3ML4A

Crystal structure of a complex between dok7 ph-ptb and the musk juxtamembrane region
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
208
structure length
205
Chain Sequence
EAALVEGQVKLRKWKSRWLVLRKPSPVADCLLMLVYKDKCERSKGLRERSSLTLEDICGLEPALPYEGLAHTLAIICLSQAVMLGFDSHEAMCAWDTRIRYALGEVHRFHVTVAPGTKLESGPATLHLCNDILVLARDIPPTVMGQWKLSDLRRYGAVPNGFIFEGGTRCGYWAGVFFLSSAEGEQMSFLFDCIVRGISPTKGPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Cytoplasmic Adaptor Protein Dok7 Activates the Receptor Tyrosine Kinase MuSK via Dimerization.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Protein Dok-7
total genus 41
structure length 205
sequence length 208
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02174 IRS PTB domain (IRS-1 type)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3ml4A01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3ml4A02
5DHAB 2D9XA 3PG7A 2D11A 2Z0OA 1H4RA 3PVWA 1AQCA 3T06A 1ISNA 2RGNB 4BBKA 4WSFA 2LG1A 3G9WA 4TYZA 2DKQA 1N3HA 1MKEA 3CIKA 1U5DA 1P3RA 4HHVA 2GCJA 3PP2A 1RJ2A 1EAZA 3ODWA 5LONB 4DBBA 4A6HA 1AWEA 4GZUA 3ZVRA 2COFA 1V89A 4F7HA 4NSWA 2DA0A 2N23A 3TVVA 4P7IA 3X23A 3VOQA 2VRWB 3U7DA 1WG7A 4HB4B 2Z0PA 5CLQB 4A5KA 4A6KA 2ROZB 2LKOA 2DX5A 3VIAA 2H7EA 2DHKA 1LB1A 1XX0A 1Z87A 2YF0A 2YS5A 4HB3B 1BAKA 2XQNM 2D10A 4Z2NA 2COAA 3LJUX 1OQNA 5DIFB 1V5PA 4K2OA 1WGQA 1UPRA 4EJNA 3TO1A 2DHIA 1DDVA 2J59M 5C16A 2D9YA 2LOXA 1GG3A 4HAZB 4ZRIA 1WJMA 5D27A 1V5MA 3BINA 2D9VA 3FEHA 5D3WA 4NY0A 2I1JA 1FHXA 3P7ZA 5D3YA 1U29A 4A6FA 4EKUA 2K2UA 4Y94A 5HE1A 1NTYA 4CHJA 1X86A 2N0YA 2P8VA 1WGUA 1FHOA 2Q13A 2ZPYA 3IVFA 1I7AA 2UZRA 5C79A 2LOZA 4KHOA 1XR0B 1DBHA 2OTXA 2DKPA 1KZGA 4B6HA 2D2QA 4KHAA 4L6EA 2KCJA 2GCLA 2DX1A 3RCPA 4XWXA 5HE2A 3MDBC 1UPQA 1RRPB 1OY2A 4PNKA 1GC7A 2RSGA 4GXBA 3V5WA 5DH9B 2W2WA 3F5RA 2KUPA 3ODXA 1MPHA 1M7RA 3SNHA 2NZ8B 2P0DA 1V5UA 2QKMA 2JP2A 1XD4A 3PZDA 2ELBA 4WJ7A 3DXEA 4HAVB 1BTKA 4DX8A 4HDOA 2Y7BA 3TCAA 2L2IA 2YSZA 3KSYA 4D0NB 3D8FA 5JP4A 3FSSA 1SHCA 1K5GB 2I5CA 2Y8FA 2YRYA 5JLJB 2CAYA 4MY6A 4HAYB 2YS3A 2YS1A 1E5WA 3TW1A 1P6SA 1ZVRA 3PVUA 2YT0A 2W2XD 3OANA 1XCGA 4EMOA 4CYEA 1V88A 2RLOA 2V76A 3HW2B 2GS0A 5KCVA 2CY5A 1XODA 1ZSQA 1WI1A 2ROVA 1LW3A 1EF1A 2GJYA 2ADZA 1QQGA 2UZSA 3ML4A 5GOWB 1FAOA 1ZC3B 1B55A 1M7EA 1W1HA 1UNQA 1W1DA 2X18A 1KZ7A 2VKIA 2RNRB 4GPTB 1P5TA 3N7CA 2CODA 1OMWA 2FJLA 3TFMA 1DYNA 2P0HA 2M14A 1MK7B 2E2XA 5DI9B 3SO6A 4HB2B 3KY9A 2ELAA 5KQ4A 3GYOA 1PMSA 3O96A 3U8ZA 3WYFB 1Y5OA 5J3YA 1U5FA 5HE3A 2NMBA 5C5BA 1PFJA 3BJIA 4MK0A 4K2PA 1X05A 5EFXA 4ZRJA 1U2BA 2EJ8A 1W1GA 2DYQA 2AL6A 3D8EA 2CRFA 2HTHB 2M38A 3KZ1A 5C6RA 4A6FB 2DLWA 5D3VA 