1DDVA

Crystal structure of the homer evh1 domain with bound mglur peptide
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
b'IFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINSTITPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLGF-DOMAIN PROTEIN HOMER
molecule tags Signaling protein
source organism Rattus norvegicus
publication title Structure of the Homer EVH1 domain-peptide complex reveals a new twist in polyproline recognition.
pubmed doi rcsb
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 1999-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1ddvA00
1DYNA 2P0DA 1QC6A 1W1HA 1J0WA 1E5WA 3A98B 3ODWA 5J3YA 2J0KA 3P6AA 3O96A 5DH9B 3V5WA 3MDBC 1KZGA 1ZM0A 1V5UA 5FI0A 1FHXA 3PVUA 1DDVA 5D3WA 3N7CA 1P5TA 3NSUA 3D8DA 3HQCA 1ISNA 1MAIA 3A8PA 2RLOA 2V76A 4A5KA 1PMSA 2ROVA 2DFKA 1PLSA 3IVFA 2J0MA 2CAYA 4MK0A 3F5RA 4YONA 4D0NB 3SUZA 1WJ1A 4HB2B 5DHAB 4K17A 5KQ1A 2UZRA 4HDQA 2QKLA 4GMVA 3QIJA 4Z2NA 4DX8A 4B6HA 2X18A 4F7HA 1FHWA 2VRWB 5HE0A 4CYEA 1BWNA 3MPXA 1WGUA 1DBHA 4KHAA 1M7EA 1ZC3B 3HK0A 2W2WA 5CLQB 1WJMA 2GJYA 4XWXA 5D3VA 2KUPA 2YT1A 1W1DA 2W2XC 3AU5A 1WG7A 2XQNM 2ELBA 2CY4A 1H10A 3SO6A 5JP4A 1MIXA 1U2BA 2MDXA 2UVMA 4A6KA 3CIKA 5DIFB 2E2XA 2D10A 1MPHA 5J3TA 5J3QA 1I2HA 4L6EA 2I5CA 1BTNA 2RUKB 1J19A 2YVCA 2DTCA 4HDOA 2AL6A 2Y8FA 5CLLB 1FGZA 3KZ1A 2P0HA 3ULCA 1NTVA 5LONB 4F7UP 1X86A 2DA0A 2P8VA 3PG7A 1K5GB 1EF1A 4A6HA 4EKUA 4HB4B 3BJIA 1MIZB 2MFQA 4GZUA 3P7ZA 4NSWA 2COFA 3QWMA 1OQNA 2COCA 1PFJA 1Z87A 1EAZA 3X23A 1NI2A 1K5DB 4KHBB 4HAZB 2K00A 1WVHA 5C5BB 3WA0A 1B55A 1UNQA 1TJ6A 1IRSA 3DXCA 3QBVB 1X11A 2UZSA 2MWNB 2LKOA 5D27A 4WSFA 3G9WA 2ELAA 3M1IB 2COAA 2H7DA 4P7IA 4HB0B 1BAKA 2EMTA 2AEHA 1QQGA 4K2PA 3SNHA 1DDMA 4MT7A 1TQZA 2ROZB 4GXBA 4K2OA 3VIAA 1V5MA 1XODA 1KI1B 1UNRA 2DKPA 3ZVRA 1UPQA 2GS0A 1TXDA 2G35A 3PSCA 2Y7BA 2M14A 2Q13A 2D9YA 1ZSQA 1X05A 3TW1A 1WGQA 3TO1A 2VSZA 3AJ4A 2Z0QA 2FJLA 1V5PA 3KY9A 1FB8A 2N0YA 4KVGB 2I1KA 1OY2A 2DHIA 4IAPA 1M7RA 1NU2A 1GG3A 3FSSA 3PEGA 1V89A 2LOXA 5HE1A 1EVHA 2NZ8B 2YT0A 5C6RA 3T06A 1U5EA 1V88A 3LJUX 5LOPB 1XD4A 5KQ4A 1H4RA 2CY5A 2DX5A 2LULA 4HAUB 3PZDA 3TVVA 2D9VA 2YS1A 4ZRKA 2D11A 2YS5A 4EMOA 3RCPA 3UZTA 2LYDA 2KGXB 2GCJA 2R09A 2DHKA 3HW2B 2MKRA 1U5FA 1LB1A 1MK9B 2D4QA 4HHVA 2DX1A 3GYPA 2HE7A 1OMWA 5GOWB 4WJ7A 4TYZA 1BTKA 2LG1A 5FI1A 3BINA 2M38A 4A6FA 2JP2A 4C0AA 5DI9B 4PNKA 1Y5OA 2OQBA 4Y94A 2D9ZA 1U27A 2RVBB 1I7AA 1WI1A 2RSGA 1RRPB 1UPRA 2DKQA 4CHMA 4Z2MB 2J59M 2IFSA 2YSZA 3A8QA 3GYOA 4HATB 2RGNB 4DXAB 1U29A 5EFXA 3ULBA 4ZRJA 1U5DA 1FAOA 4NY0A 1AWEA 2EJ8A 2HTHB 2RNRB 2Z0PA 3VOQA 4GMXB 2ADZA 1EGXA 1XX0A 3D8FA 2I1JA 4K81A 1XKEA 4IFSA 1KZ7A 2YF0A 2I5FA 4TKNA 3WYFB 4KHOA 2ZPYA 3F0WA 3ML4A 2OTXA 4HAXB 5C5BA 2W2XD 1ZVRA 3KRXA 2CODA 3ODXA 4DX90 3D8EA 4HB3B 4GN1A 1W1GA 1Y19B 2GCLA 2L2IA 4GPTB 1FOEA 2K2UA 1XR0B 2N23A 1V61A 1RJ2A 1FHOA 2K2JA 2PZ1A 2QKMA 2Z0OA 2EC1A 3KSYA 5D3XA 5HE3A 4BBKA 