4OSNA

Crystal structure of engineered hcmv glycoprotein b domain ii
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
110
Chain Sequence
NEDLDEGIMVVYKRNGCQLTFWEASERTIRSEAEDSYHFSSAKMTATFLSKKQEVNMSDSALDCVRDEAINKLQQIFNTSYNQTYEKYGNVSVFETTGGLVVFWQGIKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Envelope glycoprotein B
publication title Crystal structure of engineered HCMV glycoprotein B Domain II
rcsb
source organism Human cytomegalovirus
molecule tags Viral protein
total genus 29
structure length 110
sequence length 114
ec nomenclature
pdb deposition date 2014-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17416 Glycoprot_B_PH1 Herpesvirus Glycoprotein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.100 Mainly Beta Roll PH-domain like PH-domain like 4osnA00
2GUMA 4HSIA 3NW8A 3NWDA 4L1RA 3FVCA 4OSNA 3NWFA 4OT1A 3NWAA
chains in the Genus database with same CATH superfamily
1WJ1A 5D27A 1RJ2A 1ZC4B 4B6HA 3ZDTA 4A5KA 2RRFA 2D11A 4HAVB 4HDQA 2DKPA 2DHJA 3RCPA 3PP2A 1V5PA 1PFJA 4WSFA 2J0MA 5DHAB 5D3YA 4Y94A 4KHOA 1FGZA 2KIGA 1K5GB 4QJ3B 3TO1A 2G35A 2D4QA 2OTXA 4K17A 3DXCA 2K8EA 3BINA 2E2XA 4CSQA 4HATB 5L81A 2I5FA 3D8EA 4PQ0A 2YVCA 2HE7A 2DX1A 3PSCA 4A6HA 4HB4B 3WA0A 4CHMA 5JLJB 3N7CA 1X86A 3A58A 4NY0A 3DXEA 1I7AA 3HIEA 1UNQA 5J3TA 2LKOA 3KY9A 2Z13A 4GXBA 2IYBA 5D3VA 2W2XC 1V5MA 1W1DA 3SO6A 1K5DB 1FAOA 2ZPYA 2GUMA 3PZDA 1ZC3B 1UNPA 2FJLA 2D9VA 1FOEA 3KSYA 1MK9B 1J19A 4GN1A 1M7RA 5KCVA 5DIFB 2YS5A 1U5DA 2KCJA 1QQGA 3MPXA 1UNRA 2D10A 5I2SA 4K2PA 2Z0QA 5KQ4A 2Y8FA 3D8FA 3PEGA 1J0WA 2VSZA 5CLLB 3IVFA 2IFSA 2LOXA 2AL6A 2LG1A 2PZ1A 3FVCA 1ZVRA 2H7DA 2NBVA 2Z14A 1M7EA 1UPRA 4NSWA 2D9ZA 3FEHA 5J3QA 2KUPA 4GNKB 2D9YA 2CY5A 4GMVA 2Y7BA 2M38A 2I1JA 1B55A 1E5WA 3FSSA 1PLSA 4KVGB 4WVFB 2DHIA 1WGUA 1ZYIA 2ZKMX 5JP4A 2J59M 2P0FA 2JP2A 1Y19B 2D2QA 3A8QA 5M4YB 2BCJA 1XCGA 3U8ZA 2MFQA 4TYZA 1AWEA 2L2IA 1BAKA 3CXBB 2XQNM 1LB1A 4HSIA 2K2UA 4YONA 4GPTB 1PMSA 3PVLA 4KHBA 4HB0B 1OMWA 3U12A 2J0JA 3HK0A 2FJUB 4F7HA 1H10A 1ISNA 2ELBA 5J3YA 1KZGA 