1WJ1A 2OQBA 4HB0B 2HE7A 3QIJA 1J0WA 5FI1A 4GMVA 2I5FA 1U27A 2K00A 3QBVB 4PQ0A 3PVLA 3DXCA 3M1IB 4WVFB 1FB8A 4TKNA 4F7GA 3A98B 3F0WA 1ZC4B 2DYNA 4KHBB 3ZDTA 3DXDA 1SGHA 1MIXA 4ZRKA 2H7DA 1NU2A 1DROA 4K17A 1NI2A 4GMXB 3A8PA 2EC1A 1K5DB 1QC6A 2VSZA 2BCJA 5JHHA 1UNRA 4KAXB 2G35A 4HDQA 3CXBB 2D9WA 2UVMA 2K2JA 3P6AA 1DDMA 1FHWA 1BWNA 3ULCA 5J3TA 2R0DA 2MFQA 1TXDA 2J0JA 2RUKB 1EVHA 2YVCA 2D9ZA 4DXAB 2IFSA 2Z0QA 2J0MA 1IRSA 3KRWA 1Y19B 2RVBB 4IAPA 3PSCA 1UNPA 2IYBA 3A8QA 1GC6A 3AJ4A 1FGYA 1H10A 5JHGA 3ULBA 4GN1A 2LULA 1XKEA 5J3QA 2DFKA 4H8SA 1NTVA 2CY4A 2AEHA 1U5EA 2PZ1A 3MPXA 2W2XC 3HK0A 1I2HA 4HAUB 5DHFB 2MDXA 1X11A 3QWMA 3ODOA 4C0AA 5C5BB 2DTCA 3AU5A 4DX90 3SUZA 5L81A 5KQ1A 3SYXA 1MIZB 3SV1A 4YONA 1V61A 4IOYX 1KI1B 4HAWB 1X1FA 3WA0A 2EMSA 1ZM0A 3UZTA 4F7UP 1TJ6A 3AU4A 1DDWA 4HAXB 2J0KA 3NSUA 5CLLB 1MK9B 4MT7A 2DHJA 3D8DA 4KVGB 1TQZA 1EGXA 4HATB 2R09A 1UEFA 3GYPA 4CHMA 3PEGA 2EMTA 2MKRA 4IFSA 2DN6A 4YL8A 5HE0A 5D3XA 2I1KA 1BTNA 4Z2MB 2KGXB 1MAIA 2D4QA 5LOPB 3FM8C 1U5GA 4K81A 1PLSA 1Q67A 2Y8GA 1X1GA 1FGZA 2L1CA 3HQCA 1J19A 2P0FA 2LYDA 2MWNB 1WVHA 2YT1A 3KRXA 5FI0A 2COCA 1FOEA 2QKLA
chains in the Genus database with same CATH superfamily
5DHAB 2D9XA 3PG7A 2D11A 2Z0OA 1H4RA 3PVWA 1AQCA 3T06A 1ISNA 2RGNB 4BBKA 4WSFA 2LG1A 3G9WA 4TYZA 2DKQA 5M4YB 1N3HA 1MKEA 3CIKA 1U5DA 1P3RA 4HHVA 2GCJA 3PP2A 1RJ2A 1EAZA 3ODWA 5LONB 4QXAB 4DBBA 4A6HA 1AWEA 4GZUA 3ZVRA 2COFA 1V89A 4F7HA 4NSWA 2DA0A 4L1RA 2N23A 3TVVA 2ZKMX 4P7IA 3X23A 3VOQA 2VRWB 3U7DA 1WG7A 4HB4B 2Z0PA 5CLQB 4A5KA 4A6KA 2ROZB 2LKOA 2DX5A 3VIAA 2H7EA 2DHKA 1LB1A 1XX0A 1Z87A 2YF0A 2YS5A 4HB3B 1BAKA 2XQNM 2D10A 4Z2NA 2COAA 3LJUX 3A58A 1OQNA 5DIFB 1V5PA 4K2OA 1WGQA 1UPRA 3HSAA 3TO1A 4EJNA 4QJ3B 2DHIA 1DDVA 2J59M 5C16A 2D9YA 2LOXA 1GG3A 4HAZB 4ZRIA 1WJMA 4HSIA 5D27A 1V5MA 3BINA 2D9VA 3FEHA 5D3WA 4NY0A 2I1JA 1FHXA 3P7ZA 5D3YA 1U29A 4A6FA 4EKUA 2K2UA 4Y94A 5HE1A 4OT1A 1NTYA 4CHJA 1X86A 2N0YA 1MI1A 2P8VA 3OHMB 1WGUA 1FHOA 2Q13A 2ZPYA 3IVFA 1I7AA 2UZRA 5C79A 2LOZA 4KHOA 1XR0B 1DBHA 2OTXA 4KHBA 2RRFA 2DKPA 4QJ5B 1KZGA 4B6HA 2D2QA 4KHAA 4L6EA 2KCJA 2GCLA 2DX1A 3RCPA 4XWXA 2R2YA 5HE2A 3MDBC 4OSNA 1RRPB 1UPQA 1OY2A 4PNKA 1GC7A 2RSGA 4GXBA 3V5WA 5DH9B 2W2WA 3F5RA 2KUPA 3ODXA 1MPHA 3FVCA 1M7RA 1ZYIA 3SNHA 2NZ8B 2P0DA 1V5UA 2QKMA 2JP2A 1XD4A 3PZDA 2ELBA 4WJ7A 3DXEA 4HAVB 1BTKA 4DX8A 4HDOA 2Y7BA 3TCAA 2L2IA 2YSZA 3KSYA 4D0NB 3D8FA 5JP4A 4GNKB 3FSSA 2KUQA 1SHCA 2YT2A 1K5GB 2I5CA 2Y8FA 2FJUB 2YRYA 5JLJB 2CAYA 4MY6A 4HAYB 2YS3A 2YS1A 1E5WA 3NWFA 2Z4DA 3TW1A 3B77A 1P6SA 5IRSA 1ZVRA 3U12A 3PVUA 2YT0A 2W2XD 3OANA 1XCGA 4EMOA 4CYEA 1V88A 2RLOA 2KR0A 2V76A 3HW2B 