2DYNA 2P0FA 1MK7B 2H7EA 4ZRIA 4HAVB 1GC7A 5L81A 1MKEA 4KAXB 5JHGA 1UEFA 5C79A 3DXEA 2YS3A 4YL8A 4CHJA 5D3YA 1ZC4B 1GC6A 3PP2A 3FM8C 1LW3A 3TCAA 1SGHA 1P6SA 2DHJA 3KRWA 1P3RA 2L1CA 4HAYB 4PQ0A 3ODOA 4H8SA 3AU4A 4F7GA 2LOZA 3OANA 4WVFB 1DROA 5DHFB 4EJNA 1X1GA 2CRFA 2BCJA 3SYXA 2D2QA 5HE2A 3PVLA 1X1FA 1XCGA 1Q67A 5KCVA 2J0JA 3CXBB 4IOYX 3PVWA 1N3HA 2IYBA 1FGYA 2KCJA 5C16A 1U5GA 5JHHA 3SV1A 1NTYA 3TFMA 4DBBA 2D9WA 3ZDTA 4HAWB 1UNPA 4MY6A 2D9XA 2Y8GA 2DLWA 1DDWA 2NMBA 2DYQA 1AQCA 3FEHA 3U8ZA 2R0DA 5JLJB 3U7DA 3DXDA 1SHCA 2YRYA 2EMSA 2VKIA 4A6FB 2DN6A
chains in the Genus database with same CATH superfamily
1DYNA 2P0DA 1QC6A 1W1HA 1J0WA 1E5WA 3A98B 3ODWA 5J3YA 2J0KA 3P6AA 3O96A 5DH9B 3V5WA 3MDBC 1KZGA 1ZM0A 1V5UA 5FI0A 1FHXA 3PVUA 1DDVA 5D3WA 5LG4B 3N7CA 1P5TA 3NSUA 3D8DA 3HQCA 1ISNA 1MAIA 3A8PA 2RLOA 2V76A 4A5KA 4QJ4B 1PMSA 4QJ5B 2ROVA 2DFKA 1PLSA 3IVFA 2J0MA 2CAYA 4MK0A 3F5RA 4YONA 4D0NB 3SUZA 1WJ1A 4HB2B 5DHAB 4K17A 5KQ1A 2UZRA 3A58A 4HDQA 2QKLA 4GMVA 3QIJA 4Z2NA 4DX8A 2KIEA 2Z13A 4B6HA 2X18A 4F7HA 1FHWA 2VRWB 5HE0A 4CYEA 1BWNA 2KUQA 3MPXA 1WGUA 1DBHA 4KHAA 1M7EA 1ZC3B 3HK0A 2W2WA 5CLQB 2Z14A 1WJMA 2GJYA 4XWXA 5D3VA 2KUPA 2YT1A 1W1DA 1MI1A 2W2XC 3AU5A 1WG7A 2XQNM 2ELBA 2CY4A 1H10A 2K49A 3SO6A 5JP4A 1MIXA 1U2BA 2MDXA 4OSNA 2UVMA 4A6KA 3CIKA 5DIFB 2E2XA 2D10A 1MPHA 5J3TA 5J3QA 5I2MA 1I2HA 4L6EA 2I5CA 1BTNA 2RUKB 1J19A 2YVCA 2DTCA 4HDOA 2AL6A 2Y8FA 4L1RA 1FGZA 5CLLB 3KZ1A 2P0HA 3ULCA 1NTVA 5LONB 3NWFA 1T77A 4F7UP 1X86A 2DA0A 2P8VA 3PG7A 1K5GB 1EF1A 5I2SA 4A6HA 4EKUA 4HB4B 3BJIA 1MIZB 3U12A 2MFQA 4GZUA 3P7ZA 4NSWA 2Z59A 2COFA 3QWMA 1OQNA 2COCA 1PFJA 1Z87A 1EAZA 3X23A 1NI2A 1K5DB 4KHBB 4HAZB 2K00A 1WVHA 5C5BB 3WA0A 1B55A 2GUMA 1UNQA 1TJ6A 1IRSA 3DXCA 3QBVB 1X11A 2UZSA 2MWNB 2LKOA 5D27A 4WSFA 3G9WA 2ELAA 3M1IB 2COAA 2H7DA 4P7IA 4HB0B 1BAKA 2EMTA 2AEHA 1QQGA 4K2PA 3SNHA 1DDMA 4MT7A 1TQZA 2ROZB 4GXBA 4K2OA 3VIAA 1V5MA 1XODA 1KI1B 1UNRA 2DKPA 3ZVRA 1UPQA 2GS0A 1TXDA 2G35A 3PSCA 2Y7BA 2M14A 2Q13A 2ZKMX 2D9YA 1ZSQA 1X05A 3TW1A 2K8EA 1WGQA 3TO1A 2VSZA 3AJ4A 2Z0QA 2FJLA 1V5PA 3KY9A 1FB8A 2N0YA 4KVGB 2I1KA 1OY2A 2DHIA 4IAPA 1M7RA 1NU2A 1GG3A 4KHBA 3FSSA 3PEGA 2Z4DA 1V89A 4QJ3B 2LOXA 5HE1A 1EVHA 2NZ8B 2YT0A 5C6RA 3T06A 1U5EA 1V88A 3LJUX 5LOPB 1XD4A 5KQ4A 1H4RA 2CY5A 2DX5A 2LULA 4HAUB 3PZDA 3TVVA 2D9VA 2YS1A 4ZRKA 2D11A 2YS5A 4EMOA 3RCPA 3UZTA 2LYDA 2KGXB 2GCJA 2R09A 2RRFA 2DHKA 3HW2B 2MKRA 1U5FA 1LB1A 1MK9B 2D4QA 4HHVA 2DX1A 3GYPA 2HE7A 1OMWA 5GOWB 4WJ7A 4TYZA 1BTKA 2LG1A 5FI1A 3HSAA 3BINA 2M38A 4A6FA 4D6WA 2JP2A 4C0AA 5DI9B 4PNKA 1Y5OA 2OQBA 3FVCA 4Y94A 2D9ZA 1U27A 2RVBB 1I7AA 1WI1A 3OHMB 2RSGA 1RRPB 1UPRA 2DKQA 4CHMA 4Z2MB 2J59M 2IFSA 2YSZA 3A8QA 3GYOA 4HATB 2RGNB 4DXAB 1U29A 5EFXA 3ULBA 4ZRJA 1U5DA 1FAOA 4NY0A 1AWEA 5M4YB 2EJ8A 2HTHB 2RNRB 2Z0PA 3VOQA 2YT2A 4GMXB 2R2YA 4DIXA 2ADZA 1EGXA 1XX0A 3D8FA 2I1JA 4K81A 1XKEA 4IFSA 1KZ7A 2YF0A 2I5FA 4TKNA 3WYFB 4KHOA 