2CAYA

Vps36 n-terminal ph domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
132
structure length
132
Chain Sequence
HHMEYWHYVETTSSGQPLLREGEKDIFIDQSVGLYHGKSKILQRQRGRIFLTSQRIIYIDDAKPTQNSLGLELDDLAYVNYSSGFLTRSPRLILFFKDPSSSTEFVQLSFRKSDGVLFSQATERALENILTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VACUOLAR PROTEIN SORTING PROTEIN 36
publication title Escrt-I Core and Escrt-II Glue Domain Structures Reveal Role for Glue in Linking to Escrt-I and Membranes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport
total genus 31
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11605 Vps36_ESCRT-II Vacuolar protein sorting protein 36 Vps36
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2cayA00
5LOPB 2IFSA 4HDQA 1Y5OA 2DYNA 3SV1A 1XODA 2D9WA 3DXCA 5JP4A 2D2QA 4D0NB 3P6AA 2YRYA 2DX1A 2MKRA 2GCJA 3GYPA 1PLSA 4MK0A 2RLOA 1OQNA 2RUKB 1FGZA 5HE3A 3VIAA 1X11A 3M1IB 3G9WA 1UPRA 1KZ7A 2YSZA 2DKQA 4IOYX 3GYOA 3U7DA 5J3YA 2I5CA 3PZDA 5C6RA 5L81A 1SGHA 2CAYA 2YF0A 4A6FA 2VSZA 5JLJB 2JP2A 4HATB 1WG7A 2KGXB 2BCJA 2ELBA 3SO6A 1BTKA 1K5DB 1GG3A 2J0JA 1DDMA 1KI1B 4KVGB 5KCVA 4Z2MB 5D27A 5J3QA 2AL6A 3D8EA 1PMSA 2RVBB 3HW2B 1FAOA 3TW1A 1NI2A 5HE1A 3X23A 2LYDA 2EMSA 3U8ZA 1EAZA 4F7HA 1RJ2A 4CYEA 2VRWB 3RCPA 3KRWA 1X1GA 3AU4A 2QKMA 1AQCA 2COAA 3LJUX 1EF1A 4HAYB 4Y94A 1I2HA 4HHVA 4A6KA 2P0DA 2UZRA 5KQ1A 2MFQA 3O96A 4YONA 2DHKA 1V5MA 3ODOA 2HTHB 3CXBB 4YL8A 1XCGA 1DROA 1W1DA 1U5FA 4DXAB 3F5RA 1BTNA 1KZGA 3KY9A 3TCAA 2H7DA 2YS5A 4XWXA 2G35A 1X1FA 2UZSA 4B6HA 4DBBA 2DKPA 3ZVRA 4F7GA 2ROZB 5JHHA 1TQZA 1DDVA 4HB3B 5C5BA 4HB0B 1U29A 3N7CA 1H4RA 1U5GA 1ZVRA 2K00A 4GMXB 1OMWA 1V5PA 1XD4A 1ISNA 2P8VA 3HQCA 4EJNA 3BJIA 2CODA 4P7IA 5FI1A 3ULCA 5C79A 4ZRJA 2X18A 4KHBB 2CY4A 1LB1A 4HAZB 4NSWA 2YS3A 4IAPA 1MK7B 2DHJA 4GMVA 2W2XC 5D3VA 3ZDTA 3A98B 2MWNB 1J0WA 3PG7A 3T06A 2D9ZA 1GC6A 3IVFA 2NMBA 2RGNB 2OQBA 2VKIA 5J3TA 1FGYA 1B55A 1UNPA 3NSUA 3A8PA 2NZ8B 2KUPA 3UZTA 4C0AA 2ELAA 2LULA 2Z0OA 2DN6A 1RRPB 2DHIA 4F7UP 5GOWB 1UPQA 1WVHA 3SNHA 1U5EA 2I5FA 2K2UA 3VOQA 1UNRA 1ZM0A 5CLLB 3FEHA 2COCA 1UEFA 2EC1A 2OTXA 5DH9B 3FM8C 2DYQA 1WI1A 3FSSA 4MY6A 2W2WA 2YS1A 2J0MA 4A6FB 3PVWA 1V61A 3KSYA 2ZPYA 2EJ8A 2I1JA 2Y8FA 1SHCA 2PZ1A 1OY2A 4GPTB 3MPXA 2COFA 1WGUA 5D3WA 4ZRIA 1EVHA 1P3RA 1Z87A 4WVFB 1XX0A 2M38A 3OANA 2YT0A 1FHOA 3ODXA 1QC6A 5JHGA 2DX5A 5DHFB 2J59M 4A6HA 2Y7BA 1MIXA 1BAKA 1M7RA 2RNRB 3V5WA 3KZ1A 3WYFB 2L2IA 2D9XA 2R0DA 2GJYA 3PVUA 2H7EA 2I1KA 1U5DA 1DBHA 2LOZA 3DXEA 3AJ4A 1IRSA 2XQNM 1MKEA 4HB4B 3AU5A 2DLWA 4Z2NA 1EGXA 2FJLA 2QKLA 3CIKA 2HE7A 2ROVA 5DI9B 2P0HA 3QIJA 1XR0B 1WJ1A 4HAWB 4KHAA 4TKNA 2J0KA 5EFXA 2D9VA 5DIFB 2LKOA 3SUZA 2CRFA 1DDWA 1P6SA 1P5TA 3ULBA 4PNKA 5LONB 5KQ4A 5C5BB 4BBKA 1MPHA 4K2PA 4PQ0A 4NY0A 2YVCA 4GXBA 5DHAB 1FHWA 1K5GB 2ADZA 4HAXB 5D3XA 4L6EA 4HAVB 5HE0A 3PEGA 1U27A 4HAUB 2M14A 1Q67A 1V5UA 1NU2A 4CHJA 4K17A 2Q13A 2R09A 5D3YA 1Y19B 1NTYA 5CLQB 5HE2A 3DXDA 