1DDVA

Crystal structure of the homer evh1 domain with bound mglur peptide
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
IFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINSTITPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords GLGF-DOMAIN PROTEIN HOMER
publication title Structure of the Homer EVH1 domain-peptide complex reveals a new twist in polyproline recognition.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 1999-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1ddvA00
3PSCA 3ZDTA 2N0YA 2QKMA 1FAOA 2M14A 2VRWB 5DHAB 5FI1A 3FM8C 1J19A 4NSWA 5C79A 1V89A 4KVGB 3OANA 5DH9B 1V5UA 3DXDA 2DYQA 4MY6A 1M7RA 4DBBA 1BWNA 2COCA 5DIFB 1SHCA 2QKLA 2YF0A 3QIJA 3QWMA 1N3HA 2J59M 2K00A 1B55A 2DTCA 5L81A 4KHOA 2LOZA 3FSSA 1WJ1A 2K2JA 3DXEA 5D3VA 4TKNA 5JHGA 5JLJB 4KAXB 2D4QA 2CY5A 2D9ZA 4H8SA 2P8VA 2DHJA 2D10A 2LYDA 3O96A 2Q13A 3NSUA 3ODWA 3D8EA 1TXDA 5DHFB 2L2IA 1WVHA 4C0AA 3PP2A 3F5RA 1U5FA 2UVMA 1TJ6A 1OQNA 1MK9B 1FHWA 1SGHA 3CIKA 2Z0QA 2LKOA 1I2HA 1M7EA 1ZM0A 3TFMA 1ZC3B 4CYEA 2OTXA 4MT7A 3T06A 1EGXA 1E5WA 3M1IB 2M38A 1Q67A 2MDXA 4YONA 5D3YA 1W1GA 5C5BA 1NTYA 2X18A 1FB8A 2DX5A 1P6SA 3P6AA 4Z2NA 1EVHA 4CHJA 1UNQA 4A6FB 3SO6A 2IYBA 1ZVRA 3KRWA 5C16A 2EMSA 2DLWA 1DYNA 4K2PA 3HQCA 2EJ8A 2VKIA 2DHKA 1FHOA 1UPRA 3ODXA 3VOQA 1AQCA 1BAKA 5CLQB 1J0WA 2KUPA 1H4RA 3UZTA 3PG7A 4HATB 1RJ2A 3BINA 2HTHB 2J0KA 1X1FA 4F7HA 2RLOA 4K17A 4GMVA 3SYXA 2DN6A 3AJ4A 3LJUX 3KSYA 4GN1A 4Y94A 5KCVA 1I7AA 2DKQA 1U27A 1U5EA 1DDMA 2AL6A 1U2BA 2L1CA 1LB1A 1WJMA 1UNRA 3DXCA 2R09A 3MPXA 2Z0OA 2IFSA 2H7EA 4CHMA 3ULCA 2FJLA 3FEHA 3A98B 4HB2B 2RNRB 2OQBA 4HB3B 2VSZA 2R0DA 2D11A 2YVCA 2DA0A 3TO1A 3PZDA 3WYFB 2I1KA 1EAZA 4F7UP 1KI1B 2YS1A 2W2XD 3X23A 2Y7BA 2CRFA 4L6EA 1Y5OA 3D8FA 5EFXA 4ZRKA 3ULBA 4HDOA 3TCAA 1W1DA 1WGQA 4TYZA 1NI2A 1MPHA 1UPQA 4GZUA 4HAUB 2N23A 2RUKB 5J3QA 2NZ8B 3A8QA 2AEHA 1EF1A 4GXBA 5J3YA 3KRXA 1ZSQA 2ELBA 3GYPA 1MK7B 2DYNA 1XR0B 2GJYA 2H7DA 4GMXB 2P0HA 4HAVB 1KZGA 4PQ0A 2V76A 3BJIA 3SV1A 4HAZB 2GCJA 2MFQA 5JP4A 2YRYA 2RSGA 4Z2MB 4D0NB 4HHVA 4NY0A 3PEGA 2G35A 2D9VA 2I5CA 3HW2B 3CXBB 4DX90 5FI0A 1X11A 2XQNM 4XWXA 1KZ7A 1LW3A 2UZSA 4KHAA 3A8PA 1BTNA 4IOYX 1W1HA 1QC6A 1GG3A 1Z87A 1UNPA 3SUZA 5CLLB 3D8DA 1X05A 2Y8FA 5C5BB 3WA0A 4K81A 1NTVA 1PMSA 1Y19B 3GYOA 1X86A 1TQZA 2RGNB 1V88A 2BCJA 5D3XA 3V5WA 2COFA 1FGZA 2JP2A 5HE3A 1PFJA 2CODA 2EMTA 1U5DA 5HE0A 2D9XA 2ZPYA 3VIAA 1DROA 2D2QA 4A6HA 4HAXB 4DX8A 1WGUA 3AU4A 5D3WA 1GC6A 1U29A 4A5KA 2J0MA 4HAYB 2D9YA 4ZRIA 2D9WA 2CAYA 1K5GB 3HK0A 1DDVA 1MKEA 2YT1A 5DI9B 1DDWA 4HB4B 1XKEA 5GOWB 2YS3A 1V5MA 1XODA 2NMBA 1MIXA 4YL8A 1K5DB 4IAPA 1P5TA 4PNKA 4K2OA 4ZRJA 1RRPB 1PLSA 3RCPA 2K2UA 2MKRA 2GCLA 2YS5A 1WI1A 4WJ7A 3IVFA 1FOEA 1H10A 1V61A 1GC7A 1QQGA 4EKUA 1MIZB 4GPTB 5KQ1A 1ZC4B 5D27A 2UZRA 3SNHA 1X1GA 2W2XC 2LOXA 5KQ4A 2LULA 3F0WA 3KZ1A 1V5PA 2DKPA 4HB0B 1AWEA 2GS0A 2I5FA 2HE7A 1BTKA 1OMWA 