EGXA 2VSZA 1E5WA 5FI0A 2RNRB 2P0FA 4YONA 2P0HA 2QKLA 3F0WA 5JP4A 1U2BA 5EFXA 5CLLB 4C0AA 1EAZA 1J19A 1MIZB 2COFA 1KZGA 1GC7A 2LKOA 2IYBA 2MFQA 2W2WA 1MK7B 1FGYA 2DHJA 3D8EA 2ELBA 2EJ8A 1U27A 5C5BA 3ODOA 4HHVA 1UNPA 1ZM0A 2J59M 1FAOA 4ZRJA 1RJ2A 4HAVB 4PQ0A 1Z87A 1H10A 3HW2B 4HAZB 4KHBB 4WSFA 3FEHA 3ULBA 3FSSA 4TYZA 2DTCA 4A6FA 1TQZA 2PZ1A 4HB4B 1LW3A 3ZVRA 4DXAB 3V5WA 1AWEA 3TW1A 4K17A 3SYXA 2VRWB 2I5FA 5DHAB 3HK0A 1V89A 2H7DA 1XCGA 2M14A 4K2OA 2LULA 2DHIA 5DI9B 2OTXA 3KY9A 4TKNA 3PZDA 3D8FA 3U8ZA 2Z0OA 3G9WA 1K5DB 2RLOA 2N0YA 1SGHA 2I1JA 1EVHA 1V5UA 3HQCA 1XODA 2ROVA 4HB3B 2GCLA 5HE1A 4GMXB 2DX5A 2D9YA 5J3QA 5HE3A 3IVFA 3BJIA 5CLQB
chains in the Genus database with same CATH superfamily
2ROZB 4CSQA 4QJ4B 3QWMA 5C6RA 5M4YB 2Y8GA 1FOEA 1UNRA 1GG3A 4OT1A 4DX90 4WVFB 1B55A 2KGXB 1MAIA 5LONB 3PEGA 2YS3A 5C79A 1WGQA 3PVUA 4Z2NA 2LOZA 3KZ1A 4MK0A 4ZRIA 2Z13A 2DFKA 1MI1A 4HAXB 5D27A 1GC6A 4CHMA 1DDWA 5C16A 5J3TA 3MDBC 1QC6A 5I2SA 1EF1A 2RUKB 1MIXA 1NTVA 1X11A 2J0KA 1FGZA 1ZC4B 5HE2A 3X23A 3DCXA 3HIEA 3NWFA 2KIEA 4HDOA 5D3XA 3RCPA 2JP2A 2EMTA 4GZUA 2YT2A 3PVLA 4D6WA 5KQ1A 3NWAA 3UZTA 2RSGA 4ZRKA 4EMOA 5FI1A 2LG1A 2J0JA 2ZPYA 4B6HA 3PSCA 5KQ4A 4HB0B 4PNKA 4P7IA 1KI1B 2D2QA 1UPRA 2DX1A 3P7ZA 2UVMA 1W1DA 2R2YA 1UEFA 3ML4A 2H7EA 3CIKA 1DROA 5D3YA 2RVBB 5DH9B 2K8EA 1DYNA 1PLSA 2CAYA 5GOWB 5C5BB 1WJMA 3HSAA 1FHOA 3VIAA 2GJYA 1U5EA 1I7AA 1X86A 4EJNA 2L2IA 1UNQA 2YSZA 4QJ5B 4A6FB 4D0NB 3KRWA 2YVCA 2K2JA 3NSUA 2NZ8B 3U7DA 1OMWA 2D9XA 2R09A 2YF0A 2KR0A 1MKEA 4GOUA 3PP2A 1ZC3B 3P6AA 1QQGA 4KHOA 4NY0A 3WYFB 3FM8C 4DX8A 2YT1A 2COCA 1DDVA 1DDMA 3SO6A 2RGNB 4QJ3B 3O96A 3LJUX 2MWNB 4MT7A 3NWDA 4IFSA 2J0MA 3GYOA 3M1IB 1V5PA 2DA0A 2DKQA 1PMSA 5KCVA 1PFJA 1P5TA 2M38A 1LB1A 3SNHA 2YS5A 3TCAA 4CHJA 2NBVA 1M7EA 2P8VA 1ZVRA 2P0DA 4HSIA 2K00A 1M7RA 4HAUB 4HAWB 4HAYB 2QKMA 4L6EA 3QBVB 3PVWA 3AU4A 2YS1A 4KAXB 2I1KA 2G35A 5D3WA 2ADZA 2V76A 3DXDA 1BAKA 1NTYA 4YL8A 2CY5A 2DKPA 1V5MA 4Z2MB 3MPXA 1T77A 3D8DA 1XKEA 3PG7A 2COAA 1X1GA 2HTHB 2OQBA 1MPHA 1H4RA 4HB2B 2CODA 2W2XC 1BTNA 3ODWA 2Z0PA 3KRXA 2MDXA 1NU2A 1IRSA 2CY4A 3SUZA 5L81A 1Y19B 4L1RA 2LOXA 2R0DA 1XX0A 1ISNA 3ULCA 3QIJA 4QXAB 3NW8A 2L1CA 4KHBA 1WI1A 1P6SA 2DN6A 2CRFA 2YRYA 1BTKA 1FB8A 2KCJA 1WG7A 1V61A 2ELAA 3OANA 4KVGB 1BWNA 5DHFB 4F7GA 2UZSA 3AU5A 2GCJA 3VOQA 4GXBA 1ZYIA 3DXEA 3KSYA 2D11A 2KUPA 3A8QA 4A6HA 1ZSQA 3A8PA 1KZ7A 2MKRA 4DBBA 2NMBA 4KHAA 4A6KA 4DIXA 1AQCA 2W2XD 3SV1A 2DHKA 3TO1A 2EMSA 1K5GB 2DYQA 1SHCA 2FJLA 2BCJA 1TXDA 2HE7A 4XWXA 2FJUB 4A5KA 2I5CA 2D9VA 2LYDA 3GYPA 1P3RA 2Y8FA 