3ML4A

Crystal structure of a complex between dok7 ph-ptb and the musk juxtamembrane region
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
208
structure length
205
Chain Sequence
EAALVEGQVKLRKWKSRWLVLRKPSPVADCLLMLVYKDKCERSKGLRERSSLTLEDICGLEPALPYEGLAHTLAIICLSQAVMLGFDSHEAMCAWDTRIRYALGEVHRFHVTVAPGTKLESGPATLHLCNDILVLARDIPPTVMGQWKLSDLRRYGAVPNGFIFEGGTRCGYWAGVFFLSSAEGEQMSFLFDCIVRGISPTKGPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Protein Dok-7
publication title The Cytoplasmic Adaptor Protein Dok7 Activates the Receptor Tyrosine Kinase MuSK via Dimerization.
pubmed doi rcsb
source organism Mus musculus
total genus 41
structure length 205
sequence length 208
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02174 IRS PTB domain (IRS-1 type)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3ml4A01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3ml4A02
1NI2A 4WJ7A 3PVWA 5DHFB 1FGYA 3TVVA 2DFKA 3NSUA 2EC1A 2DX1A 4TYZA 1U2BA 2CY4A 1PFJA 5KQ1A 3F5RA 1Y19B 1UNQA 5FI0A 1U5DA 4GXBA 1ZSQA 2YVCA 3A8PA 1U5FA 3GYPA 1WVHA 3HK0A 3WA0A 3KZ1A 3T06A 4K81A 2YT0A 3CIKA 1MK9B 4NY0A 2L2IA 1OY2A 1MIZB 1U27A 1NTYA 4KVGB 2CAYA 2OTXA 3UZTA 2DYQA 4MT7A 4MY6A 5D27A 3ULBA 1UNRA 2CY5A 4L6EA 4ZRKA 1Y5OA 1EVHA 3SYXA 2P0FA 1WGQA 1V5UA 4DBBA 4A6FA 5J3YA 1XX0A 1UEFA 2W2XD 4K17A 1XR0B 3CXBB 3SUZA 4GZUA 2FJLA 2YSZA 1BTKA 3TCAA 2PZ1A 2D4QA 3FM8C 2YS5A 1NU2A 2DTCA 2N23A 1DDVA 1OQNA 2D9VA 2I5CA 2M14A 2UVMA 1LB1A 2YS1A 1U29A 3DXDA 2UZSA 2YT1A 3ZVRA 4K2PA 4KHAA 1KZGA 1W1DA 3ODXA 2KUPA 2X18A 2LKOA 5JP4A 2DKPA 2Q13A 4MK0A 5J3QA 4YONA 1P6SA 2ROVA 3V5WA 4IOYX 2ELBA 2Z0PA 1SGHA 3BINA 3F0WA 1PMSA 3VIAA 5HE0A 2GJYA 3DXCA 2MKRA 1Q67A 4D0NB 1FHXA 2GS0A 2D9ZA 1XD4A 2DKQA 4F7UP 1V88A 2P0DA 5D3VA 2W2XC 1XCGA 4C0AA 4XWXA 2EJ8A 3KRXA 2ELAA 1RJ2A 2QKMA 1MK7B 5LOPB 4Z2NA 4HB4B 1KZ7A 2DHKA 3DXEA 1W1GA 1X05A 3D8DA 3D8FA 4CHMA 1J19A 5JLJB 4HB3B 2D10A 3PVUA 5C6RA 3P7ZA 3ODOA 2DHJA 3GYOA 4F7GA 4HAWB 3RCPA 5L81A 2DA0A 1M7RA 1TXDA 1M7EA 4DX90 2Y8FA 5HE1A 2NMBA 2RGNB 3A98B 2D9WA 2EMSA 2GCLA 4GN1A 4HATB 2R09A 4A5KA 2J0JA 2DN6A 5C5BA 2MFQA 3PSCA 2UZRA 2N0YA 1EAZA 2ZPYA 4HAZB 2COCA 5LONB 2IYBA 3D8EA 2QKLA 2P8VA 3QBVB 4HHVA 4K2OA 2KGXB 3ODWA 3X23A 4DX8A 1DROA 2Y8GA 1MPHA 1OMWA 1Z87A 1ZC3B 3U7DA 3PG7A 1FGZA 5CLQB 3PEGA 2HE7A 2XQNM 3U8ZA 1K5DB 5D3WA 5GOWB 2COAA 1TJ6A 1IRSA 3LJUX 4TKNA 2ROZB 2VRWB 2AL6A 2BCJA 4F7HA 3PP2A 2D2QA 2D9XA 1WJMA 2DX5A 4P7IA 1ZVRA 3KRWA 2I1JA 4Z2MB 3MPXA 4CHJA 5KCVA 1N3HA 2RUKB 2COFA 2RSGA 3P6AA 5D3XA 2J0KA 2AEHA 2K2UA 1DDMA 1V61A 1TQZA 2VSZA 1UNPA 1X11A 3PVLA 3IVFA 5DIFB 1U5EA 1KI1B 2D9YA 4A6KA 4WSFA 1WGUA 2LULA 1P5TA 2I5FA 1B55A 2Z0QA 3QWMA 1ZC4B 2OQBA 4GMVA 3ZDTA 2L1CA 5JHGA 3A8QA 4ZRJA 2P0HA 3SO6A 1X86A 2YRYA 4ZRIA 3HW2B 4HAUB 1WI1A 2RLOA 2MDXA 2VKIA 2RVBB 2Z0OA 3FSSA 4A6FB 3PZDA 1I7AA 3KY9A 2K2JA 4GPTB 2V76A 1MKEA 2DHIA 4HAYB 5CLLB 2W2WA 1GC7A 5DH9B 4YL8A 1BAKA 3OANA 4B6HA 3KSYA 4EMOA 1I2HA 1FHWA 