1W1GA 2LOXA 1H10A 1ZSQA 4KAXB 2E2XA 1BWNA 3SYXA 3PVLA 1N3HA 2EMTA 2MDXA 3BINA 1U2BA 3QBVB 2P0FA 4EMOA 3HK0A 4DX8A 2DA0A 3D8DA 1XKEA 1J19A 1TXDA 3ML4A 2DFKA 2LG1A 4TYZA 1E5WA 3WA0A 2V76A 4GN1A 4ZRKA 4HDOA 3A8QA 1LW3A 3QWMA 2N23A 1ZC3B 1UNQA 1MK9B 1DYNA 5FI0A 1FB8A 1X05A 4EKUA 3PP2A 2D10A 1FOEA 1NTVA 2GCLA 1V89A 1FHXA 3ODWA 4CHMA 2N0YA 4K81A 2Y8GA 4IFSA 2Z0PA 4HB2B 1ZC4B 1X86A 4KHOA 1M7EA 1PFJA 1MAIA 2KCJA 1TJ6A 1V88A 2YT1A 5C16A 4MT7A 1AWEA 2D9YA 4A5KA 4H8SA 1WJMA 4DX90 2Z0QA 1QQGA 3TFMA 3P7ZA 2D11A 1MIZB 2UVMA 2DTCA 2W2XD 1W1HA 4WJ7A 2D4QA 3TO1A 3F0WA 3KRXA 2RSGA 4K2OA 2AEHA 4WSFA 3PSCA 2CY5A 3TVVA 2GS0A 2L1CA 1I7AA 3D8FA 1GC7A 3MDBC 4GZUA 2K2JA 2IYBA 1WGQA
chains in the Genus database with same CATH superfamily
5LOPB 2IFSA 4HDQA 1Y5OA 2DYNA 3SV1A 1XODA 2D9WA 3DXCA 5JP4A 2D2QA 4CSQA 4D0NB 3P6AA 2YRYA 2DX1A 2MKRA 2GCJA 3GYPA 4QJ3B 1PLSA 4MK0A 2RLOA 1OQNA 2RUKB 1FGZA 5HE3A 3VIAA 1X11A 3M1IB 3G9WA 1UPRA 1KZ7A 2YSZA 2DKQA 4IOYX 3GYOA 3U7DA 5J3YA 2I5CA 3PZDA 5C6RA 5L81A 1SGHA 2CAYA 2RRFA 2YF0A 2Z14A 4A6FA 2VSZA 5JLJB 2JP2A 4HATB 1WG7A 2KGXB 2BCJA 2ELBA 3SO6A 1BTKA 1K5DB 1GG3A 2J0JA 1DDMA 1KI1B 4KVGB 5KCVA 4Z2MB 5D27A 5J3QA 2AL6A 3D8EA 1PMSA 2RVBB 3FVCA 3HW2B 1FAOA 3TW1A 1NI2A 5HE1A 3X23A 2LYDA 2EMSA 3U8ZA 1EAZA 4GNKB 3U12A 4F7HA 1RJ2A 4CYEA 2VRWB 3RCPA 3KRWA 1X1GA 4OSNA 3AU4A 2QKMA 1AQCA 2COAA 3LJUX 1EF1A 4L1RA 4HAYB 4Y94A 1I2HA 4HHVA 4A6KA 2P0DA 2UZRA 5KQ1A 2MFQA 3O96A 4YONA 2DHKA 1V5MA 3ODOA 2HTHB 2K49A 3CXBB 4YL8A 1XCGA 1DROA 1W1DA 1U5FA 4DXAB 3F5RA 1BTNA 1KZGA 3KY9A 3TCAA 2Z4DA 2H7DA 2YS5A 4XWXA 2G35A 1X1FA 2UZSA 4B6HA 4DBBA 2DKPA 3ZVRA 4F7GA 2ROZB 5JHHA 1TQZA 1DDVA 4HB3B 5C5BA 4HB0B 1U29A 3N7CA 1H4RA 1U5GA 1ZVRA 2K00A 4GMXB 1OMWA 1V5PA 1XD4A 1ISNA 2P8VA 3HQCA 2Z13A 4EJNA 3BJIA 2CODA 4P7IA 5M4YB 5FI1A 3ULCA 5C79A 4ZRJA 2X18A 4KHBB 2CY4A 1LB1A 4HAZB 2YT2A 4NSWA 2YS3A 4IAPA 1MK7B 2DHJA 4GMVA 2W2XC 1T77A 3B77A 5D3VA 3ZDTA 3A98B 2MWNB 1J0WA 3PG7A 2KIEA 3T06A 2D9ZA 1GC6A 3IVFA 1ZYIA 2NMBA 2RGNB 2OQBA 2VKIA 5J3TA 1FGYA 1B55A 1UNPA 3NSUA 3A8PA 2NZ8B 2KUPA 4QJ4B 3UZTA 4C0AA 2ELAA 2LULA 2Z0OA 2DN6A 1RRPB 2DHIA 5IRSA 4F7UP 5GOWB 1UPQA 1WVHA 3SNHA 1U5EA 2I5FA 2K2UA 3VOQA 1UNRA 1ZM0A 5CLLB 3FEHA 2COCA 1MI1A 1UEFA 2EC1A 2OTXA 4OT1A 5DH9B 3FM8C 2DYQA 1WI1A 3FSSA 4MY6A 2W2WA 4HSIA 2YS1A 2J0MA 4A6FB 3PVWA 1V61A 3KSYA 2ZPYA 2EJ8A 2I1JA 2Y8FA 2PZ1A 1SHCA 1OY2A 4GPTB 2COFA 3MPXA 1WGUA 5D3WA 4ZRIA 1EVHA 1P3RA 1Z87A 4WVFB 1XX0A 2M38A 3OANA 2YT0A 5I2MA 3ODXA 1QC6A 1FHOA 5JHGA 2DX5A 5DHFB 2J59M 4A6HA 2Y7BA 2FJUB 1MIXA 1BAKA 1M7RA 2RNRB 3V5WA 3KZ1A 2R2YA 3WYFB 2L2IA 2D9XA 2R0DA 2GJYA 3PVUA 2H7EA 2I1KA 1U5DA 1DBHA 3NWFA 2LOZA 3DXEA 3AJ4A 1IRSA 2XQNM 1MKEA 4HB4B 3AU5A 3NW8A 2DLWA 4Z2NA 1EGXA 3HIEA 2FJLA 2QKLA 3CIKA 2HE7A 2ROVA 5DI9B 2P0HA 3QIJA 1XR0B 1WJ1A 4HAWB 4KHAA 4TKNA 2J0KA 5EFXA 2D9VA 5DIFB 2LKOA 3SUZA 2CRFA 1DDWA 1P6SA 1P5TA 3ULBA 2K8EA 4PNKA 4QXAB 5LONB 3DCXA 5KQ4A 5C5BB 4KHBA 