2ZPYA 3F0WA 3ML4A 2OTXA 4HAXB 5C5BA 2W2XD 1ZVRA 3KRXA 2CODA 4CSQA 4QXAB 3ODXA 2KR0A 4DX90 3D8EA 1ZYIA 4GN1A 4HB3B 1W1GA 1Y19B 2GCLA 2L2IA 4GPTB 1FOEA 2K2UA 1XR0B 2N23A 1V61A 1RJ2A 1FHOA 2K2JA 2PZ1A 2QKMA 2Z0OA 2EC1A 3KSYA 5D3XA 2KIGA 5HE3A 4BBKA 2DYNA 2P0FA 1MK7B 4HSIA 3B77A 2H7EA 4OT1A 4GOUA 4ZRIA 4HAVB 1GC7A 5L81A 1MKEA 4KAXB 5JHGA 1UEFA 5C79A 3DXEA 2YS3A 4YL8A 4CHJA 5D3YA 3HIEA 1ZC4B 1GC6A 3PP2A 2NBVA 3NWDA 3FM8C 1LW3A 3TCAA 4GNKB 1SGHA 1P6SA 2DHJA 3KRWA 1P3RA 2L1CA 4HAYB 4PQ0A 3ODOA 4H8SA 3AU4A 4F7GA 2LOZA 3OANA 4WVFB 1DROA 5DHFB 4EJNA 1X1GA 2CRFA 2BCJA 3SYXA 2D2QA 5HE2A 3DCXA 3PVLA 1X1FA 1XCGA 1Q67A 3NWAA 5KCVA 2J0JA 3CXBB 4IOYX 3PVWA 1N3HA 2FJUB 2IYBA 1FGYA 2KCJA 5C16A 1U5GA 5JHHA 3SV1A 3NW8A 1NTYA 3TFMA 4DBBA 2D9WA 3ZDTA 4HAWB 1UNPA 4MY6A 2D9XA 2Y8GA 2DLWA 1DDWA 2NMBA 5IRSA 2DYQA 1AQCA 3FEHA 3U8ZA 2R0DA 5JLJB 3U7DA 3DXDA 1SHCA 2YRYA 2EMSA 2VKIA 4A6FB 2DN6A
chains in the Genus database with same CATH topology
1DYNA 2P0DA 1QC6A 1W1HA 1J0WA 1E5WA 3A98B 3ODWA 5J3YA 2J0KA 3P6AA 3O96A 5DH9B 3V5WA 3MDBC 1KZGA 1ZM0A 1V5UA 5FI0A 1FHXA 3PVUA 1DDVA 5D3WA 3N7CA 1P5TA 3NSUA 3D8DA 3HQCA 1ISNA 1MAIA 3A8PA 2RLOA 2V76A 4A5KA 1PMSA 2ROVA 2DFKA 1PLSA 3IVFA 2J0MA 2CAYA 4MK0A 3F5RA 4YONA 4D0NB 3SUZA 1WJ1A 4HB2B 5DHAB 4K17A 5KQ1A 2UZRA 4HDQA 2QKLA 4GMVA 3QIJA 4Z2NA 4DX8A 4B6HA 2X18A 4F7HA 1FHWA 2VRWB 5HE0A 4CYEA 1BWNA 3MPXA 1WGUA 1DBHA 4KHAA 1M7EA 1ZC3B 3HK0A 2W2WA 5CLQB 1WJMA 2GJYA 4XWXA 5D3VA 2KUPA 2YT1A 1W1DA 2W2XC 3AU5A 1WG7A 2XQNM 2ELBA 2CY4A 1H10A 3SO6A 5JP4A 1MIXA 1U2BA 2MDXA 2UVMA 4A6KA 3CIKA 5DIFB 2E2XA 2D10A 1MPHA 5J3TA 5J3QA 1I2HA 4L6EA 2I5CA 1BTNA 2RUKB 1J19A 2YVCA 2DTCA 4HDOA 2AL6A 2Y8FA 5CLLB 1FGZA 3KZ1A 2P0HA 3ULCA 1NTVA 5LONB 4F7UP 1X86A 2DA0A 2P8VA 3PG7A 1K5GB 1EF1A 4A6HA 4EKUA 4HB4B 3BJIA 1MIZB 2MFQA 4GZUA 3P7ZA 4NSWA 2COFA 3QWMA 1OQNA 2COCA 1PFJA 1Z87A 1EAZA 3X23A 1NI2A 1K5DB 4KHBB 4HAZB 2K00A 1WVHA 5C5BB 3WA0A 1B55A 1UNQA 1TJ6A 1IRSA 3DXCA 3QBVB 1X11A 2UZSA 2MWNB 2LKOA 5D27A 4WSFA 3G9WA 2ELAA 3M1IB 2COAA 2H7DA 4P7IA 4HB0B 1BAKA 2EMTA 2AEHA 1QQGA 4K2PA 3SNHA 1DDMA 4MT7A 1TQZA 2ROZB 4GXBA 4K2OA 3VIAA 1V5MA 1XODA 1KI1B 1UNRA 2DKPA 3ZVRA 1UPQA 2GS0A 1TXDA 2G35A 3PSCA 2Y7BA 2M14A 2Q13A 2D9YA 1ZSQA 1X05A 3TW1A 1WGQA 3TO1A 2VSZA 3AJ4A 2Z0QA 2FJLA 1V5PA 3KY9A 1FB8A 2N0YA 4KVGB 2I1KA 1OY2A 2DHIA 4IAPA 1M7RA 1NU2A 1GG3A 3FSSA 3PEGA 1V89A 2LOXA 5HE1A 1EVHA 2NZ8B 2YT0A 5C6RA 3T06A 1U5EA 1V88A 3LJUX 5LOPB 1XD4A 5KQ4A 1H4RA 2CY5A 2DX5A 2LULA 4HAUB 3PZDA 3TVVA 2D9VA 2YS1A 4ZRKA 2D11A 2YS5A 4EMOA 3RCPA 3UZTA 2LYDA 2KGXB 2GCJA 2R09A 2DHKA 3HW2B 2MKRA 1U5FA 1LB1A 1MK9B 2D4QA 4HHVA 2DX1A 3GYPA 2HE7A 1OMWA 5GOWB 4WJ7A 4TYZA 1BTKA 2LG1A 5FI1A 3BINA 2M38A 4A6FA 2JP2A 4C0AA 5DI9B 4PNKA 1Y5OA 2OQBA 4Y94A 2D9ZA 1U27A 2RVBB 1I7AA 1WI1A 2RSGA 1RRPB 1UPRA 2DKQA 4CHMA 4Z2MB 2J59M 2IFSA 2YSZA 3A8QA 3GYOA 4HATB 2RGNB 4DXAB 1U29A 5EFXA 3ULBA 4ZRJA 1U5DA 1FAOA 4NY0A 