2IFSA 5HE2A 3AJ4A 3AU5A 3MDBC 1E5WA 1EGXA 2M38A 3N7CA 4Y94A 3TFMA 3TW1A 2EMTA 4A6HA 3ML4A 4HDOA 2JP2A 4PQ0A 3BJIA 4IAPA 1GC6A 4EKUA 3HQCA 4GMXB 2K00A 4HAXB 3ULCA 1X1GA 1DYNA 5DHAB 2D11A 1H10A 1NTVA 3FEHA 1V5MA 2LYDA 2CODA 3VOQA 2KCJA 4HDQA 4PNKA 1FOEA 1FHOA 1UPQA 1RRPB 1LW3A 2H7EA 1QC6A 2E2XA 2Y7BA 2HTHB 4H8SA 4EJNA 1MAIA 1V5PA 1P3RA 4HB0B 5FI1A 1ZM0A 1FAOA 2LG1A 2YF0A 2MWNB 1X1FA 5D3YA 1WG7A 2DYNA 4KAXB 5JHHA 5J3TA 1FB8A 1W1HA 1DBHA 2RNRB 1BTNA 1PLSA 1WJ1A 2ADZA 2DLWA 2H7DA 4BBKA 4CYEA 1K5GB 5DI9B 2CRFA 3M1IB 1MIXA 3WYFB 1BWNA 5EFXA 4DXAB 4HAVB 4WVFB 2R0DA 1UPRA 1AWEA 1J0WA 1H4RA 1GG3A 1V89A 1DDWA 4KHBB 1ISNA 5C5BB 2NZ8B 2I1KA 4NSWA 4KHOA 5C79A 5HE3A 3G9WA 2J59M 3QIJA 5KQ4A 3AU4A 1SHCA 4IFSA 3SV1A 1XODA 1EF1A 3TO1A 1XKEA 2J0MA 5C16A 2G35A 3SNHA 1U5GA 1QQGA 2LOZA 4HB2B 3O96A 2YS3A 2GCJA 2LOXA 1AQCA
chains in the Genus database with same CATH superfamily
1NI2A 4WJ7A 3PVWA 5DHFB 1FGYA 3TVVA 2DFKA 3NSUA 2EC1A 2DX1A 4TYZA 1U2BA 2CY4A 1PFJA 5KQ1A 3F5RA 1Y19B 1UNQA 5FI0A 1U5DA 4GXBA 1ZSQA 2YVCA 3A8PA 1U5FA 3GYPA 1WVHA 3HK0A 3WA0A 5I2MA 3KZ1A 3T06A 2Z4DA 3A58A 4K81A 2YT0A 3CIKA 1MK9B 2GUMA 4NY0A 2L2IA 1OY2A 1MIZB 1U27A 1NTYA 4KVGB 2CAYA 2OTXA 3UZTA 4QJ4B 2DYQA 4MT7A 4MY6A 5D27A 3ULBA 1UNRA 2CY5A 4L6EA 4ZRKA 5LG4B 1Y5OA 1EVHA 3SYXA 2P0FA 1WGQA 1V5UA 4DBBA 4A6FA 5J3YA 1XX0A 1UEFA 3NWDA 2W2XD 4K17A 1XR0B 3CXBB 3SUZA 4GZUA 4GOUA 2FJLA 2YSZA 1BTKA 3TCAA 2PZ1A 2D4QA 3FM8C 2YS5A 1NU2A 2DTCA 2N23A 1DDVA 1OQNA 2D9VA 2I5CA 2M14A 2UVMA 1LB1A 2YS1A 1U29A 3DXDA 2UZSA 2YT1A 3ZVRA 4K2PA 2K8EA 4KHAA 1KZGA 1W1DA 3ODXA 2KUPA 2X18A 2LKOA 3U12A 5JP4A 2DKPA 2Q13A 4MK0A 5J3QA 4YONA 1P6SA 2ROVA 3V5WA 4IOYX 2ELBA 2Z0PA 1SGHA 3BINA 3F0WA 1PMSA 3VIAA 5HE0A 2GJYA 3DXCA 2MKRA 3FVCA 1Q67A 4D0NB 1FHXA 2GS0A 2D9ZA 1XD4A 2DKQA 4F7UP 1V88A 2P0DA 4QJ3B 3DCXA 5D3VA 2W2XC 1XCGA 4C0AA 4XWXA 2EJ8A 3KRXA 2KR0A 2ELAA 1RJ2A 2QKMA 1MK7B 5LOPB 4Z2NA 4HB4B 4OSNA 1KZ7A 4DIXA 2DHKA 3DXEA 1W1GA 1X05A 3D8DA 3D8FA 4CHMA 1J19A 5JLJB 4HB3B 2D10A 3PVUA 5C6RA 3P7ZA 3ODOA 2DHJA 3GYOA 4F7GA 4HAWB 3RCPA 5L81A 2DA0A 1M7RA 1TXDA 4CSQA 1M7EA 4DX90 2Y8FA 5HE1A 2NMBA 2RGNB 3A98B 2D9WA 2EMSA 2GCLA 4GN1A 4HATB 2R09A 4A5KA 4KHBA 2J0JA 4QJ5B 2DN6A 5C5BA 2MFQA 3PSCA 4GNKB 2UZRA 2N0YA 1EAZA 2ZPYA 2KIGA 4HAZB 2COCA 5LONB 2IYBA 3D8EA 2QKLA 2P8VA 3QBVB 4HHVA 4K2OA 2KGXB 3ODWA 3X23A 4DX8A 1DROA 2Y8GA 1MPHA 1OMWA 1Z87A 1ZC3B 3U7DA 3PG7A 1FGZA 5CLQB 3PEGA 2HE7A 2XQNM 3U8ZA 1K5DB 5D3WA 5GOWB 2COAA 1TJ6A 1IRSA 3LJUX 4TKNA 1ZYIA 2ROZB 2VRWB 2AL6A 2BCJA 4F7HA 3PP2A 5IRSA 2D2QA 2D9XA 1WJMA 2DX5A 4P7IA 1ZVRA 3KRWA 2I1JA 4HSIA 4Z2MB 3MPXA 4CHJA 5KCVA 1N3HA 2RRFA 2RUKB 2COFA 2RSGA 3P6AA 5D3XA 2J0KA 2AEHA 2K2UA 1DDMA 1V61A 1TQZA 2VSZA 1UNPA 1X11A 3PVLA 3IVFA 5DIFB 1U5EA 1KI1B 2D9YA 4A6KA 4WSFA 1WGUA 5I2SA 2LULA 1P5TA 2I5FA 1B55A 2Z0QA 3QWMA 1ZC4B 2OQBA 4GMVA 3ZDTA 2L1CA 5JHGA 3A8QA 4ZRJA 2P0HA 3SO6A 1X86A 2YRYA 4ZRIA 3HW2B 4HAUB 1WI1A 2RLOA 2MDXA 2VKIA 2RVBB 2Z0OA 