4BBKA 1MPHA 4K2PA 4PQ0A 4NY0A 2YVCA 4GXBA 5DHAB 1FHWA 1K5GB 2ADZA 4HAXB 5I2SA 5D3XA 4L6EA 4QJ5B 4HAVB 5HE0A 3PEGA 1U27A 4HAUB 2M14A 3NWAA 1Q67A 1V5UA 2KR0A 1NU2A 4CHJA 4K17A 2Q13A 2R09A 5D3YA 1Y19B 1NTYA 5CLQB 5HE2A 3DXDA 1W1GA 2LOXA 1H10A 1ZSQA 4GOUA 2E2XA 4KAXB 1BWNA 3SYXA 4D6WA 3PVLA 1N3HA 2EMTA 2MDXA 3BINA 1U2BA 3QBVB 2P0FA 4EMOA 3HK0A 4DX8A 2DA0A 3D8DA 1XKEA 1J19A 1TXDA 3ML4A 2DFKA 3HSAA 2LG1A 4TYZA 1E5WA 3WA0A 2V76A 4GN1A 4ZRKA 4HDOA 3A8QA 1LW3A 3QWMA 2N23A 1ZC3B 5LG4B 1UNQA 1MK9B 1DYNA 5FI0A 3OHMB 1FB8A 1X05A 2KUQA 4EKUA 3PP2A 2D10A 1FOEA 1NTVA 2GCLA 1V89A 1FHXA 3ODWA 4CHMA 2N0YA 2GUMA 4K81A 2Y8GA 4IFSA 2Z0PA 2ZKMX 4HB2B 1ZC4B 1X86A 4KHOA 1M7EA 1PFJA 1MAIA 2KCJA 1TJ6A 1V88A 2YT1A 5C16A 4MT7A 1AWEA 2D9YA 4A5KA 2KIGA 4H8SA 1WJMA 4DX90 4DIXA 2Z0QA 3NWDA 1QQGA 3TFMA 3P7ZA 2D11A 1MIZB 2UVMA 2DTCA 2W2XD 1W1HA 4WJ7A 2D4QA 3TO1A 3F0WA 3KRXA 2RSGA 4K2OA 2AEHA 4WSFA 3PSCA 2CY5A 3TVVA 3A58A 2GS0A 2NBVA 2L1CA 1I7AA 3D8FA 1GC7A 3MDBC 4GZUA 2K2JA 2Z59A 2IYBA 1WGQA
chains in the Genus database with same CATH topology
5LOPB 2IFSA 4HDQA 1Y5OA 2DYNA 3SV1A 1XODA 2D9WA 3DXCA 5JP4A 2D2QA 4D0NB 3P6AA 2YRYA 2DX1A 2MKRA 2GCJA 3GYPA 1PLSA 4MK0A 2RLOA 1OQNA 2RUKB 1FGZA 5HE3A 3VIAA 1X11A 3M1IB 3G9WA 1UPRA 1KZ7A 2YSZA 2DKQA 4IOYX 3GYOA 3U7DA 5J3YA 2I5CA 3PZDA 5C6RA 5L81A 1SGHA 2CAYA 2YF0A 4A6FA 2VSZA 5JLJB 2JP2A 4HATB 1WG7A 2KGXB 2BCJA 2ELBA 3SO6A 1BTKA 1K5DB 1GG3A 2J0JA 1DDMA 1KI1B 4KVGB 5KCVA 4Z2MB 5D27A 5J3QA 2AL6A 3D8EA 1PMSA 2RVBB 3HW2B 1FAOA 3TW1A 1NI2A 5HE1A 3X23A 2LYDA 2EMSA 3U8ZA 1EAZA 4F7HA 1RJ2A 4CYEA 2VRWB 3RCPA 3KRWA 1X1GA 3AU4A 2QKMA 1AQCA 2COAA 3LJUX 1EF1A 4HAYB 4Y94A 1I2HA 4HHVA 4A6KA 2P0DA 2UZRA 5KQ1A 2MFQA 3O96A 4YONA 2DHKA 1V5MA 3ODOA 2HTHB 3CXBB 4YL8A 1XCGA 1DROA 1W1DA 1U5FA 4DXAB 3F5RA 1BTNA 1KZGA 3KY9A 3TCAA 2H7DA 2YS5A 4XWXA 2G35A 1X1FA 2UZSA 4B6HA 4DBBA 2DKPA 3ZVRA 4F7GA 2ROZB 5JHHA 1TQZA 1DDVA 4HB3B 5C5BA 4HB0B 1U29A 3N7CA 1H4RA 1U5GA 1ZVRA 2K00A 4GMXB 1OMWA 1V5PA 1XD4A 1ISNA 2P8VA 3HQCA 4EJNA 3BJIA 2CODA 4P7IA 5FI1A 3ULCA 5C79A 4ZRJA 2X18A 4KHBB 2CY4A 1LB1A 4HAZB 4NSWA 2YS3A 4IAPA 1MK7B 2DHJA 4GMVA 2W2XC 5D3VA 3ZDTA 3A98B 2MWNB 1J0WA 3PG7A 3T06A 2D9ZA 1GC6A 3IVFA 2NMBA 2RGNB 2OQBA 2VKIA 5J3TA 1FGYA 1B55A 1UNPA 3NSUA 3A8PA 2NZ8B 2KUPA 3UZTA 4C0AA 2ELAA 2LULA 2Z0OA 2DN6A 1RRPB 2DHIA 4F7UP 5GOWB 1UPQA 1WVHA 3SNHA 1U5EA 2I5FA 2K2UA 3VOQA 1UNRA 1ZM0A 5CLLB 3FEHA 2COCA 1UEFA 2EC1A 2OTXA 5DH9B 3FM8C 2DYQA 1WI1A 3FSSA 4MY6A 2W2WA 2YS1A 2J0MA 4A6FB 3PVWA 1V61A 3KSYA 2ZPYA 2EJ8A 2I1JA 2Y8FA 1SHCA 2PZ1A 1OY2A 4GPTB 3MPXA 2COFA 1WGUA 5D3WA 4ZRIA 1EVHA 1P3RA 1Z87A 4WVFB 1XX0A 2M38A 3OANA 2YT0A 1FHOA 3ODXA 1QC6A 5JHGA 2DX5A 5DHFB 2J59M 4A6HA 2Y7BA 1MIXA 1BAKA 1M7RA 2RNRB 3V5WA 3KZ1A 3WYFB 2L2IA 2D9XA 2R0DA 2GJYA 3PVUA 2H7EA 2I1KA 1U5DA 1DBHA 2LOZA 3DXEA 3AJ4A 1IRSA 2XQNM 1MKEA 4HB4B 3AU5A 2DLWA 4Z2NA 1EGXA 2FJLA 2QKLA 3CIKA 2HE7A 2ROVA 5DI9B 2P0HA 3QIJA 1XR0B 1WJ1A 