3P7ZA 3UZTA 1OY2A 5HE3A 3NWAA 2Z0OA 5IRSA 4Z2MB 1I2HA 4HAUB 1XX0A 4MK0A 3T06A 2Z59A 1MIXA 2ADZA 5EFXA 4DBBA 2DX5A 1GC7A 5FI0A 1FHOA 4HB2B 5D3XA 5JHHA 4D6WA 5HE0A 4QJ5B 2COFA 1DDVA 1DBHA 2R0DA 3F5RA 3TVVA 1H4RA 1ZSQA 1X11A 2VRWB 5DHFB 3ML4A 3G9WA 2P8VA 3M1IB 4H8SA 3OHMB 4DXAB 2DTCA 4OSNA 5DI9B 4KHAA 3DCXA 3QIJA 2KUQA 2UVMA 4L1RA 1WVHA 5C5BA 3U7DA 2COCA 4GMXB 2DA0A 4ZRIA 1X1FA 5HE1A 3KRWA 3AU4A 4DX90 2R09A 1TJ6A 1WG7A 1RRPB 2DKQA 4P7IA 5DH9B 2K49A 1LW3A 2DYQA 2MKRA 4F7GA 4C0AA 1V5UA 1DDWA 1NTVA 2N0YA 1W1HA 1KZ7A 2CY4A 4BBKA 3ULCA 1FHWA 1TQZA 3QWMA 1BWNA 1U29A 5GOWB 4OT1A 3A98B 2H7EA 1TXDA 1W1GA 1NU2A 1DYNA 3VIAA 3HSAA 5I2MA 5CLQB 4KAXB 3FM8C 4GZUA 2DHKA 3GYOA 2YS3A 1P5TA 3NWFA 3ZVRA 4QXAB 1X05A 2COAA 2W2XD 4MY6A 4EJNA 1UEFA 2ROZB 2VKIA 2MDXA 5C79A 2GJYA 2UZSA 2I5CA 1XD4A 5LG4B 1XR0B 3AJ4A 2L1CA 2Y8GA 2CRFA 4HB3B 2RUKB 3SUZA 2EMTA 1DROA 1WI1A 4A6FA 2RGNB 3PVUA 3SNHA 5HE2A 2RLOA 2GCJA 4ZRKA 4KHBB 2YT1A 2CAYA 2GCLA 3NSUA 3GYPA 1V88A 1Z87A 5KQ1A 3SV1A 2DN6A 2OQBA 2HTHB 2YT0A 4CHJA 1U5GA 1FGYA 1U27A 2V76A 4F7UP 2J0KA 3ULBA 1N3HA 4YL8A 4XWXA 2CODA 2R2YA 4IAPA 4IOYX 1WGQA 2DFKA 3P6AA 1MPHA 2Z4DA 2D9WA 2N23A 3NW8A 4PNKA 2LOZA 3WYFB 1ZM0A 1T77A 1FHXA 2K00A 3KRXA 3PVWA 2K2JA 2KIEA 1GC6A 2MWNB 2YS1A 3OANA 4CYEA 3TCAA 1QC6A 5FI1A 1EAZA 1BTNA 1P6SA 4DX8A 1Y5OA 4IFSA 5JHGA 2RNRB 5C5BB 5D3WA 1UPQA 4QJ4B 2EMSA 3HQCA 4HAXB 2RSGA 3CIKA 1XKEA 3QBVB 1MAIA 3MDBC 1X1GA 3X23A 2ROVA 5C6RA 2NZ8B 3NWDA 1MKEA 2ELAA 4HHVA 1XODA 4MT7A 2QKLA 2KR0A 3F0WA 3ODXA 2M14A 3V5WA 4L6EA 1DDMA 3O96A 5C16A 2Z0PA 3ODOA 3KZ1A 2AEHA 1IRSA 3PG7A 1OQNA 1U5EA 2I1KA 3TFMA 1EF1A 2NMBA 2DYNA 1NTYA 2DLWA 2EJ8A 4HAWB 3TW1A 3BJIA 1AQCA 2YT2A 1SGHA 2RVBB 4EMOA 4D0NB 2P0HA 2LYDA 3D8DA 3A8PA 1FB8A 4TKNA 4ZRJA 1GG3A 3DXDA 2EC1A 2P0DA 1KI1B 4WJ7A 4K2OA 2QKMA 4A6FB 1SHCA 4GOUA 2YRYA 1EVHA 3LJUX 1WJMA 3SYXA 5LOPB 3HW2B 3VOQA 4Z2NA 4K81A 1V89A 5LONB 2W2WA 1V61A 1MK7B 2LULA 1Q67A 4HAYB 1U5FA 1P3RA 1U2BA 2Q13A 2UZRA 1MIZB 2X18A 4A6KA 4DIXA 1MI1A 2D9XA 2KGXB 3AU5A 3B77A 3ODWA 1NI2A 2GS0A 4HAZB 4HDOA 2YF0A 1EGXA 2YSZA 1BTKA 4EKUA
