4OSNA

Crystal structure of engineered hcmv glycoprotein b domain ii
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
110
Chain Sequence
NEDLDEGIMVVYKRNGCQLTFWEASERTIRSEAEDSYHFSSAKMTATFLSKKQEVNMSDSALDCVRDEAINKLQQIFNTSYNQTYEKYGNVSVFETTGGLVVFWQGIKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of engineered HCMV glycoprotein B Domain II
rcsb
source organism Human cytomegalovirus
molecule tags Viral protein
molecule keywords Envelope glycoprotein B
total genus 29
structure length 110
sequence length 114
ec nomenclature
pdb deposition date 2014-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17416 Glycoprot_B_PH1 Herpesvirus Glycoprotein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.100 Mainly Beta Roll PH-domain like PH-domain like 4osnA00
4HSIA 3NW8A 3NWAA 4OT1A 3NWFA 4OSNA 3NWDA 2GUMA 4L1RA 3FVCA
chains in the Genus database with same CATH superfamily
1X11A 2KCJA 3D8EA 2W2XC 2I1JA 1PFJA 4A6FB 2ZKMX 2LYDA 2H7EA 1UPRA 2D2QA 3NW8A 3NWAA 1DDVA 3RCPA 2I5CA 5LONB 4NY0A 3F0WA 1UNRA 1XKEA 4KHBA 4CHJA 3HK0A 1ZM0A 2RNRB 4GMXB 2COCA 1WI1A 2Y8FA 3PG7A 2GJYA 3SNHA 1WGUA 4OT1A 2RUKB 4B6HA 2P0HA 1ZSQA 2FJLA 2VRWB 2MWNB 1ZC4B 5D3VA 3PVUA 3SUZA 2RSGA 2DFKA 4QJ3B 4GMVA 4GXBA 2K49A 4C0AA 1ZC3B 4DX90 1XX0A 3TO1A 1P3RA 1U5FA 5JHHA 4MY6A 2Y7BA 4H8SA 2BCJA 4DX8A 2K2JA 2ROZB 2YS5A 3QBVB 5C79A 3DCXA 4L6EA 1DYNA 2AL6A 4HATB 4D6WA 2IYBA 5JLJB 1MK7B 3A98B 2UVMA 3PSCA 3SYXA 2LG1A 4D0NB 1BTNA 2D9XA 2GUMA 2EMSA 4IAPA 2AEHA 2M38A 1WGQA 1NI2A 1OQNA 2K00A 2NMBA 1X05A 5LOPB 2CODA 1EAZA 4HSIA 2I5FA 3WA0A 2D11A 1UNPA 3ZVRA 3DXDA 5FI0A 2D10A 3KRWA 1EGXA 2EJ8A 3FVCA 2D9ZA 2CRFA 3V5WA 2NBVA 4TYZA 4ZRIA 3VOQA 1FAOA 2YSZA 5LG4B 5HE2A 4K17A 4YL8A 3D8DA 5DIFB 1V88A 4L1RA 1PLSA 4PQ0A 4HAYB 1SGHA 3TVVA 3HW2B 2YS3A 4DBBA 1MI1A 3OANA 3HQCA 3FSSA 3NSUA 4GN1A 4CSQA 2UZRA 5C16A 1EF1A 1Y19B 2X18A 3QWMA 5EFXA 3CIKA 3TFMA 5J3TA 1W1HA 1GC7A 2R2YA 2DKPA 3P6AA 4GPTB 2LOXA 1NTYA 4ZRKA 3BINA 3ODXA 1DROA 4OSNA 1IRSA 4K2PA 1FHWA 1ZYIA 3HIEA 1EVHA 5M4YB 2Z0OA 5I2MA 2QKMA 