4OSNA

Crystal structure of engineered hcmv glycoprotein b domain ii
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
110
Chain Sequence
NEDLDEGIMVVYKRNGCQLTFWEASERTIRSEAEDSYHFSSAKMTATFLSKKQEVNMSDSALDCVRDEAINKLQQIFNTSYNQTYEKYGNVSVFETTGGLVVFWQGIKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Envelope glycoprotein B
publication title Crystal structure of engineered HCMV glycoprotein B Domain II
rcsb
source organism Human cytomegalovirus
total genus 29
structure length 110
sequence length 114
ec nomenclature
pdb deposition date 2014-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17416 Glycoprot_B_PH1 Herpesvirus Glycoprotein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.100 Mainly Beta Roll PH-domain like PH-domain like 4osnA00
3NW8A 3NWAA 4HSIA 4L1RA 3NWFA 3FVCA 4OT1A 2GUMA 3NWDA 4OSNA
chains in the Genus database with same CATH superfamily
3U7DA 2P0DA 1EF1A 5KQ1A 1LW3A 5KCVA 2DKQA 4GMVA 3GYOA 1PLSA 1W1DA 1RRPB 1OMWA 5L81A 4HAZB 1V89A 2DX1A 2GCJA 4QJ4B 1X05A 3WYFB 2NMBA 2YT0A 5J3QA 5FI0A 1MK9B 1PFJA 3A98B 1FAOA 2D11A 2DHKA 1XKEA 1BWNA 2RLOA 2ROVA 4TKNA 3VIAA 1FB8A 2Q13A 2VKIA 2YSZA 4PQ0A 1T77A 4Y94A 2ROZB 1UEFA 2CODA 1AQCA 4HB2B 1U2BA 2YF0A 1X1GA 2ELBA 2R09A 3VOQA 2COAA 2IFSA 4KVGB 1TXDA 1V88A 3HQCA 2Y7BA 4CHMA 1ZYIA 2DN6A 5KQ4A 1E5WA 4MK0A 1P5TA 2ADZA 2D9YA 3PVWA 1V5PA 2GCLA 4HDQA 1DDVA 3F5RA 1QQGA 3D8DA 1BTKA 2H7EA 4MY6A 3SO6A 2KUPA 1PMSA 1V5UA 4GPTB 1DDWA 2M38A 3CXBB 4HSIA 1DYNA 5C5BA 3P7ZA 2RNRB 2DHJA 3MPXA 1GC6A 2W2WA 4WJ7A 2GJYA 2YS1A 2K8EA 3SV1A 3ZVRA 2DFKA 2Y8FA 3KY9A 1FOEA 3SYXA 1I2HA 2DLWA 2Z4DA 4B6HA 2D9VA 2MFQA 1EAZA 2RGNB 1SGHA 4K2PA 5CLLB 3LJUX 3NWDA 3NWAA 4HAXB 1H4RA 2AL6A 4QJ5B 4GMXB 3PSCA 2DTCA 2XQNM 4A5KA 4HB3B 2ZPYA 2OQBA 5FI1A 3HW2B 1MIZB 3AU4A 1U27A 2KGXB 2V76A 4HDOA 5DH9B 1TQZA 2VRWB 5JP4A 1J19A 4HAVB 1H10A 2NZ8B 1GG3A 5DHFB 2UZSA 3ZDTA 4CHJA 2Z13A 2H7DA 3BJIA 1GC7A 5JLJB 4CYEA 3KRXA 3QBVB 5C79A 5J3TA 1ZC3B 3O96A 4GZUA 1P6SA 1KZGA 2EJ8A 1ZM0A 4A6FA 2RUKB 5JHGA 3PVUA 2Z59A 3PZDA 1WI1A 