3FSSA 4A6FB 3PZDA 1I7AA 3KY9A 2K2JA 4GPTB 2V76A 1MKEA 2DHIA 1MI1A 4HAYB 2R2YA 5CLLB 4D6WA 2W2WA 1GC7A 5DH9B 3HIEA 4YL8A 4OT1A 3NWAA 1BAKA 3OANA 4B6HA 4QXAB 3KSYA 2K49A 4EMOA 1I2HA 1FHWA 2IFSA 5HE2A 3AJ4A 1T77A 3AU5A 3MDBC 1E5WA 1EGXA 2M38A 3N7CA 3NW8A 4Y94A 3TFMA 3TW1A 2EMTA 2ZKMX 4A6HA 2KIEA 3ML4A 4HDOA 2JP2A 4PQ0A 2NBVA 3BJIA 4IAPA 1GC6A 4EKUA 3HQCA 4GMXB 2K00A 4HAXB 3ULCA 1X1GA 3OHMB 1DYNA 5DHAB 2D11A 1H10A 1NTVA 3FEHA 1V5MA 2LYDA 2CODA 3VOQA 2KCJA 4HDQA 4PNKA 1FOEA 1FHOA 1UPQA 1RRPB 1LW3A 2H7EA 1QC6A 2E2XA 2Y7BA 2HTHB 4H8SA 4EJNA 1MAIA 1V5PA 1P3RA 3B77A 2Z14A 4HB0B 5FI1A 1ZM0A 1FAOA 2LG1A 2YF0A 2MWNB 1X1FA 5D3YA 1WG7A 2Z13A 2DYNA 4KAXB 5JHHA 5J3TA 1FB8A 1W1HA 1DBHA 2RNRB 1BTNA 1PLSA 1WJ1A 2KUQA 2ADZA 2DLWA 2H7DA 4BBKA 4CYEA 1K5GB 5DI9B 2CRFA 3M1IB 1MIXA 3WYFB 1BWNA 5EFXA 2YT2A 3HSAA 4HAVB 2R0DA 4WVFB 4DXAB 5M4YB 1UPRA 1AWEA 1J0WA 1H4RA 1GG3A 1V89A 1DDWA 4KHBB 4L1RA 1ISNA 5C5BB 2NZ8B 2I1KA 4NSWA 4KHOA 5C79A 5HE3A 3G9WA 2J59M 3QIJA 5KQ4A 3AU4A 1SHCA 4IFSA 3SV1A 1XODA 1EF1A 2FJUB 3TO1A 2Z59A 1XKEA 2J0MA 5C16A 2G35A 3SNHA 1U5GA 1QQGA 2LOZA 4HB2B 3O96A 3NWFA 2YS3A 2GCJA 2LOXA 1AQCA
chains in the Genus database with same CATH topology
1NI2A 4WJ7A 3PVWA 5DHFB 1FGYA 3TVVA 2DFKA 3NSUA 2EC1A 2DX1A 4TYZA 1U2BA 2CY4A 1PFJA 5KQ1A 3F5RA 1Y19B 1UNQA 5FI0A 1U5DA 4GXBA 1ZSQA 2YVCA 3A8PA 1U5FA 3GYPA 1WVHA 3HK0A 3WA0A 3KZ1A 3T06A 4K81A 2YT0A 3CIKA 1MK9B 4NY0A 2L2IA 1OY2A 1MIZB 1U27A 1NTYA 4KVGB 2CAYA 2OTXA 3UZTA 2DYQA 4MT7A 4MY6A 5D27A 3ULBA 1UNRA 2CY5A 4L6EA 4ZRKA 1Y5OA 1EVHA 3SYXA 2P0FA 1WGQA 1V5UA 4DBBA 4A6FA 5J3YA 1XX0A 1UEFA 2W2XD 4K17A 1XR0B 3CXBB 3SUZA 4GZUA 2FJLA 2YSZA 1BTKA 3TCAA 2PZ1A 2D4QA 3FM8C 2YS5A 1NU2A 2DTCA 2N23A 1DDVA 1OQNA 2D9VA 2I5CA 2M14A 2UVMA 1LB1A 2YS1A 1U29A 3DXDA 2UZSA 2YT1A 3ZVRA 4K2PA 4KHAA 1KZGA 1W1DA 3ODXA 2KUPA 2X18A 2LKOA 5JP4A 2DKPA 2Q13A 4MK0A 5J3QA 4YONA 1P6SA 2ROVA 3V5WA 4IOYX 2ELBA 2Z0PA 1SGHA 3BINA 3F0WA 1PMSA 3VIAA 5HE0A 2GJYA 3DXCA 2MKRA 1Q67A 4D0NB 1FHXA 2GS0A 2D9ZA 1XD4A 2DKQA 4F7UP 1V88A 2P0DA 5D3VA 2W2XC 1XCGA 4C0AA 4XWXA 2EJ8A 3KRXA 2ELAA 1RJ2A 2QKMA 1MK7B 5LOPB 4Z2NA 4HB4B 1KZ7A 2DHKA 3DXEA 1W1GA 1X05A 3D8DA 3D8FA 4CHMA 1J19A 5JLJB 4HB3B 2D10A 3PVUA 5C6RA 3P7ZA 3ODOA 2DHJA 3GYOA 4F7GA 4HAWB 3RCPA 5L81A 2DA0A 1M7RA 1TXDA 1M7EA 4DX90 2Y8FA 5HE1A 2NMBA 2RGNB 3A98B 2D9WA 2EMSA 2GCLA 4GN1A 4HATB 2R09A 4A5KA 2J0JA 2DN6A 5C5BA 2MFQA 3PSCA 2UZRA 2N0YA 1EAZA 2ZPYA 4HAZB 2COCA 5LONB 2IYBA 3D8EA 2QKLA 2P8VA 3QBVB 4HHVA 4K2OA 2KGXB 3ODWA 3X23A 4DX8A 1DROA 2Y8GA 1MPHA 1OMWA 1Z87A 1ZC3B 3U7DA 3PG7A 1FGZA 5CLQB 3PEGA 2HE7A 2XQNM 3U8ZA 1K5DB 5D3WA 5GOWB 2COAA 1TJ6A 1IRSA 3LJUX 4TKNA 2ROZB 2VRWB 2AL6A 2BCJA 4F7HA 3PP2A 2D2QA 2D9XA 1WJMA 2DX5A 4P7IA 1ZVRA 3KRWA 2I1JA 4Z2MB 3MPXA 4CHJA 5KCVA 1N3HA 2RUKB 2COFA 2RSGA 3P6AA 5D3XA 2J0KA 2AEHA 2K2UA 1DDMA 1V61A 1TQZA 2VSZA 1UNPA 1X11A 3PVLA 3IVFA 5DIFB 1U5EA 1KI1B 2D9YA 4A6KA 4WSFA 1WGUA 2LULA 1P5TA 2I5FA 1B55A 2Z0QA 3QWMA 