5LOPB 2E2XA 1U5DA 4BBKA 3F5RA 3A98B 3U12A 3CXBB 5I2MA 1OQNA 4GMVA 5LG4B 2X18A 2UZRA 1FHWA 5DIFB 5JHHA 1X05A 2RRFA 3WA0A 4MY6A 1W1HA 3DXCA 2K2UA 4GN1A 2Z0QA 4EKUA 2D9WA 5J3YA 3A58A 1U5GA 3FVCA 2XQNM 1U5FA 2ZKMX 2KUQA 4K2PA 2AL6A 4HATB 1N3HA 4NSWA 4GPTB 5D3VA 1RRPB 4F7HA 1Q67A 1DBHA 2Z14A 1J0WA 1WVHA 4WJ7A 4K81A 1FHXA 3ODXA 1UPQA 2GS0A 1XR0B 2N23A 1OY2A 5HE0A 1Y5OA 2D10A 2VKIA 2Z59A 3BINA 3OHMB 4CYEA 3T06A 2DYNA 2Y7BA 4Y94A 5JHGA 2Q13A 2GUMA 1TJ6A 4HDQA 5JLJB 2DLWA 2D4QA 1WGUA 3ZDTA 1XD4A 1WJ1A 1MK9B 1I2HA 2AEHA 2EC1A 2D9ZA 3TVVA 3AJ4A 4H8SA 1W1GA 2IFSA 1U29A 2YT0A 1V88A 1NI2A 4F7UP 4IOYX 3N7CA 3TFMA 1X1FA 4IAPA 1EGXA 2VSZA 1E5WA 5FI0A 2RNRB 2P0FA 4YONA 2P0HA 2QKLA 3F0WA 5JP4A 1U2BA 5EFXA 5CLLB 4C0AA 1EAZA 3B77A 1J19A 1MIZB 2COFA 1KZGA 1GC7A 2LKOA 2IYBA 2MFQA 2W2WA 1MK7B 1FGYA 2DHJA 3D8EA 2ELBA 2EJ8A 1U27A 5C5BA 3ODOA 4HHVA 1UNPA 1ZM0A 2J59M 5IRSA 1FAOA 4ZRJA 1RJ2A 4HAVB 4PQ0A 1Z87A 1H10A 3HW2B 4HAZB 4KHBB 4WSFA 3FEHA 3ULBA 3FSSA 4TYZA 2DTCA 4A6FA 1TQZA 2PZ1A 4HB4B 1LW3A 2Z4DA 3ZVRA 4DXAB 3V5WA 1AWEA 2KIGA 3TW1A 4K17A 3SYXA 2VRWB 2I5FA 5DHAB 3HK0A 1V89A 2H7DA 1XCGA 2M14A 4GNKB 4K2OA 4OSNA 2LULA 2DHIA 5DI9B 2OTXA 3KY9A 4TKNA 3PZDA 3D8FA 3U8ZA 2Z0OA 3G9WA 1K5DB 2RLOA 2N0YA 1SGHA 2I1JA 1EVHA 1V5UA 3HQCA 1XODA 2ROVA 4HB3B 2GCLA 5HE1A 4GMXB 2DX5A 2D9YA 5J3QA 5HE3A 3IVFA 3BJIA 2K49A 5CLQB
chains in the Genus database with same CATH topology
2ROZB 3QWMA 5C6RA 2Y8GA 1FOEA 1UNRA 1GG3A 4DX90 4WVFB 1B55A 2KGXB 1MAIA 5LONB 3PEGA 2YS3A 5C79A 1WGQA 3PVUA 4Z2NA 2LOZA 3KZ1A 4MK0A 4ZRIA 2DFKA 4HAXB 5D27A 1GC6A 4CHMA 1DDWA 5C16A 5J3TA 3MDBC 1QC6A 1EF1A 2RUKB 1MIXA 1NTVA 1X11A 2J0KA 1FGZA 1ZC4B 5HE2A 3X23A 4HDOA 5D3XA 3RCPA 2JP2A 2EMTA 4GZUA 3PVLA 5KQ1A 3UZTA 2RSGA 4ZRKA 4EMOA 5FI1A 2LG1A 2J0JA 2ZPYA 4B6HA 3PSCA 5KQ4A 4HB0B 4PNKA 4P7IA 1KI1B 2D2QA 1UPRA 2DX1A 3P7ZA 2UVMA 1W1DA 1UEFA 3ML4A 2H7EA 3CIKA 1DROA 5D3YA 2RVBB 5DH9B 1DYNA 1PLSA 2CAYA 5GOWB 5C5BB 1WJMA 1FHOA 3VIAA 2GJYA 1U5EA 1I7AA 1X86A 4EJNA 2L2IA 1UNQA 2YSZA 4A6FB 4D0NB 3KRWA 2YVCA 2K2JA 3NSUA 2NZ8B 3U7DA 1OMWA 2D9XA 2R09A 2YF0A 1MKEA 3PP2A 1ZC3B 3P6AA 1QQGA 4KHOA 4NY0A 3WYFB 3FM8C 4DX8A 2YT1A 2COCA 1DDVA 1DDMA 3SO6A 2RGNB 3O96A 3LJUX 2MWNB 4MT7A 4IFSA 2J0MA 3GYOA 3M1IB 1V5PA 2DA0A 2DKQA 1PMSA 5KCVA 1PFJA 1P5TA 2M38A 1LB1A 3SNHA 2YS5A 3TCAA 4CHJA 1M7EA 2P8VA 1ZVRA 2P0DA 2K00A 1M7RA 4HAUB 4HAWB 4HAYB 2QKMA 4L6EA 3QBVB 3PVWA 3AU4A 2YS1A 4KAXB 2I1KA 2G35A 5D3WA 2ADZA 2V76A 3DXDA 1BAKA 1NTYA 4YL8A 2CY5A 2DKPA 1V5MA 4Z2MB 3MPXA 3D8DA 1XKEA 3PG7A 2COAA 1X1GA 2HTHB 2OQBA 1MPHA 