2P0FA 4A6KA 2PZ1A 5HE2A 3G9WA 2W2WA 4BBKA 3TW1A 4A6FA 4DXAB 2MWNB 4F7GA 2COAA 3ML4A 2KCJA 5LONB 1XX0A 2RVBB 1NU2A 2YT0A 3QBVB 2YSZA 1IRSA 2ELAA 5LOPB 4WSFA 4HAWB 2LG1A 1DBHA 2DX1A 4EJNA 3MDBC 1ISNA 1FHXA 4P7IA 5J3TA 2CY4A 1OY2A 4B6HA 1UEFA 1MAIA 2KGXB 3KY9A 4MK0A 1WG7A 1XCGA 1FGYA 3P7ZA 2I1JA 3U8ZA 2DHIA 2ROZB 3AU5A 3PVLA 2DFKA 4EMOA 2Y8GA 1U5GA 4KHBB 4IFSA 2P0DA 3PVUA 3ODOA 2J0JA 5JHHA 3PVWA 3N7CA 2ROVA 3U7DA 2E2XA 2Z0PA 1P3RA 5C6RA 2ADZA 1XD4A 5HE1A 2EC1A 4WVFB 3TVVA 3ZVRA 4HDQA
chains in the Genus database with same CATH superfamily
3PSCA 3ZDTA 2N0YA 2QKMA 1FAOA 2M14A 2Z14A 2VRWB 2Z13A 5DHAB 5FI1A 3FM8C 1J19A 4NSWA 5C79A 1V89A 4KVGB 3OANA 5DH9B 1V5UA 3DXDA 3HIEA 3NWFA 3FVCA 2DYQA 4MY6A 1M7RA 4DBBA 1BWNA 2COCA 5DIFB 1SHCA 2QKLA 2YF0A 3QIJA 3QWMA 1N3HA 2J59M 2K00A 1B55A 2DTCA 5L81A 4KHOA 2LOZA 3FSSA 1WJ1A 2K2JA 3DXEA 5D3VA 4TKNA 2GUMA 5JHGA 5JLJB 4KAXB 2D4QA 2CY5A 2D9ZA 4H8SA 2P8VA 4L1RA 2DHJA 2D10A 2LYDA 3O96A 2Q13A 3NSUA 3ODWA 3D8EA 1TXDA 5DHFB 1T77A 2L2IA 1WVHA 3U12A 4C0AA 3PP2A 3F5RA 3A58A 1U5FA 2UVMA 1TJ6A 1OQNA 1MK9B 1FHWA 1SGHA 4OT1A 3CIKA 2Z0QA 2KUQA 2LKOA 2ZKMX 1I2HA 1M7EA 1ZM0A 3TFMA 1ZC3B 4CYEA 2OTXA 4MT7A 3T06A 1EGXA 1E5WA 3M1IB 2M38A 1Q67A 2MDXA 4YONA 5D3YA 1W1GA 5C5BA 1NTYA 2X18A 1FB8A 2DX5A 1P6SA 3P6AA 4Z2NA 1EVHA 4CHJA 4CSQA 1UNQA 4A6FB 3SO6A 2IYBA 1ZVRA 3KRWA 5C16A 2EMSA 2DLWA 1DYNA 4K2PA 3HQCA 2EJ8A 2VKIA 2DHKA 1FHOA 1UPRA 3ODXA 3VOQA 1AQCA 1BAKA 5CLQB 3NW8A 1J0WA 2KUPA 1H4RA 3UZTA 3PG7A 4HATB 1RJ2A 3BINA 2HTHB 2J0KA 1X1FA 4F7HA 2RLOA 4K17A 4GMVA 3SYXA 2DN6A 3AJ4A 3LJUX 3KSYA 4GN1A 4Y94A 5KCVA 1I7AA 2DKQA 1U27A 1U5EA 1DDMA 2AL6A 1U2BA 2L1CA 1LB1A 1WJMA 4HSIA 1UNRA 3DXCA 2R09A 3MPXA 2Z0OA 2IFSA 3NWAA 2H7EA 4CHMA 3ULCA 2FJLA 4QXAB 3FEHA 3A98B 4HB2B 2RNRB 2OQBA 4HB3B 2VSZA 4QJ5B 2R0DA 2D11A 2YVCA 2DA0A 3TO1A 3PZDA 3WYFB 2I1KA 1EAZA 4F7UP 1KI1B 2YS1A 2W2XD 3X23A 2Y7BA 2CRFA 4L6EA 1Y5OA 3D8FA 5EFXA 4ZRKA 3ULBA 4HDOA 2KIEA 3TCAA 1W1DA 1WGQA 4TYZA 1NI2A 1MPHA 1UPQA 4GZUA 4HAUB 2N23A 3B77A 2RUKB 5J3QA 2NBVA 2NZ8B 3A8QA 2R2YA 2AEHA 1EF1A 4GXBA 5J3YA 3KRXA 1ZSQA 2ELBA 3GYPA 1MK7B 2DYNA 1XR0B 2GJYA 2H7DA 4GMXB 2P0HA 4HAVB 1KZGA 4PQ0A 2V76A 3BJIA 3OHMB 3SV1A 4HAZB 2GCJA 2MFQA 5JP4A 2YRYA 2RSGA 4Z2MB 4D0NB 4HHVA 4NY0A 3PEGA 2G35A 2D9VA 2I5CA 3HW2B 3CXBB 4DX90 4QJ3B 5FI0A 1X11A 2XQNM 4XWXA 4DIXA 1KZ7A 5LG4B 1LW3A 2UZSA 4KHAA 3A8PA 1BTNA 4IOYX 1W1HA 1QC6A 1GG3A 1Z87A 1UNPA 3SUZA 4KHBA 5CLLB 3D8DA 1X05A 2Y8FA 5C5BB 2RRFA 4K81A 3WA0A 5I2SA 1NTVA 2K8EA 5I2MA 1PMSA 1Y19B 3GYOA 1X86A 1TQZA 2RGNB 1V88A 2BCJA 1ZYIA 5D3XA 3V5WA 2COFA 1FGZA 2JP2A 5HE3A 5M4YB 1PFJA 2YT2A 2CODA 2EMTA 1U5DA 5HE0A 2D9XA 2ZPYA 3VIAA 1DROA 2D2QA 4A6HA 4HAXB 4DX8A 1WGUA 3AU4A 5D3WA 1GC6A 1U29A 4A5KA 4OSNA 2J0MA 4HAYB 2D9YA 4GOUA 4ZRIA 2D9WA 2CAYA 1K5GB 3HK0A 1DDVA 1MKEA 2YT1A 5DI9B 1DDWA 3NWDA 4HB4B 1XKEA 5GOWB 2YS3A 1V5MA 1XODA 2NMBA 1MIXA 4YL8A 1K5DB 4IAPA 2FJUB 