chains in the Genus database with same CATH topology
5I2SA 4CSQA 3FSSA 3HIEA 4HSIA 4KHBB 4OSNA 4IFSA 2Z4DA 2GCLA 2RRFA 3GYPA 4QJ4B 4KHAA 1ZYIA 4D6WA 2ZKMX 4QJ5B 2KUQA 4KHBA 2Z13A 3NW8A 5LG4B 4L1RA 4PQ0A 3U12A 4OT1A 3TVVA 2FJUB 4DIXA 2GUMA 5M4YB 3NWDA 3FVCA 4GOUA 2NBVA 2Z14A 2KIEA 4KHOA 5I2MA 2KIGA 3TW1A 4Z2NA 3NWAA 4QJ3B 3TO1A 5IRSA 2KR0A 3A58A 3GYOA 4Z2MB 2GCJA 3NWFA 2YT2A 4GNKB 2K49A 2K8EA 4QXAB 2R2YA 2Z59A 3OHMB 4IOYX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GUM A;  4HSI A;  3NW8 A;  3NWD A;  4L1R A;  3FVC A;  4OSN A;  3NWF A;  4OT1 A;  3NWA A; 
#chains in the Genus database with same CATH topology
 1WJ1 A;  5D27 A;  1RJ2 A;  1ZC4 B;  4B6H A;  3ZDT A;  4A5K A;  2RRF A;  2D11 A;  4HAV B;  4HDQ A;  2DKP A;  2DHJ A;  3RCP A;  3PP2 A;  1V5P A;  1PFJ A;  4WSF A;  2J0M A;  5DHA B;  5D3Y A;  4Y94 A;  4KHO A;  1FGZ A;  2KIG A;  1K5G B;  4QJ3 B;  3TO1 A;  2G35 A;  2D4Q A;  2OTX A;  4K17 A;  3DXC A;  2K8E A;  3BIN A;  2E2X A;  4CSQ A;  4HAT B;  5L81 A;  2I5F A;  3D8E A;  4PQ0 A;  2YVC A;  2HE7 A;  2DX1 A;  3PSC A;  4A6H A;  4HB4 B;  3WA0 A;  4CHM A;  5JLJ B;  3N7C A;  1X86 A;  3A58 A;  4NY0 A;  3DXE A;  1I7A A;  3HIE A;  1UNQ A;  5J3T A;  2LKO A;  3KY9 A;  2Z13 A;  4GXB A;  2IYB A;  5D3V A;  2W2X C;  1V5M A;  1W1D A;  3SO6 A;  1K5D B;  1FAO A;  2ZPY A;  2GUM A;  3PZD A;  1ZC3 B;  1UNP A;  2FJL A;  2D9V A;  1FOE A;  3KSY A;  1MK9 B;  1J19 A;  4GN1 A;  1M7R A;  5KCV A;  5DIF B;  2YS5 A;  1U5D A;  2KCJ A;  1QQG A;  3MPX A;  1UNR A;  2D10 A;  5I2S A;  4K2P A;  2Z0Q A;  5KQ4 A;  2Y8F A;  3D8F A;  3PEG A;  1J0W A;  2VSZ A;  5CLL B;  3IVF A;  2IFS A;  2LOX A;  2AL6 A;  2LG1 A;  2PZ1 A;  3FVC A;  1ZVR A;  2H7D A;  2NBV A;  2Z14 A;  1M7E A;  1UPR A;  4NSW A;  2D9Z A;  3FEH A;  5J3Q A;  2KUP A;  4GNK B;  2D9Y A;  2CY5 A;  4GMV A;  2Y7B A;  2M38 A;  2I1J A;  1B55 A;  1E5W A;  3FSS A;  1PLS A;  4KVG B;  4WVF B;  2DHI A;  1WGU A;  1ZYI A;  2ZKM X;  5JP4 A;  2J59 M;  2P0F A;  2JP2 A;  1Y19 B;  2D2Q A;  3A8Q A;  5M4Y