2ZKMX 2I1JA 5HE0A 2RVBB 2DKPA 1U5EA 4HAYB 4ZRJA 3ULCA 4D6WA 4C0AA 4F7GA 1B55A 1MPHA 2LYDA 1FHXA 3DXEA 4GNKB 1EVHA 2L1CA 3KRWA 3A8PA 3FM8C 5C5BB 3HIEA 1UNRA 2KR0A 1Q67A 3P6AA 2YT2A 4YONA 2BCJA 3DCXA 5LG4B 4L6EA 2CAYA 1DBHA 2RSGA 3KZ1A 4KHOA 1MIXA 4NSWA 2E2XA 4KHBB 1FGYA 4XWXA 2YS5A 5D3XA 1WJ1A 4QXAB 1KI1B 4F7HA 2CRFA 1U5GA 1MI1A 3HK0A 1Z87A 4HB0B 5D3YA 4PNKA 5LOPB 1EGXA 1UNQA 2EC1A 2HTHB 5HE1A 4Z2NA 2KIGA 2K2UA 3OHMB 3D8EA 1NU2A 4HB4B 2K00A 4NY0A 2Z0QA 3IVFA 1N3HA 1XD4A 2QKMA 3D8FA 2N23A 2YT1A 2D2QA 2I5FA 2K2JA 2J0JA 2JP2A 1U5DA 3PVLA 2R0DA 1XX0A 5D3VA 1X86A 2EMTA 1ZC4B 2DX5A 4EMOA 1V61A 2P8VA 2PZ1A 3CIKA 4GN1A 2R2YA 2W2XC 3A58A 3BINA 1U5FA 1LB1A 3NW8A 3TVVA 1WGUA 3V5WA 5I2SA 2LULA 4BBKA 4KHAA 2M14A 1OQNA 2LKOA 1X11A 1NTVA 3PG7A 2LOXA 4K17A 2DA0A 3ODWA 1M7EA 1WGQA 4WVFB 4DXAB 1FHWA 1K5DB 2LG1A 1UPQA 4HATB 2MKRA 3UZTA 2GS0A 4CSQA 2CY5A 2FJUB 5DI9B 1KZ7A 3PEGA 3ODXA 3MDBC 5LONB 4DX8A 1MKEA 1QC6A 1XCGA 3QWMA 3F0WA 3WA0A 2D4QA 5M4YB 2NBVA 5IRSA 3NSUA 4DX90 2LOZA 1XODA 2QKLA 2YVCA 3DXDA 3TFMA 3ULBA 1FGZA 1UPRA 2MDXA 4OT1A 1NTYA 4EKUA 1IRSA 3FSSA 4GOUA 3PP2A 3OANA 2Z14A 1NI2A 4YL8A 5CLQB 4ZRIA 2P0HA 2I5CA 1W1GA 1Y5OA 3AU5A 4HAUB 5GOWB 2FJLA 1FHOA 2N0YA 4DBBA 1XR0B 2D9WA 2KCJA 2KUQA 2X18A 1MAIA 2L2IA 4IOYX 5DIFB 2COCA 1X1FA 2VSZA 2DYNA 3B77A 4MT7A 4KAXB 4IAPA 1WG7A 1I7AA 4D0NB 2I1KA 3TW1A 1BAKA 2CY4A 3U12A 5I2MA 1WVHA 5HE2A 1DROA 3FEHA 2D9ZA 5DHAB 2RRFA 2GUMA 2EMSA 3G9WA 2DYQA 1W1HA 2AEHA 3QIJA 3FVCA 4P7IA 5J3YA 2IYBA 3TCAA 1SHCA 1P3RA 2MWNB 4QJ3B 2P0FA 2YS3A 4L1RA 4WSFA 4GXBA 2D9XA 2UVMA 4HHVA 4IFSA 3M1IB 5JHHA 1J0WA 5HE3A 5C16A 3ML4A 1RJ2A 2D10A 3ODOA 4A6KA 1U29A 3T06A 3TO1A 5D27A 1OY2A 1Y19B 2HE7A 4TYZA 2ELAA 4A6FB 4F7UP 4EJNA 5EFXA 1ZSQA 2K49A 4A6HA 2J0MA 3DXCA 2YRYA 2Z0OA 2Z0PA 1TJ6A 3X23A 3U8ZA 1BTNA 2W2XD 3RCPA 2KIEA 2J59M 2COFA 3GYPA 4KHBA 1UNPA 2Y8GA 4HAWB 1M7RA 1WJMA 3N7CA 3SUZA 3HSAA 1V5MA 2DHIA 4H8SA 1DDMA 2J0KA 3AJ4A 3KSYA 4ZRKA 4Z2MB 4DIXA 2UZRA 2OTXA 4OSNA 1ZVRA 1MK7B 3NWFA 2G35A 3SNHA 1ISNA 5C6RA 1K5GB 3A8QA 4K2OA 1AWEA 5D3WA 4K81A