1P5TA 4PNKA 4K2OA 4ZRJA 1RRPB 1PLSA 3RCPA 2K2UA 4QJ4B 2MKRA 2GCLA 2YS5A 1WI1A 4WJ7A 3IVFA 1FOEA 1H10A 1V61A 2K49A 1GC7A 1QQGA 4EKUA 1MIZB 4GPTB 4D6WA 5KQ1A 1ZC4B 5D27A 2UZRA 3SNHA 1X1GA 2W2XC 2LOXA 5KQ4A 2LULA 3F0WA 3KZ1A 1V5PA 2DKPA 2KR0A 4HB0B 1AWEA 2GS0A 2I5FA 2HE7A 1BTKA 1OMWA 2P0FA 4A6KA 2PZ1A 5HE2A 3G9WA 2W2WA 4BBKA 5IRSA 3TW1A 4A6FA 4DXAB 2MWNB 4F7GA 2COAA 3ML4A 2KCJA 5LONB 1XX0A 2RVBB 3HSAA 1NU2A 2YT0A 2Z59A 3QBVB 2YSZA 1IRSA 2ELAA 5LOPB 4WSFA 4HAWB 2LG1A 1DBHA 2DX1A 4EJNA 3MDBC 1ISNA 1FHXA 4P7IA 5J3TA 2CY4A 1OY2A 4B6HA 1UEFA 1MAIA 2KGXB 3KY9A 4MK0A 1WG7A 1XCGA 1FGYA 3P7ZA 2I1JA 3U8ZA 2DHIA 4GNKB 2ROZB 3AU5A 3PVLA 2DFKA 4EMOA 2Y8GA 1U5GA 4KHBB 2KIGA 2P0DA 4IFSA 3PVUA 3ODOA 2J0JA 5JHHA 3DCXA 3PVWA 3N7CA 2ROVA 3U7DA 2E2XA 2Z0PA 1P3RA 5C6RA 2ADZA 1XD4A 5HE1A 2EC1A 4WVFB 1MI1A 2Z4DA 3TVVA 3ZVRA 4HDQA
chains in the Genus database with same CATH topology
3PSCA 3ZDTA 2N0YA 2QKMA 1FAOA 2M14A 2VRWB 5DHAB 5FI1A 3FM8C 1J19A 4NSWA 5C79A 1V89A 4KVGB 3OANA 5DH9B 1V5UA 3DXDA 2DYQA 4MY6A 1M7RA 4DBBA 1BWNA 2COCA 5DIFB 1SHCA 2QKLA 2YF0A 3QIJA 3QWMA 1N3HA 2J59M 2K00A 1B55A 2DTCA 5L81A 4KHOA 2LOZA 3FSSA 1WJ1A 2K2JA 3DXEA 5D3VA 4TKNA 5JHGA 5JLJB 4KAXB 2D4QA 2CY5A 2D9ZA 4H8SA 2P8VA 2DHJA 2D10A 2LYDA 3O96A 2Q13A 3NSUA 3ODWA 3D8EA 1TXDA 5DHFB 2L2IA 1WVHA 4C0AA 3PP2A 3F5RA 1U5FA 2UVMA 1TJ6A 1OQNA 1MK9B 1FHWA 1SGHA 3CIKA 2Z0QA 2LKOA 1I2HA 1M7EA 1ZM0A 3TFMA 1ZC3B 4CYEA 2OTXA 4MT7A 3T06A 1EGXA 1E5WA 3M1IB 2M38A 1Q67A 2MDXA 4YONA 5D3YA 1W1GA 5C5BA 1NTYA 2X18A 1FB8A 2DX5A 1P6SA 3P6AA 4Z2NA 1EVHA 4CHJA 1UNQA 4A6FB 3SO6A 2IYBA 1ZVRA 3KRWA 5C16A 2EMSA 2DLWA 1DYNA 4K2PA 3HQCA 2EJ8A 2VKIA 2DHKA 1FHOA 1UPRA 3ODXA 3VOQA 1AQCA 1BAKA 5CLQB 1J0WA 2KUPA 1H4RA 3UZTA 3PG7A 4HATB 1RJ2A 3BINA 2HTHB 2J0KA 1X1FA 4F7HA 2RLOA 4K17A 4GMVA 3SYXA 2DN6A 3AJ4A 3LJUX 3KSYA 4GN1A 4Y94A 5KCVA 1I7AA 2DKQA 1U27A 1U5EA 1DDMA 2AL6A 1U2BA 2L1CA 1LB1A 1WJMA 1UNRA 3DXCA 2R09A 3MPXA 2Z0OA 2IFSA 2H7EA 4CHMA 3ULCA 2FJLA 3FEHA 3A98B 4HB2B 2RNRB 2OQBA 4HB3B 2VSZA 2R0DA 2D11A 2YVCA 2DA0A 3TO1A 3PZDA 3WYFB 2I1KA 1EAZA 4F7UP 1KI1B 2YS1A 2W2XD 3X23A 2Y7BA 2CRFA 4L6EA 1Y5OA 3D8FA 5EFXA 4ZRKA 3ULBA 4HDOA 3TCAA 1W1DA 1WGQA 4TYZA 1NI2A 1MPHA 1UPQA 4GZUA 4HAUB 2N23A 2RUKB 5J3QA 2NZ8B 3A8QA 2AEHA 1EF1A 4GXBA 5J3YA 3KRXA 1ZSQA 2ELBA 3GYPA 1MK7B 2DYNA 1XR0B 2GJYA 2H7DA 4GMXB 2P0HA 4HAVB 1KZGA 4PQ0A 2V76A 3BJIA 3SV1A 4HAZB 2GCJA 2MFQA 5JP4A 2YRYA 2RSGA 4Z2MB 4D0NB 4HHVA 4NY0A 3PEGA 2G35A 2D9VA 2I5CA 3HW2B 3CXBB 4DX90 5FI0A 1X11A 2XQNM 4XWXA 1KZ7A 1LW3A 2UZSA 4KHAA 3A8PA 1BTNA 4IOYX 1W1HA 1QC6A 1GG3A 1Z87A 1UNPA 3SUZA 5CLLB 3D8DA 1X05A 2Y8FA 5C5BB 3WA0A 4K81A 1NTVA 1PMSA 1Y19B 3GYOA 1X86A 1TQZA 2RGNB 1V88A 2BCJA 5D3XA 3V5WA 2COFA 1FGZA 2JP2A 5HE3A 1PFJA 2CODA 2EMTA 1U5DA 5HE0A 2D9XA 2ZPYA 3VIAA 1DROA 2D2QA 4A6HA 4HAXB 4DX8A 1WGUA 3AU4A 5D3WA 1GC6A 1U29A 4A5KA 2J0MA 4HAYB 2D9YA 4ZRIA 2D9WA 2CAYA 1K5GB 