1H4RA 4HB2B 2CODA 2W2XC 1BTNA 3ODWA 2Z0PA 3KRXA 2MDXA 1NU2A 1IRSA 2CY4A 3SUZA 5L81A 1Y19B 2LOXA 2R0DA 1XX0A 1ISNA 3ULCA 3QIJA 2L1CA 1WI1A 1P6SA 2DN6A 2CRFA 2YRYA 1BTKA 1FB8A 2KCJA 1WG7A 1V61A 2ELAA 3OANA 4KVGB 1BWNA 5DHFB 4F7GA 2UZSA 3AU5A 2GCJA 3VOQA 4GXBA 3DXEA 3KSYA 2D11A 2KUPA 3A8QA 4A6HA 1ZSQA 3A8PA 1KZ7A 2MKRA 4DBBA 2NMBA 4KHAA 4A6KA 1AQCA 2W2XD 3SV1A 2DHKA 3TO1A 2EMSA 1K5GB 2DYQA 1SHCA 2FJLA 2BCJA 1TXDA 2HE7A 4XWXA 4A5KA 2I5CA 2D9VA 2LYDA 3GYPA 1P3RA 2Y8FA 5LOPB 2E2XA 1U5DA 4BBKA 3F5RA 3A98B 3CXBB 1OQNA 4GMVA 2X18A 2UZRA 1FHWA 5DIFB 5JHHA 1X05A 3WA0A 4MY6A 1W1HA 3DXCA 2K2UA 4GN1A 2Z0QA 4EKUA 2D9WA 5J3YA 1U5GA 2XQNM 1U5FA 4K2PA 2AL6A 4HATB 1N3HA 4NSWA 4GPTB 5D3VA 1RRPB 4F7HA 1Q67A 1DBHA 1J0WA 1WVHA 4WJ7A 4K81A 1FHXA 3ODXA 1UPQA 2GS0A 1XR0B 2N23A 1OY2A 5HE0A 1Y5OA 2D10A 2VKIA 3BINA 4CYEA 3T06A 2DYNA 2Y7BA 4Y94A 5JHGA 2Q13A 4HDQA 1TJ6A 5JLJB 2DLWA 2D4QA 1WGUA 3ZDTA 1XD4A 1WJ1A 1MK9B 1I2HA 2AEHA 2EC1A 2D9ZA 3TVVA 3AJ4A 4H8SA 1W1GA 2IFSA 1U29A 2YT0A 1V88A 1NI2A 4F7UP 4IOYX 3N7CA 3TFMA 1X1FA 4IAPA 1EGXA 2VSZA 1E5WA 5FI0A 2RNRB 2P0FA 4YONA 2P0HA 2QKLA 3F0WA 5JP4A 1U2BA 5EFXA 5CLLB 4C0AA 1EAZA 1J19A 1MIZB 2COFA 1KZGA 1GC7A 2LKOA 2IYBA 2MFQA 2W2WA 1MK7B 1FGYA 2DHJA 3D8EA 2ELBA 2EJ8A 1U27A 5C5BA 3ODOA 4HHVA 1UNPA 1ZM0A 2J59M 1FAOA 4ZRJA 1RJ2A 4HAVB 4PQ0A 1Z87A 1H10A 3HW2B 4HAZB 4KHBB 4WSFA 3FEHA 3ULBA 3FSSA 4TYZA 2DTCA 4A6FA 1TQZA 2PZ1A 4HB4B 1LW3A 3ZVRA 4DXAB 3V5WA 1AWEA 3TW1A 4K17A 3SYXA 2VRWB 2I5FA 5DHAB 3HK0A 1V89A 2H7DA 1XCGA 2M14A 4K2OA 2LULA 2DHIA 5DI9B 2OTXA 3KY9A 4TKNA 3PZDA 3D8FA 3U8ZA 2Z0OA 3G9WA 1K5DB 2RLOA 2N0YA 1SGHA 2I1JA 1EVHA 1V5UA 3HQCA 1XODA 2ROVA 4HB3B 2GCLA 5HE1A 4GMXB 2DX5A 2D9YA 5J3QA 5HE3A 3IVFA 3BJIA 5CLQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ROZ B;  3QWM A;  5C6R A;  2Y8G A;  1FOE A;  1UNR A;  1GG3 A;  4DX9 0;  4WVF B;  1B55 A;  2KGX B;  1MAI A;  5LON B;  3PEG A;  2YS3 A;  5C79 A;  1WGQ A;  3PVU A;  4Z2N A;  2LOZ A;  3KZ1 A;  4MK0 A;  4ZRI A;  2DFK A;  4HAX B;  5D27 A;  1GC6 A;  4CHM A;  1DDW A;  5C16 A;  5J3T A;  3MDB C;  1QC6 A;  1EF1 A;  2RUK B;  1MIX A;  1NTV A;  1X11 A;  2J0K A;  1FGZ A;  1ZC4 B;  5HE2 A;  3X23 A;  4HDO A;  5D3X A;  3RCP A;  2JP2 A;  2EMT A;  4GZU A;  3PVL A;  5KQ1 A;  3UZT A;  2RSG A;  4ZRK A;  4EMO A;  5FI1 A;  2LG1 A;  2J0J A;  2ZPY A;  4B6H A;  3PSC A;  5KQ4 A;  4HB0 B;  4PNK A;  4P7I A;  1KI1 B;  2D2Q A;  1UPR A;  2DX1 A;  3P7Z A;  2UVM A;  1W1D A;  1UEF A;  3ML4 A;  2H7E A;  3CIK A;  1DRO A;  5D3Y A;  2RVB B;  5DH9 B;  1DYN A;  1PLS A;  2CAY A;  