1ZC4B 2OQBA 4GMVA 3ZDTA 2L1CA 5JHGA 3A8QA 4ZRJA 2P0HA 3SO6A 1X86A 2YRYA 4ZRIA 3HW2B 4HAUB 1WI1A 2RLOA 2MDXA 2VKIA 2RVBB 2Z0OA 3FSSA 4A6FB 3PZDA 1I7AA 3KY9A 2K2JA 4GPTB 2V76A 1MKEA 2DHIA 4HAYB 5CLLB 2W2WA 1GC7A 5DH9B 4YL8A 1BAKA 3OANA 4B6HA 3KSYA 4EMOA 1I2HA 1FHWA 2IFSA 5HE2A 3AJ4A 3AU5A 3MDBC 1E5WA 1EGXA 2M38A 3N7CA 4Y94A 3TFMA 3TW1A 2EMTA 4A6HA 3ML4A 4HDOA 2JP2A 4PQ0A 3BJIA 4IAPA 1GC6A 4EKUA 3HQCA 4GMXB 2K00A 4HAXB 3ULCA 1X1GA 1DYNA 5DHAB 2D11A 1H10A 1NTVA 3FEHA 1V5MA 2LYDA 2CODA 3VOQA 2KCJA 4HDQA 4PNKA 1FOEA 1FHOA 1UPQA 1RRPB 1LW3A 2H7EA 1QC6A 2E2XA 2Y7BA 2HTHB 4H8SA 4EJNA 1MAIA 1V5PA 1P3RA 4HB0B 5FI1A 1ZM0A 1FAOA 2LG1A 2YF0A 2MWNB 1X1FA 5D3YA 1WG7A 2DYNA 4KAXB 5JHHA 5J3TA 1FB8A 1W1HA 1DBHA 2RNRB 1BTNA 1PLSA 1WJ1A 2ADZA 2DLWA 2H7DA 4BBKA 4CYEA 1K5GB 5DI9B 2CRFA 3M1IB 1MIXA 3WYFB 1BWNA 5EFXA 4DXAB 4HAVB 4WVFB 2R0DA 1UPRA 1AWEA 1J0WA 1H4RA 1GG3A 1V89A 1DDWA 4KHBB 1ISNA 5C5BB 2NZ8B 2I1KA 4NSWA 4KHOA 5C79A 5HE3A 3G9WA 2J59M 3QIJA 5KQ4A 3AU4A 1SHCA 4IFSA 3SV1A 1XODA 1EF1A 3TO1A 1XKEA 2J0MA 5C16A 2G35A 3SNHA 1U5GA 1QQGA 2LOZA 4HB2B 3O96A 2YS3A 2GCJA 2LOXA 1AQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NI2 A;  4WJ7 A;  3PVW A;  5DHF B;  1FGY A;  3TVV A;  2DFK A;  3NSU A;  2EC1 A;  2DX1 A;  4TYZ A;  1U2B A;  2CY4 A;  1PFJ A;  5KQ1 A;  3F5R A;  1Y19 B;  1UNQ A;  5FI0 A;  1U5D A;  4GXB A;  1ZSQ A;  2YVC A;  3A8P A;  1U5F A;  3GYP A;  1WVH A;  3HK0 A;  3WA0 A;  3KZ1 A;  3T06 A;  4K81 A;  2YT0 A;  3CIK A;  1MK9 B;  4NY0 A;  2L2I A;  1OY2 A;  1MIZ B;  1U27 A;  1NTY A;  4KVG B;  2CAY A;  2OTX A;  3UZT A;  2DYQ A;  4MT7 A;  4MY6 A;  5D27 A;  3ULB A;  1UNR A;  2CY5 A;  4L6E A;  4ZRK A;  1Y5O A;  1EVH A;  3SYX A;  2P0F A;  1WGQ A;  1V5U A;  4DBB A;  4A6F A;  5J3Y A;  1XX0 A;  1UEF A;  2W2X D;  4K17 A;  1XR0 B;  3CXB B;  3SUZ A;  4GZU A;  2FJL A;  2YSZ A;  1BTK A;  3TCA A;  2PZ1 A;  2D4Q A;  3FM8 C;  2YS5 A;  1NU2 A;  2DTC A;  2N23 A;  1DDV A;  1OQN A;  2D9V A;  2I5C A;  2M14 A;  2UVM A;  1LB1 A;  2YS1 A;  1U29 A;  3DXD A;  2UZS A;  2YT1 A;  3ZVR A;  4K2P A;  4KHA A;  1KZG A;  1W1D A;  3ODX A;  2KUP A;  2X18 A;  2LKO A;  5JP4 A;  2DKP A;  2Q13 A;  4MK0 A;  5J3Q A;  4YON A;  1P6S A;  2ROV A;  3V5W A;  4IOY X;  2ELB A;  2Z0P A;  1SGH A;  3BIN A;  3F0W A;  1PMS A;  3VIA A;  5HE0 A;  2GJY A;  3DXC A;  2MKR A;  1Q67 A;  4D0N B;  1FHX A;  2GS0 A;  2D9Z A;  1XD4 A;  2DKQ A;  4F7U P;  1V88 A;  2P0D A;  5D3V A;  2W2X C;  1XCG A;  4C0A A;  4XWX A;  2EJ8 A;  3KRX A;  2ELA A;  1RJ2 A;  2QKM A;  1MK7 B;  5LOP B;  4Z2N A;  4HB4 B;  1KZ7 A;  2DHK A;  3DXE A;  1W1G A;  1X05 A;  3D8D A;  3D8F A;  4CHM A;  1J19 A;  5JLJ B;  4HB3 B;  2D10 A;  3PVU A;  5C6R A;  3P7Z A;  3ODO A;  2DHJ A;  3GYO A;  4F7G A;  4HAW B;  3RCP A;  5L81 A;  2DA0 A;  1M7R A;  1TXD A;  1M7E A;  4DX9 0;  2Y8F A;  5HE1 A;  2NMB A;  2RGN B;  3A98 B;  2D9W A;  2EMS A;  2GCL A;  4GN1 A;  4HAT B;  2R09 A;  4A5K A;  2J0J A;  2DN6 A;  