1AWEA 2EJ8A 2HTHB 2RNRB 2Z0PA 3VOQA 4GMXB 2ADZA 1EGXA 1XX0A 3D8FA 2I1JA 4K81A 1XKEA 4IFSA 1KZ7A 2YF0A 2I5FA 4TKNA 3WYFB 4KHOA 2ZPYA 3F0WA 3ML4A 2OTXA 4HAXB 5C5BA 2W2XD 1ZVRA 3KRXA 2CODA 3ODXA 4DX90 3D8EA 4HB3B 4GN1A 1W1GA 1Y19B 2GCLA 2L2IA 4GPTB 1FOEA 2K2UA 1XR0B 2N23A 1V61A 1RJ2A 1FHOA 2K2JA 2PZ1A 2QKMA 2Z0OA 2EC1A 3KSYA 5D3XA 5HE3A 4BBKA 2DYNA 2P0FA 1MK7B 2H7EA 4ZRIA 4HAVB 1GC7A 5L81A 1MKEA 4KAXB 5JHGA 1UEFA 5C79A 3DXEA 2YS3A 4YL8A 4CHJA 5D3YA 1ZC4B 1GC6A 3PP2A 3FM8C 1LW3A 3TCAA 1SGHA 1P6SA 2DHJA 3KRWA 1P3RA 2L1CA 4HAYB 4PQ0A 3ODOA 4H8SA 3AU4A 4F7GA 2LOZA 3OANA 4WVFB 1DROA 5DHFB 4EJNA 1X1GA 2CRFA 2BCJA 3SYXA 2D2QA 5HE2A 3PVLA 1X1FA 1XCGA 1Q67A 5KCVA 2J0JA 3CXBB 4IOYX 3PVWA 1N3HA 2IYBA 1FGYA 2KCJA 5C16A 1U5GA 5JHHA 3SV1A 1NTYA 3TFMA 4DBBA 2D9WA 3ZDTA 4HAWB 1UNPA 4MY6A 2D9XA 2Y8GA 2DLWA 1DDWA 2NMBA 2DYQA 1AQCA 3FEHA 3U8ZA 2R0DA 5JLJB 3U7DA 3DXDA 1SHCA 2YRYA 2EMSA 2VKIA 4A6FB 2DN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DYN A;  2P0D A;  1QC6 A;  1W1H A;  1J0W A;  1E5W A;  3A98 B;  3ODW A;  5J3Y A;  2J0K A;  3P6A A;  3O96 A;  5DH9 B;  3V5W A;  3MDB C;  1KZG A;  1ZM0 A;  1V5U A;  5FI0 A;  1FHX A;  3PVU A;  1DDV A;  5D3W A;  3N7C A;  1P5T A;  3NSU A;  3D8D A;  3HQC A;  1ISN A;  1MAI A;  3A8P A;  2RLO A;  2V76 A;  4A5K A;  1PMS A;  2ROV A;  2DFK A;  1PLS A;  3IVF A;  2J0M A;  2CAY A;  4MK0 A;  3F5R A;  4YON A;  4D0N B;  3SUZ A;  1WJ1 A;  4HB2 B;  5DHA B;  4K17 A;  5KQ1 A;  2UZR A;  4HDQ A;  2QKL A;  4GMV A;  3QIJ A;  4Z2N A;  4DX8 A;  4B6H A;  2X18 A;  4F7H A;  1FHW A;  2VRW B;  5HE0 A;  4CYE A;  1BWN A;  3MPX A;  1WGU A;  1DBH A;  4KHA A;  1M7E A;  1ZC3 B;  3HK0 A;  2W2W A;  5CLQ B;  1WJM A;  2GJY A;  4XWX A;  5D3V A;  2KUP A;  2YT1 A;  1W1D A;  2W2X C;  3AU5 A;  1WG7 A;  2XQN M;  2ELB A;  2CY4 A;  1H10 A;  3SO6 A;  5JP4 A;  1MIX A;  1U2B A;  2MDX A;  2UVM A;  4A6K A;  3CIK A;  5DIF B;  2E2X A;  2D10 A;  1MPH A;  5J3T A;  5J3Q A;  1I2H A;  4L6E A;  2I5C A;  1BTN A;  2RUK B;  1J19 A;  2YVC A;  2DTC A;  4HDO A;  2AL6 A;  2Y8F A;  5CLL B;  1FGZ A;  3KZ1 A;  2P0H A;  3ULC A;  1NTV A;  5LON B;  4F7U P;  1X86 A;  2DA0 A;  2P8V A;  3PG7 A;  1K5G B;  1EF1 A;  4A6H A;  4EKU A;  4HB4 B;  3BJI A;  1MIZ B;  2MFQ A;  4GZU A;  3P7Z A;  4NSW A;  2COF A;  3QWM A;  1OQN A;  2COC A;  1PFJ A;  1Z87 A;  1EAZ A;  3X23 A;  1NI2 A;  1K5D B;  4KHB B;  4HAZ B;  2K00 A;  1WVH A;  5C5B B;  3WA0 A;  1B55 A;  1UNQ A;  1TJ6 A;  1IRS A;  3DXC A;  3QBV B;  1X11 A;  2UZS A;  2MWN B;  2LKO A;  5D27 A;  4WSF A;  3G9W A;  2ELA A;  3M1I B;  2COA A;  2H7D A;  4P7I A;  4HB0 B;  1BAK A;  2EMT A;  2AEH A;  1QQG A;  4K2P A;  3SNH A;  1DDM A;  4MT7 A;  1TQZ A;  2ROZ B;  4GXB A;  4K2O A;  3VIA A;  1V5M A;  1XOD A;  1KI1 B;  1UNR A;  2DKP A;  3ZVR A;  1UPQ A;  2GS0 A;  1TXD A;  2G35 A;  3PSC A;  2Y7B A;  2M14 A;  2Q13 A;  2D9Y A;  1ZSQ A;  1X05 A;  3TW1 A;  1WGQ A;  3TO1 A;  2VSZ A;  3AJ4 A;  2Z0Q A;  2FJL A;  1V5P A;  3KY9 A;  1FB8 A;  2N0Y A;  4KVG B;  2I1K A;  1OY2 A;  2DHI A;  4IAP A;  1M7R A;  1NU2 A;  1GG3 A;  3FSS A;  3PEG A;  1V89 A;  2LOX A;  5HE1 A;  1EVH A;  2NZ8 B;  2YT0 A;  5C6R A;  3T06 A;  1U5E A;  1V88 A;  3LJU X;  5LOP B;  1XD4 A;  5KQ4 A;  1H4R A;  2CY5 A;  2DX5 A;  2LUL A;  4HAU B;  3PZD A;  3TVV A;  2D9V A;  2YS1 A;  4ZRK A;  2D11 A;  2YS5 A;  4EMO A;  3RCP A;  3UZT A;  2LYD A;  2KGX B;  2GCJ A;  2R09 A;  2DHK A;  3HW2 B;  2MKR A;  1U5F A;  1LB1 A;  1MK9 B;  2D4Q A;  4HHV A;  2DX1 A;  3GYP A;  2HE7 A;  1OMW A;  5GOW B;  4WJ7 A;  4TYZ A;  1BTK A;  2LG1 A;  5FI1 A;  3BIN A;  2M38 A;  4A6F A;  2JP2 A;  4C0A A;  5DI9 B;  4PNK A;  1Y5O A;  2OQB A;  4Y94 A;  2D9Z A;  1U27 A;  2RVB B;  1I7A A;  1WI1 A;  2RSG A;  1RRP B;  1UPR A;  2DKQ A;  4CHM A;  4Z2M B;  2J59 M;  2IFS A;  2YSZ A;  3A8Q A;  3GYO A;  4HAT B;  2RGN B;  4DXA B;  1U29 A;  5EFX A;  3ULB A;  4ZRJ A;  1U5D A;  1FAO A;  4NY0 A;  1AWE A;  2EJ8 A;  2HTH B;  2RNR B;  2Z0P A;  3VOQ A;  4GMX B;  2ADZ A;  1EGX A;  1XX0 A;  3D8F A;  2I1J A;  4K81 A;  1XKE A;  4IFS A;  1KZ7 A;  2YF0 A;  2I5F A;  4TKN A;  3WYF B;  4KHO A;  2ZPY A;  3F0W A;  3ML4 A;  2OTX A;  4HAX B;  5C5B A;  2W2X D;  1ZVR A;  3KRX A;  2COD A;  3ODX A;  4DX9 0;  3D8E A;  4HB3 B;  4GN1 A;  1W1G A;  1Y19 B;  2GCL A;  2L2I A;  4GPT B;  1FOE A;  2K2U A;  1XR0 B;  2N23 A;  1V61 A;  1RJ2 A;  1FHO A;  2K2J A;  2PZ1 A;  2QKM A;  2Z0O A;  2EC1 A;  3KSY A;  5D3X A;  5HE3 A;  4BBK A;  2DYN A;  2P0F A;  1MK7 B;  2H7E A;  4ZRI A;  4HAV B;  1GC7 A;  5L81 A;  1MKE A;  4KAX B;  5JHG A;  1UEF A;  5C79 A;  3DXE A;  2YS3 A;  4YL8 A;  4CHJ A;  5D3Y A;  1ZC4 B;  1GC6 A;  3PP2 A;  3FM8 C;  1LW3 A;  3TCA A;  1SGH A;  1P6S A;  2DHJ A;  3KRW A;  1P3R A;  2L1C A;  4HAY B;  4PQ0 A;  3ODO A;  4H8S A;  3AU4 A;  4F7G A;  2LOZ A;  3OAN A;  4WVF B;  1DRO A;  5DHF B;  4EJN A;  1X1G A;  2CRF A;  2BCJ A;  3SYX A;  2D2Q A;  5HE2 A;  3PVL A;  1X1F A;  1XCG A;  1Q67 A;  5KCV A;  2J0J A;  3CXB B;  4IOY X;  3PVW A;  1N3H A;  2IYB A;  1FGY A;  2KCJ A;  5C16 A;  1U5G A;  5JHH A;  3SV1 A;  1NTY A;  3TFM A;  4DBB A;  2D9W A;  3ZDT A;  4HAW B;  1UNP A;  4MY6 A;  2D9X A;  2Y8G A;  2DLW A;  1DDW A;  2NMB A;  2DYQ A;  1AQC A;  3FEH A;  3U8Z A;  2R0D A;  5JLJ B;  3U7D A;  3DXD A;  1SHC A;  2YRY A;  2EMS A;  2VKI A;  4A6F B;  2DN6 A; 
#chains in the Genus database with same CATH topology
 1DYN A;  2P0D A;  1QC6 A;  1W1H A;  1J0W A;  1E5W A;  3A98 B;  3ODW A;  5J3Y A;  2J0K A;  3P6A A;  3O96 A;  5DH9 B;  3V5W A;  3MDB C;  1KZG A;  1ZM0 A;  1V5U A;  5FI0 A;  1FHX A;  3PVU A;  1DDV A;  5D3W A;  5LG4 B;  3N7C A;  1P5T A;  3NSU A;  3D8D A;  3HQC A;  1ISN A;  1MAI A;  3A8P A;  2RLO A;  2V76 A;  4A5K A;  4QJ4 B;  1PMS A;  4QJ5 B;  2ROV A;  2DFK A;  1PLS A;  3IVF A;  2J0M A;  2CAY A;  4MK0 A;  3F5R A;  4YON A;  4D0N B;  3SUZ A;  1WJ1 A;  4HB2 