5GOW B;  5C5B B;  1WJM A;  1FHO A;  3VIA A;  2GJY A;  1U5E A;  1I7A A;  1X86 A;  4EJN A;  2L2I A;  1UNQ A;  2YSZ A;  4A6F B;  4D0N B;  3KRW A;  2YVC A;  2K2J A;  3NSU A;  2NZ8 B;  3U7D A;  1OMW A;  2D9X A;  2R09 A;  2YF0 A;  1MKE A;  3PP2 A;  1ZC3 B;  3P6A A;  1QQG A;  4KHO A;  4NY0 A;  3WYF B;  3FM8 C;  4DX8 A;  2YT1 A;  2COC A;  1DDV A;  1DDM A;  3SO6 A;  2RGN B;  3O96 A;  3LJU X;  2MWN B;  4MT7 A;  4IFS A;  2J0M A;  3GYO A;  3M1I B;  1V5P A;  2DA0 A;  2DKQ A;  1PMS A;  5KCV A;  1PFJ A;  1P5T A;  2M38 A;  1LB1 A;  3SNH A;  2YS5 A;  3TCA A;  4CHJ A;  1M7E A;  2P8V A;  1ZVR A;  2P0D A;  2K00 A;  1M7R A;  4HAU B;  4HAW B;  4HAY B;  2QKM A;  4L6E A;  3QBV B;  3PVW A;  3AU4 A;  2YS1 A;  4KAX B;  2I1K A;  2G35 A;  5D3W A;  2ADZ A;  2V76 A;  3DXD A;  1BAK A;  1NTY A;  4YL8 A;  2CY5 A;  2DKP A;  1V5M A;  4Z2M B;  3MPX A;  3D8D A;  1XKE A;  3PG7 A;  2COA A;  1X1G A;  2HTH B;  2OQB A;  1MPH A;  1H4R A;  4HB2 B;  2COD A;  2W2X C;  1BTN A;  3ODW A;  2Z0P A;  3KRX A;  2MDX A;  1NU2 A;  1IRS A;  2CY4 A;  3SUZ A;  5L81 A;  1Y19 B;  2LOX A;  2R0D A;  1XX0 A;  1ISN A;  3ULC A;  3QIJ A;  2L1C A;  1WI1 A;  1P6S A;  2DN6 A;  2CRF A;  2YRY A;  1BTK A;  1FB8 A;  2KCJ A;  1WG7 A;  1V61 A;  2ELA A;  3OAN A;  4KVG B;  1BWN A;  5DHF B;  4F7G A;  2UZS A;  3AU5 A;  2GCJ A;  3VOQ A;  4GXB A;  3DXE A;  3KSY A;  2D11 A;  2KUP A;  3A8Q A;  4A6H A;  1ZSQ A;  3A8P A;  1KZ7 A;  2MKR A;  4DBB A;  2NMB A;  4KHA A;  4A6K A;  1AQC A;  2W2X D;  3SV1 A;  2DHK A;  3TO1 A;  2EMS A;  1K5G B;  2DYQ A;  1SHC A;  2FJL A;  2BCJ A;  1TXD A;  2HE7 A;  4XWX A;  4A5K A;  2I5C A;  2D9V A;  2LYD A;  3GYP A;  1P3R A;  2Y8F A;  5LOP B;  2E2X A;  1U5D A;  4BBK A;  3F5R A;  3A98 B;  3CXB B;  1OQN A;  4GMV A;  2X18 A;  2UZR A;  1FHW A;  5DIF B;  5JHH A;  1X05 A;  3WA0 A;  4MY6 A;  1W1H A;  3DXC A;  2K2U A;  4GN1 A;  2Z0Q A;  4EKU A;  2D9W A;  5J3Y A;  1U5G A;  2XQN M;  1U5F A;  4K2P A;  2AL6 A;  4HAT B;  1N3H A;  4NSW A;  4GPT B;  5D3V A;  1RRP B;  4F7H A;  1Q67 A;  1DBH A;  1J0W A;  1WVH A;  4WJ7 A;  4K81 A;  1FHX A;  3ODX A;  1UPQ A;  2GS0 A;  1XR0 B;  2N23 A;  1OY2 A;  5HE0 A;  1Y5O A;  2D10 A;  2VKI A;  3BIN A;  4CYE A;  3T06 A;  2DYN A;  2Y7B A;  4Y94 A;  5JHG A;  2Q13 A;  4HDQ A;  1TJ6 A;  5JLJ B;  2DLW A;  2D4Q A;  1WGU A;  3ZDT A;  1XD4 A;  1WJ1 A;  1MK9 B;  1I2H A;  2AEH A;  2EC1 A;  2D9Z A;  3TVV A;  3AJ4 A;  4H8S A;  1W1G A;  2IFS A;  1U29 A;  2YT0 A;  1V88 A;  1NI2 A;  4F7U P;  4IOY X;  3N7C A;  3TFM A;  1X1F A;  4IAP A;  1EGX A;  2VSZ A;  1E5W A;  5FI0 