4HAWB 4KHAA 4TKNA 2J0KA 5EFXA 2D9VA 5DIFB 2LKOA 3SUZA 2CRFA 1DDWA 1P6SA 1P5TA 3ULBA 4PNKA 5LONB 5KQ4A 5C5BB 4BBKA 1MPHA 4K2PA 4PQ0A 4NY0A 2YVCA 4GXBA 5DHAB 1FHWA 1K5GB 2ADZA 4HAXB 5D3XA 4L6EA 4HAVB 5HE0A 3PEGA 1U27A 4HAUB 2M14A 1Q67A 1V5UA 1NU2A 4CHJA 4K17A 2Q13A 2R09A 5D3YA 1Y19B 1NTYA 5CLQB 5HE2A 3DXDA 1W1GA 2LOXA 1H10A 1ZSQA 4KAXB 2E2XA 1BWNA 3SYXA 3PVLA 1N3HA 2EMTA 2MDXA 3BINA 1U2BA 3QBVB 2P0FA 4EMOA 3HK0A 4DX8A 2DA0A 3D8DA 1XKEA 1J19A 1TXDA 3ML4A 2DFKA 2LG1A 4TYZA 1E5WA 3WA0A 2V76A 4GN1A 4ZRKA 4HDOA 3A8QA 1LW3A 3QWMA 2N23A 1ZC3B 1UNQA 1MK9B 1DYNA 5FI0A 1FB8A 1X05A 4EKUA 3PP2A 2D10A 1FOEA 1NTVA 2GCLA 1V89A 1FHXA 3ODWA 4CHMA 2N0YA 4K81A 2Y8GA 4IFSA 2Z0PA 4HB2B 1ZC4B 1X86A 4KHOA 1M7EA 1PFJA 1MAIA 2KCJA 1TJ6A 1V88A 2YT1A 5C16A 4MT7A 1AWEA 2D9YA 4A5KA 4H8SA 1WJMA 4DX90 2Z0QA 1QQGA 3TFMA 3P7ZA 2D11A 1MIZB 2UVMA 2DTCA 2W2XD 1W1HA 4WJ7A 2D4QA 3TO1A 3F0WA 3KRXA 2RSGA 4K2OA 2AEHA 4WSFA 3PSCA 2CY5A 3TVVA 2GS0A 2L1CA 1I7AA 3D8FA 1GC7A 3MDBC 4GZUA 2K2JA 2IYBA 1WGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LOP B;  2IFS A;  4HDQ A;  1Y5O A;  2DYN A;  3SV1 A;  1XOD A;  2D9W A;  3DXC A;  5JP4 A;  2D2Q A;  4D0N B;  3P6A A;  2YRY A;  2DX1 A;  2MKR A;  2GCJ A;  3GYP A;  1PLS A;  4MK0 A;  2RLO A;  1OQN A;  2RUK B;  1FGZ A;  5HE3 A;  3VIA A;  1X11 A;  3M1I B;  3G9W A;  1UPR A;  1KZ7 A;  2YSZ A;  2DKQ A;  4IOY X;  3GYO A;  3U7D A;  5J3Y A;  2I5C A;  3PZD A;  5C6R A;  5L81 A;  1SGH A;  2CAY A;  2YF0 A;  4A6F A;  2VSZ A;  5JLJ B;  2JP2 A;  4HAT B;  1WG7 A;  2KGX B;  2BCJ A;  2ELB A;  3SO6 A;  1BTK A;  1K5D B;  1GG3 A;  2J0J A;  1DDM A;  1KI1 B;  4KVG B;  5KCV A;  4Z2M B;  5D27 A;  5J3Q A;  2AL6 A;  3D8E A;  1PMS A;  2RVB B;  3HW2 B;  1FAO A;  3TW1 A;  1NI2 A;  5HE1 A;  3X23 A;  2LYD A;  2EMS A;  3U8Z A;  1EAZ A;  4F7H A;  1RJ2 A;  4CYE A;  2VRW B;  3RCP A;  3KRW A;  1X1G A;  3AU4 A;  2QKM A;  1AQC A;  2COA A;  3LJU X;  1EF1 A;  4HAY B;  4Y94 A;  1I2H A;  4HHV A;  4A6K A;  2P0D A;  2UZR A;  5KQ1 A;  2MFQ A;  3O96 A;  4YON A;  2DHK A;  1V5M A;  3ODO A;  2HTH B;  3CXB B;  4YL8 A;  1XCG A;  1DRO A;  1W1D A;  1U5F A;  4DXA B;  3F5R A;  1BTN A;  1KZG A;  3KY9 A;  3TCA A;  2H7D A;  2YS5 A;  4XWX A;  2G35 A;  1X1F A;  2UZS A;  4B6H A;  4DBB A;  2DKP A;  3ZVR A;  4F7G A;  2ROZ B;  5JHH A;  1TQZ A;  1DDV A;  4HB3 B;  5C5B A;  4HB0 B;  1U29 A;  3N7C A;  1H4R A;  1U5G A;  1ZVR A;  2K00 A;  4GMX B;  1OMW A;  1V5P A;  1XD4 A;  1ISN A;  2P8V A;  3HQC A;  4EJN A;  3BJI A;  2COD A;  4P7I A;  5FI1 A;  3ULC A;  5C79 A;  4ZRJ A;  2X18 A;  4KHB B;  2CY4 A;  1LB1 A;  4HAZ B;  4NSW A;  2YS3 A;  4IAP A;  1MK7 B;  2DHJ A;  4GMV A;  2W2X C;  5D3V A;  3ZDT A;  3A98 B;  2MWN B;  1J0W A;  3PG7 A;  3T06 A;  2D9Z A;  1GC6 A;  3IVF A;  2NMB A;  2RGN B;  2OQB A;  2VKI A;  5J3T A;  1FGY A;  1B55 A;  1UNP A;  3NSU A;  3A8P A;  2NZ8 B;  2KUP A;  3UZT A;  4C0A A;  2ELA A;  2LUL A;  2Z0O A;  2DN6 A;  