chains in the Genus database with same CATH topology
4HSIA 3NWAA 3FSSA 3A58A 4GOUA 2Z13A 4L1RA 4QJ3B 2K49A 2Z14A 4D6WA 1ZYIA 4KHOA 4QJ5B 4CSQA 3TW1A 4IFSA 2FJUB 4KHBB 3NW8A 4GNKB 3TVVA 4PQ0A 4Z2MB 4DIXA 5I2SA 4QXAB 3U12A 5I2MA 4OSNA 4KHAA 3HIEA 2K8EA 3GYOA 2GCLA 2RRFA 3NWFA 3TO1A 2KUQA 2GUMA 2KR0A 5M4YB 2NBVA 2GCJA 2YT2A 2Z4DA 5IRSA 2KIEA 4QJ4B 2Z59A 4IOYX 3GYPA 4KHBA 2ZKMX 5LG4B 4OT1A 3FVCA 2KIGA 4Z2NA 3OHMB 3NWDA 2R2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NW8 A;  3NWA A;  4HSI A;  4L1R A;  3NWF A;  3FVC A;  4OT1 A;  2GUM A;  3NWD A;  4OSN A; 
#chains in the Genus database with same CATH topology
 3U7D A;  2P0D A;  1EF1 A;  5KQ1 A;  1LW3 A;  5KCV A;  2DKQ A;  4GMV A;  3GYO A;  1PLS A;  1W1D A;  1RRP B;  1OMW A;  5L81 A;  4HAZ B;  1V89 A;  2DX1 A;  2GCJ A;  4QJ4 B;  1X05 A;  3WYF B;  2NMB A;  2YT0 A;  5J3Q A;  5FI0 A;  1MK9 B;  1PFJ A;  3A98 B;  1FAO A;  2D11 A;  2DHK A;  1XKE A;  1BWN A;  2RLO A;  2ROV A;  4TKN A;  3VIA A;  1FB8 A;  2Q13 A;  2VKI A;  2YSZ A;  4PQ0 A;  1T77 A;  4Y94 A;  2ROZ B;  1UEF A;  2COD A;  1AQC A;  4HB2 B;  1U2B A;  2YF0 A;  1X1G A;  2ELB A;  2R09 A;  3VOQ A;  2COA A;  2IFS A;  4KVG B;  1TXD A;  1V88 A;  3HQC A;  2Y7B A;  4CHM A;  1ZYI A;  2DN6 A;  5KQ4 A;  1E5W A;  4MK0 A;  1P5T A;  2ADZ A;  2D9Y A;  3PVW A;  1V5P A;  2GCL A;  4HDQ A;  1DDV A;  3F5R A;  1QQG A;  3D8D A;  1BTK A;  2H7E A;  4MY6 A;  3SO6 A;  2KUP A;  1PMS A;  1V5U A;  4GPT B;  1DDW A;  2M38 A;  3CXB B;  4HSI A;  1DYN A;  5C5B A;  3P7Z A;  2RNR B;  2DHJ A;  3MPX A;  1GC6 A;  2W2W A;  4WJ7 A;  2GJY A;  2YS1 A;  2K8E A;  3SV1 A;  3ZVR A;  2DFK A;  2Y8F A;  3KY9 A;  1FOE A;  3SYX A;  1I2H A;  2DLW A;  2Z4D A;  4B6H A;  2D9V A;  2MFQ A;  1EAZ A;  2RGN B;  1SGH A;  4K2P A;  5CLL B;  3LJU X;  3NWD A;  3NWA A;  4HAX B;  1H4R A;  2AL6 A;  4QJ5 B;  4GMX B;  3PSC A;  2DTC A;  2XQN M;  4A5K A;  4HB3 B;  2ZPY A;  2OQB A;  5FI1 A;  3HW2 B;  1MIZ B;  3AU4 A;  1U27 A;  2KGX B;  2V76 A;  4HDO A;  5DH9 B;  1TQZ A;  2VRW B;  5JP4 A;  