B;  5DHA B;  4K17 A;  5KQ1 A;  2UZR A;  3A58 A;  4HDQ A;  2QKL A;  4GMV A;  3QIJ A;  4Z2N A;  4DX8 A;  2KIE A;  2Z13 A;  4B6H A;  2X18 A;  4F7H A;  1FHW A;  2VRW B;  5HE0 A;  4CYE A;  1BWN A;  2KUQ A;  3MPX A;  1WGU A;  1DBH A;  4KHA A;  1M7E A;  1ZC3 B;  3HK0 A;  2W2W A;  5CLQ B;  2Z14 A;  1WJM A;  2GJY A;  4XWX A;  5D3V A;  2KUP A;  2YT1 A;  1W1D A;  1MI1 A;  2W2X C;  3AU5 A;  1WG7 A;  2XQN M;  2ELB A;  2CY4 A;  1H10 A;  2K49 A;  3SO6 A;  5JP4 A;  1MIX A;  1U2B A;  2MDX A;  4OSN A;  2UVM A;  4A6K A;  3CIK A;  5DIF B;  2E2X A;  2D10 A;  1MPH A;  5J3T A;  5J3Q A;  5I2M A;  1I2H A;  4L6E A;  2I5C A;  1BTN A;  2RUK B;  1J19 A;  2YVC A;  2DTC A;  4HDO A;  2AL6 A;  2Y8F A;  4L1R A;  1FGZ A;  5CLL B;  3KZ1 A;  2P0H A;  3ULC A;  1NTV A;  5LON B;  3NWF A;  1T77 A;  4F7U P;  1X86 A;  2DA0 A;  2P8V A;  3PG7 A;  1K5G B;  1EF1 A;  5I2S A;  4A6H A;  4EKU A;  4HB4 B;  3BJI A;  1MIZ B;  3U12 A;  2MFQ A;  4GZU A;  3P7Z A;  4NSW A;  2Z59 A;  2COF A;  3QWM A;  1OQN A;  2COC A;  1PFJ A;  1Z87 A;  1EAZ A;  3X23 A;  1NI2 A;  1K5D B;  4KHB B;  4HAZ B;  2K00 A;  1WVH A;  5C5B B;  3WA0 A;  1B55 A;  2GUM A;  1UNQ A;  1TJ6 A;  1IRS A;  3DXC A;  3QBV B;  1X11 A;  2UZS A;  2MWN B;  2LKO A;  5D27 A;  4WSF A;  3G9W A;  2ELA A;  3M1I B;  2COA A;  2H7D A;  4P7I A;  4HB0 B;  1BAK A;  2EMT A;  2AEH A;  1QQG A;  4K2P A;  3SNH A;  1DDM A;  4MT7 A;  1TQZ A;  2ROZ B;  4GXB A;  4K2O A;  3VIA A;  1V5M A;  1XOD A;  1KI1 B;  1UNR A;  2DKP A;  3ZVR A;  1UPQ A;  2GS0 A;  1TXD A;  2G35 A;  3PSC A;  2Y7B A;  2M14 A;  2Q13 A;  2ZKM X;  2D9Y A;  1ZSQ A;  1X05 A;  3TW1 A;  2K8E A;  1WGQ A;  3TO1 A;  2VSZ A;  3AJ4 A;  2Z0Q A;  2FJL A;  1V5P A;  3KY9 A;  1FB8 A;  2N0Y A;  4KVG B;  2I1K A;  1OY2 A;  2DHI A;  4IAP A;  1M7R A;  1NU2 A;  1GG3 A;  4KHB A;  3FSS A;  3PEG A;  2Z4D A;  1V89 A;  4QJ3 B;  2LOX A;  5HE1 A;  1EVH A;  2NZ8 B;  2YT0 A;  5C6R A;  3T06 A;  1U5E A;  1V88 A;  3LJU X;  5LOP B;  1XD4 A;  5KQ4 A;  1H4R A;  2CY5 A;  2DX5 A;  2LUL A;  4HAU B;  3PZD A;  3TVV A;  2D9V A;  2YS1 A;  4ZRK A;  2D11 A;  2YS5 A;  4EMO A;  3RCP A;  3UZT A;  2LYD A;  2KGX B;  2GCJ A;  2R09 A;  2RRF A;  2DHK A;  3HW2 B;  2MKR A;  1U5F A;  1LB1 A;  1MK9 B;  2D4Q A;  4HHV A;  2DX1 A;  3GYP A;  2HE7 A;  1OMW A;  5GOW B;  4WJ7 A;  4TYZ A;  1BTK A;  2LG1 A;  5FI1 A;  3HSA A;  3BIN A;  2M38 A;  4A6F A;  4D6W A;  2JP2 A;  4C0A A;  5DI9 B;  4PNK A;  1Y5O A;  2OQB A;  3FVC A;  4Y94 A;  2D9Z A;  1U27 A;  2RVB B;  1I7A A;  1WI1 A;  3OHM B;  2RSG A;  1RRP B;  1UPR A;  2DKQ A;  4CHM A;  4Z2M B;  2J59 M;  2IFS A;  2YSZ A;  3A8Q A;  3GYO A;  4HAT B;  2RGN B;  4DXA B;  1U29 A;  5EFX A;  3ULB A;  4ZRJ A;  1U5D A;  1FAO A;  4NY0 A;  1AWE A;  5M4Y B;  2EJ8 A;  2HTH B;  2RNR B;  2Z0P A;  3VOQ A;  2YT2 A;  4GMX B;  2R2Y A;  4DIX A;  2ADZ A;  1EGX A;  1XX0 A;  3D8F A;  2I1J A;  4K81 A;  1XKE A;  4IFS A;  1KZ7 A;  2YF0 A;  2I5F