1RRP B;  2DHI A;  4F7U P;  5GOW B;  1UPQ A;  1WVH A;  3SNH A;  1U5E A;  2I5F A;  2K2U A;  3VOQ A;  1UNR A;  1ZM0 A;  5CLL B;  3FEH A;  2COC A;  1UEF A;  2EC1 A;  2OTX A;  5DH9 B;  3FM8 C;  2DYQ A;  1WI1 A;  3FSS A;  4MY6 A;  2W2W A;  2YS1 A;  2J0M A;  4A6F B;  3PVW A;  1V61 A;  3KSY A;  2ZPY A;  2EJ8 A;  2I1J A;  2Y8F A;  1SHC A;  2PZ1 A;  1OY2 A;  4GPT B;  3MPX A;  2COF A;  1WGU A;  5D3W A;  4ZRI A;  1EVH A;  1P3R A;  1Z87 A;  4WVF B;  1XX0 A;  2M38 A;  3OAN A;  2YT0 A;  1FHO A;  3ODX A;  1QC6 A;  5JHG A;  2DX5 A;  5DHF B;  2J59 M;  4A6H A;  2Y7B A;  1MIX A;  1BAK A;  1M7R A;  2RNR B;  3V5W A;  3KZ1 A;  3WYF B;  2L2I A;  2D9X A;  2R0D A;  2GJY A;  3PVU A;  2H7E A;  2I1K A;  1U5D A;  1DBH A;  2LOZ A;  3DXE A;  3AJ4 A;  1IRS A;  2XQN M;  1MKE A;  4HB4 B;  3AU5 A;  2DLW A;  4Z2N A;  1EGX A;  2FJL A;  2QKL A;  3CIK A;  2HE7 A;  2ROV A;  5DI9 B;  2P0H A;  3QIJ A;  1XR0 B;  1WJ1 A;  4HAW B;  4KHA A;  4TKN A;  2J0K A;  5EFX A;  2D9V A;  5DIF B;  2LKO A;  3SUZ A;  2CRF A;  1DDW A;  1P6S A;  1P5T A;  3ULB A;  4PNK A;  5LON B;  5KQ4 A;  5C5B B;  4BBK A;  1MPH A;  4K2P A;  4PQ0 A;  4NY0 A;  2YVC A;  4GXB A;  5DHA B;  1FHW A;  1K5G B;  2ADZ A;  4HAX B;  5D3X A;  4L6E A;  4HAV B;  5HE0 A;  3PEG A;  1U27 A;  4HAU B;  2M14 A;  1Q67 A;  1V5U A;  1NU2 A;  4CHJ A;  4K17 A;  2Q13 A;  2R09 A;  5D3Y A;  1Y19 B;  1NTY A;  5CLQ B;  5HE2 A;  3DXD A;  1W1G A;  2LOX A;  1H10 A;  1ZSQ A;  4KAX B;  2E2X A;  1BWN A;  3SYX A;  3PVL A;  1N3H A;  2EMT A;  2MDX A;  3BIN A;  1U2B A;  3QBV B;  2P0F A;  4EMO A;  3HK0 A;  4DX8 A;  2DA0 A;  3D8D A;  1XKE A;  1J19 A;  1TXD A;  3ML4 A;  2DFK A;  2LG1 A;  4TYZ A;  1E5W A;  3WA0 A;  2V76 A;  4GN1 A;  4ZRK A;  4HDO A;  3A8Q A;  1LW3 A;  3QWM A;  2N23 A;  1ZC3 B;  1UNQ A;  1MK9 B;  1DYN A;  5FI0 A;  1FB8 A;  1X05 A;  4EKU A;  3PP2 A;  2D10 A;  1FOE A;  1NTV A;  2GCL A;  1V89 A;  1FHX A;  3ODW A;  4CHM A;  2N0Y A;  4K81 A;  2Y8G A;  4IFS A;  2Z0P A;  4HB2 B;  1ZC4 B;  1X86 A;  4KHO A;  1M7E A;  1PFJ A;  1MAI A;  2KCJ A;  1TJ6 A;  1V88 A;  2YT1 A;  5C16 A;  4MT7 A;  1AWE A;  2D9Y A;  4A5K A;  4H8S A;  1WJM A;  4DX9 0;  2Z0Q A;  1QQG A;  3TFM A;  3P7Z A;  2D11 A;  1MIZ B;  2UVM A;  2DTC A;  2W2X D;  1W1H A;  4WJ7 A;  2D4Q A;  3TO1 A;  3F0W A;  3KRX A;  2RSG A;  4K2O A;  2AEH A;  4WSF A;  3PSC A;  2CY5 A;  3TVV A;  2GS0 A;  2L1C A;  1I7A A;  3D8F A;  1GC7 A;  3MDB C;  4GZU A;  2K2J A;  2IYB A;  1WGQ A; 
#chains in the Genus database with same CATH topology