A;  2RNR B;  2P0F A;  4YON A;  2P0H A;  2QKL A;  3F0W A;  5JP4 A;  1U2B A;  5EFX A;  5CLL B;  4C0A A;  1EAZ A;  1J19 A;  1MIZ B;  2COF A;  1KZG A;  1GC7 A;  2LKO A;  2IYB A;  2MFQ A;  2W2W A;  1MK7 B;  1FGY A;  2DHJ A;  3D8E A;  2ELB A;  2EJ8 A;  1U27 A;  5C5B A;  3ODO A;  4HHV A;  1UNP A;  1ZM0 A;  2J59 M;  1FAO A;  4ZRJ A;  1RJ2 A;  4HAV B;  4PQ0 A;  1Z87 A;  1H10 A;  3HW2 B;  4HAZ B;  4KHB B;  4WSF A;  3FEH A;  3ULB A;  3FSS A;  4TYZ A;  2DTC A;  4A6F A;  1TQZ A;  2PZ1 A;  4HB4 B;  1LW3 A;  3ZVR A;  4DXA B;  3V5W A;  1AWE A;  3TW1 A;  4K17 A;  3SYX A;  2VRW B;  2I5F A;  5DHA B;  3HK0 A;  1V89 A;  2H7D A;  1XCG A;  2M14 A;  4K2O A;  2LUL A;  2DHI A;  5DI9 B;  2OTX A;  3KY9 A;  4TKN A;  3PZD A;  3D8F A;  3U8Z A;  2Z0O A;  3G9W A;  1K5D B;  2RLO A;  2N0Y A;  1SGH A;  2I1J A;  1EVH A;  1V5U A;  3HQC A;  1XOD A;  2ROV A;  4HB3 B;  2GCL A;  5HE1 A;  4GMX B;  2DX5 A;  2D9Y A;  5J3Q A;  5HE3 A;  3IVF A;  3BJI A;  5CLQ B; 
#chains in the Genus database with same CATH topology
 2ROZ B;  4CSQ A;  4QJ4 B;  3QWM A;  5C6R A;  5M4Y B;  2Y8G A;  1FOE A;  1UNR A;  1GG3 A;  4OT1 A;  4DX9 0;  4WVF B;  1B55 A;  2KGX B;  1MAI A;  5LON B;  3PEG A;  2YS3 A;  5C79 A;  1WGQ A;  3PVU A;  4Z2N A;  2LOZ A;  3KZ1 A;  4MK0 A;  4ZRI A;  2Z13 A;  2DFK A;  1MI1 A;  4HAX B;  5D27 A;  1GC6 A;  4CHM A;  1DDW A;  5C16 A;  5J3T A;  3MDB C;  1QC6 A;  5I2S A;  1EF1 A;  2RUK B;  1MIX A;  1NTV A;  1X11 A;  2J0K A;  1FGZ A;  1ZC4 B;  5HE2 A;  3X23 A;  3DCX A;  3HIE A;  3NWF A;  2KIE A;  4HDO A;  5D3X A;  3RCP A;  2JP2 A;  2EMT A;  4GZU A;  2YT2 A;  3PVL A;  4D6W A;  5KQ1 A;  3NWA A;  3UZT A;  2RSG A;  4ZRK A;  4EMO A;  5FI1 A;  2LG1 A;  2J0J A;  2ZPY A;  4B6H A;  3PSC A;  5KQ4 A;  4HB0 B;  4PNK A;  4P7I A;  1KI1 B;  2D2Q A;  1UPR A;  2DX1 A;  3P7Z A;  2UVM A;  1W1D A;  2R2Y A;  1UEF A;  3ML4 A;  2H7E A;  3CIK A;  1DRO A;  5D3Y A;  2RVB B;  5DH9 B;  2K8E A;  1DYN A;  1PLS A;  2CAY A;  5GOW B;  5C5B B;  1WJM A;  3HSA A;  1FHO A;  3VIA A;  2GJY A;  1U5E A;  1I7A A;  1X86 A;  4EJN A;  2L2I A;  1UNQ A;  2YSZ A;  4QJ5 B;  4A6F B;  4D0N B;  3KRW A;  2YVC A;  2K2J A;  3NSU A;  2NZ8 B;  3U7D A;  1OMW A;  2D9X A;  2R09 A;  2YF0 A;  2KR0 A;  1MKE A;  4GOU A;  3PP2 A;  1ZC3 B;  3P6A A;  1QQG A;  4KHO A;  4NY0 A;  3WYF B;  3FM8 C;  4DX8 A;  2YT1 A;  2COC A;  1DDV A;  1DDM A;  3SO6 A;  2RGN B;  4QJ3 B;  3O96 A;  3LJU X;  2MWN B;  4MT7 A;  3NWD A;  4IFS A;  2J0M A;  3GYO A;  3M1I B;  1V5P A;  2DA0 A;  2DKQ A;  1PMS A;  5KCV A;  1PFJ A;  1P5T A;  2M38 A;  1LB1 A;  