2GS0A 5KCVA 2CY5A 1XODA 1ZSQA 1WI1A 2ROVA 1LW3A 1EF1A 2GJYA 2ADZA 1QQGA 2UZSA 3ML4A 5GOWB 1FAOA 1ZC3B 1B55A 1M7EA 1W1HA 1UNQA 1W1DA 2X18A 2Z13A 1KZ7A 2VKIA 2RNRB 4GPTB 1P5TA 3N7CA 2CODA 1OMWA 2FJLA 3TFMA 1DYNA 2P0HA 2M14A 1MK7B 2E2XA 3DCXA 5DI9B 3SO6A 4HB2B 3KY9A 2ELAA 5I2MA 5KQ4A 3GYOA 1PMSA 3O96A 2Z14A 3U8ZA 3WYFB 1Y5OA 5J3YA 1U5FA 5HE3A 2NMBA 5C5BA 1PFJA 4D6WA 3BJIA 4MK0A 4CSQA 4K2PA 1X05A 5EFXA 4ZRJA 1U2BA 2EJ8A 2K49A 1W1GA 2DYQA 2AL6A 3D8EA 2CRFA 2HTHB 2M38A 3KZ1A 5C6RA 4A6FB 2DLWA 5D3VA 1WJ1A 2OQBA 4HB0B 2HE7A 3QIJA 1J0WA 5FI1A 4GMVA 2I5FA 1U27A 2K00A 3QBVB 4PQ0A 3PVLA 3DXCA 3M1IB 4WVFB 1FB8A 4TKNA 4F7GA 3A98B 3F0WA 1ZC4B 2DYNA 4KHBB 3ZDTA 3DXDA 1SGHA 1MIXA 4ZRKA 3NWAA 2H7DA 1NU2A 1DROA 4K17A 1NI2A 3A8PA 4GMXB 2EC1A 1K5DB 1QC6A 2VSZA 2BCJA 2K8EA 3NWDA 5JHHA 1UNRA 4KAXB 2G35A 4HDQA 3CXBB 2D9WA 2UVMA 2K2JA 3P6AA 3NW8A 1DDMA 1FHWA 1BWNA 3ULCA 5J3TA 2R0DA 2MFQA 1TXDA 2J0JA 2RUKB 2GUMA 1EVHA 2YVCA 2D9ZA 2KIGA 4DXAB 2IFSA 4GOUA 5LG4B 2Z0QA 2J0MA 1IRSA 3KRWA 1Y19B 2RVBB 4IAPA 3PSCA 1UNPA 2IYBA 3A8QA 1GC6A 3AJ4A 1FGYA 1H10A 2KIEA 5JHGA 2Z59A 3ULBA 4QJ4B 4GN1A 2LULA 1XKEA 5J3QA 2DFKA 4H8SA 1NTVA 2CY4A 2AEHA 1U5EA 2PZ1A 3MPXA 2W2XC 3HK0A 1I2HA 4HAUB 5DHFB 2MDXA 1X11A 3QWMA 3ODOA 4C0AA 5C5BB 2DTCA 3AU5A 4DX90 3SUZA 5L81A 5KQ1A 3SYXA 1MIZB 3SV1A 4YONA 1V61A 4IOYX 1KI1B 4HAWB 1X1FA 3WA0A 2EMSA 1ZM0A 3UZTA 4F7UP 1TJ6A 3AU4A 1DDWA 2J0KA 4HAXB 3NSUA 5CLLB 1MK9B 4MT7A 2DHJA 3D8DA 4KVGB 1TQZA 1EGXA 4HATB 2R09A 1UEFA 3GYPA 4CHMA 3PEGA 2EMTA 2MKRA 4IFSA 2DN6A 4YL8A 5HE0A 5D3XA 2I1KA 1BTNA 4Z2MB 5I2SA 2KGXB 1MAIA 4DIXA 2D4QA 3HIEA 5LOPB 3FM8C 1U5GA 1T77A 4K81A 1PLSA 1Q67A 2Y8GA 1X1GA 1FGZA 2L1CA 3HQCA 1J19A 2P0FA 2LYDA 2MWNB 1WVHA 2YT1A 3KRXA 5FI0A 2NBVA 2COCA 1FOEA 2QKLA
chains in the Genus database with same CATH topology
5DHAB 2D9XA 3PG7A 2D11A 2Z0OA 1H4RA 3PVWA 1AQCA 3T06A 1ISNA 2RGNB 4BBKA 4WSFA 2LG1A 3G9WA 4TYZA 2DKQA 1N3HA 1MKEA 3CIKA 1U5DA 1P3RA 4HHVA 2GCJA 3PP2A 1RJ2A 1EAZA 3ODWA 5LONB 4DBBA 4A6HA 1AWEA 4GZUA 3ZVRA 2COFA 1V89A 4F7HA 4NSWA 2DA0A 2N23A 3TVVA 4P7IA 3X23A 3VOQA 2VRWB 3U7DA 1WG7A 4HB4B 2Z0PA 5CLQB 4A5KA 4A6KA 2ROZB 2LKOA 2DX5A 3VIAA 2H7EA 2DHKA 1LB1A 1XX0A 1Z87A 2YF0A 2YS5A 4HB3B 1BAKA 2XQNM 2D10A 4Z2NA 2COAA 3LJUX 1OQNA 5DIFB 1V5PA 4K2OA 1WGQA 1UPRA 4EJNA 3TO1A 2DHIA 1DDVA 2J59M 5C16A 2D9YA 2LOXA 1GG3A 4HAZB 4ZRIA 1WJMA 5D27A 1V5MA 3BINA 2D9VA 3FEHA 5D3WA 4NY0A 2I1JA 1FHXA 3P7ZA 5D3YA 1U29A 4A6FA 4EKUA 2K2UA 4Y94A 5HE1A 1NTYA 4CHJA 1X86A 2N0YA 2P8VA 1WGUA 1FHOA 2Q13A 2ZPYA 3IVFA 1I7AA 2UZRA 5C79A 2LOZA 4KHOA 1XR0B 1DBHA 2OTXA 2DKPA 1KZGA 4B6HA 2D2QA 4KHAA 4L6EA 2KCJA 2GCLA 