A;  4TKN A;  3WYF B;  4KHO A;  2ZPY A;  3F0W A;  3ML4 A;  2OTX A;  4HAX B;  5C5B A;  2W2X D;  1ZVR A;  3KRX A;  2COD A;  4CSQ A;  4QXA B;  3ODX A;  2KR0 A;  4DX9 0;  3D8E A;  1ZYI A;  4GN1 A;  4HB3 B;  1W1G A;  1Y19 B;  2GCL A;  2L2I A;  4GPT B;  1FOE A;  2K2U A;  1XR0 B;  2N23 A;  1V61 A;  1RJ2 A;  1FHO A;  2K2J A;  2PZ1 A;  2QKM A;  2Z0O A;  2EC1 A;  3KSY A;  5D3X A;  2KIG A;  5HE3 A;  4BBK A;  2DYN A;  2P0F A;  1MK7 B;  4HSI A;  3B77 A;  2H7E A;  4OT1 A;  4GOU A;  4ZRI A;  4HAV B;  1GC7 A;  5L81 A;  1MKE A;  4KAX B;  5JHG A;  1UEF A;  5C79 A;  3DXE A;  2YS3 A;  4YL8 A;  4CHJ A;  5D3Y A;  3HIE A;  1ZC4 B;  1GC6 A;  3PP2 A;  2NBV A;  3NWD A;  3FM8 C;  1LW3 A;  3TCA A;  4GNK B;  1SGH A;  1P6S A;  2DHJ A;  3KRW A;  1P3R A;  2L1C A;  4HAY B;  4PQ0 A;  3ODO A;  4H8S A;  3AU4 A;  4F7G A;  2LOZ A;  3OAN A;  4WVF B;  1DRO A;  5DHF B;  4EJN A;  1X1G A;  2CRF A;  2BCJ A;  3SYX A;  2D2Q A;  5HE2 A;  3DCX A;  3PVL A;  1X1F A;  1XCG A;  1Q67 A;  3NWA A;  5KCV A;  2J0J A;  3CXB B;  4IOY X;  3PVW A;  1N3H A;  2FJU B;  2IYB A;  1FGY A;  2KCJ A;  5C16 A;  1U5G A;  5JHH A;  3SV1 A;  3NW8 A;  1NTY A;  3TFM A;  4DBB A;  2D9W A;  3ZDT A;  4HAW B;  1UNP A;  4MY6 A;  2D9X A;  2Y8G A;  2DLW A;  1DDW A;  2NMB A;  5IRS A;  2DYQ A;  1AQC A;  3FEH A;  3U8Z A;  2R0D A;  5JLJ B;  3U7D A;  3DXD A;  1SHC A;  2YRY A;  2EMS A;  2VKI A;  4A6F B;  2DN6 A; 
#chains in the Genus database with same CATH homology
 1DYN A;  2P0D A;  1QC6 A;  1W1H A;  1J0W A;  1E5W A;  3A98 B;  3ODW A;  5J3Y A;  2J0K A;  3P6A A;  3O96 A;  5DH9 B;  3V5W A;  3MDB C;  1KZG A;  1ZM0 A;  1V5U A;  5FI0 A;  1FHX A;  3PVU A;  1DDV A;  5D3W A;  3N7C A;  1P5T A;  3NSU A;  3D8D A;  3HQC A;  1ISN A;  1MAI A;  3A8P A;  2RLO A;  2V76 A;  4A5K A;  1PMS A;  2ROV A;  2DFK A;  1PLS A;  3IVF A;  2J0M A;  2CAY A;  4MK0 A;  3F5R A;  4YON A;  4D0N B;  3SUZ A;  1WJ1 A;  4HB2 B;  5DHA B;  4K17 A;  5KQ1 A;  2UZR A;  4HDQ A;  2QKL A;  4GMV A;  3QIJ A;  4Z2N A;  4DX8 A;  4B6H A;  2X18 A;  4F7H A;  1FHW A;  2VRW B;  5HE0 A;  4CYE A;  1BWN A;  3MPX A;  1WGU A;  1DBH A;  4KHA A;  1M7E A;  1ZC3 B;  3HK0 A;  2W2W A;  5CLQ B;  1WJM A;  2GJY A;  4XWX A;  5D3V A;  2KUP A;  2YT1 A;  1W1D A;  2W2X C;  3AU5 A;  1WG7 A;  2XQN M;  2ELB A;  2CY4 A;  1H10 A;  3SO6 A;  5JP4 A;  1MIX A;  1U2B A;  2MDX A;  2UVM A;  4A6K A;  3CIK A;  5DIF B;  2E2X A;  2D10 A;  1MPH A;  5J3T A;  5J3Q A;  1I2H A;  4L6E A;  2I5C A;  1BTN A;  2RUK B;  1J19 A;  2YVC A;  2DTC A;  4HDO A;  2AL6 A;  2Y8F A;  5CLL B;  1FGZ A;  3KZ1 A;  2P0H A;  3ULC A;  1NTV A;  5LON B;  4F7U P;  1X86 A;  2DA0 A;  2P8V A;  3PG7 A;  1K5G B;  1EF1 A;  4A6H A;  4EKU A;  4HB4 B;  3BJI A;  1MIZ B;  2MFQ A;  4GZU A;  3P7Z A;  4NSW A;  2COF A;  3QWM A;  1OQN A;  2COC A;  1PFJ A;  1Z87 A;  1EAZ A;  3X23 A;  1NI2 A;  1K5D B;  4KHB B;  4HAZ B;  2K00 A;  1WVH A;  5C5B B;  3WA0 A;  1B55 A;  1UNQ A;  1TJ6 A;  1IRS A;  3DXC A;  3QBV B;  1X11 A;  2UZS A;  2MWN B;  2LKO A;  5D27 A;  4WSF A;  3G9W A;  2ELA A;  3M1I B;  2COA A;  2H7D A;  4P7I A;  4HB0 B;  1BAK A;  2EMT A;  2AEH A;  1QQG A;  4K2P A;  3SNH A;  1DDM A;  4MT7 A;  1TQZ A;  2ROZ B;  4GXB A;  4K2O A;  3VIA A;  1V5M A;  1XOD A;  1KI1 B;  1UNR A;  2DKP A;  3ZVR A;  1UPQ A;  2GS0 A;  1TXD A;  2G35 A;  3PSC A;  2Y7B A;  2M14 A;  2Q13 A;  2D9Y A;  1ZSQ A;  1X05 A;  3TW1 A;  1WGQ A;  3TO1 A;  2VSZ A;  3AJ4 A;  2Z0Q A;  2FJL A;  1V5P A;  3KY9 A;  1FB8 A;  2N0Y A;  4KVG B;  2I1K A;  1OY2 A;  2DHI A;  4IAP A;  1M7R A;  1NU2 A;  1GG3 A;  3FSS A;  3PEG A;  1V89 A;  2LOX A;  5HE1 A;  1EVH A;  2NZ8 B;  2YT0 A;  5C6R A;  3T06 A;  1U5E A;  1V88 A;  3LJU X;  5LOP B;  1XD4 A;  5KQ4 A;  1H4R A;  2CY5 A;  2DX5 A;  2LUL A;  4HAU B;  3PZD A;  3TVV A;  2D9V A;  2YS1 A;  4ZRK A;  2D11 A;  2YS5 A;  4EMO A;  3RCP A;  3UZT A;  2LYD A;  2KGX B;  2GCJ A;  2R09 A;  2DHK A;  3HW2 B;  2MKR A;  1U5F A;  1LB1 A;  1MK9 B;  2D4Q A;  4HHV A;  2DX1 A;  3GYP A;  2HE7 A;  1OMW A;  5GOW B;  4WJ7 A;  4TYZ A;  1BTK A;  2LG1 A;  5FI1 A;  3BIN A;  2M38 A;  4A6F A;  2JP2 A;  4C0A A;  5DI9 B;  4PNK A;  1Y5O A;  2OQB A;  4Y94 A;  2D9Z A;  1U27 A;  2RVB B;  1I7A A;  1WI1 A;  2RSG A;  1RRP B;  1UPR A;  2DKQ A;  4CHM A;  4Z2M B;  2J59 M;  2IFS A;  2YSZ A;  3A8Q A;  3GYO A;  4HAT B;  2RGN B;  4DXA B;  1U29 A;  5EFX A;  3ULB A;  4ZRJ A;  1U5D A;  1FAO A;  4NY0 A;  1AWE A;  2EJ8 A;  2HTH B;  2RNR B;  2Z0P A;  3VOQ A;  4GMX B;  2ADZ A;  1EGX A;  1XX0 A;  3D8F A;  2I1J A;  4K81 A;  1XKE A;  4IFS A;  1KZ7 A;  2YF0 A;  2I5F A;  4TKN A;  3WYF B;  4KHO A;  2ZPY A;  3F0W A;  3ML4 A;  2OTX A;  4HAX B;  5C5B A;  2W2X D;  1ZVR A;  3KRX A;  2COD A;  3ODX A;  4DX9 0;  3D8E A;  4HB3 B;  4GN1 A;  1W1G A;  1Y19 B;  2GCL A;  2L2I A;  4GPT B;  1FOE A;  2K2U A;  1XR0 B;  2N23 A;  1V61 A;  1RJ2 A;  1FHO A;  2K2J A;  2PZ1 A;  2QKM A;  2Z0O A;  2EC1 A;  3KSY A;  5D3X A;  5HE3 A;  4BBK A;  2DYN A;  2P0F A;  1MK7 B;  2H7E A;  4ZRI A;  4HAV B;  1GC7 A;  5L81 A;  1MKE A;  4KAX B;  5JHG A;  1UEF A;  5C79 A;  3DXE A;  2YS3 A;  4YL8 A;  4CHJ A;  5D3Y A;  1ZC4 B;  1GC6 A;  3PP2 A;  3FM8 C;  1LW3 A;  3TCA A;  1SGH A;  1P6S A;  2DHJ A;  3KRW A;  1P3R A;  2L1C A;  4HAY B;  4PQ0 A;  3ODO A;  4H8S A;  3AU4 A;  4F7G A;  2LOZ A;  3OAN A;  4WVF B;  1DRO A;  5DHF B;  4EJN A;  1X1G A;  2CRF A;  2BCJ A;  3SYX A;  2D2Q A;  5HE2 A;  3PVL A;  1X1F A;  1XCG A;  1Q67 A;  5KCV A;  2J0J A;  3CXB B;  4IOY X;  3PVW A;  1N3H A;  2IYB A;  1FGY A;  2KCJ A;  5C16 A;  1U5G A;  5JHH A;  3SV1 A;  1NTY A;  3TFM A;  4DBB A;  2D9W A;  3ZDT A;  4HAW B;  1UNP A;  4MY6 A;  2D9X A;  2Y8G A;  2DLW A;  1DDW A;  2NMB A;  2DYQ A;  1AQC A;  3FEH A;  3U8Z A;  2R0D A;  5JLJ B;  3U7D A;  3DXD A;  1SHC A;  2YRY A;  2EMS A;  2VKI A;  4A6F B;  2DN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...