3HK0A 1DDVA 1MKEA 2YT1A 5DI9B 1DDWA 4HB4B 1XKEA 5GOWB 2YS3A 1V5MA 1XODA 2NMBA 1MIXA 4YL8A 1K5DB 4IAPA 1P5TA 4PNKA 4K2OA 4ZRJA 1RRPB 1PLSA 3RCPA 2K2UA 2MKRA 2GCLA 2YS5A 1WI1A 4WJ7A 3IVFA 1FOEA 1H10A 1V61A 1GC7A 1QQGA 4EKUA 1MIZB 4GPTB 5KQ1A 1ZC4B 5D27A 2UZRA 3SNHA 1X1GA 2W2XC 2LOXA 5KQ4A 2LULA 3F0WA 3KZ1A 1V5PA 2DKPA 4HB0B 1AWEA 2GS0A 2I5FA 2HE7A 1BTKA 1OMWA 2P0FA 4A6KA 2PZ1A 5HE2A 3G9WA 2W2WA 4BBKA 3TW1A 4A6FA 4DXAB 2MWNB 4F7GA 2COAA 3ML4A 2KCJA 5LONB 1XX0A 2RVBB 1NU2A 2YT0A 3QBVB 2YSZA 1IRSA 2ELAA 5LOPB 4WSFA 4HAWB 2LG1A 1DBHA 2DX1A 4EJNA 3MDBC 1ISNA 1FHXA 4P7IA 5J3TA 2CY4A 1OY2A 4B6HA 1UEFA 1MAIA 2KGXB 3KY9A 4MK0A 1WG7A 1XCGA 1FGYA 3P7ZA 2I1JA 3U8ZA 2DHIA 2ROZB 3AU5A 3PVLA 2DFKA 4EMOA 2Y8GA 1U5GA 4KHBB 4IFSA 2P0DA 3PVUA 3ODOA 2J0JA 5JHHA 3PVWA 3N7CA 2ROVA 3U7DA 2E2XA 2Z0PA 1P3RA 5C6RA 2ADZA 1XD4A 5HE1A 2EC1A 4WVFB 3TVVA 3ZVRA 4HDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PSC A;  3ZDT A;  2N0Y A;  2QKM A;  1FAO A;  2M14 A;  2VRW B;  5DHA B;  5FI1 A;  3FM8 C;  1J19 A;  4NSW A;  5C79 A;  1V89 A;  4KVG B;  3OAN A;  5DH9 B;  1V5U A;  3DXD A;  2DYQ A;  4MY6 A;  1M7R A;  4DBB A;  1BWN A;  2COC A;  5DIF B;  1SHC A;  2QKL A;  2YF0 A;  3QIJ A;  3QWM A;  1N3H A;  2J59 M;  2K00 A;  1B55 A;  2DTC A;  5L81 A;  4KHO A;  2LOZ A;  3FSS A;  1WJ1 A;  2K2J A;  3DXE A;  5D3V A;  4TKN A;  5JHG A;  5JLJ B;  4KAX B;  2D4Q A;  2CY5 A;  2D9Z A;  4H8S A;  2P8V A;  2DHJ A;  2D10 A;  2LYD A;  3O96 A;  2Q13 A;  3NSU A;  3ODW A;  3D8E A;  1TXD A;  5DHF B;  2L2I A;  1WVH A;  4C0A A;  3PP2 A;  3F5R A;  1U5F A;  2UVM A;  1TJ6 A;  1OQN A;  1MK9 B;  1FHW A;  1SGH A;  3CIK A;  2Z0Q A;  2LKO A;  1I2H A;  1M7E A;  1ZM0 A;  3TFM A;  1ZC3 B;  4CYE A;  2OTX A;  4MT7 A;  3T06 A;  1EGX A;  1E5W A;  3M1I B;  2M38 A;  1Q67 A;  2MDX A;  4YON A;  5D3Y A;  1W1G A;  5C5B A;  1NTY A;  2X18 A;  1FB8 A;  2DX5 A;  1P6S A;  3P6A A;  4Z2N A;  1EVH A;  4CHJ A;  1UNQ A;  4A6F B;  3SO6 A;  2IYB A;  1ZVR A;  3KRW A;  5C16 A;  2EMS A;  2DLW A;  1DYN A;  4K2P A;  3HQC A;  2EJ8 A;  2VKI A;  2DHK A;  1FHO A;  1UPR A;  3ODX A;  3VOQ A;  1AQC A;  1BAK A;  5CLQ B;  1J0W A;  2KUP A;  1H4R A;  3UZT A;  3PG7 A;  4HAT B;  1RJ2 A;  3BIN A;  2HTH B;  2J0K A;  1X1F A;  4F7H A;  2RLO A;  4K17 A;  4GMV A;  3SYX A;  2DN6 A;  3AJ4 A;  3LJU X;  3KSY A;  4GN1 A;  4Y94 A;  5KCV A;  1I7A A;  2DKQ A;  1U27 A;  1U5E A;  1DDM A;  2AL6 A;  1U2B A;  2L1C A;  1LB1 A;  1WJM A;  1UNR A;  3DXC A;  2R09 A;  3MPX A;  2Z0O A;  2IFS A;  2H7E A;  4CHM A;  3ULC A;  2FJL A;  3FEH A;  3A98 B;  4HB2 B;  2RNR B;  2OQB A;  4HB3 B;  2VSZ A;  2R0D A;  2D11 A;  2YVC A;  2DA0 A;  3TO1 A;  3PZD A;  3WYF B;  2I1K A;  1EAZ A;  4F7U P;  1KI1 B;  2YS1 A;  2W2X D;  3X23 A;  2Y7B A;  2CRF A;  4L6E A;  1Y5O A;  3D8F A;  5EFX A;  4ZRK A;  3ULB A;  4HDO A;  3TCA A;  1W1D A;  1WGQ A;  4TYZ A;  1NI2 A;  1MPH A;  1UPQ A;  4GZU A;  4HAU