2DX1A 3RCPA 4XWXA 5HE2A 3MDBC 1UPQA 1RRPB 1OY2A 4PNKA 1GC7A 2RSGA 4GXBA 3V5WA 5DH9B 2W2WA 3F5RA 2KUPA 3ODXA 1MPHA 1M7RA 3SNHA 2NZ8B 2P0DA 1V5UA 2QKMA 2JP2A 1XD4A 3PZDA 2ELBA 4WJ7A 3DXEA 4HAVB 1BTKA 4DX8A 4HDOA 2Y7BA 3TCAA 2L2IA 2YSZA 3KSYA 4D0NB 3D8FA 5JP4A 3FSSA 1SHCA 1K5GB 2I5CA 2Y8FA 2YRYA 5JLJB 2CAYA 4MY6A 4HAYB 2YS3A 2YS1A 1E5WA 3TW1A 1P6SA 1ZVRA 3PVUA 2YT0A 2W2XD 3OANA 1XCGA 4EMOA 4CYEA 1V88A 2RLOA 2V76A 3HW2B 2GS0A 5KCVA 2CY5A 1XODA 1ZSQA 1WI1A 2ROVA 1LW3A 1EF1A 2GJYA 2ADZA 1QQGA 2UZSA 3ML4A 5GOWB 1FAOA 1ZC3B 1B55A 1M7EA 1W1HA 1UNQA 1W1DA 2X18A 1KZ7A 2VKIA 2RNRB 4GPTB 1P5TA 3N7CA 2CODA 1OMWA 2FJLA 3TFMA 1DYNA 2P0HA 2M14A 1MK7B 2E2XA 5DI9B 3SO6A 4HB2B 3KY9A 2ELAA 5KQ4A 3GYOA 1PMSA 3O96A 3U8ZA 3WYFB 1Y5OA 5J3YA 1U5FA 5HE3A 2NMBA 5C5BA 1PFJA 3BJIA 4MK0A 4K2PA 1X05A 5EFXA 4ZRJA 1U2BA 2EJ8A 1W1GA 2DYQA 2AL6A 3D8EA 2CRFA 2HTHB 2M38A 3KZ1A 5C6RA 4A6FB 2DLWA 5D3VA 1WJ1A 2OQBA 4HB0B 2HE7A 3QIJA 1J0WA 5FI1A 4GMVA 2I5FA 1U27A 2K00A 3QBVB 4PQ0A 3PVLA 3DXCA 3M1IB 4WVFB 1FB8A 4TKNA 4F7GA 3A98B 3F0WA 1ZC4B 2DYNA 4KHBB 3ZDTA 3DXDA 1SGHA 1MIXA 4ZRKA 2H7DA 1NU2A 1DROA 4K17A 1NI2A 4GMXB 3A8PA 2EC1A 1K5DB 1QC6A 2VSZA 2BCJA 5JHHA 1UNRA 4KAXB 2G35A 4HDQA 3CXBB 2D9WA 2UVMA 2K2JA 3P6AA 1DDMA 1FHWA 1BWNA 3ULCA 5J3TA 2R0DA 2MFQA 1TXDA 2J0JA 2RUKB 1EVHA 2YVCA 2D9ZA 4DXAB 2IFSA 2Z0QA 2J0MA 1IRSA 3KRWA 1Y19B 2RVBB 4IAPA 3PSCA 1UNPA 2IYBA 3A8QA 1GC6A 3AJ4A 1FGYA 1H10A 5JHGA 3ULBA 4GN1A 2LULA 1XKEA 5J3QA 2DFKA 4H8SA 1NTVA 2CY4A 2AEHA 1U5EA 2PZ1A 3MPXA 2W2XC 3HK0A 1I2HA 4HAUB 5DHFB 2MDXA 1X11A 3QWMA 3ODOA 4C0AA 5C5BB 2DTCA 3AU5A 4DX90 3SUZA 5L81A 5KQ1A 3SYXA 1MIZB 3SV1A 4YONA 1V61A 4IOYX 1KI1B 4HAWB 1X1FA 3WA0A 2EMSA 1ZM0A 3UZTA 4F7UP 1TJ6A 3AU4A 1DDWA 4HAXB 2J0KA 3NSUA 5CLLB 1MK9B 4MT7A 2DHJA 3D8DA 4KVGB 1TQZA 1EGXA 4HATB 2R09A 1UEFA 3GYPA 4CHMA 3PEGA 2EMTA 2MKRA 4IFSA 2DN6A 4YL8A 5HE0A 5D3XA 2I1KA 1BTNA 4Z2MB 2KGXB 1MAIA 2D4QA 5LOPB 3FM8C 1U5GA 4K81A 1PLSA 1Q67A 2Y8GA 1X1GA 1FGZA 2L1CA 3HQCA 1J19A 2P0FA 2LYDA 2MWNB 1WVHA 2YT1A 3KRXA 5FI0A 2COCA 1FOEA 2QKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DHA B;  2D9X A;  3PG7 A;  2D11 A;  2Z0O A;  1H4R A;  3PVW A;  1AQC A;  3T06 A;  1ISN A;  2RGN B;  4BBK A;  4WSF A;  2LG1 A;  3G9W A;  4TYZ A;  2DKQ A;  1N3H A;  1MKE A;  3CIK A;  1U5D A;  1P3R A;  4HHV A;  2GCJ A;  3PP2 A;  1RJ2 A;  1EAZ A;  3ODW A;  5LON B;  4DBB A;  4A6H A;  1AWE A;  4GZU A;  3ZVR A;  2COF A;  1V89 A;  4F7H A;  4NSW A;  2DA0 A;  2N23 A;  3TVV A;  4P7I A;  3X23 A;  3VOQ A;  2VRW B;  3U7D A;  1WG7 A;  4HB4 B;  2Z0P A;  5CLQ B;  4A5K A;  4A6K A;  2ROZ B;  2LKO A;  2DX5 A;  3VIA A;  2H7E A;  