3SNH A;  2YS5 A;  3TCA A;  4CHJ A;  2NBV A;  1M7E A;  2P8V A;  1ZVR A;  2P0D A;  4HSI A;  2K00 A;  1M7R A;  4HAU B;  4HAW B;  4HAY B;  2QKM A;  4L6E A;  3QBV B;  3PVW A;  3AU4 A;  2YS1 A;  4KAX B;  2I1K A;  2G35 A;  5D3W A;  2ADZ A;  2V76 A;  3DXD A;  1BAK A;  1NTY A;  4YL8 A;  2CY5 A;  2DKP A;  1V5M A;  4Z2M B;  3MPX A;  1T77 A;  3D8D A;  1XKE A;  3PG7 A;  2COA A;  1X1G A;  2HTH B;  2OQB A;  1MPH A;  1H4R A;  4HB2 B;  2COD A;  2W2X C;  1BTN A;  3ODW A;  2Z0P A;  3KRX A;  2MDX A;  1NU2 A;  1IRS A;  2CY4 A;  3SUZ A;  5L81 A;  1Y19 B;  4L1R A;  2LOX A;  2R0D A;  1XX0 A;  1ISN A;  3ULC A;  3QIJ A;  4QXA B;  3NW8 A;  2L1C A;  4KHB A;  1WI1 A;  1P6S A;  2DN6 A;  2CRF A;  2YRY A;  1BTK A;  1FB8 A;  2KCJ A;  1WG7 A;  1V61 A;  2ELA A;  3OAN A;  4KVG B;  1BWN A;  5DHF B;  4F7G A;  2UZS A;  3AU5 A;  2GCJ A;  3VOQ A;  4GXB A;  1ZYI A;  3DXE A;  3KSY A;  2D11 A;  2KUP A;  3A8Q A;  4A6H A;  1ZSQ A;  3A8P A;  1KZ7 A;  2MKR A;  4DBB A;  2NMB A;  4KHA A;  4A6K A;  4DIX A;  1AQC A;  2W2X D;  3SV1 A;  2DHK A;  3TO1 A;  2EMS A;  1K5G B;  2DYQ A;  1SHC A;  2FJL A;  2BCJ A;  1TXD A;  2HE7 A;  4XWX A;  2FJU B;  4A5K A;  2I5C A;  2D9V A;  2LYD A;  3GYP A;  1P3R A;  2Y8F A;  5LOP B;  2E2X A;  1U5D A;  4BBK A;  3F5R A;  3A98 B;  3U12 A;  3CXB B;  5I2M A;  1OQN A;  4GMV A;  5LG4 B;  2X18 A;  2UZR A;  1FHW A;  5DIF B;  5JHH A;  1X05 A;  2RRF A;  3WA0 A;  4MY6 A;  1W1H A;  3DXC A;  2K2U A;  4GN1 A;  2Z0Q A;  4EKU A;  2D9W A;  5J3Y A;  3A58 A;  1U5G A;  3FVC A;  2XQN M;  1U5F A;  2ZKM X;  2KUQ A;  4K2P A;  2AL6 A;  4HAT B;  1N3H A;  4NSW A;  4GPT B;  5D3V A;  1RRP B;  4F7H A;  1Q67 A;  1DBH A;  2Z14 A;  1J0W A;  1WVH A;  4WJ7 A;  4K81 A;  1FHX A;  3ODX A;  1UPQ A;  2GS0 A;  1XR0 B;  2N23 A;  1OY2 A;  5HE0 A;  1Y5O A;  2D10 A;  2VKI A;  2Z59 A;  3BIN A;  3OHM B;  4CYE A;  3T06 A;  2DYN A;  2Y7B A;  4Y94 A;  5JHG A;  2Q13 A;  2GUM A;  1TJ6 A;  4HDQ A;  5JLJ B;  2DLW A;  2D4Q A;  1WGU A;  3ZDT A;  1XD4 A;  1WJ1 A;  1MK9 B;  1I2H A;  2AEH A;  2EC1 A;  2D9Z A;  3TVV A;  3AJ4 A;  4H8S A;  1W1G A;  2IFS A;  1U29 A;  2YT0 A;  1V88 A;  1NI2 A;  4F7U P;  4IOY X;  3N7C A;  3TFM A;  1X1F A;  4IAP A;  1EGX A;  2VSZ A;  1E5W A;  5FI0 A;  2RNR B;  2P0F A;  4YON A;  2P0H A;  2QKL A;  3F0W A;  5JP4 A;  1U2B A;  5EFX A;  5CLL B;  4C0A A;  1EAZ A;  3B77 A;  1J19 A;  1MIZ B;  2COF A;  1KZG A;  1GC7 A;  2LKO A;  2IYB A;  2MFQ A;  2W2W A;  1MK7 B;  1FGY A;  2DHJ A;  3D8E A;  2ELB A;  2EJ8 A;  1U27 A;  5C5B A;  3ODO A;  4HHV A;  1UNP A;  1ZM0 A;  2J59 M;  5IRS