 5LOP B;  2IFS A;  4HDQ A;  1Y5O A;  2DYN A;  3SV1 A;  1XOD A;  2D9W A;  3DXC A;  5JP4 A;  2D2Q A;  4CSQ A;  4D0N B;  3P6A A;  2YRY A;  2DX1 A;  2MKR A;  2GCJ A;  3GYP A;  4QJ3 B;  1PLS A;  4MK0 A;  2RLO A;  1OQN A;  2RUK B;  1FGZ A;  5HE3 A;  3VIA A;  1X11 A;  3M1I B;  3G9W A;  1UPR A;  1KZ7 A;  2YSZ A;  2DKQ A;  4IOY X;  3GYO A;  3U7D A;  5J3Y A;  2I5C A;  3PZD A;  5C6R A;  5L81 A;  1SGH A;  2CAY A;  2RRF A;  2YF0 A;  2Z14 A;  4A6F A;  2VSZ A;  5JLJ B;  2JP2 A;  4HAT B;  1WG7 A;  2KGX B;  2BCJ A;  2ELB A;  3SO6 A;  1BTK A;  1K5D B;  1GG3 A;  2J0J A;  1DDM A;  1KI1 B;  4KVG B;  5KCV A;  4Z2M B;  5D27 A;  5J3Q A;  2AL6 A;  3D8E A;  1PMS A;  2RVB B;  3FVC A;  3HW2 B;  1FAO A;  3TW1 A;  1NI2 A;  5HE1 A;  3X23 A;  2LYD A;  2EMS A;  3U8Z A;  1EAZ A;  4GNK B;  3U12 A;  4F7H A;  1RJ2 A;  4CYE A;  2VRW B;  3RCP A;  3KRW A;  1X1G A;  4OSN A;  3AU4 A;  2QKM A;  1AQC A;  2COA A;  3LJU X;  1EF1 A;  4L1R A;  4HAY B;  4Y94 A;  1I2H A;  4HHV A;  4A6K A;  2P0D A;  2UZR A;  5KQ1 A;  2MFQ A;  3O96 A;  4YON A;  2DHK A;  1V5M A;  3ODO A;  2HTH B;  2K49 A;  3CXB B;  4YL8 A;  1XCG A;  1DRO A;  1W1D A;  1U5F A;  4DXA B;  3F5R A;  1BTN A;  1KZG A;  3KY9 A;  3TCA A;  2Z4D A;  2H7D A;  2YS5 A;  4XWX A;  2G35 A;  1X1F A;  2UZS A;  4B6H A;  4DBB A;  2DKP A;  3ZVR A;  4F7G A;  2ROZ B;  5JHH A;  1TQZ A;  1DDV A;  4HB3 B;  5C5B A;  4HB0 B;  1U29 A;  3N7C A;  1H4R A;  1U5G A;  1ZVR A;  2K00 A;  4GMX B;  1OMW A;  1V5P A;  1XD4 A;  1ISN A;  2P8V A;  3HQC A;  2Z13 A;  4EJN A;  3BJI A;  2COD A;  4P7I A;  5M4Y B;  5FI1 A;  3ULC A;  5C79 A;  4ZRJ A;  2X18 A;  4KHB B;  2CY4 A;  1LB1 A;  4HAZ B;  2YT2 A;  4NSW A;  2YS3 A;  4IAP A;  1MK7 B;  2DHJ A;  4GMV A;  2W2X C;  1T77 A;  3B77 A;  5D3V A;  3ZDT A;  3A98 B;  2MWN B;  1J0W A;  3PG7 A;  2KIE A;  3T06 A;  2D9Z A;  1GC6 A;  3IVF A;  1ZYI A;  2NMB A;  2RGN B;  2OQB A;  2VKI A;  5J3T A;  1FGY A;  1B55 A;  1UNP A;  3NSU A;  3A8P A;  2NZ8 B;  2KUP A;  4QJ4 B;  3UZT A;  4C0A A;  2ELA A;  2LUL A;  2Z0O A;  2DN6 A;  1RRP B;  2DHI A;  5IRS A;  4F7U P;  5GOW B;  1UPQ A;  1WVH A;  3SNH A;  1U5E A;  2I5F A;  2K2U A;  3VOQ A;  1UNR A;  1ZM0 A;  5CLL B;  3FEH A;  2COC A;  1MI1 A;  1UEF A;  2EC1 A;  2OTX A;  4OT1 A;  5DH9 B;  3FM8 C;  2DYQ A;  1WI1 A;  3FSS A;  4MY6 A;  2W2W A;  4HSI A;  2YS1 A;  2J0M A;  4A6F B;  3PVW A;  1V61 A;  3KSY A;  2ZPY A;  2EJ8 A;  2I1J A;  2Y8F A;  2PZ1 A;  1SHC A;  1OY2 A;  4GPT B;  2COF A;  3MPX A;  1WGU A;  5D3W A;  4ZRI A;  1EVH A;  1P3R A;  1Z87 A;  4WVF B;  1XX0 A;  2M38 A;  3OAN A;  2YT0 A;  5I2M A;  3ODX A;  1QC6 A;  1FHO A;  5JHG A;  2DX5 A;  5DHF B;  2J59 M;  4A6H A;  2Y7B A;  2FJU B;  1MIX A;  1BAK A;  1M7R A;  2RNR B;  3V5W A;  3KZ1 A;  2R2Y A;  3WYF B;  2L2I A;  2D9X A;  2R0D A;  2GJY A;  3PVU A;  2H7E A;  2I1K A;  1U5D A;  1DBH A;  3NWF A;  2LOZ A;  3DXE A;  3AJ4 A;  1IRS A;  2XQN M;  1MKE A;  4HB4 B;  3AU5 A;  3NW8 A;  2DLW A;  4Z2N A;  1EGX A;  3HIE A;  2FJL A;  2QKL A;  3CIK A;  2HE7 A;  2ROV A;  5DI9 B;  2P0H A;  3QIJ A;  1XR0 B;  1WJ1 A;  4HAW B;  4KHA A;  4TKN A;  2J0K A;  5EFX A;  2D9V A;  5DIF B;  2LKO A;  3SUZ A;  2CRF A;  1DDW A;  1P6S A;  1P5T A;  3ULB A;  2K8E A;  4PNK A;  4QXA B;  5LON B;  3DCX A;  5KQ4 A;  5C5B B;  4KHB A;  4BBK A;  1MPH A;  4K2P A;  4PQ0 A;  4NY0 A;  2YVC A;  4GXB A;  5DHA B;  1FHW A;  