4OSNA

Crystal structure of engineered hcmv glycoprotein b domain ii
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
110
Chain Sequence
b'NEDLDEGIMVVYKRNGCQLTFWEASERTIRSEAEDSYHFSSAKMTATFLSKKQEVNMSDSALDCVRDEAINKLQQIFNTSYNQTYEKYGNVSVFETTGGLVVFWQGIKQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Envelope glycoprotein B
publication title Crystal structure of engineered HCMV glycoprotein B Domain II
rcsb
source organism Human cytomegalovirus
molecule tags Viral protein
total genus 29
structure length 110
sequence length 114
ec nomenclature
pdb deposition date 2014-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17416 Glycoprot_B_PH1 Herpesvirus Glycoprotein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.100 Mainly Beta Roll PH-domain like PH-domain like 4osnA00
3FVCA 4L1RA 3NWFA 3NW8A 4OT1A 3NWDA 4HSIA 2GUMA 4OSNA 3NWAA
chains in the Genus database with same CATH superfamily
5J3TA 4GMXB 1GC7A 2YS1A 1U5GA 3VIAA 5KQ4A 3ML4A 5I2SA 3A8PA 3TFMA 2IFSA 4GMVA 2EJ8A 2CY5A 4HB4B 2K49A 1MK7B 3PSCA 2KGXB 4TYZA 2D9VA 4EKUA 3BINA 3SUZA 5C79A 1TJ6A 1M7EA 1TXDA 1W1HA 2KIEA 3PVLA 3P7ZA 1P6SA 3PVUA 1DBHA 1BTNA 3X23A 4CYEA 2Z0QA 1MK9B 3O96A 1V5MA 2RNRB 1WVHA 2RUKB 4A6FB 2Z0OA 1FHXA 1XCGA 2ADZA 2NBVA 2Z59A 5C16A 2I1JA 1K5DB 2MKRA 3AU4A 2ROVA 1ZM0A 2W2XC 2J0JA 4Y94A 2R0DA 1EF1A 2LG1A 2VKIA 2KCJA 4GNKB 1DDVA 3FEHA 2XQNM 5M4YB 2W2XD 2X18A 2DX1A 4DX90 1WGUA 1BAKA 1WJMA 3U12A 3SO6A 2DKPA 2FJUB 3B77A 1I7AA 1EGXA 2AL6A 2Z14A 1IRSA 2OQBA 2COAA 2AEHA 3PZDA 2ZKMX 2D2QA 2UZSA 3AJ4A 3FSSA 3U7DA 2RRFA 1RRPB 5LOPB 4HDQA 2N0YA 1ZYIA 3G9WA 4EJNA 3D8FA 3A8QA 2MWNB 1WI1A 4IOYX 1UNQA 2DFKA 2YS5A 2Z13A 3SYXA 1ISNA 5LONB 2I5CA 2QKLA 1GG3A 3FM8C 2LOZA 3F5RA 2EC1A 2G35A 1MI1A 1NU2A 4QXAB 2UVMA 2D9ZA 1LB1A 3GYOA 3WA0A 2PZ1A 5D3XA 4Z2MB 2DX5A 1ZC3B 2YF0A 1FAOA 1X11A 3V5WA 2YT2A 1FGZA 5C6RA 5LG4B 4D0NB 1XD4A 2LKOA 2LYDA 2J0KA 3LJUX 3U8ZA 2YS3A 2HE7A 4TKNA 1P3RA 5HE0A 1UEFA 4ZRJA 2D11A 1MPHA 4HAWB 3SV1A 2L1CA 1U5EA 2Z4DA 3QWMA 4DX8A 3CIKA 3NWFA 3ULCA 5KQ1A 1H10A 