A;  1FAO A;  4ZRJ A;  1RJ2 A;  4HAV B;  4PQ0 A;  1Z87 A;  1H10 A;  3HW2 B;  4HAZ B;  4KHB B;  4WSF A;  3FEH A;  3ULB A;  3FSS A;  4TYZ A;  2DTC A;  4A6F A;  1TQZ A;  2PZ1 A;  4HB4 B;  1LW3 A;  2Z4D A;  3ZVR A;  4DXA B;  3V5W A;  1AWE A;  2KIG A;  3TW1 A;  4K17 A;  3SYX A;  2VRW B;  2I5F A;  5DHA B;  3HK0 A;  1V89 A;  2H7D A;  1XCG A;  2M14 A;  4GNK B;  4K2O A;  4OSN A;  2LUL A;  2DHI A;  5DI9 B;  2OTX A;  3KY9 A;  4TKN A;  3PZD A;  3D8F A;  3U8Z A;  2Z0O A;  3G9W A;  1K5D B;  2RLO A;  2N0Y A;  1SGH A;  2I1J A;  1EVH A;  1V5U A;  3HQC A;  1XOD A;  2ROV A;  4HB3 B;  2GCL A;  5HE1 A;  4GMX B;  2DX5 A;  2D9Y A;  5J3Q A;  5HE3 A;  3IVF A;  3BJI A;  2K49 A;  5CLQ B; 
#chains in the Genus database with same CATH homology
 2ROZ B;  3QWM A;  5C6R A;  2Y8G A;  1FOE A;  1UNR A;  1GG3 A;  4DX9 0;  4WVF B;  1B55 A;  2KGX B;  1MAI A;  5LON B;  3PEG A;  2YS3 A;  5C79 A;  1WGQ A;  3PVU A;  4Z2N A;  2LOZ A;  3KZ1 A;  4MK0 A;  4ZRI A;  2DFK A;  4HAX B;  5D27 A;  1GC6 A;  4CHM A;  1DDW A;  5C16 A;  5J3T A;  3MDB C;  1QC6 A;  1EF1 A;  2RUK B;  1MIX A;  1NTV A;  1X11 A;  2J0K A;  1FGZ A;  1ZC4 B;  5HE2 A;  3X23 A;  4HDO A;  5D3X A;  3RCP A;  2JP2 A;  2EMT A;  4GZU A;  3PVL A;  5KQ1 A;  3UZT A;  2RSG A;  4ZRK A;  4EMO A;  5FI1 A;  2LG1 A;  2J0J A;  2ZPY A;  4B6H A;  3PSC A;  5KQ4 A;  4HB0 B;  4PNK A;  4P7I A;  1KI1 B;  2D2Q A;  1UPR A;  2DX1 A;  3P7Z A;  2UVM A;  1W1D A;  1UEF A;  3ML4 A;  2H7E A;  3CIK A;  1DRO A;  5D3Y A;  2RVB B;  5DH9 B;  1DYN A;  1PLS A;  2CAY A;  5GOW B;  5C5B B;  1WJM A;  1FHO A;  3VIA A;  2GJY A;  1U5E A;  1I7A A;  1X86 A;  4EJN A;  2L2I A;  1UNQ A;  2YSZ A;  4A6F B;  4D0N B;  3KRW A;  2YVC A;  2K2J A;  3NSU A;  2NZ8 B;  3U7D A;  1OMW A;  2D9X A;  2R09 A;  2YF0 A;  1MKE A;  3PP2 A;  1ZC3 B;  3P6A A;  1QQG A;  4KHO A;  4NY0 A;  3WYF B;  3FM8 C;  4DX8 A;  2YT1 A;  2COC A;  1DDV A;  1DDM A;  3SO6 A;  2RGN B;  3O96 A;  3LJU X;  2MWN B;  4MT7 A;  4IFS A;  2J0M A;  3GYO A;  3M1I B;  1V5P A;  2DA0 A;  2DKQ A;  1PMS A;  5KCV A;  1PFJ A;  1P5T A;  2M38 A;  1LB1 A;  3SNH A;  2YS5 A;  3TCA A;  4CHJ A;  1M7E A;  2P8V A;  1ZVR A;  2P0D A;  2K00 A;  1M7R A;  4HAU B;  4HAW B;  4HAY B;  2QKM A;  4L6E A;  3QBV B;  3PVW A;  3AU4 A;  2YS1 A;  4KAX B;  2I1K A;  2G35 A;  5D3W A;  2ADZ A;  2V76 A;  3DXD A;  1BAK A;  1NTY A;  4YL8 A;  2CY5 A;  2DKP A;  1V5M A;  4Z2M B;  3MPX A;  3D8D A;  1XKE A;  3PG7 A;  2COA A;  1X1G A;  2HTH B;  2OQB A;  1MPH A;  1H4R A;  4HB2 B;  2COD A;  2W2X C;  1BTN A;  3ODW A;  2Z0P A;  3KRX A;  2MDX A;  