B;  2N23 A;  2RUK B;  5J3Q A;  2NZ8 B;  3A8Q A;  2AEH A;  1EF1 A;  4GXB A;  5J3Y A;  3KRX A;  1ZSQ A;  2ELB A;  3GYP A;  1MK7 B;  2DYN A;  1XR0 B;  2GJY A;  2H7D A;  4GMX B;  2P0H A;  4HAV B;  1KZG A;  4PQ0 A;  2V76 A;  3BJI A;  3SV1 A;  4HAZ B;  2GCJ A;  2MFQ A;  5JP4 A;  2YRY A;  2RSG A;  4Z2M B;  4D0N B;  4HHV A;  4NY0 A;  3PEG A;  2G35 A;  2D9V A;  2I5C A;  3HW2 B;  3CXB B;  4DX9 0;  5FI0 A;  1X11 A;  2XQN M;  4XWX A;  1KZ7 A;  1LW3 A;  2UZS A;  4KHA A;  3A8P A;  1BTN A;  4IOY X;  1W1H A;  1QC6 A;  1GG3 A;  1Z87 A;  1UNP A;  3SUZ A;  5CLL B;  3D8D A;  1X05 A;  2Y8F A;  5C5B B;  3WA0 A;  4K81 A;  1NTV A;  1PMS A;  1Y19 B;  3GYO A;  1X86 A;  1TQZ A;  2RGN B;  1V88 A;  2BCJ A;  5D3X A;  3V5W A;  2COF A;  1FGZ A;  2JP2 A;  5HE3 A;  1PFJ A;  2COD A;  2EMT A;  1U5D A;  5HE0 A;  2D9X A;  2ZPY A;  3VIA A;  1DRO A;  2D2Q A;  4A6H A;  4HAX B;  4DX8 A;  1WGU A;  3AU4 A;  5D3W A;  1GC6 A;  1U29 A;  4A5K A;  2J0M A;  4HAY B;  2D9Y A;  4ZRI A;  2D9W A;  2CAY A;  1K5G B;  3HK0 A;  1DDV A;  1MKE A;  2YT1 A;  5DI9 B;  1DDW A;  4HB4 B;  1XKE A;  5GOW B;  2YS3 A;  1V5M A;  1XOD A;  2NMB A;  1MIX A;  4YL8 A;  1K5D B;  4IAP A;  1P5T A;  4PNK A;  4K2O A;  4ZRJ A;  1RRP B;  1PLS A;  3RCP A;  2K2U A;  2MKR A;  2GCL A;  2YS5 A;  1WI1 A;  4WJ7 A;  3IVF A;  1FOE A;  1H10 A;  1V61 A;  1GC7 A;  1QQG A;  4EKU A;  1MIZ B;  4GPT B;  5KQ1 A;  1ZC4 B;  5D27 A;  2UZR A;  3SNH A;  1X1G A;  2W2X C;  2LOX A;  5KQ4 A;  2LUL A;  3F0W A;  3KZ1 A;  1V5P A;  2DKP A;  4HB0 B;  1AWE A;  2GS0 A;  2I5F A;  2HE7 A;  1BTK A;  1OMW A;  2P0F A;  4A6K A;  2PZ1 A;  5HE2 A;  3G9W A;  2W2W A;  4BBK A;  3TW1 A;  4A6F A;  4DXA B;  2MWN B;  4F7G A;  2COA A;  3ML4 A;  2KCJ A;  5LON B;  1XX0 A;  2RVB B;  1NU2 A;  2YT0 A;  3QBV B;  2YSZ A;  1IRS A;  2ELA A;  5LOP B;  4WSF A;  4HAW B;  2LG1 A;  1DBH A;  2DX1 A;  4EJN A;  3MDB C;  1ISN A;  1FHX A;  4P7I A;  5J3T A;  2CY4 A;  1OY2 A;  4B6H A;  1UEF A;  1MAI A;  2KGX B;  3KY9 A;  4MK0 A;  1WG7 A;  1XCG A;  1FGY A;  3P7Z A;  2I1J A;  3U8Z A;  2DHI A;  2ROZ B;  3AU5 A;  3PVL A;  2DFK A;  4EMO A;  2Y8G A;  1U5G A;  4KHB B;  4IFS A;  2P0D A;  3PVU A;  3ODO A;  2J0J A;  5JHH A;  3PVW A;  3N7C A;  2ROV A;  3U7D A;  2E2X A;  2Z0P A;  1P3R A;  5C6R A;  2ADZ A;  1XD4 A;  5HE1 A;  2EC1 A;  4WVF B;  3TVV A;  3ZVR A;  4HDQ A; 
#chains in the Genus database with same CATH topology
 3PSC A;  3ZDT A;  2N0Y A;  2QKM A;  1FAO A;  2M14 A;  2Z14 A;  2VRW B;  2Z13 A;  5DHA B;  5FI1 A;  3FM8 C;  1J19 A;  4NSW A;  5C79 A;  1V89 A;  4KVG B;  3OAN A;  5DH9 B;  1V5U A;  3DXD A;  3HIE A;  3NWF A;  3FVC A;  2DYQ A;  4MY6 A;  1M7R A;  4DBB A;  1BWN A;  2COC A;  5DIF B;  1SHC A;  2QKL A;  2YF0 A;  3QIJ A;  3QWM A;  1N3H A;  2J59 M;  2K00 A;  1B55 A;  2DTC A;  5L81 A;  4KHO A;  2LOZ A;  3FSS A;  1WJ1 A;  2K2J A;  3DXE A;  5D3V A;  4TKN A;  2GUM A;  5JHG A;  5JLJ B;  4KAX B;  2D4Q A;  2CY5 A;  2D9Z A;  4H8S A;  2P8V A;  4L1R A;  2DHJ A;  2D10 A;  2LYD A;  3O96 A;  2Q13 A;  3NSU A;  3ODW A;  3D8E A;  1TXD A;  5DHF B;  1T77 A;  2L2I A;  1WVH A;  3U12 A;  4C0A A;  3PP2 A;  3F5R A;  3A58 A;  1U5F A;  2UVM A;  1TJ6 A;  1OQN A;  1MK9 B;  1FHW A;  1SGH A;  4OT1 A;  3CIK A;  2Z0Q A;  2KUQ A;  2LKO A;  2ZKM X;  1I2H A;  1M7E A;  1ZM0 A;  3TFM A;  1ZC3 B;  4CYE A;  2OTX A;  4MT7 A;  3T06 A;  1EGX A;  1E5W A;  3M1I B;  2M38 A;  1Q67 A;  2MDX A;  4YON A;  5D3Y A;  1W1G A;  5C5B A;  1NTY A;  2X18 A;  1FB8 A;  2DX5 A;  1P6S A;  3P6A A;  4Z2N A;  1EVH A;  4CHJ A;  4CSQ A;  1UNQ A;  4A6F B;  3SO6 A;  2IYB A;  1ZVR A;  3KRW A;  5C16 A;  2EMS A;  2DLW A;  1DYN A;  4K2P A;  3HQC A;  2EJ8 A;  2VKI A;  2DHK A;  1FHO A;  1UPR A;  3ODX A;  3VOQ A;  1AQC A;  1BAK A;  5CLQ B;  3NW8 A;  1J0W A;  2KUP A;  1H4R A;  3UZT A;  3PG7 A;  4HAT B;  1RJ2 A;  3BIN A;  2HTH B;  2J0K A;  1X1F A;  4F7H A;  2RLO A;  4K17 A;  4GMV A;  3SYX A;  2DN6 A;  3AJ4 A;  3LJU X;  3KSY A;  4GN1 A;  4Y94 A;  5KCV A;  1I7A A;  2DKQ A;  1U27 A;  1U5E A;  1DDM A;  2AL6 A;  1U2B A;  2L1C A;  1LB1 A;  1WJM A;  4HSI A;  1UNR A;  3DXC A;  2R09 A;  3MPX A;  2Z0O A;  2IFS A;  3NWA A;  2H7E A;  4CHM A;  3ULC A;  2FJL A;  4QXA B;  3FEH A;  3A98 B;  4HB2 B;  2RNR B;  2OQB A;  4HB3 B;  2VSZ A;  4QJ5 B;  2R0D A;  2D11 A;  2YVC A;  2DA0 A;  3TO1 A;  3PZD A;  3WYF B;  2I1K A;  1EAZ A;  4F7U P;  1KI1 B;  2YS1 A;  2W2X D;  3X23 A;  2Y7B A;  2CRF A;  4L6E A;  1Y5O A;  3D8F A;  5EFX A;  4ZRK A;  3ULB A;  4HDO A;  2KIE A;  3TCA A;  1W1D A;  1WGQ A;  4TYZ A;  1NI2 A;  1MPH A;  1UPQ A;  4GZU A;  4HAU B;  2N23 A;  3B77 A;  2RUK B;  5J3Q A;  2NBV A;  2NZ8 B;  3A8Q A;  2R2Y A;  2AEH A;  1EF1 A;  4GXB A;  5J3Y A;  3KRX A;  1ZSQ A;  2ELB A;  3GYP A;  1MK7 B;  2DYN A;  1XR0 B;  2GJY A;  2H7D A;  4GMX B;  2P0H A;  4HAV B;  1KZG A;  4PQ0 A;  2V76 A;  3BJI A;  3OHM B;  3SV1 A;  4HAZ B;  2GCJ A;  2MFQ A;  5JP4 A;  2YRY A;  2RSG A;  4Z2M B;  4D0N B;  4HHV A;  4NY0 A;  3PEG A;  2G35 A;  2D9V A;  2I5C A;  3HW2 B;  3CXB B;  4DX9 0;  4QJ3 B;  5FI0 A;  1X11 A;  2XQN M;  4XWX A;  4DIX A;  1KZ7 A;  5LG4 B;  1LW3 A;  2UZS A;  4KHA A;  3A8P A;  1BTN A;  4IOY X;  1W1H A;  1QC6 A;  1GG3 A;  1Z87 A;  1UNP A;  3SUZ A;  4KHB A;  5CLL B;  3D8D A;  1X05 A;  2Y8F A;  5C5B B;  2RRF A;  4K81 A;  3WA0 A;  5I2S A;  1NTV A;  2K8E A;  5I2M A;  1PMS A;  1Y19 B;  3GYO A;  1X86 A;  1TQZ A;  2RGN B;  1V88 A;  2BCJ A;  1ZYI A;  5D3X A;  3V5W A;  2COF A;  1FGZ A;  2JP2 A;  5HE3 A;  5M4Y B;  1PFJ A;  2YT2 A;  2COD A;  2EMT A;  1U5D A;  5HE0 A;  2D9X A;  2ZPY A;  3VIA A;  1DRO A;  2D2Q A;  4A6H A;  4HAX B;  4DX8 A;  1WGU A;  3AU4 A;  5D3W A;  1GC6 A;  1U29 A;  4A5K A;  4OSN A;  2J0M A;  4HAY B;  2D9Y A;  4GOU A;  4ZRI A;  2D9W A;  2CAY A;  1K5G B;  3HK0 A;  1DDV A;  1MKE A;  2YT1 A;  5DI9 B;  1DDW A;  3NWD A;  4HB4 