5C5B A;  2MFQ A;  3PSC A;  2UZR A;  2N0Y A;  1EAZ A;  2ZPY A;  4HAZ B;  2COC A;  5LON B;  2IYB A;  3D8E A;  2QKL A;  2P8V A;  3QBV B;  4HHV A;  4K2O A;  2KGX B;  3ODW A;  3X23 A;  4DX8 A;  1DRO A;  2Y8G A;  1MPH A;  1OMW A;  1Z87 A;  1ZC3 B;  3U7D A;  3PG7 A;  1FGZ A;  5CLQ B;  3PEG A;  2HE7 A;  2XQN M;  3U8Z A;  1K5D B;  5D3W A;  5GOW B;  2COA A;  1TJ6 A;  1IRS A;  3LJU X;  4TKN A;  2ROZ B;  2VRW B;  2AL6 A;  2BCJ A;  4F7H A;  3PP2 A;  2D2Q A;  2D9X A;  1WJM A;  2DX5 A;  4P7I A;  1ZVR A;  3KRW A;  2I1J A;  4Z2M B;  3MPX A;  4CHJ A;  5KCV A;  1N3H A;  2RUK B;  2COF A;  2RSG A;  3P6A A;  5D3X A;  2J0K A;  2AEH A;  2K2U A;  1DDM A;  1V61 A;  1TQZ A;  2VSZ A;  1UNP A;  1X11 A;  3PVL A;  3IVF A;  5DIF B;  1U5E A;  1KI1 B;  2D9Y A;  4A6K A;  4WSF A;  1WGU A;  2LUL A;  1P5T A;  2I5F A;  1B55 A;  2Z0Q A;  3QWM A;  1ZC4 B;  2OQB A;  4GMV A;  3ZDT A;  2L1C A;  5JHG A;  3A8Q A;  4ZRJ A;  2P0H A;  3SO6 A;  1X86 A;  2YRY A;  4ZRI A;  3HW2 B;  4HAU B;  1WI1 A;  2RLO A;  2MDX A;  2VKI A;  2RVB B;  2Z0O A;  3FSS A;  4A6F B;  3PZD A;  1I7A A;  3KY9 A;  2K2J A;  4GPT B;  2V76 A;  1MKE A;  2DHI A;  4HAY B;  5CLL B;  2W2W A;  1GC7 A;  5DH9 B;  4YL8 A;  1BAK A;  3OAN A;  4B6H A;  3KSY A;  4EMO A;  1I2H A;  1FHW A;  2IFS A;  5HE2 A;  3AJ4 A;  3AU5 A;  3MDB C;  1E5W A;  1EGX A;  2M38 A;  3N7C A;  4Y94 A;  3TFM A;  3TW1 A;  2EMT A;  4A6H A;  3ML4 A;  4HDO A;  2JP2 A;  4PQ0 A;  3BJI A;  4IAP A;  1GC6 A;  4EKU A;  3HQC A;  4GMX B;  2K00 A;  4HAX B;  3ULC A;  1X1G A;  1DYN A;  5DHA B;  2D11 A;  1H10 A;  1NTV A;  3FEH A;  1V5M A;  2LYD A;  2COD A;  3VOQ A;  2KCJ A;  4HDQ A;  4PNK A;  1FOE A;  1FHO A;  1UPQ A;  1RRP B;  1LW3 A;  2H7E A;  1QC6 A;  2E2X A;  2Y7B A;  2HTH B;  4H8S A;  4EJN A;  1MAI A;  1V5P A;  1P3R A;  4HB0 B;  5FI1 A;  1ZM0 A;  1FAO A;  2LG1 A;  2YF0 A;  2MWN B;  1X1F A;  5D3Y A;  1WG7 A;  2DYN A;  4KAX B;  5JHH A;  5J3T A;  1FB8 A;  1W1H A;  1DBH A;  2RNR B;  1BTN A;  1PLS A;  1WJ1 A;  2ADZ A;  2DLW A;  2H7D A;  4BBK A;  4CYE A;  1K5G B;  5DI9 B;  2CRF A;  3M1I B;  1MIX A;  3WYF B;  1BWN A;  5EFX A;  4DXA B;  4HAV B;  4WVF B;  2R0D A;  1UPR A;  1AWE A;  1J0W A;  1H4R A;  1GG3 A;  1V89 A;  1DDW A;  4KHB B;  1ISN A;  5C5B B;  2NZ8 B;  2I1K A;  4NSW A;  4KHO A;  5C79 A;  5HE3 A;  3G9W A;  2J59 M;  3QIJ A;  5KQ4 A;  3AU4 A;  1SHC A;  4IFS A;  3SV1 A;  1XOD A;  1EF1 A;  3TO1 A;  1XKE A;  2J0M A;  5C16 A;  2G35 A;  3SNH A;  1U5G A;  1QQG A;  2LOZ A;  4HB2 B;  3O96 A;  2YS3 A;  2GCJ A;  2LOX A;  1AQC A; 
#chains in the Genus database with same CATH topology