4YONA 1X86A 3M1IB 4BBKA 5L81A 4WSFA 2Z14A 2ELBA 2COAA 3KSYA 2EMTA 3ODOA 4F7GA 1FB8A 5HE0A 1LW3A 1I2HA 1FGZA 1QQGA 4Y94A 5FI1A 1BAKA 3CXBB 4HB0B 5DI9B 4PNKA 3B77A 3ULBA 1MPHA 2CY4A 5JHGA 3X23A 1DDWA 3TW1A 4HB4B 2R0DA 4KHAA 1M7RA 2DX5A 1FGYA 4F7HA 2MKRA 5KQ4A 2YVCA 5C6RA 1U27A 1XODA 4CHMA 2ROVA 4KHBB 2VSZA 4HHVA 3A58A 1U5EA 2R09A 2M14A 2Z0QA 2DHKA 2LOZA 4HDOA 1T77A 2J0KA 2COFA 2ADZA 2KIGA 5JP4A 2P0DA 3PVLA 3NWFA 2I1KA 4MK0A 4HB2B 1X1GA 1M7EA 5CLLB 2W2XD 5DHFB 1AQCA 3PVWA 3ML4A 1DDMA 1GC6A 3KZ1A 2D9WA 2NZ8B 2DTCA 1V5UA 4IOYX 1K5DB 1UEFA 1DBHA 2QKLA 3U8ZA 1UPQA 3DXEA 5D27A 1OY2A 2MDXA 4HAZB 3VIAA 4ZRJA 2G35A 2UZSA 2Z59A 1LB1A 4XWXA 2DHJA 1J19A 2V76A 4TKNA 2YF0A 5D3YA 1J0WA 5DHAB 4KAXB 1K5GB 1PMSA 3BJIA 5J3QA 1I7AA 4KHOA 3TCAA 2Y8GA 1V5PA 1FHXA 4HAVB 5HE3A 2RLOA 1FHOA 1XCGA 4EMOA 2DHIA 2DX1A 5D3WA 3LJUX 2Z13A 5C5BB 3AU4A 4GOUA 1MKEA 1WG7A 3WYFB 1BTKA 2GCJA 4A6FA 2XQNM 1P5TA 2HE7A 1V5MA 3D8FA 1RRPB 4HDQA 1MAIA 2LULA 1UNQA 1MK9B 5DH9B 5IRSA 4DXAB 3ODWA 1H10A 4DIXA 1QC6A 4HB3B 4A6HA 4CYEA 3PEGA 2YT0A 4QJ5B 2K8EA 2ZPYA 1ZVRA 3U7DA 3ZDTA 2OTXA 4Z2MB 2N0YA 2J59M 2RGNB 2D4QA 2J0MA 1BWNA 1TQZA 4K2OA 1H4RA 4GNKB 3A8PA 2YS1A 1WJ1A 1V89A 2EC1A 1MIZB 4MT7A 1Y5OA 3ULCA 1NU2A 2OQBA 5C5BA 1MIXA 1Z87A 2P8VA 1ISNA 5J3YA 3U12A 4K81A 5CLQB 3GYOA 5I2SA 3IVFA 1X1FA 1XD4A 4EKUA 2PZ1A 2FJUB 4QJ4B 2CAYA 2J0JA 5D3XA 1U29A 3F5RA 4A6KA 5KCVA 1V61A 1NTVA 1KZ7A 1KI1B 1U5GA 3NWDA 2Q13A 2KUQA 3DXCA 2Z4DA 2K2UA 2Z0PA 1WJMA 3PP2A 2RVBB 1W1GA 2MFQA 1AWEA 1TXDA 3AJ4A 3MDBC 2L1CA 3A8QA 2DYQA 5GOWB 3OHMB 1GG3A 4GZUA 4EJNA 2DN6A 3KRXA 3HSAA 5HE1A 3FM8C 3KY9A 3SV1A 4NSWA 3T06A 2GS0A 2P0FA 1P6SA 2E2XA 2L2IA 1W1DA 2KR0A 4HAUB 2ELAA 1XR0B 2DYNA 2HTHB 2DLWA 3UZTA 4HAXB 2H7DA 2YT1A 2GCLA 2D9YA 2N23A 1N3HA 4F7UP 3PZDA 2W2WA 2YT2A 2DKQA 2IFSA 4IFSA 1RJ2A 3QIJA 2DA0A 3FEHA 4WVFB 2KGXB 2KUPA 4WJ7A 2D9VA 3P7ZA 2VKIA 4QXAB 1OMWA 1KZGA 1U5DA 3SO6A 1WVHA 2RRFA 3G9WA 2CY5A 3MPXA 5KQ1A 3AU5A 1FOEA 4Z2NA 2YRYA 2KIEA 3GYPA 3N7CA 1TJ6A 1Q67A 1SHCA 4A5KA 1U2BA 2JP2A 3O96A 4P7IA 4KVGB 1E5WA 4HAWB 1B55A 2LKOA