1NU2 A;  1IRS A;  2CY4 A;  3SUZ A;  5L81 A;  1Y19 B;  2LOX A;  2R0D A;  1XX0 A;  1ISN A;  3ULC A;  3QIJ A;  2L1C A;  1WI1 A;  1P6S A;  2DN6 A;  2CRF A;  2YRY A;  1BTK A;  1FB8 A;  2KCJ A;  1WG7 A;  1V61 A;  2ELA A;  3OAN A;  4KVG B;  1BWN A;  5DHF B;  4F7G A;  2UZS A;  3AU5 A;  2GCJ A;  3VOQ A;  4GXB A;  3DXE A;  3KSY A;  2D11 A;  2KUP A;  3A8Q A;  4A6H A;  1ZSQ A;  3A8P A;  1KZ7 A;  2MKR A;  4DBB A;  2NMB A;  4KHA A;  4A6K A;  1AQC A;  2W2X D;  3SV1 A;  2DHK A;  3TO1 A;  2EMS A;  1K5G B;  2DYQ A;  1SHC A;  2FJL A;  2BCJ A;  1TXD A;  2HE7 A;  4XWX A;  4A5K A;  2I5C A;  2D9V A;  2LYD A;  3GYP A;  1P3R A;  2Y8F A;  5LOP B;  2E2X A;  1U5D A;  4BBK A;  3F5R A;  3A98 B;  3CXB B;  1OQN A;  4GMV A;  2X18 A;  2UZR A;  1FHW A;  5DIF B;  5JHH A;  1X05 A;  3WA0 A;  4MY6 A;  1W1H A;  3DXC A;  2K2U A;  4GN1 A;  2Z0Q A;  4EKU A;  2D9W A;  5J3Y A;  1U5G A;  2XQN M;  1U5F A;  4K2P A;  2AL6 A;  4HAT B;  1N3H A;  4NSW A;  4GPT B;  5D3V A;  1RRP B;  4F7H A;  1Q67 A;  1DBH A;  1J0W A;  1WVH A;  4WJ7 A;  4K81 A;  1FHX A;  3ODX A;  1UPQ A;  2GS0 A;  1XR0 B;  2N23 A;  1OY2 A;  5HE0 A;  1Y5O A;  2D10 A;  2VKI A;  3BIN A;  4CYE A;  3T06 A;  2DYN A;  2Y7B A;  4Y94 A;  5JHG A;  2Q13 A;  4HDQ A;  1TJ6 A;  5JLJ B;  2DLW A;  2D4Q A;  1WGU A;  3ZDT A;  1XD4 A;  1WJ1 A;  1MK9 B;  1I2H A;  2AEH A;  2EC1 A;  2D9Z A;  3TVV A;  3AJ4 A;  4H8S A;  1W1G A;  2IFS A;  1U29 A;  2YT0 A;  1V88 A;  1NI2 A;  4F7U P;  4IOY X;  3N7C A;  3TFM A;  1X1F A;  4IAP A;  1EGX A;  2VSZ A;  1E5W A;  5FI0 A;  2RNR B;  2P0F A;  4YON A;  2P0H A;  2QKL A;  3F0W A;  5JP4 A;  1U2B A;  5EFX A;  5CLL B;  4C0A A;  1EAZ A;  1J19 A;  1MIZ B;  2COF A;  1KZG A;  1GC7 A;  2LKO A;  2IYB A;  2MFQ A;  2W2W A;  1MK7 B;  1FGY A;  2DHJ A;  3D8E A;  2ELB A;  2EJ8 A;  1U27 A;  5C5B A;  3ODO A;  4HHV A;  1UNP A;  1ZM0 A;  2J59 M;  1FAO A;  4ZRJ A;  1RJ2 A;  4HAV B;  4PQ0 A;  1Z87 A;  1H10 A;  3HW2 B;  4HAZ B;  4KHB B;  4WSF A;  3FEH A;  3ULB A;  3FSS A;  4TYZ A;  2DTC A;  4A6F A;  1TQZ A;  2PZ1 A;  4HB4 B;  1LW3 A;  3ZVR A;  4DXA B;  3V5W A;  1AWE A;  3TW1 A;  4K17 A;  3SYX A;  2VRW B;  2I5F A;  5DHA B;  3HK0 A;  1V89 A;  2H7D A;  1XCG A;  2M14 A;  4K2O A;  2LUL A;  2DHI A;  5DI9 B;  2OTX A;  3KY9 A;  4TKN A;  3PZD A;  3D8F A;  3U8Z A;  2Z0O A;  3G9W A;  1K5D B;  2RLO A;  2N0Y A;  1SGH A;  2I1J A;  1EVH A;  1V5U A;  3HQC A;  1XOD A;  2ROV A;  4HB3 B;  2GCL A;  5HE1 A;  4GMX B;  2DX5 A;  2D9Y A;  5J3Q A;  5HE3 A;  3IVF A;  3BJI A;  5CLQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...