 1NI2 A;  4WJ7 A;  3PVW A;  5DHF B;  1FGY A;  3TVV A;  2DFK A;  3NSU A;  2EC1 A;  2DX1 A;  4TYZ A;  1U2B A;  2CY4 A;  1PFJ A;  5KQ1 A;  3F5R A;  1Y19 B;  1UNQ A;  5FI0 A;  1U5D A;  4GXB A;  1ZSQ A;  2YVC A;  3A8P A;  1U5F A;  3GYP A;  1WVH A;  3HK0 A;  3WA0 A;  5I2M A;  3KZ1 A;  3T06 A;  2Z4D A;  3A58 A;  4K81 A;  2YT0 A;  3CIK A;  1MK9 B;  2GUM A;  4NY0 A;  2L2I A;  1OY2 A;  1MIZ B;  1U27 A;  1NTY A;  4KVG B;  2CAY A;  2OTX A;  3UZT A;  4QJ4 B;  2DYQ A;  4MT7 A;  4MY6 A;  5D27 A;  3ULB A;  1UNR A;  2CY5 A;  4L6E A;  4ZRK A;  5LG4 B;  1Y5O A;  1EVH A;  3SYX A;  2P0F A;  1WGQ A;  1V5U A;  4DBB A;  4A6F A;  5J3Y A;  1XX0 A;  1UEF A;  3NWD A;  2W2X D;  4K17 A;  1XR0 B;  3CXB B;  3SUZ A;  4GZU A;  4GOU A;  2FJL A;  2YSZ A;  1BTK A;  3TCA A;  2PZ1 A;  2D4Q A;  3FM8 C;  2YS5 A;  1NU2 A;  2DTC A;  2N23 A;  1DDV A;  1OQN A;  2D9V A;  2I5C A;  2M14 A;  2UVM A;  1LB1 A;  2YS1 A;  1U29 A;  3DXD A;  2UZS A;  2YT1 A;  3ZVR A;  4K2P A;  2K8E A;  4KHA A;  1KZG A;  1W1D A;  3ODX A;  2KUP A;  2X18 A;  2LKO A;  3U12 A;  5JP4 A;  2DKP A;  2Q13 A;  4MK0 A;  5J3Q A;  4YON A;  1P6S A;  2ROV A;  3V5W A;  4IOY X;  2ELB A;  2Z0P A;  1SGH A;  3BIN A;  3F0W A;  1PMS A;  3VIA A;  5HE0 A;  2GJY A;  3DXC A;  2MKR A;  3FVC A;  1Q67 A;  4D0N B;  1FHX A;  2GS0 A;  2D9Z A;  1XD4 A;  2DKQ A;  4F7U P;  1V88 A;  2P0D A;  4QJ3 B;  3DCX A;  5D3V A;  2W2X C;  1XCG A;  4C0A A;  4XWX A;  2EJ8 A;  3KRX A;  2KR0 A;  2ELA A;  1RJ2 A;  2QKM A;  1MK7 B;  5LOP B;  4Z2N A;  4HB4 B;  4OSN A;  1KZ7 A;  4DIX A;  2DHK A;  3DXE A;  1W1G A;  1X05 A;  3D8D A;  3D8F A;  4CHM A;  1J19 A;  5JLJ B;  4HB3 B;  2D10 A;  3PVU A;  5C6R A;  3P7Z A;  3ODO A;  2DHJ A;  3GYO A;  4F7G A;  4HAW B;  3RCP A;  5L81 A;  2DA0 A;  1M7R A;  1TXD A;  4CSQ A;  1M7E A;  4DX9 0;  2Y8F A;  5HE1 A;  2NMB A;  2RGN B;  3A98 B;  2D9W A;  2EMS A;  2GCL A;  4GN1 A;  4HAT B;  2R09 A;  4A5K A;  4KHB A;  2J0J A;  4QJ5 B;  2DN6 A;  5C5B A;  2MFQ A;  3PSC A;  4GNK B;  2UZR A;  2N0Y A;  1EAZ A;  2ZPY A;  2KIG A;  4HAZ B;  2COC A;  5LON B;  2IYB A;  3D8E A;  2QKL A;  2P8V A;  3QBV B;  4HHV A;  4K2O A;  2KGX B;  3ODW A;  3X23 A;  4DX8 A;  1DRO A;  2Y8G A;  1MPH A;  1OMW A;  1Z87 A;  1ZC3 B;  3U7D A;  3PG7 A;  1FGZ A;  5CLQ B;  3PEG A;  2HE7 A;  2XQN M;  3U8Z A;  1K5D B;  5D3W A;  5GOW B;  2COA A;  1TJ6 A;  1IRS A;  3LJU X;  4TKN A;  1ZYI A;  2ROZ B;  2VRW B;  2AL6 A;  2BCJ A;  4F7H A;  3PP2 A;  5IRS A;  2D2Q A;  2D9X A;  1WJM A;  2DX5 A;  4P7I A;  1ZVR A;  3KRW A;  2I1J A;  4HSI A;  4Z2M B;  3MPX A;  4CHJ A;  5KCV A;  1N3H A;  2RRF A;  2RUK B;  2COF A;  2RSG A;  3P6A A;  5D3X A;  2J0K A;  2AEH A;  2K2U A;  1DDM A;  1V61 A;  1TQZ A;  2VSZ A;  1UNP A;  1X11 A;  3PVL A;  3IVF A;  5DIF B;  1U5E A;  1KI1 B;  2D9Y A;  4A6K A;  4WSF A;  1WGU A;  5I2S A;  2LUL A;  1P5T A;  2I5F A;  1B55 A;  2Z0Q A;  3QWM A;  1ZC4 B;  2OQB A;  4GMV A;  3ZDT A;  2L1C A;  5JHG A;  3A8Q A;  4ZRJ A;  2P0H A;  3SO6 A;  1X86 A;  2YRY A;  4ZRI A;  3HW2 B;  4HAU B;  1WI1 A;  2RLO A;  2MDX A;  2VKI A;  2RVB B;  2Z0O A;  3FSS A;  4A6F B;  3PZD A;  1I7A A;  3KY9 A;  2K2J A;  4GPT B;  2V76 A;  1MKE A;  2DHI A;  1MI1 A;  4HAY B;  2R2Y A;  5CLL B;  4D6W A;  2W2W A;  1GC7 A;  5DH9 B;  3HIE A;  4YL8 A;  4OT1 A;  3NWA A;  1BAK A;  3OAN A;  4B6H A;  4QXA B;  3KSY A;  2K49 A;  4EMO A;  1I2H A;  1FHW A;  2IFS A;  5HE2 A;  3AJ4 A;  1T77 A;  3AU5 A;  3MDB C;  1E5W A;  1EGX A;  2M38 A;  3N7C A;  3NW8 A;  4Y94 A;  3TFM A;  3TW1 A;  2EMT A;  2ZKM X;  4A6H A;  2KIE A;  3ML4 A;  4HDO A;  2JP2 A;  4PQ0 A;  2NBV A;  3BJI A;  4IAP A;  1GC6 A;  4EKU A;  3HQC A;  4GMX B;  2K00 A;  4HAX B;  3ULC A;  1X1G A;  3OHM B;  1DYN A;  5DHA B;  2D11 A;  1H10 A;  1NTV A;  3FEH A;  1V5M A;  2LYD A;  2COD A;  3VOQ A;  2KCJ A;  4HDQ A;  4PNK A;  1FOE A;  1FHO A;  1UPQ A;  1RRP B;  1LW3 A;  2H7E A;  1QC6 A;  2E2X A;  2Y7B A;  2HTH B;  4H8S A;  4EJN A;  1MAI A;  1V5P A;  1P3R A;  3B77 A;  2Z14 A;  4HB0 B;  5FI1 A;  1ZM0 A;  1FAO A;  2LG1 A;  2YF0 A;  2MWN B;  1X1F A;  5D3Y A;  1WG7 A;  2Z13 A;  2DYN A;  4KAX B;  5JHH A;  5J3T A;  1FB8 A;  1W1H A;  1DBH A;  2RNR B;  1BTN A;  1PLS A;  1WJ1 A;  2KUQ A;  2ADZ A;  2DLW A;  2H7D A;  4BBK A;  4CYE A;  1K5G B;  5DI9 B;  2CRF A;  3M1I B;  1MIX A;  3WYF B;  1BWN A;  5EFX A;  2YT2 A;  3HSA A;  4HAV B;  2R0D A;  4WVF B;  4DXA B;  5M4Y B;  1UPR A;  1AWE A;  1J0W A;  1H4R A;  1GG3 A;  1V89 A;  1DDW A;  4KHB B;  4L1R A;  1ISN A;  5C5B B;  2NZ8 B;  2I1K A;  4NSW A;  4KHO A;  5C79 A;  5HE3 A;  3G9W A;  2J59 M;  3QIJ A;  5KQ4 A;  3AU4 A;  1SHC A;  4IFS A;  3SV1 A;  1XOD A;  1EF1 A;  2FJU B;  3TO1 A;  2Z59 A;  1XKE A;  2J0M A;  5C16 A;  2G35 A;  3SNH A;  1U5G A;  1QQG A;  2LOZ A;  4HB2 B;  3O96 A;  3NWF A;  2YS3 A;  2GCJ A;  2LOX A;  1AQC A; 
#chains in the Genus database with same CATH homology
 1NI2 A;  4WJ7 A;  3PVW A;  5DHF B;  1FGY A;  3TVV A;  2DFK A;  3NSU A;  2EC1 A;  2DX1 A;  4TYZ A;  1U2B A;  2CY4 A;  1PFJ A;  5KQ1 A;  3F5R A;  1Y19 B;  1UNQ A;  5FI0 A;  1U5D A;  4GXB A;  1ZSQ A;  2YVC A;  3A8P A;  1U5F A;  3GYP A;  1WVH A;  3HK0 A;  3WA0 A;  3KZ1 A;  3T06 A;  4K81 A;  2YT0 A;  3CIK A;  1MK9 B;  4NY0 A;  2L2I A;  1OY2 A;  1MIZ B;  1U27 A;  1NTY A;  4KVG B;  2CAY A;  2OTX A;  3UZT A;  2DYQ A;  4MT7 A;  4MY6 A;  5D27 A;  3ULB A;  1UNR A;  2CY5 A;  4L6E A;  4ZRK A;  1Y5O A;  1EVH A;  3SYX A;  2P0F A;  1WGQ A;  1V5U A;  4DBB A;  4A6F A;  5J3Y A;  1XX0 A;  1UEF A;  2W2X D;  4K17 A;  1XR0 B;  3CXB B;  3SUZ A;  4GZU A;  2FJL A;  2YSZ A;  1BTK A;  3TCA A;  2PZ1 A;  2D4Q A;  3FM8 C;  2YS5 A;  1NU2 A;  2DTC A;  2N23 A;  1DDV A;  1OQN A;  2D9V A;  2I5C A;  2M14 A;  2UVM A;  1LB1 A;  2YS1 A;  1U29 A;  3DXD A;  2UZS A;  2YT1 A;  3ZVR A;  4K2P A;  4KHA A;  1KZG A;  1W1D A;  3ODX A;  2KUP A;  2X18 A;  2LKO A;  5JP4 A;  2DKP A;  2Q13 A;  4MK0 A;  5J3Q A;  4YON A;  1P6S A;  2ROV A;  3V5W A;  4IOY X;  2ELB A;  2Z0P A;  1SGH A;  3BIN A;  3F0W A;  1PMS A;  3VIA A;  5HE0 A;  2GJY A;  3DXC A;  2MKR A;  1Q67 A;  4D0N B;  1FHX A;  2GS0 A;  2D9Z A;  1XD4 A;  2DKQ A;  4F7U P;  1V88 A;  2P0D A;  5D3V A;  2W2X C;  1XCG A;  4C0A A;  4XWX A;  2EJ8 A;  3KRX A;  2ELA A;  1RJ2 A;  2QKM A;  1MK7 B;  5LOP B;  4Z2N A;  4HB4 B;  1KZ7 A;  2DHK A;  3DXE