2DHK A;  1LB1 A;  1XX0 A;  1Z87 A;  2YF0 A;  2YS5 A;  4HB3 B;  1BAK A;  2XQN M;  2D10 A;  4Z2N A;  2COA A;  3LJU X;  1OQN A;  5DIF B;  1V5P A;  4K2O A;  1WGQ A;  1UPR A;  4EJN A;  3TO1 A;  2DHI A;  1DDV A;  2J59 M;  5C16 A;  2D9Y A;  2LOX A;  1GG3 A;  4HAZ B;  4ZRI A;  1WJM A;  5D27 A;  1V5M A;  3BIN A;  2D9V A;  3FEH A;  5D3W A;  4NY0 A;  2I1J A;  1FHX A;  3P7Z A;  5D3Y A;  1U29 A;  4A6F A;  4EKU A;  2K2U A;  4Y94 A;  5HE1 A;  1NTY A;  4CHJ A;  1X86 A;  2N0Y A;  2P8V A;  1WGU A;  1FHO A;  2Q13 A;  2ZPY A;  3IVF A;  1I7A A;  2UZR A;  5C79 A;  2LOZ A;  4KHO A;  1XR0 B;  1DBH A;  2OTX A;  2DKP A;  1KZG A;  4B6H A;  2D2Q A;  4KHA A;  4L6E A;  2KCJ A;  2GCL A;  2DX1 A;  3RCP A;  4XWX A;  5HE2 A;  3MDB C;  1UPQ A;  1RRP B;  1OY2 A;  4PNK A;  1GC7 A;  2RSG A;  4GXB A;  3V5W A;  5DH9 B;  2W2W A;  3F5R A;  2KUP A;  3ODX A;  1MPH A;  1M7R A;  3SNH A;  2NZ8 B;  2P0D A;  1V5U A;  2QKM A;  2JP2 A;  1XD4 A;  3PZD A;  2ELB A;  4WJ7 A;  3DXE A;  4HAV B;  1BTK A;  4DX8 A;  4HDO A;  2Y7B A;  3TCA A;  2L2I A;  2YSZ A;  3KSY A;  4D0N B;  3D8F A;  5JP4 A;  3FSS A;  1SHC A;  1K5G B;  2I5C A;  2Y8F A;  2YRY A;  5JLJ B;  2CAY A;  4MY6 A;  4HAY B;  2YS3 A;  2YS1 A;  1E5W A;  3TW1 A;  1P6S A;  1ZVR A;  3PVU A;  2YT0 A;  2W2X D;  3OAN A;  1XCG A;  4EMO A;  4CYE A;  1V88 A;  2RLO A;  2V76 A;  3HW2 B;  2GS0 A;  5KCV A;  2CY5 A;  1XOD A;  1ZSQ A;  1WI1 A;  2ROV A;  1LW3 A;  1EF1 A;  2GJY A;  2ADZ A;  1QQG A;  2UZS A;  3ML4 A;  5GOW B;  1FAO A;  1ZC3 B;  1B55 A;  1M7E A;  1W1H A;  1UNQ A;  1W1D A;  2X18 A;  1KZ7 A;  2VKI A;  2RNR B;  4GPT B;  1P5T A;  3N7C A;  2COD A;  1OMW A;  2FJL A;  3TFM A;  1DYN A;  2P0H A;  2M14 A;  1MK7 B;  2E2X A;  5DI9 B;  3SO6 A;  4HB2 B;  3KY9 A;  2ELA A;  5KQ4 A;  3GYO A;  1PMS A;  3O96 A;  3U8Z A;  3WYF B;  1Y5O A;  5J3Y A;  1U5F A;  5HE3 A;  2NMB A;  5C5B A;  1PFJ A;  3BJI A;  4MK0 A;  4K2P A;  1X05 A;  5EFX A;  4ZRJ A;  1U2B A;  2EJ8 A;  1W1G A;  2DYQ A;  2AL6 A;  3D8E A;  2CRF A;  2HTH B;  2M38 A;  3KZ1 A;  5C6R A;  4A6F B;  2DLW A;  5D3V A;  1WJ1 A;  2OQB A;  4HB0 B;  2HE7 A;  3QIJ A;  1J0W A;  5FI1 A;  4GMV A;  2I5F A;  1U27 A;  2K00 A;  3QBV B;  4PQ0 A;  3PVL A;  3DXC A;  3M1I B;  4WVF B;  1FB8 A;  4TKN A;  4F7G A;  3A98 B;  3F0W A;  1ZC4 B;  2DYN A;  4KHB B;  3ZDT A;  3DXD A;  1SGH A;  1MIX A;  4ZRK A;  2H7D A;  1NU2 A;  1DRO A;  4K17 A;  1NI2 A;  4GMX B;  3A8P A;  2EC1 A;  1K5D B;  1QC6 A;  2VSZ A;  2BCJ A;  5JHH A;  1UNR A;  4KAX B;  2G35 A;  4HDQ A;  3CXB B;  2D9W A;  2UVM A;  2K2J A;  3P6A A;  1DDM A;  1FHW A;  1BWN A;  3ULC A;  5J3T A;  2R0D A;  2MFQ A;  1TXD A;  2J0J