1X05A 5L81A 2P0FA 4K17A 1DDWA 4YL8A 1NTVA 5D27A 1TQZA 5C5BB 2K2JA 1B55A 4OSNA 5GOWB 4F7UP 2E2XA 1LW3A 1UPRA 4ZRKA 4DXAB 3ZDTA 2EMSA 4MY6A 5JLJB 1V61A 3P6AA 1ZSQA 4HB0B 2DHIA 1P5TA 2JP2A 4BBKA 1PLSA 2K00A 3HQCA 3GYPA 2RGNB 3TCAA 4MT7A 3ODWA 4HAXB 2OTXA 4K2PA 5FI1A 2W2WA 2YT0A 1MKEA 3TW1A 1PFJA 2V76A 5FI0A 3NWAA 3KSYA 4EMOA 1OY2A 3D8EA 1AQCA 3BJIA 1U2BA 2DLWA 4HSIA 4A6KA 4Z2NA 2VSZA 2ELAA 3KZ1A 1M7RA 1OQNA 1W1DA 4DIXA 4WJ7A 2GJYA 3HIEA 5JP4A 2GS0A 1NTYA 2RVBB 2I5FA 1MIZB 2DTCA 2D9YA 1J19A 3OHMB 1WG7A 3VOQA 4HAZB 1UPQA 4GN1A 2QKMA 3PEGA 2EMTA 2ROZB 2J0MA 1W1GA 4A6HA 2CY4A 4K81A 3HW2B 1EVHA 2L2IA 1XX0A 5JHHA 3DXCA 2HTHB 4HATB 1AWEA 1V89A 4NSWA 4MK0A 2K8EA 4GPTB 3UZTA 1KZ7A 1U29A 2BCJA 3TO1A 4D6WA 2ELBA 2KR0A 1FOEA 4DBBA 4A5KA 1SGHA 3WYFB 2FJLA 4CHJA 1K5GB 1FB8A 1DROA 3F0WA 4KHBA 4HAVB 3KRWA 3PP2A 1H4RA 4KHAA 5JHGA 3MDBC 1XR0B 1KZGA 2D9WA 2NMBA 3QBVB 1RJ2A 1U5DA 2D10A 1V88A 3A58A 5CLLB 4IFSA 2YRYA 2DA0A 1V5PA 1FHOA 1QQGA 3T06A 2H7EA 5DIFB 2K2UA 2M38A 2COCA 2D4QA 1ZVRA 2RSGA 1FGYA 2YVCA 1X1GA 1XKEA 5D3YA 4WVFB 2ZPYA 3KRXA 1GC6A 2CRFA 4QJ3B 5EFXA 2DHJA 4OT1A 5I2MA 1DDMA 4F7GA 4GOUA 2CAYA 3KY9A 1DYNA 2IYBA 4B6HA 4ZRIA 5IRSA 4H8SA 4HAYB 4PQ0A 3PVWA 2LOXA 4KVGB 2Y8FA 3NWDA 1XODA 3QIJA 1QC6A 2YT1A 3FVCA 4L1RA 3NW8A 1NI2A 1X1FA 2KUQA 4HHVA 1T77A 1U27A 1V5UA 3DXDA 2Y7BA 3M1IB 2M14A 1Q67A 1I2HA 3PG7A 5C5BA 4F7HA 4CSQA 4QJ5B 4WSFA 2I1KA 1Y19B 2GCLA 4L6EA 2P0DA 4P7IA 3CXBB 2YSZA 2UZRA 5KCVA 1WGQA 4K2OA 4HDOA 4A6FA 1BTKA 1SHCA 2H7DA 2GUMA 2RLOA 1OMWA 2DYQA 4KAXB 5HE3A 5DH9B 2LULA 3D8DA 1U5FA 2R2YA 5DI9B 5D3WA 2CODA 4KHOA 5DHFB 5HE2A 4IAPA 2DN6A 2DHKA 5J3YA 2Q13A 3DCXA 2DYNA 1UNPA 3ZVRA 3MPXA 2D9XA 1UNRA 4YONA 4PNKA 2DKQA 1MAIA 1N3HA 2Y8GA 1KI1B 3RCPA 5CLQB 4CHMA 1J0WA 3TVVA 4HB2B 5D3VA 3NSUA 1X86A 2P0HA 1BWNA 4NY0A 3HSAA 3HK0A 2J59M 4QJ4B 2N23A 4C0AA 2Z0PA 2GCJA 3ODXA 4GXBA 1Y5OA 3IVFA 1FHWA 1EAZA 3A98B 1Z87A 3SNHA 2KUPA 4HB3B 5J3QA 2KIGA 3AU5A 4KHBB 2MDXA 3DXEA 1ZC4B 4HAUB 1E5WA 2MFQA 3N7CA 4GZUA 3ODOA 2P8VA 3OANA 1WJ1A 5DHAB 3ULBA 2R09A 4XWXA 1MIXA 1PMSA 2VRWB 5HE1A 2NZ8B 2COFA
chains in the Genus database with same CATH topology
4QJ3B 2Z14A 4KHBA 3HIEA 4OT1A 3GYPA 5I2MA 4KHAA 2YT2A 2KIGA 4KHBB 2ZKMX 4GOUA 5LG4B 2R2YA 4DIXA 4CSQA 4QJ5B 5IRSA 3FSSA 4KHOA 2RRFA 3A58A 4PQ0A 3TW1A 2K8EA 4GNKB 4IFSA 4QXAB 4OSNA 2KIEA 3TVVA 3NWAA 3TO1A 4D6WA 2GCLA 5M4YB 5I2SA 1ZYIA 2KR0A 3NWDA 2Z4DA 3GYOA 3OHMB 4HSIA 4QJ4B 4Z2NA 4IOYX 2K49A 3FVCA 4L1RA 3U12A 3NWFA 2GCJA 3NW8A 2FJUB 2KUQA 2Z13A 2GUMA 4Z2MB 2NBVA 2Z59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FVC A;  4L1R A;  3NWF A;  3NW8 A;  4OT1 A;  3NWD A;  4HSI A;  2GUM A;  4OSN A;  3NWA A; 
#chains in the Genus database with same CATH topology
 5J3T A;  4GMX B;  1GC7 A;  2YS1 A;  1U5G A;  3VIA A;  5KQ4 A;  3ML4 A;  5I2S A;  3A8P A;  3TFM A;  2IFS A;  4GMV A;  2EJ8 A;  2CY5 A;  4HB4 B;  2K49 A;  1MK7 B;  3PSC A;  2KGX B;  4TYZ A;  2D9V A;  4EKU A;  3BIN A;  3SUZ A;  5C79 A;  1TJ6 A;  1M7E A;  1TXD A;  1W1H A;  2KIE A;  3PVL A;  3P7Z A;  1P6S A;  3PVU A;  1DBH A;  1BTN A;  3X23 A;  4CYE A;  2Z0Q A;  1MK9 B;  3O96 A;  1V5M A;  2RNR B;  1WVH A;  2RUK B;  4A6F B;  2Z0O A;  1FHX A;  1XCG A;  2ADZ A;  2NBV A;  2Z59 A;  5C16 A;  2I1J A;  1K5D B;  2MKR A;  3AU4 A;  2ROV A;  1ZM0 A;  2W2X C;  2J0J A;  4Y94 A;  2R0D A;  1EF1 A;  2LG1 A;  2VKI A;  2KCJ A;  4GNK B;  1DDV A;  3FEH A;  2XQN M;  5M4Y B;  2W2X D;  2X18 A;  2DX1 A;  4DX9 0;  1WGU A;  1BAK A;  1WJM A;  3U12 A;  3SO6 A;  2DKP A;  2FJU B;  3B77 A;  1I7A A;  1EGX A;  2AL6 A;  2Z14 A;  1IRS A;  2OQB A;  2COA A;  2AEH A;  3PZD A;  2ZKM X;  2D2Q A;  2UZS A;  3AJ4 A;  3FSS A;  3U7D A;  2RRF A;  1RRP B;  5LOP B;  4HDQ A;  2N0Y A;  1ZYI A;  3G9W A;  4EJN A;  3D8F A;  3A8Q A;  2MWN B;  1WI1 A;  4IOY X;  1UNQ A;  2DFK A;  2YS5 A;  2Z13 A;  3SYX A;  1ISN A;  5LON B;  2I5C A;  2QKL A;  1GG3 A;  3FM8 C;  2LOZ A;  3F5R A;  2EC1 A;  2G35 A;  1MI1 A;  1NU2 A;  4QXA B;  2UVM A;  2D9Z A;  1LB1 A;  3GYO A;  3WA0 A;  2PZ1 A;  5D3X A;  4Z2M B;  2DX5 A;  1ZC3 B;  2YF0 A;  1FAO A;  1X11 A;  3V5W A;  2YT2 A;  1FGZ A;  5C6R A;  5LG4 B;  4D0N B;  1XD4 A;  2LKO A;  2LYD A;  2J0K A;  3LJU X;  3U8Z A;  2YS3 A;  2HE7 A;  4TKN A;  1P3R A;  5HE0 A;  1UEF A;  4ZRJ A;  2D11 A;  1MPH A;  4HAW B;  3SV1 A;  2L1C A;  1U5E A;  2Z4D A;  3QWM A;  4DX8 A;  3CIK A;  3NWF A;  3ULC A;  5KQ1 A;  1H10 A;  1X05 A;  5L81 A;  2P0F A;  4K17 A;  1DDW A;  4YL8 A;  1NTV A;  5D27 A;  1TQZ A;  5C5B B;  2K2J A;  1B55 A;  4OSN A;  5GOW B;  4F7U P;  2E2X A;  1LW3 A;  1UPR A;  4ZRK A;  4DXA B;  3ZDT A;  2EMS A;  4MY6 A;  5JLJ B;  1V61 A;  3P6A A;  1ZSQ A;  4HB0 B;  2DHI A;  1P5T A;  2JP2 A;  4BBK A;  1PLS A;  2K00 A;  3HQC A;  3GYP A;  2RGN B;  3TCA A;  4MT7 A;  3ODW A;  4HAX B;  2OTX A;  4K2P A;  5FI1 A;  2W2W A;  2YT0 A;  1MKE A;  3TW1 A;  1PFJ A;  2V76 A;  5FI0 A;  3NWA A;  3KSY A;  4EMO A;  1OY2 A;  3D8E A;  1AQC A;  3BJI A;  1U2B A;  2DLW A;  4HSI A;  4A6K A;  4Z2N A;  2VSZ A;  2ELA A;  3KZ1 A;  1M7R A;  1OQN A;  1W1D A;  4DIX A;  4WJ7 A;  2GJY A;  3HIE A;  5JP4 A;  2GS0 A;  1NTY A;  2RVB B;  2I5F A;  1MIZ B;  2DTC A;  2D9Y A;  1J19 A;  3OHM B;  1WG7 A;  3VOQ A;  4HAZ B;  1UPQ A;  4GN1 A;  2QKM A;  3PEG A;  2EMT A;  2ROZ B;  2J0M A;  1W1G A;  4A6H A;  2CY4 A;  4K81 A;  3HW2 B;  1EVH A;  2L2I A;  1XX0 A;  5JHH A;  3DXC A;  2HTH B;  4HAT B;  1AWE A;  1V89 A;  4NSW A;  4MK0 A;  2K8E A;  4GPT B;  3UZT A;  1KZ7 A;  1U29 A;  2BCJ A;  3TO1 A;  4D6W A;  2ELB A;  2KR0 A;  1FOE A;  4DBB A;  4A5K A;  1SGH A;  3WYF B;  2FJL A;  4CHJ A;  1K5G B;  1FB8 A;  1DRO A;  3F0W A;  4KHB A;  4HAV B;  3KRW A;  3PP2 A;  1H4R A;  4KHA A;  5JHG A;  3MDB C;  1XR0 B;  1KZG A;  2D9W A;  2NMB A;  3QBV B;  1RJ2 A;  1U5D A;  2D10 A;  1V88 A;  3A58 A;  5CLL B;  4IFS A;  2YRY A;  2DA0 A;  1V5P A;  1FHO A;  1QQG A;  3T06 A;  2H7E A;  5DIF B;  2K2U A;  2M38 A;  2COC A;  2D4Q A;  1ZVR A;  2RSG A;  1FGY A;  2YVC A;  1X1G A;  1XKE A;  5D3Y A;  4WVF B;  2ZPY A;  3KRX A;  1GC6 A;  2CRF A;  4QJ3 B;  5EFX A;  2DHJ A;  4OT1 A;  5I2M A;  1DDM A;  4F7G A;  4GOU A;  2CAY A;  3KY9 A;  1DYN A;  2IYB A;  4B6H A;  4ZRI A;  