A;  1W1G A;  1X05 A;  3D8D A;  3D8F A;  4CHM A;  1J19 A;  5JLJ B;  4HB3 B;  2D10 A;  3PVU A;  5C6R A;  3P7Z A;  3ODO A;  2DHJ A;  3GYO A;  4F7G A;  4HAW B;  3RCP A;  5L81 A;  2DA0 A;  1M7R A;  1TXD A;  1M7E A;  4DX9 0;  2Y8F A;  5HE1 A;  2NMB A;  2RGN B;  3A98 B;  2D9W A;  2EMS A;  2GCL A;  4GN1 A;  4HAT B;  2R09 A;  4A5K A;  2J0J A;  2DN6 A;  5C5B A;  2MFQ A;  3PSC A;  2UZR A;  2N0Y A;  1EAZ A;  2ZPY A;  4HAZ B;  2COC A;  5LON B;  2IYB A;  3D8E A;  2QKL A;  2P8V A;  3QBV B;  4HHV A;  4K2O A;  2KGX B;  3ODW A;  3X23 A;  4DX8 A;  1DRO A;  2Y8G A;  1MPH A;  1OMW A;  1Z87 A;  1ZC3 B;  3U7D A;  3PG7 A;  1FGZ A;  5CLQ B;  3PEG A;  2HE7 A;  2XQN M;  3U8Z A;  1K5D B;  5D3W A;  5GOW B;  2COA A;  1TJ6 A;  1IRS A;  3LJU X;  4TKN A;  2ROZ B;  2VRW B;  2AL6 A;  2BCJ A;  4F7H A;  3PP2 A;  2D2Q A;  2D9X A;  1WJM A;  2DX5 A;  4P7I A;  1ZVR A;  3KRW A;  2I1J A;  4Z2M B;  3MPX A;  4CHJ A;  5KCV A;  1N3H A;  2RUK B;  2COF A;  2RSG A;  3P6A A;  5D3X A;  2J0K A;  2AEH A;  2K2U A;  1DDM A;  1V61 A;  1TQZ A;  2VSZ A;  1UNP A;  1X11 A;  3PVL A;  3IVF A;  5DIF B;  1U5E A;  1KI1 B;  2D9Y A;  4A6K A;  4WSF A;  1WGU A;  2LUL A;  1P5T A;  2I5F A;  1B55 A;  2Z0Q A;  3QWM A;  1ZC4 B;  2OQB A;  4GMV A;  3ZDT A;  2L1C A;  5JHG A;  3A8Q A;  4ZRJ A;  2P0H A;  3SO6 A;  1X86 A;  2YRY A;  4ZRI A;  3HW2 B;  4HAU B;  1WI1 A;  2RLO A;  2MDX A;  2VKI A;  2RVB B;  2Z0O A;  3FSS A;  4A6F B;  3PZD A;  1I7A A;  3KY9 A;  2K2J A;  4GPT B;  2V76 A;  1MKE A;  2DHI A;  4HAY B;  5CLL B;  2W2W A;  1GC7 A;  5DH9 B;  4YL8 A;  1BAK A;  3OAN A;  4B6H A;  3KSY A;  4EMO A;  1I2H A;  1FHW A;  2IFS A;  5HE2 A;  3AJ4 A;  3AU5 A;  3MDB C;  1E5W A;  1EGX A;  2M38 A;  3N7C A;  4Y94 A;  3TFM A;  3TW1 A;  2EMT A;  4A6H A;  3ML4 A;  4HDO A;  2JP2 A;  4PQ0 A;  3BJI A;  4IAP A;  1GC6 A;  4EKU A;  3HQC A;  4GMX B;  2K00 A;  4HAX B;  3ULC A;  1X1G A;  1DYN A;  5DHA B;  2D11 A;  1H10 A;  1NTV A;  3FEH A;  1V5M A;  2LYD A;  2COD A;  3VOQ A;  2KCJ A;  4HDQ A;  4PNK A;  1FOE A;  1FHO A;  1UPQ A;  1RRP B;  1LW3 A;  2H7E A;  1QC6 A;  2E2X A;  2Y7B A;  2HTH B;  4H8S A;  4EJN A;  1MAI A;  1V5P A;  1P3R A;  4HB0 B;  5FI1 A;  1ZM0 A;  1FAO A;  2LG1 A;  2YF0 A;  2MWN B;  1X1F A;  5D3Y A;  1WG7 A;  2DYN A;  4KAX B;  5JHH A;  5J3T A;  1FB8 A;  1W1H A;  1DBH A;  2RNR B;  1BTN A;  1PLS A;  1WJ1 A;  2ADZ A;  2DLW A;  2H7D A;  4BBK A;  4CYE A;  1K5G B;  5DI9 B;  2CRF A;  3M1I B;  1MIX A;  3WYF B;  1BWN A;  5EFX A;  4DXA B;  4HAV B;  4WVF B;  2R0D A;  1UPR A;  1AWE A;  1J0W A;  1H4R A;  1GG3 A;  1V89 A;  1DDW A;  4KHB B;  1ISN A;  5C5B B;  2NZ8 B;  2I1K A;  4NSW A;  4KHO A;  5C79 A;  5HE3 A;  3G9W A;  2J59 M;  3QIJ A;  5KQ4 A;  3AU4 A;  1SHC A;  4IFS A;  3SV1 A;  1XOD A;  1EF1 A;  3TO1 A;  1XKE A;  2J0M A;  5C16 A;  2G35 A;  3SNH A;  1U5G A;  1QQG A;  2LOZ A;  4HB2 B;  3O96 A;  2YS3 A;  2GCJ A;  2LOX A;  1AQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...