1K5G B;  2ADZ A;  4HAX B;  5I2S A;  5D3X A;  4L6E A;  4QJ5 B;  4HAV B;  5HE0 A;  3PEG A;  1U27 A;  4HAU B;  2M14 A;  3NWA A;  1Q67 A;  1V5U A;  2KR0 A;  1NU2 A;  4CHJ A;  4K17 A;  2Q13 A;  2R09 A;  5D3Y A;  1Y19 B;  1NTY A;  5CLQ B;  5HE2 A;  3DXD A;  1W1G A;  2LOX A;  1H10 A;  1ZSQ A;  4GOU A;  2E2X A;  4KAX B;  1BWN A;  3SYX A;  4D6W A;  3PVL A;  1N3H A;  2EMT A;  2MDX A;  3BIN A;  1U2B A;  3QBV B;  2P0F A;  4EMO A;  3HK0 A;  4DX8 A;  2DA0 A;  3D8D A;  1XKE A;  1J19 A;  1TXD A;  3ML4 A;  2DFK A;  3HSA A;  2LG1 A;  4TYZ A;  1E5W A;  3WA0 A;  2V76 A;  4GN1 A;  4ZRK A;  4HDO A;  3A8Q A;  1LW3 A;  3QWM A;  2N23 A;  1ZC3 B;  5LG4 B;  1UNQ A;  1MK9 B;  1DYN A;  5FI0 A;  3OHM B;  1FB8 A;  1X05 A;  2KUQ A;  4EKU A;  3PP2 A;  2D10 A;  1FOE A;  1NTV A;  2GCL A;  1V89 A;  1FHX A;  3ODW A;  4CHM A;  2N0Y A;  2GUM A;  4K81 A;  2Y8G A;  4IFS A;  2Z0P A;  2ZKM X;  4HB2 B;  1ZC4 B;  1X86 A;  4KHO A;  1M7E A;  1PFJ A;  1MAI A;  2KCJ A;  1TJ6 A;  1V88 A;  2YT1 A;  5C16 A;  4MT7 A;  1AWE A;  2D9Y A;  4A5K A;  2KIG A;  4H8S A;  1WJM A;  4DX9 0;  4DIX A;  2Z0Q A;  3NWD A;  1QQG A;  3TFM A;  3P7Z A;  2D11 A;  1MIZ B;  2UVM A;  2DTC A;  2W2X D;  1W1H A;  4WJ7 A;  2D4Q A;  3TO1 A;  3F0W A;  3KRX A;  2RSG A;  4K2O A;  2AEH A;  4WSF A;  3PSC A;  2CY5 A;  3TVV A;  3A58 A;  2GS0 A;  2NBV A;  2L1C A;  1I7A A;  3D8F A;  1GC7 A;  3MDB C;  4GZU A;  2K2J A;  2Z59 A;  2IYB A;  1WGQ A; 
#chains in the Genus database with same CATH homology
 5LOP B;  2IFS A;  4HDQ A;  1Y5O A;  2DYN A;  3SV1 A;  1XOD A;  2D9W A;  3DXC A;  5JP4 A;  2D2Q A;  4D0N B;  3P6A A;  2YRY A;  2DX1 A;  2MKR A;  2GCJ A;  3GYP A;  1PLS A;  4MK0 A;  2RLO A;  1OQN A;  2RUK B;  1FGZ A;  5HE3 A;  3VIA A;  1X11 A;  3M1I B;  3G9W A;  1UPR A;  1KZ7 A;  2YSZ A;  2DKQ A;  4IOY X;  3GYO A;  3U7D A;  5J3Y A;  2I5C A;  3PZD A;  5C6R A;  5L81 A;  1SGH A;  2CAY A;  2YF0 A;  4A6F A;  2VSZ A;  5JLJ B;  2JP2 A;  4HAT B;  1WG7 A;  2KGX B;  2BCJ A;  2ELB A;  3SO6 A;  1BTK A;  1K5D B;  1GG3 A;  2J0J A;  1DDM A;  1KI1 B;  4KVG B;  5KCV A;  4Z2M B;  5D27 A;  5J3Q A;  2AL6 A;  3D8E A;  1PMS A;  2RVB B;  3HW2 B;  1FAO A;  3TW1 A;  1NI2 A;  5HE1 A;  3X23 A;  2LYD A;  2EMS A;  3U8Z A;  1EAZ A;  4F7H A;  1RJ2 A;  4CYE A;  2VRW B;  3RCP A;  3KRW A;  1X1G A;  3AU4 A;  2QKM A;  1AQC A;  2COA A;  3LJU X;  1EF1 A;  4HAY B;  4Y94 A;  1I2H A;  4HHV A;  4A6K A;  2P0D A;  2UZR A;  5KQ1 A;  2MFQ A;  3O96 A;  4YON A;  2DHK A;  1V5M A;  3ODO A;  2HTH B;  3CXB B;  4YL8 A;  1XCG A;  1DRO A;  1W1D A;  1U5F A;  4DXA B;  3F5R A;  1BTN A;  1KZG A;  3KY9 A;  3TCA A;  2H7D A;  2YS5 A;  4XWX A;  2G35 A;  1X1F A;  2UZS A;  4B6H A;  4DBB A;  2DKP A;  3ZVR A;  4F7G A;  2ROZ B;  5JHH A;  1TQZ A;  1DDV A;  4HB3 B;  5C5B A;  4HB0 B;  1U29 A;  3N7C A;  1H4R A;  1U5G A;  1ZVR A;  2K00 A;  4GMX B;  1OMW A;  1V5P A;  1XD4 A;  1ISN A;  2P8V A;  3HQC A;  4EJN A;  3BJI A;  2COD A;  4P7I A;  5FI1 A;  3ULC A;  5C79 A;  4ZRJ A;  2X18 A;  4KHB B;  2CY4 A;  1LB1 A;  4HAZ B;  4NSW A;  2YS3 A;  4IAP A;  1MK7 B;  2DHJ A;  4GMV A;  2W2X C;  5D3V A;  3ZDT A;  3A98 B;  2MWN B;  1J0W A;  3PG7 A;  3T06 A;  2D9Z A;  1GC6 A;  3IVF A;  2NMB A;  2RGN B;  2OQB A;  2VKI A;  5J3T A;  1FGY A;  1B55 A;  1UNP A;  3NSU A;  3A8P A;  2NZ8 B;  2KUP A;  3UZT A;  4C0A A;  2ELA A;  2LUL A;  2Z0O A;  2DN6 A;  1RRP B;  2DHI A;  4F7U P;  5GOW B;  1UPQ A;  1WVH A;  3SNH A;  1U5E A;  2I5F A;  2K2U A;  3VOQ A;  1UNR A;  1ZM0 A;  5CLL B;  3FEH A;  2COC A;  1UEF A;  2EC1 A;  2OTX A;  5DH9 B;  3FM8 C;  2DYQ A;  1WI1 A;  3FSS A;  4MY6 A;  2W2W A;  2YS1 A;  2J0M A;  4A6F B;  3PVW A;  1V61 A;  3KSY A;  2ZPY A;  2EJ8 A;  2I1J A;  2Y8F A;  1SHC A;  2PZ1 A;  1OY2 A;  4GPT B;  3MPX A;  2COF A;  1WGU A;  5D3W A;  4ZRI A;  1EVH A;  1P3R A;  1Z87 A;  4WVF B;  1XX0 A;  2M38 A;  3OAN A;  2YT0 A;  1FHO A;  3ODX A;  1QC6 A;  5JHG A;  2DX5 A;  5DHF B;  2J59 M;  4A6H A;  2Y7B A;  1MIX A;  1BAK A;  1M7R A;  2RNR B;  3V5W A;  3KZ1 A;  3WYF B;  2L2I A;  2D9X A;  2R0D A;  2GJY A;  3PVU A;  2H7E A;  2I1K A;  1U5D A;  1DBH A;  2LOZ A;  3DXE A;  3AJ4 A;  1IRS A;  2XQN M;  1MKE A;  4HB4 B;  3AU5 A;  2DLW A;  4Z2N A;  1EGX A;  2FJL A;  2QKL A;  3CIK A;  2HE7 A;  2ROV A;  5DI9 B;  2P0H A;  3QIJ A;  1XR0 B;  1WJ1 A;  4HAW B;  4KHA A;  4TKN A;  2J0K A;  5EFX A;  2D9V A;  5DIF B;  2LKO A;  3SUZ A;  2CRF A;  1DDW A;  1P6S A;  1P5T A;  3ULB A;  4PNK A;  5LON B;  5KQ4 A;  5C5B B;  4BBK A;  1MPH A;  4K2P A;  4PQ0 A;  4NY0 A;  2YVC A;  4GXB A;  5DHA B;  1FHW A;  1K5G B;  2ADZ A;  4HAX B;  5D3X A;  4L6E A;  4HAV B;  5HE0 A;  3PEG A;  1U27 A;  4HAU B;  2M14 A;  1Q67 A;  1V5U A;  1NU2 A;  4CHJ A;  4K17 A;  2Q13 A;  2R09 A;  5D3Y A;  1Y19 B;  1NTY A;  5CLQ B;  5HE2 A;  3DXD A;  1W1G A;  2LOX A;  1H10 A;  1ZSQ A;  4KAX B;  2E2X A;  1BWN A;  3SYX A;  3PVL A;  1N3H A;  2EMT A;  2MDX A;  3BIN A;  1U2B A;  3QBV B;  2P0F A;  4EMO A;  3HK0 A;  4DX8 A;  2DA0 A;  3D8D A;  1XKE A;  1J19 A;  1TXD A;  3ML4 A;  2DFK A;  2LG1 A;  4TYZ A;  1E5W A;  3WA0 A;  2V76 A;  4GN1 A;  4ZRK A;  4HDO A;  3A8Q A;  1LW3 A;  3QWM A;  2N23 A;  1ZC3 B;  1UNQ A;  1MK9 B;  1DYN A;  5FI0 A;  1FB8 A;  1X05 A;  4EKU A;  3PP2 A;  2D10 A;  1FOE A;  1NTV A;  2GCL A;  1V89 A;  1FHX A;  3ODW A;  4CHM A;  2N0Y A;  4K81 A;  2Y8G A;  4IFS A;  2Z0P A;  4HB2 B;  1ZC4 B;  1X86 A;  4KHO A;  1M7E A;  1PFJ A;  1MAI A;  2KCJ A;  1TJ6 A;  1V88 A;  2YT1 A;  5C16 A;  4MT7 A;  1AWE A;  2D9Y A;  4A5K A;  4H8S A;  1WJM A;  4DX9 0;  2Z0Q A;  1QQG A;  3TFM A;  3P7Z A;  2D11 A;  1MIZ B;  2UVM A;  2DTC A;  2W2X D;  1W1H A;  4WJ7 A;  2D4Q A;  3TO1 A;  3F0W A;  3KRX A;  2RSG A;  4K2O A;  2AEH A;  4WSF A;  3PSC A;  2CY5 A;  3TVV A;  2GS0 A;  2L1C A;  1I7A A;  3D8F A;  1GC7 A;  3MDB C;  4GZU A;  2K2J A;  2IYB A;  1WGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...