5IRS A;  4H8S A;  4HAY B;  4PQ0 A;  3PVW A;  2LOX A;  4KVG B;  2Y8F A;  3NWD A;  1XOD A;  3QIJ A;  1QC6 A;  2YT1 A;  3FVC A;  4L1R A;  3NW8 A;  1NI2 A;  1X1F A;  2KUQ A;  4HHV A;  1T77 A;  1U27 A;  1V5U A;  3DXD A;  2Y7B A;  3M1I B;  2M14 A;  1Q67 A;  1I2H A;  3PG7 A;  5C5B A;  4F7H A;  4CSQ A;  4QJ5 B;  4WSF A;  2I1K A;  1Y19 B;  2GCL A;  4L6E A;  2P0D A;  4P7I A;  3CXB B;  2YSZ A;  2UZR A;  5KCV A;  1WGQ A;  4K2O A;  4HDO A;  4A6F A;  1BTK A;  1SHC A;  2H7D A;  2GUM A;  2RLO A;  1OMW A;  2DYQ A;  4KAX B;  5HE3 A;  5DH9 B;  2LUL A;  3D8D A;  1U5F A;  2R2Y A;  5DI9 B;  5D3W A;  2COD A;  4KHO A;  5DHF B;  5HE2 A;  4IAP A;  2DN6 A;  2DHK A;  5J3Y A;  2Q13 A;  3DCX A;  2DYN A;  1UNP A;  3ZVR A;  3MPX A;  2D9X A;  1UNR A;  4YON A;  4PNK A;  2DKQ A;  1MAI A;  1N3H A;  2Y8G A;  1KI1 B;  3RCP A;  5CLQ B;  4CHM A;  1J0W A;  3TVV A;  4HB2 B;  5D3V A;  3NSU A;  1X86 A;  2P0H A;  1BWN A;  4NY0 A;  3HSA A;  3HK0 A;  2J59 M;  4QJ4 B;  2N23 A;  4C0A A;  2Z0P A;  2GCJ A;  3ODX A;  4GXB A;  1Y5O A;  3IVF A;  1FHW A;  1EAZ A;  3A98 B;  1Z87 A;  3SNH A;  2KUP A;  4HB3 B;  5J3Q A;  2KIG A;  3AU5 A;  4KHB B;  2MDX A;  3DXE A;  1ZC4 B;  4HAU B;  1E5W A;  2MFQ A;  3N7C A;  4GZU A;  3ODO A;  2P8V A;  3OAN A;  1WJ1 A;  5DHA B;  3ULB A;  2R09 A;  4XWX A;  1MIX A;  1PMS A;  2VRW B;  5HE1 A;  2NZ8 B;  2COF A; 
#chains in the Genus database with same CATH homology
 4QJ3 B;  2Z14 A;  4KHB A;  3HIE A;  4OT1 A;  3GYP A;  5I2M A;  4KHA A;  2YT2 A;  2KIG A;  4KHB B;  2ZKM X;  4GOU A;  5LG4 B;  2R2Y A;  4DIX A;  4CSQ A;  4QJ5 B;  5IRS A;  3FSS A;  4KHO A;  2RRF A;  3A58 A;  4PQ0 A;  3TW1 A;  2K8E A;  4GNK B;  4IFS A;  4QXA B;  4OSN A;  2KIE A;  3TVV A;  3NWA A;  3TO1 A;  4D6W A;  2GCL A;  5M4Y B;  5I2S A;  1ZYI A;  2KR0 A;  3NWD A;  2Z4D A;  3GYO A;  3OHM B;  4HSI A;  4QJ4 B;  4Z2N A;  4IOY X;  2K49 A;  3FVC A;  4L1R A;  3U12 A;  3NWF A;  2GCJ A;  3NW8 A;  2FJU B;  2KUQ A;  2Z13 A;  2GUM A;  4Z2M B;  2NBV A;  2Z59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...