chains in the Genus database with same CATH topology
3TW1A 4HSIA 2RRFA 2GCLA 4GOUA 2Z59A 3FSSA 4KHAA 2KIGA 4OT1A 4CSQA 3NWFA 4QJ5B 2K8EA 3NWDA 2ZKMX 2KUQA 2GCJA 4D6WA 2Z4DA 3FVCA 2Z14A 2YT2A 3U12A 2R2YA 3NW8A 3NWAA 3GYOA 5I2SA 2NBVA 4Z2MB 2GUMA 4IFSA 4KHBB 2KR0A 4Z2NA 5LG4B 3A58A 2KIEA 4QJ3B 4KHBA 2K49A 2FJUB 3GYPA 4OSNA 4QJ4B 4IOYX 5IRSA 4KHOA 3OHMB 4L1RA 3TO1A 1ZYIA 4PQ0A 4GNKB 3TVVA 3HIEA 4QXAB 4DIXA 5M4YB 5I2MA 2Z13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HSI A;  3NW8 A;  3NWA A;  4OT1 A;  3NWF A;  4OSN A;  3NWD A;  2GUM A;  4L1R A;  3FVC A; 
#chains in the Genus database with same CATH topology
 1X11 A;  2KCJ A;  3D8E A;  2W2X C;  2I1J A;  1PFJ A;  4A6F B;  2ZKM X;  2LYD A;  2H7E A;  1UPR A;  2D2Q A;  3NW8 A;  3NWA A;  1DDV A;  3RCP A;  2I5C A;  5LON B;  4NY0 A;  3F0W A;  1UNR A;  1XKE A;  4KHB A;  4CHJ A;  3HK0 A;  1ZM0 A;  2RNR B;  4GMX B;  2COC A;  1WI1 A;  2Y8F A;  3PG7 A;  2GJY A;  3SNH A;  1WGU A;  4OT1 A;  2RUK B;  4B6H A;  2P0H A;  1ZSQ A;  2FJL A;  2VRW B;  2MWN B;  1ZC4 B;  5D3V A;  3PVU A;  3SUZ A;  2RSG A;  2DFK A;  4QJ3 B;  4GMV A;  4GXB A;  2K49 A;  4C0A A;  1ZC3 B;  4DX9 0;  1XX0 A;  3TO1 A;  1P3R A;  1U5F A;  5JHH A;  4MY6 A;  2Y7B A;  4H8S A;  2BCJ A;  4DX8 A;  2K2J A;  2ROZ B;  2YS5 A;  3QBV B;  5C79 A;  3DCX A;  4L6E A;  1DYN A;  2AL6 A;  4HAT B;  4D6W A;  2IYB A;  5JLJ B;  1MK7 B;  3A98 B;  2UVM A;  3PSC A;  3SYX A;  2LG1 A;  4D0N B;  1BTN A;  2D9X A;  2GUM A;  2EMS A;  4IAP A;  2AEH A;  2M38 A;  1WGQ A;  1NI2 A;  1OQN A;  2K00 A;  2NMB A;  1X05 A;  5LOP B;  2COD A;  1EAZ A;  4HSI A;  2I5F A;  3WA0 A;  2D11 A;  1UNP A;  3ZVR A;  3DXD A;  5FI0 A;  2D10 A;  3KRW A;  1EGX A;  2EJ8 A;  3FVC A;  2D9Z A;  2CRF A;  3V5W A;  2NBV A;  4TYZ A;  4ZRI A;  3VOQ A;  1FAO A;  2YSZ A;  5LG4 B;  5HE2 A;  4K17 A;  4YL8 A;  3D8D A;  5DIF B;  1V88 A;  4L1R A;  1PLS A;  4PQ0 A;  4HAY B;  1SGH A;  3TVV A;  3HW2 B;  2YS3 A;  4DBB A;  1MI1 A;  3OAN A;  3HQC A;  3FSS A;  3NSU A;  4GN1 A;  4CSQ A;  2UZR