1J19 A;  4HAV B;  1H10 A;  2NZ8 B;  1GG3 A;  5DHF B;  2UZS A;  3ZDT A;  4CHJ A;  2Z13 A;  2H7D A;  3BJI A;  1GC7 A;  5JLJ B;  4CYE A;  3KRX A;  3QBV B;  5C79 A;  5J3T A;  1ZC3 B;  3O96 A;  4GZU A;  1P6S A;  1KZG A;  2EJ8 A;  1ZM0 A;  4A6F A;  2RUK B;  5JHG A;  3PVU A;  2Z59 A;  3PZD A;  1WI1 A;  2ZKM X;  2I1J A;  5HE0 A;  2RVB B;  2DKP A;  1U5E A;  4HAY B;  4ZRJ A;  3ULC A;  4D6W A;  4C0A A;  4F7G A;  1B55 A;  1MPH A;  2LYD A;  1FHX A;  3DXE A;  4GNK B;  1EVH A;  2L1C A;  3KRW A;  3A8P A;  3FM8 C;  5C5B B;  3HIE A;  1UNR A;  2KR0 A;  1Q67 A;  3P6A A;  2YT2 A;  4YON A;  2BCJ A;  3DCX A;  5LG4 B;  4L6E A;  2CAY A;  1DBH A;  2RSG A;  3KZ1 A;  4KHO A;  1MIX A;  4NSW A;  2E2X A;  4KHB B;  1FGY A;  4XWX A;  2YS5 A;  5D3X A;  1WJ1 A;  4QXA B;  1KI1 B;  4F7H A;  2CRF A;  1U5G A;  1MI1 A;  3HK0 A;  1Z87 A;  4HB0 B;  5D3Y A;  4PNK A;  5LOP B;  1EGX A;  1UNQ A;  2EC1 A;  2HTH B;  5HE1 A;  4Z2N A;  2KIG A;  2K2U A;  3OHM B;  3D8E A;  1NU2 A;  4HB4 B;  2K00 A;  4NY0 A;  2Z0Q A;  3IVF A;  1N3H A;  1XD4 A;  2QKM A;  3D8F A;  2N23 A;  2YT1 A;  2D2Q A;  2I5F A;  2K2J A;  2J0J A;  2JP2 A;  1U5D A;  3PVL A;  2R0D A;  1XX0 A;  5D3V A;  1X86 A;  2EMT A;  1ZC4 B;  2DX5 A;  4EMO A;  1V61 A;  2P8V A;  2PZ1 A;  3CIK A;  4GN1 A;  2R2Y A;  2W2X C;  3A58 A;  3BIN A;  1U5F A;  1LB1 A;  3NW8 A;  3TVV A;  1WGU A;  3V5W A;  5I2S A;  2LUL A;  4BBK A;  4KHA A;  2M14 A;  1OQN A;  2LKO A;  1X11 A;  1NTV A;  3PG7 A;  2LOX A;  4K17 A;  2DA0 A;  3ODW A;  1M7E A;  1WGQ A;  4WVF B;  4DXA B;  1FHW A;  1K5D B;  2LG1 A;  1UPQ A;  4HAT B;  2MKR A;  3UZT A;  2GS0 A;  4CSQ A;  2CY5 A;  2FJU B;  5DI9 B;  1KZ7 A;  3PEG A;  3ODX A;  3MDB C;  5LON B;  4DX8 A;  1MKE A;  1QC6 A;  1XCG A;  3QWM A;  3F0W A;  3WA0 A;  2D4Q A;  5M4Y B;  2NBV A;  5IRS A;  3NSU A;  4DX9 0;  2LOZ A;  1XOD A;  2QKL A;  2YVC A;  3DXD A;  3TFM A;  3ULB A;  1FGZ A;  1UPR A;  2MDX A;  4OT1 A;  1NTY A;  4EKU A;  1IRS A;  3FSS A;  4GOU A;  3PP2 A;  3OAN A;  2Z14 A;  1NI2 A;  4YL8 A;  5CLQ B;  4ZRI A;  2P0H