A;  2RUK B;  1EVH A;  2YVC A;  2D9Z A;  4DXA B;  2IFS A;  2Z0Q A;  2J0M A;  1IRS A;  3KRW A;  1Y19 B;  2RVB B;  4IAP A;  3PSC A;  1UNP A;  2IYB A;  3A8Q A;  1GC6 A;  3AJ4 A;  1FGY A;  1H10 A;  5JHG A;  3ULB A;  4GN1 A;  2LUL A;  1XKE A;  5J3Q A;  2DFK A;  4H8S A;  1NTV A;  2CY4 A;  2AEH A;  1U5E A;  2PZ1 A;  3MPX A;  2W2X C;  3HK0 A;  1I2H A;  4HAU B;  5DHF B;  2MDX A;  1X11 A;  3QWM A;  3ODO A;  4C0A A;  5C5B B;  2DTC A;  3AU5 A;  4DX9 0;  3SUZ A;  5L81 A;  5KQ1 A;  3SYX A;  1MIZ B;  3SV1 A;  4YON A;  1V61 A;  4IOY X;  1KI1 B;  4HAW B;  1X1F A;  3WA0 A;  2EMS A;  1ZM0 A;  3UZT A;  4F7U P;  1TJ6 A;  3AU4 A;  1DDW A;  4HAX B;  2J0K A;  3NSU A;  5CLL B;  1MK9 B;  4MT7 A;  2DHJ A;  3D8D A;  4KVG B;  1TQZ A;  1EGX A;  4HAT B;  2R09 A;  1UEF A;  3GYP A;  4CHM A;  3PEG A;  2EMT A;  2MKR A;  4IFS A;  2DN6 A;  4YL8 A;  5HE0 A;  5D3X A;  2I1K A;  1BTN A;  4Z2M B;  2KGX B;  1MAI A;  2D4Q A;  5LOP B;  3FM8 C;  1U5G A;  4K81 A;  1PLS A;  1Q67 A;  2Y8G A;  1X1G A;  1FGZ A;  2L1C A;  3HQC A;  1J19 A;  2P0F A;  2LYD A;  2MWN B;  1WVH A;  2YT1 A;  3KRX A;  5FI0 A;  2COC A;  1FOE A;  2QKL A; 
#chains in the Genus database with same CATH topology
 5DHA B;  2D9X A;  3PG7 A;  2D11 A;  2Z0O A;  1H4R A;  3PVW A;  1AQC A;  3T06 A;  1ISN A;  2RGN B;  4BBK A;  4WSF A;  2LG1 A;  3G9W A;  4TYZ A;  2DKQ A;  5M4Y B;  1N3H A;  1MKE A;  3CIK A;  1U5D A;  1P3R A;  4HHV A;  2GCJ A;  3PP2 A;  1RJ2 A;  1EAZ A;  3ODW A;  5LON B;  4QXA B;  4DBB A;  4A6H A;  1AWE A;  4GZU A;  3ZVR A;  2COF A;  1V89 A;  4F7H A;  4NSW A;  2DA0 A;  4L1R A;  2N23 A;  3TVV A;  2ZKM X;  4P7I A;  3X23 A;  3VOQ A;  2VRW B;  3U7D A;  1WG7 A;  4HB4 B;  2Z0P A;  5CLQ B;  4A5K A;  4A6K A;  2ROZ B;  2LKO A;  2DX5 A;  3VIA A;  2H7E A;  2DHK A;  1LB1 A;  1XX0 A;  1Z87 A;  2YF0 A;  2YS5 A;  4HB3 B;  1BAK A;  2XQN M;  2D10 A;  4Z2N A;  2COA A;  3LJU X;  3A58 A;  1OQN A;  5DIF B;  1V5P A;  4K2O A;  1WGQ A;  1UPR A;  3HSA A;  3TO1 A;  4EJN A;  4QJ3 B;  2DHI A;  1DDV A;  2J59 M;  5C16 A;  2D9Y A;  2LOX A;  1GG3 A;  4HAZ B;  4ZRI A;  1WJM A;  4HSI A;  5D27 A;  1V5M A;  3BIN A;  2D9V A;  3FEH A;  5D3W A;  4NY0 A;  2I1J A;  1FHX A;  3P7Z A;  5D3Y A;  1U29 A;  4A6F A;  4EKU A;  2K2U A;  4Y94 A;  5HE1 A;  4OT1 A;  1NTY A;  4CHJ A;  1X86 A;  2N0Y A;  1MI1 A;  2P8V A;  3OHM B;  1WGU A;  1FHO A;  2Q13 A;  2ZPY A;  3IVF A;  1I7A A;  2UZR A;  5C79 A;  2LOZ A;  4KHO A;  1XR0 B;  1DBH A;  2OTX A;  4KHB A;  2RRF A;  2DKP A;  4QJ5 B;  1KZG A;  4B6H A;  2D2Q A;  4KHA A;  4L6E A;  2KCJ A;  2GCL A;  2DX1 A;  3RCP A;  4XWX A;  2R2Y A;  5HE2 A;  3MDB C;  4OSN A;  1RRP B;  