A;  5C16 A;  1EF1 A;  1Y19 B;  2X18 A;  3QWM A;  5EFX A;  3CIK A;  3TFM A;  5J3T A;  1W1H A;  1GC7 A;  2R2Y A;  2DKP A;  3P6A A;  4GPT B;  2LOX A;  1NTY A;  4ZRK A;  3BIN A;  3ODX A;  1DRO A;  4OSN A;  1IRS A;  4K2P A;  1FHW A;  1ZYI A;  3HIE A;  1EVH A;  5M4Y B;  2Z0O A;  5I2M A;  2QKM A;  4YON A;  1X86 A;  3M1I B;  4BBK A;  5L81 A;  4WSF A;  2Z14 A;  2ELB A;  2COA A;  3KSY A;  2EMT A;  3ODO A;  4F7G A;  1FB8 A;  5HE0 A;  1LW3 A;  1I2H A;  1FGZ A;  1QQG A;  4Y94 A;  5FI1 A;  1BAK A;  3CXB B;  4HB0 B;  5DI9 B;  4PNK A;  3B77 A;  3ULB A;  1MPH A;  2CY4 A;  5JHG A;  3X23 A;  1DDW A;  3TW1 A;  4HB4 B;  2R0D A;  4KHA A;  1M7R A;  2DX5 A;  1FGY A;  4F7H A;  2MKR A;  5KQ4 A;  2YVC A;  5C6R A;  1U27 A;  1XOD A;  4CHM A;  2ROV A;  4KHB B;  2VSZ A;  4HHV A;  3A58 A;  1U5E A;  2R09 A;  2M14 A;  2Z0Q A;  2DHK A;  2LOZ A;  4HDO A;  1T77 A;  2J0K A;  2COF A;  2ADZ A;  2KIG A;  5JP4 A;  2P0D A;  3PVL A;  3NWF A;  2I1K A;  4MK0 A;  4HB2 B;  1X1G A;  1M7E A;  5CLL B;  2W2X D;  5DHF B;  1AQC A;  3PVW A;  3ML4 A;  1DDM A;  1GC6 A;  3KZ1 A;  2D9W A;  2NZ8 B;  2DTC A;  1V5U A;  4IOY X;  1K5D B;  1UEF A;  1DBH A;  2QKL A;  3U8Z A;  1UPQ A;  3DXE A;  5D27 A;  1OY2 A;  2MDX A;  4HAZ B;  3VIA A;  4ZRJ A;  2G35 A;  2UZS A;  2Z59 A;  1LB1 A;  4XWX A;  2DHJ A;  1J19 A;  2V76 A;  4TKN A;  2YF0 A;  5D3Y A;  1J0W A;  5DHA B;  4KAX B;  1K5G B;  1PMS A;  3BJI A;  5J3Q A;  1I7A A;  4KHO A;  3TCA A;  2Y8G A;  1V5P A;  1FHX A;  4HAV B;  5HE3 A;  2RLO A;  1FHO A;  1XCG A;  4EMO A;  2DHI A;  2DX1 A;  5D3W A;  3LJU X;  2Z13 A;  5C5B B;  3AU4 A;  4GOU A;  1MKE A;  1WG7 A;  3WYF B;  1BTK A;  2GCJ A;  4A6F A;  2XQN M;  1P5T A;  2HE7 A;  1V5M A;  3D8F A;  1RRP B;  4HDQ A;  1MAI A;  2LUL A;  1UNQ A;  1MK9 B;  5DH9 B;  5IRS A;  4DXA B;  3ODW A;  1H10 A;  4DIX A;  1QC6 A;  4HB3 B;  4A6H A;  4CYE A;  3PEG A;  2YT0 A;  4QJ5 B;  2K8E A;  2ZPY A;  1ZVR A;  3U7D A;  3ZDT A;  2OTX A;  4Z2M B;  2N0Y A;  2J59 M;  2RGN B;  2D4Q A;  2J0M A;  1BWN A;  1TQZ A;  4K2O A;  1H4R A;  4GNK