A;  2I5C A;  1W1G A;  1Y5O A;  3AU5 A;  4HAU B;  5GOW B;  2FJL A;  1FHO A;  2N0Y A;  4DBB A;  1XR0 B;  2D9W A;  2KCJ A;  2KUQ A;  2X18 A;  1MAI A;  2L2I A;  4IOY X;  5DIF B;  2COC A;  1X1F A;  2VSZ A;  2DYN A;  3B77 A;  4MT7 A;  4KAX B;  4IAP A;  1WG7 A;  1I7A A;  4D0N B;  2I1K A;  3TW1 A;  1BAK A;  2CY4 A;  3U12 A;  5I2M A;  1WVH A;  5HE2 A;  1DRO A;  3FEH A;  2D9Z A;  5DHA B;  2RRF A;  2GUM A;  2EMS A;  3G9W A;  2DYQ A;  1W1H A;  2AEH A;  3QIJ A;  3FVC A;  4P7I A;  5J3Y A;  2IYB A;  3TCA A;  1SHC A;  1P3R A;  2MWN B;  4QJ3 B;  2P0F A;  2YS3 A;  4L1R A;  4WSF A;  4GXB A;  2D9X A;  2UVM A;  4HHV A;  4IFS A;  3M1I B;  5JHH A;  1J0W A;  5HE3 A;  5C16 A;  3ML4 A;  1RJ2 A;  2D10 A;  3ODO A;  4A6K A;  1U29 A;  3T06 A;  3TO1 A;  5D27 A;  1OY2 A;  1Y19 B;  2HE7 A;  4TYZ A;  2ELA A;  4A6F B;  4F7U P;  4EJN A;  5EFX A;  1ZSQ A;  2K49 A;  4A6H A;  2J0M A;  3DXC A;  2YRY A;  2Z0O A;  2Z0P A;  1TJ6 A;  3X23 A;  3U8Z A;  1BTN A;  2W2X D;  3RCP A;  2KIE A;  2J59 M;  2COF A;  3GYP A;  4KHB A;  1UNP A;  2Y8G A;  4HAW B;  1M7R A;  1WJM A;  3N7C A;  3SUZ A;  3HSA A;  1V5M A;  2DHI A;  4H8S A;  1DDM A;  2J0K A;  3AJ4 A;  3KSY A;  4ZRK A;  4Z2M B;  4DIX A;  2UZR A;  2OTX A;  4OSN A;  1ZVR A;  1MK7 B;  3NWF A;  2G35 A;  3SNH A;  1ISN A;  5C6R A;  1K5G B;  3A8Q A;  4K2O A;  1AWE A;  5D3W A;  4K81 A; 
#chains in the Genus database with same CATH homology
 4HSI A;  3NWA A;  3FSS A;  3A58 A;  4GOU A;  2Z13 A;  4L1R A;  4QJ3 B;  2K49 A;  2Z14 A;  4D6W A;  1ZYI A;  4KHO A;  4QJ5 B;  4CSQ A;  3TW1 A;  4IFS A;  2FJU B;  4KHB B;  3NW8 A;  4GNK B;  3TVV A;  4PQ0 A;  4Z2M B;  4DIX A;  5I2S A;  4QXA B;  3U12 A;  5I2M A;  4OSN A;  4KHA A;  3HIE A;  2K8E A;  3GYO A;  2GCL A;  2RRF A;  3NWF A;  3TO1 A;  2KUQ A;  2GUM A;  2KR0 A;  5M4Y B;  2NBV A;  2GCJ A;  2YT2 A;  2Z4D A;  5IRS A;  2KIE A;  4QJ4 B;  2Z59 A;  4IOY X;  3GYP A;  4KHB A;  2ZKM X;  5LG4 B;  4OT1 A;  3FVC A;  2KIG A;  4Z2N A;  3OHM B;  3NWD A;  2R2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...