B;  1XKE A;  5GOW B;  2YS3 A;  1V5M A;  1XOD A;  2NMB A;  1MIX A;  4YL8 A;  1K5D B;  4IAP A;  2FJU B;  1P5T A;  4PNK A;  4K2O A;  4ZRJ A;  1RRP B;  1PLS A;  3RCP A;  2K2U A;  4QJ4 B;  2MKR A;  2GCL A;  2YS5 A;  1WI1 A;  4WJ7 A;  3IVF A;  1FOE A;  1H10 A;  1V61 A;  2K49 A;  1GC7 A;  1QQG A;  4EKU A;  1MIZ B;  4GPT B;  4D6W A;  5KQ1 A;  1ZC4 B;  5D27 A;  2UZR A;  3SNH A;  1X1G A;  2W2X C;  2LOX A;  5KQ4 A;  2LUL A;  3F0W A;  3KZ1 A;  1V5P A;  2DKP A;  2KR0 A;  4HB0 B;  1AWE A;  2GS0 A;  2I5F A;  2HE7 A;  1BTK A;  1OMW A;  2P0F A;  4A6K A;  2PZ1 A;  5HE2 A;  3G9W A;  2W2W A;  4BBK A;  5IRS A;  3TW1 A;  4A6F A;  4DXA B;  2MWN B;  4F7G A;  2COA A;  3ML4 A;  2KCJ A;  5LON B;  1XX0 A;  2RVB B;  3HSA A;  1NU2 A;  2YT0 A;  2Z59 A;  3QBV B;  2YSZ A;  1IRS A;  2ELA A;  5LOP B;  4WSF A;  4HAW B;  2LG1 A;  1DBH A;  2DX1 A;  4EJN A;  3MDB C;  1ISN A;  1FHX A;  4P7I A;  5J3T A;  2CY4 A;  1OY2 A;  4B6H A;  1UEF A;  1MAI A;  2KGX B;  3KY9 A;  4MK0 A;  1WG7 A;  1XCG A;  1FGY A;  3P7Z A;  2I1J A;  3U8Z A;  2DHI A;  4GNK B;  2ROZ B;  3AU5 A;  3PVL A;  2DFK A;  4EMO A;  2Y8G A;  1U5G A;  4KHB B;  2KIG A;  2P0D A;  4IFS A;  3PVU A;  3ODO A;  2J0J A;  5JHH A;  3DCX A;  3PVW A;  3N7C A;  2ROV A;  3U7D A;  2E2X A;  2Z0P A;  1P3R A;  5C6R A;  2ADZ A;  1XD4 A;  5HE1 A;  2EC1 A;  4WVF B;  1MI1 A;  2Z4D A;  3TVV A;  3ZVR A;  4HDQ A; 
#chains in the Genus database with same CATH homology
 3PSC A;  3ZDT A;  2N0Y A;  2QKM A;  1FAO A;  2M14 A;  2VRW B;  5DHA B;  5FI1 A;  3FM8 C;  1J19 A;  4NSW A;  5C79 A;  1V89 A;  4KVG B;  3OAN A;  5DH9 B;  1V5U A;  3DXD A;  2DYQ A;  4MY6 A;  1M7R A;  4DBB A;  1BWN A;  2COC A;  5DIF B;  1SHC A;  2QKL A;  2YF0 A;  3QIJ A;  3QWM A;  1N3H A;  2J59 M;  2K00 A;  1B55 A;  2DTC A;  5L81 A;  4KHO A;  2LOZ A;  3FSS A;  1WJ1 A;  2K2J A;  3DXE A;  5D3V A;  4TKN A;  5JHG A;  5JLJ B;  4KAX B;  2D4Q A;  2CY5 A;  2D9Z A;  4H8S A;  2P8V A;  2DHJ A;  2D10 A;  2LYD A;  3O96 A;  2Q13 A;  3NSU A;  3ODW A;  3D8E A;  1TXD A;  5DHF B;  2L2I A;  1WVH A;  4C0A A;  3PP2 A;  3F5R A;  1U5F A;  2UVM A;  1TJ6 A;  1OQN A;  1MK9 B;  1FHW A;  1SGH A;  3CIK A;  2Z0Q A;  2LKO A;  1I2H A;  1M7E A;  1ZM0 A;  3TFM A;  1ZC3 B;  4CYE A;  2OTX A;  4MT7 A;  3T06 A;  1EGX A;  1E5W A;  3M1I B;  2M38 A;  1Q67 A;  2MDX A;  4YON A;  5D3Y A;  1W1G A;  5C5B A;  1NTY A;  2X18 A;  1FB8 A;  2DX5 A;  1P6S A;  3P6A A;  4Z2N A;  1EVH A;  4CHJ A;  1UNQ A;  4A6F B;  3SO6 A;  2IYB A;  1ZVR A;  3KRW A;  5C16 A;  2EMS A;  2DLW A;  1DYN A;  4K2P A;  3HQC A;  2EJ8 A;  2VKI A;  2DHK A;  1FHO A;  1UPR A;  3ODX A;  3VOQ A;  1AQC A;  1BAK A;  5CLQ B;  1J0W A;  2KUP A;  1H4R A;  3UZT A;  3PG7 A;  4HAT B;  1RJ2 A;  3BIN A;  2HTH B;  2J0K A;  1X1F A;  4F7H A;  2RLO A;  4K17 A;  4GMV A;  3SYX A;  2DN6 A;  3AJ4 A;  3LJU X;  3KSY A;  4GN1 A;  4Y94 A;  5KCV A;  1I7A A;  2DKQ A;  1U27 A;  1U5E A;  1DDM A;  2AL6 A;  1U2B A;  2L1C A;  1LB1 A;  1WJM A;  1UNR A;  3DXC A;  2R09 A;  3MPX A;  2Z0O A;  2IFS A;  2H7E A;  4CHM A;  3ULC A;  2FJL A;  3FEH A;  3A98 B;  4HB2 B;  2RNR B;  2OQB A;  4HB3 B;  2VSZ A;  2R0D A;  2D11 A;  2YVC A;  2DA0 A;  3TO1 A;  3PZD A;  3WYF B;  2I1K A;  1EAZ A;  4F7U P;  1KI1 B;  2YS1 A;  2W2X D;  3X23 A;  2Y7B A;  2CRF A;  4L6E A;  1Y5O A;  3D8F A;  5EFX A;  4ZRK A;  3ULB A;  4HDO A;  3TCA A;  1W1D A;  1WGQ A;  4TYZ A;  1NI2 A;  1MPH A;  1UPQ A;  4GZU A;  4HAU B;  2N23 A;  2RUK B;  5J3Q A;  2NZ8 B;  3A8Q A;  2AEH A;  1EF1 A;  4GXB A;  5J3Y A;  3KRX A;  1ZSQ A;  2ELB A;  3GYP A;  1MK7 B;  2DYN A;  1XR0 B;  2GJY A;  2H7D A;  4GMX B;  2P0H A;  4HAV B;  1KZG A;  4PQ0 A;  2V76 A;  3BJI A;  3SV1 A;  4HAZ B;  2GCJ A;  2MFQ A;  5JP4 A;  2YRY A;  2RSG A;  4Z2M B;  4D0N B;  4HHV A;  4NY0 A;  3PEG A;  2G35 A;  2D9V A;  2I5C A;  3HW2 B;  3CXB B;  4DX9 0;  5FI0 A;  1X11 A;  2XQN M;  4XWX A;  1KZ7 A;  1LW3 A;  2UZS A;  4KHA A;  3A8P A;  1BTN A;  4IOY X;  1W1H A;  1QC6 A;  1GG3 A;  1Z87 A;  1UNP A;  3SUZ A;  5CLL B;  3D8D A;  1X05 A;  2Y8F A;  5C5B B;  3WA0 A;  4K81 A;  1NTV A;  1PMS A;  1Y19 B;  3GYO A;  1X86 A;  1TQZ A;  2RGN B;  1V88 A;  2BCJ A;  5D3X A;  3V5W A;  2COF A;  1FGZ A;  2JP2 A;  5HE3 A;  1PFJ A;  2COD A;  2EMT A;  1U5D A;  5HE0 A;  2D9X A;  2ZPY A;  3VIA A;  1DRO A;  2D2Q A;  4A6H A;  4HAX B;  4DX8 A;  1WGU A;  3AU4 A;  5D3W A;  1GC6 A;  1U29 A;  4A5K A;  2J0M A;  4HAY B;  2D9Y A;  4ZRI A;  2D9W A;  2CAY A;  1K5G B;  3HK0 A;  1DDV A;  1MKE A;  2YT1 A;  5DI9 B;  1DDW A;  4HB4 B;  1XKE A;  5GOW B;  2YS3 A;  1V5M A;  1XOD A;  2NMB A;  1MIX A;  4YL8 A;  1K5D B;  4IAP A;  1P5T A;  4PNK A;  4K2O A;  4ZRJ A;  1RRP B;  1PLS A;  3RCP A;  2K2U A;  2MKR A;  2GCL A;  2YS5 A;  1WI1 A;  4WJ7 A;  3IVF A;  1FOE A;  1H10 A;  1V61 A;  1GC7 A;  1QQG A;  4EKU A;  1MIZ B;  4GPT B;  5KQ1 A;  1ZC4 B;  5D27 A;  2UZR A;  3SNH A;  1X1G A;  2W2X C;  2LOX A;  5KQ4 A;  2LUL A;  3F0W A;  3KZ1 A;  1V5P A;  2DKP A;  4HB0 B;  1AWE A;  2GS0 A;  2I5F A;  2HE7 A;  1BTK A;  1OMW A;  2P0F A;  4A6K A;  2PZ1 A;  5HE2 A;  3G9W A;  2W2W A;  4BBK A;  3TW1 A;  4A6F A;  4DXA B;  2MWN B;  4F7G A;  2COA A;  3ML4 A;  2KCJ A;  5LON B;  1XX0 A;  2RVB B;  1NU2 A;  2YT0 A;  3QBV B;  2YSZ A;  1IRS A;  2ELA A;  5LOP B;  4WSF A;  4HAW B;  2LG1 A;  1DBH A;  2DX1 A;  4EJN A;  3MDB C;  1ISN A;  1FHX A;  4P7I A;  5J3T A;  2CY4 A;  1OY2 A;  4B6H A;  1UEF A;  1MAI A;  2KGX B;  3KY9 A;  4MK0 A;  1WG7 A;  1XCG A;  1FGY A;  3P7Z A;  2I1J A;  3U8Z A;  2DHI A;  2ROZ B;  3AU5 A;  3PVL A;  2DFK A;  4EMO A;  2Y8G A;  1U5G A;  4KHB B;  4IFS A;  2P0D A;  3PVU A;  3ODO A;  2J0J A;  5JHH A;  3PVW A;  3N7C A;  2ROV A;  3U7D A;  2E2X A;  2Z0P A;  1P3R A;  5C6R A;  2ADZ A;  1XD4 A;  5HE1 A;  2EC1 A;  4WVF B;  3TVV A;  3ZVR A;  4HDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...