B;  2BCJ A;  1XCG A;  3U8Z A;  2MFQ A;  4TYZ A;  1AWE A;  2L2I A;  1BAK A;  3CXB B;  2XQN M;  1LB1 A;  4HSI A;  2K2U A;  4YON A;  4GPT B;  1PMS A;  3PVL A;  4KHB A;  4HB0 B;  1OMW A;  3U12 A;  2J0J A;  3HK0 A;  2FJU B;  4F7H A;  1H10 A;  1ISN A;  2ELB A;  5J3Y A;  1KZG A;  3P7Z A;  3UZT A;  1OY2 A;  5HE3 A;  3NWA A;  2Z0O A;  5IRS A;  4Z2M B;  1I2H A;  4HAU B;  1XX0 A;  4MK0 A;  3T06 A;  2Z59 A;  1MIX A;  2ADZ A;  5EFX A;  4DBB A;  2DX5 A;  1GC7 A;  5FI0 A;  1FHO A;  4HB2 B;  5D3X A;  5JHH A;  4D6W A;  5HE0 A;  4QJ5 B;  2COF A;  1DDV A;  1DBH A;  2R0D A;  3F5R A;  3TVV A;  1H4R A;  1ZSQ A;  1X11 A;  2VRW B;  5DHF B;  3ML4 A;  3G9W A;  2P8V A;  3M1I B;  4H8S A;  3OHM B;  4DXA B;  2DTC A;  4OSN A;  5DI9 B;  4KHA A;  3DCX A;  3QIJ A;  2KUQ A;  2UVM A;  4L1R A;  1WVH A;  5C5B A;  3U7D A;  2COC A;  4GMX B;  2DA0 A;  4ZRI A;  1X1F A;  5HE1 A;  3KRW A;  3AU4 A;  4DX9 0;  2R09 A;  1TJ6 A;  1WG7 A;  1RRP B;  2DKQ A;  4P7I A;  5DH9 B;  2K49 A;  1LW3 A;  2DYQ A;  2MKR A;  4F7G A;  4C0A A;  1V5U A;  1DDW A;  1NTV A;  2N0Y A;  1W1H A;  1KZ7 A;  2CY4 A;  4BBK A;  3ULC A;  1FHW A;  1TQZ A;  3QWM A;  1BWN A;  1U29 A;  5GOW B;  4OT1 A;  3A98 B;  2H7E A;  1TXD A;  1W1G A;  1NU2 A;  1DYN A;  3VIA A;  3HSA A;  5I2M A;  5CLQ B;  4KAX B;  3FM8 C;  4GZU A;  2DHK A;  3GYO A;  2YS3 A;  1P5T A;  3NWF A;  3ZVR A;  4QXA B;  1X05 A;  2COA A;  2W2X D;  4MY6 A;  4EJN A;  1UEF A;  2ROZ B;  2VKI A;  2MDX A;  5C79 A;  2GJY A;  2UZS A;  2I5C A;  1XD4 A;  5LG4 B;  1XR0 B;  3AJ4 A;  2L1C A;  2Y8G A;  2CRF A;  4HB3 B;  2RUK B;  3SUZ A;  2EMT A;  1DRO A;  1WI1 A;  4A6F A;  2RGN B;  3PVU A;  3SNH A;  5HE2 A;  2RLO A;  2GCJ A;  4ZRK A;  4KHB B;  2YT1 A;  2CAY A;  2GCL A;  3NSU A;  3GYP A;  1V88 A;  1Z87 A;  5KQ1 A;  3SV1 A;  2DN6 A;  2OQB A;  2HTH B;  2YT0 A;  4CHJ A;  1U5G A;  1FGY A;  1U27 A;  2V76 A;  4F7U P;  2J0K A;  3ULB A;  1N3H A;  4YL8 A;  4XWX A;  2COD A;  2R2Y A;  4IAP A;  4IOY X;  1WGQ A;  2DFK A;  3P6A A;  1MPH A;  2Z4D A;  2D9W A;  2N23 A;  3NW8 A;  4PNK A;  2LOZ A;  3WYF B;  1ZM0 A;  1T77 A;  1FHX A;  2K00 A;  3KRX A;  3PVW A;  2K2J A;  2KIE A;  1GC6 A;  2MWN B;  2YS1 A;  3OAN A;  4CYE A;  3TCA A;  1QC6 A;  5FI1 A;  1EAZ A;  1BTN A;  1P6S A;  4DX8 A;  1Y5O A;  4IFS A;  5JHG A;  2RNR B;  5C5B B;  5D3W A;  1UPQ A;  4QJ4 B;  2EMS A;  3HQC A;  4HAX B;  2RSG A;  3CIK A;  1XKE A;  3QBV B;  1MAI A;  3MDB C;  1X1G A;  3X23 A;  2ROV A;  5C6R A;  2NZ8 B;  3NWD A;  1MKE A;  2ELA A;  4HHV A;  1XOD A;  4MT7 A;  2QKL A;  2KR0 A;  3F0W A;  3ODX A;  2M14 A;  3V5W A;  4L6E A;  1DDM A;  3O96 A;  5C16 A;  2Z0P A;  3ODO A;  3KZ1 A;  2AEH A;  1IRS A;  3PG7 A;  1OQN A;  1U5E A;  2I1K A;  3TFM A;  1EF1 A;  2NMB A;  2DYN A;  1NTY A;  2DLW A;  2EJ8 A;  4HAW B;  3TW1 A;  3BJI A;  1AQC A;  2YT2 A;  1SGH A;  2RVB B;  4EMO A;  4D0N B;  2P0H A;  2LYD A;  3D8D A;  3A8P A;  1FB8 A;  4TKN A;  4ZRJ A;  1GG3 A;  3DXD A;  2EC1 A;  2P0D A;  1KI1 B;  4WJ7 A;  4K2O A;  2QKM A;  4A6F B;  1SHC A;  4GOU A;  2YRY A;  1EVH A;  3LJU X;  1WJM A;  3SYX A;  5LOP B;  3HW2 B;  3VOQ A;  4Z2N A;  4K81 A;  1V89 A;  5LON B;  2W2W A;  1V61 A;  1MK7 B;  2LUL A;  1Q67 A;  4HAY B;  1U5F A;  1P3R A;  1U2B A;  2Q13 A;  2UZR A;  1MIZ B;  2X18 A;  4A6K A;  4DIX A;  1MI1 A;  2D9X A;  2KGX B;  3AU5 A;  3B77 A;  3ODW A;  1NI2 A;  2GS0 A;  4HAZ B;  4HDO A;  2YF0 A;  1EGX A;  2YSZ A;  1BTK A;  4EKU A; 
#chains in the Genus database with same CATH homology
 5I2S A;  4CSQ A;  3FSS A;  3HIE A;  4HSI A;  4KHB B;  4OSN A;  4IFS A;  2Z4D A;  2GCL A;  2RRF A;  3GYP A;  4QJ4 B;  4KHA A;  1ZYI A;  4D6W A;  2ZKM X;  4QJ5 B;  2KUQ A;  4KHB A;  2Z13 A;  3NW8 A;  5LG4 B;  4L1R A;  4PQ0 A;  3U12 A;  4OT1 A;  3TVV A;  2FJU B;  4DIX A;  2GUM A;  5M4Y B;  3NWD A;  3FVC A;  4GOU A;  2NBV A;  2Z14 A;  2KIE A;  4KHO A;  5I2M A;  2KIG A;  3TW1 A;  4Z2N A;  3NWA A;  4QJ3 B;  3TO1 A;  5IRS A;  2KR0 A;  3A58 A;  3GYO A;  4Z2M B;  2GCJ A;  3NWF A;  2YT2 A;  4GNK B;  2K49 A;  2K8E A;  4QXA B;  2R2Y A;  2Z59 A;  3OHM B;  4IOY X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...