B;  3A8P A;  2YS1 A;  1WJ1 A;  1V89 A;  2EC1 A;  1MIZ B;  4MT7 A;  1Y5O A;  3ULC A;  1NU2 A;  2OQB A;  5C5B A;  1MIX A;  1Z87 A;  2P8V A;  1ISN A;  5J3Y A;  3U12 A;  4K81 A;  5CLQ B;  3GYO A;  5I2S A;  3IVF A;  1X1F A;  1XD4 A;  4EKU A;  2PZ1 A;  2FJU B;  4QJ4 B;  2CAY A;  2J0J A;  5D3X A;  1U29 A;  3F5R A;  4A6K A;  5KCV A;  1V61 A;  1NTV A;  1KZ7 A;  1KI1 B;  1U5G A;  3NWD A;  2Q13 A;  2KUQ A;  3DXC A;  2Z4D A;  2K2U A;  2Z0P A;  1WJM A;  3PP2 A;  2RVB B;  1W1G A;  2MFQ A;  1AWE A;  1TXD A;  3AJ4 A;  3MDB C;  2L1C A;  3A8Q A;  2DYQ A;  5GOW B;  3OHM B;  1GG3 A;  4GZU A;  4EJN A;  2DN6 A;  3KRX A;  3HSA A;  5HE1 A;  3FM8 C;  3KY9 A;  3SV1 A;  4NSW A;  3T06 A;  2GS0 A;  2P0F A;  1P6S A;  2E2X A;  2L2I A;  1W1D A;  2KR0 A;  4HAU B;  2ELA A;  1XR0 B;  2DYN A;  2HTH B;  2DLW A;  3UZT A;  4HAX B;  2H7D A;  2YT1 A;  2GCL A;  2D9Y A;  2N23 A;  1N3H A;  4F7U P;  3PZD A;  2W2W A;  2YT2 A;  2DKQ A;  2IFS A;  4IFS A;  1RJ2 A;  3QIJ A;  2DA0 A;  3FEH A;  4WVF B;  2KGX B;  2KUP A;  4WJ7 A;  2D9V A;  3P7Z A;  2VKI A;  4QXA B;  1OMW A;  1KZG A;  1U5D A;  3SO6 A;  1WVH A;  2RRF A;  3G9W A;  2CY5 A;  3MPX A;  5KQ1 A;  3AU5 A;  1FOE A;  4Z2N A;  2YRY A;  2KIE A;  3GYP A;  3N7C A;  1TJ6 A;  1Q67 A;  1SHC A;  4A5K A;  1U2B A;  2JP2 A;  3O96 A;  4P7I A;  4KVG B;  1E5W A;  4HAW B;  1B55 A;  2LKO A; 
#chains in the Genus database with same CATH homology
 3TW1 A;  4HSI A;  2RRF A;  2GCL A;  4GOU A;  2Z59 A;  3FSS A;  4KHA A;  2KIG A;  4OT1 A;  4CSQ A;  3NWF A;  4QJ5 B;  2K8E A;  3NWD A;  2ZKM X;  2KUQ A;  2GCJ A;  4D6W A;  2Z4D A;  3FVC A;  2Z14 A;  2YT2 A;  3U12 A;  2R2Y A;  3NW8 A;  3NWA A;  3GYO A;  5I2S A;  2NBV A;  4Z2M B;  2GUM A;  4IFS A;  4KHB B;  2KR0 A;  4Z2N A;  5LG4 B;  3A58 A;  2KIE A;  4QJ3 B;  4KHB A;  2K49 A;  2FJU B;  3GYP A;  4OSN A;  4QJ4 B;  4IOY X;  5IRS A;  4KHO A;  3OHM B;  4L1R A;  3TO1 A;  1ZYI A;  4PQ0 A;  4GNK B;  3TVV A;  3HIE A;  4QXA B;  4DIX A;  5M4Y B;  5I2M A;  2Z13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...