1UPQ A;  1OY2 A;  4PNK A;  1GC7 A;  2RSG A;  4GXB A;  3V5W A;  5DH9 B;  2W2W A;  3F5R A;  2KUP A;  3ODX A;  1MPH A;  3FVC A;  1M7R A;  1ZYI A;  3SNH A;  2NZ8 B;  2P0D A;  1V5U A;  2QKM A;  2JP2 A;  1XD4 A;  3PZD A;  2ELB A;  4WJ7 A;  3DXE A;  4HAV B;  1BTK A;  4DX8 A;  4HDO A;  2Y7B A;  3TCA A;  2L2I A;  2YSZ A;  3KSY A;  4D0N B;  3D8F A;  5JP4 A;  4GNK B;  3FSS A;  2KUQ A;  1SHC A;  2YT2 A;  1K5G B;  2I5C A;  2Y8F A;  2FJU B;  2YRY A;  5JLJ B;  2CAY A;  4MY6 A;  4HAY B;  2YS3 A;  2YS1 A;  1E5W A;  3NWF A;  2Z4D A;  3TW1 A;  3B77 A;  1P6S A;  5IRS A;  1ZVR A;  3U12 A;  3PVU A;  2YT0 A;  2W2X D;  3OAN A;  1XCG A;  4EMO A;  4CYE A;  1V88 A;  2RLO A;  2KR0 A;  2V76 A;  3HW2 B;  2GS0 A;  5KCV A;  2CY5 A;  1XOD A;  1ZSQ A;  1WI1 A;  2ROV A;  1LW3 A;  1EF1 A;  2GJY A;  2ADZ A;  1QQG A;  2UZS A;  3ML4 A;  5GOW B;  1FAO A;  1ZC3 B;  1B55 A;  1M7E A;  1W1H A;  1UNQ A;  1W1D A;  2X18 A;  2Z13 A;  1KZ7 A;  2VKI A;  2RNR B;  4GPT B;  1P5T A;  3N7C A;  2COD A;  1OMW A;  2FJL A;  3TFM A;  1DYN A;  2P0H A;  2M14 A;  1MK7 B;  2E2X A;  3DCX A;  5DI9 B;  3SO6 A;  4HB2 B;  3KY9 A;  2ELA A;  5I2M A;  5KQ4 A;  3GYO A;  1PMS A;  3O96 A;  2Z14 A;  3U8Z A;  3WYF B;  1Y5O A;  5J3Y A;  1U5F A;  5HE3 A;  2NMB A;  5C5B A;  1PFJ A;  4D6W A;  3BJI A;  4MK0 A;  4CSQ A;  4K2P A;  1X05 A;  5EFX A;  4ZRJ A;  1U2B A;  2EJ8 A;  2K49 A;  1W1G A;  2DYQ A;  2AL6 A;  3D8E A;  2CRF A;  2HTH B;  2M38 A;  3KZ1 A;  5C6R A;  4A6F B;  2DLW A;  5D3V A;  1WJ1 A;  2OQB A;  4HB0 B;  2HE7 A;  3QIJ A;  1J0W A;  5FI1 A;  4GMV A;  2I5F A;  1U27 A;  2K00 A;  3QBV B;  4PQ0 A;  3PVL A;  3DXC A;  3M1I B;  4WVF B;  1FB8 A;  4TKN A;  4F7G A;  3A98 B;  3F0W A;  1ZC4 B;  2DYN A;  4KHB B;  3ZDT A;  3DXD A;  1SGH A;  1MIX A;  4ZRK A;  3NWA A;  2H7D A;  1NU2 A;  1DRO A;  4K17 A;  1NI2 A;  3A8P A;  4GMX B;  2EC1 A;  1K5D B;  1QC6 A;  2VSZ A;  2BCJ A;  2K8E A;  3NWD A;  5JHH A;  1UNR A;  4KAX B;  2G35 A;  4HDQ A;  3CXB B;  2D9W A;  2UVM A;  2K2J A;  3P6A A;  3NW8 A;  1DDM A;  1FHW A;  1BWN A;  3ULC A;  5J3T A;  2R0D A;  2MFQ A;  1TXD A;  2J0J A;  2RUK B;  2GUM A;  1EVH A;  2YVC A;  2D9Z A;  2KIG A;  4DXA B;  2IFS A;  4GOU A;  5LG4 B;  2Z0Q A;  2J0M A;  1IRS A;  3KRW A;  1Y19 B;  2RVB B;  4IAP A;  3PSC A;  1UNP A;  2IYB A;  3A8Q A;  1GC6 A;  3AJ4 A;  1FGY A;  1H10 A;  2KIE A;  5JHG A;  2Z59 A;  3ULB A;  4QJ4 B;  4GN1 A;  2LUL A;  1XKE A;  5J3Q A;  2DFK A;  4H8S A;  1NTV A;  2CY4 A;  2AEH A;  1U5E A;  2PZ1 A;  3MPX A;  2W2X C;  3HK0 A;  1I2H A;  4HAU B;  5DHF B;  2MDX A;  1X11 A;  3QWM A;  3ODO A;  4C0A A;  5C5B B;  2DTC A;  3AU5 A;  4DX9 0;  3SUZ A;  5L81 A;  5KQ1 A;  3SYX A;  1MIZ B;  3SV1 A;  4YON A;  1V61 A;  4IOY X;  1KI1 B;  4HAW B;  1X1F A;  3WA0 A;  2EMS A;  1ZM0 A;  3UZT A;  4F7U P;  1TJ6 A;  3AU4 A;  1DDW A;  2J0K A;  4HAX B;  3NSU A;  5CLL B;  1MK9 B;  4MT7 A;  2DHJ A;  3D8D A;  4KVG B;  1TQZ A;  1EGX A;  4HAT B;  2R09 A;  1UEF A;  3GYP A;  4CHM A;  3PEG A;  2EMT A;  2MKR A;  4IFS A;  2DN6 A;  4YL8 A;  5HE0 A;  5D3X A;  2I1K A;  1BTN A;  4Z2M B;  5I2S A;  2KGX B;  1MAI A;  4DIX A;  2D4Q A;  3HIE A;  5LOP B;  3FM8 C;  1U5G A;  1T77 A;  4K81 A;  1PLS A;  1Q67 A;  2Y8G A;  1X1G A;  1FGZ A;  2L1C A;  3HQC A;  1J19 A;  2P0F A;  2LYD A;  2MWN B;  1WVH A;  2YT1 A;  3KRX A;  5FI0 A;  2NBV A;  2COC A;  1FOE A;  2QKL A; 
#chains in the Genus database with same CATH homology
 5DHA B;  2D9X A;  3PG7 A;  2D11 A;  2Z0O A;  1H4R A;  3PVW A;  1AQC A;  3T06 A;  1ISN A;  2RGN B;  4BBK A;  4WSF A;  2LG1 A;  3G9W A;  4TYZ A;  2DKQ A;  1N3H A;  1MKE A;  3CIK A;  1U5D A;  1P3R A;  4HHV A;  2GCJ A;  3PP2 A;  1RJ2 A;  1EAZ A;  3ODW A;  5LON B;  4DBB A;  4A6H A;  1AWE A;  4GZU A;  3ZVR A;  2COF A;  1V89 A;  4F7H A;  4NSW A;  2DA0 A;  2N23 A;  3TVV A;  4P7I A;  3X23 A;  3VOQ A;  2VRW B;  3U7D A;  1WG7 A;  4HB4 B;  2Z0P A;  5CLQ B;  4A5K A;  4A6K A;  2ROZ B;  2LKO A;  2DX5 A;  3VIA A;  2H7E A;  2DHK A;  1LB1 A;  1XX0 A;  1Z87 A;  2YF0 A;  2YS5 A;  4HB3 B;  1BAK A;  2XQN M;  2D10 A;  4Z2N A;  2COA A;  3LJU X;  1OQN A;  5DIF B;  1V5P A;  4K2O A;  1WGQ A;  1UPR A;  4EJN A;  3TO1 A;  2DHI A;  1DDV A;  2J59 M;  5C16 A;  2D9Y A;  2LOX A;  1GG3 A;  4HAZ B;  4ZRI A;  1WJM A;  5D27 A;  1V5M A;  3BIN A;  2D9V A;  3FEH A;  5D3W A;  4NY0 A;  2I1J A;  1FHX A;  3P7Z A;  5D3Y A;  1U29 A;  4A6F A;  4EKU A;  2K2U A;  4Y94 A;  5HE1 A;  1NTY A;  4CHJ A;  1X86 A;  2N0Y A;  2P8V A;  1WGU A;  1FHO A;  2Q13 A;  2ZPY A;  3IVF A;  1I7A A;  2UZR A;  5C79 A;  2LOZ A;  4KHO A;  1XR0 B;  1DBH A;  2OTX A;  2DKP A;  1KZG A;  4B6H A;  2D2Q A;  4KHA A;  4L6E A;  2KCJ A;  2GCL A;  2DX1 A;  3RCP A;  4XWX A;  5HE2 A;  3MDB C;  1UPQ A;  1RRP B;  1OY2 A;  4PNK A;  1GC7 A;  2RSG A;  4GXB A;  3V5W A;  5DH9 B;  2W2W A;  3F5R A;  2KUP A;  3ODX A;  1MPH A;  1M7R A;  3SNH A;  2NZ8 B;  2P0D A;  1V5U A;  2QKM A;  2JP2 A;  1XD4 A;  3PZD A;  2ELB A;  4WJ7 A;  3DXE A;  4HAV B;  1BTK A;  4DX8 A;  4HDO A;  2Y7B A;  3TCA A;  2L2I A;  2YSZ A;  3KSY A;  4D0N B;  3D8F A;  5JP4 A;  3FSS A;  1SHC A;  1K5G B;  2I5C A;  2Y8F A;  2YRY A;  5JLJ B;  2CAY A;  4MY6 A;  4HAY B;  2YS3 A;  2YS1 A;  1E5W A;  3TW1 A;  1P6S A;  1ZVR A;  3PVU A;  2YT0 A;  2W2X D;  3OAN A;  1XCG A;  4EMO A;  4CYE A;  1V88 A;  2RLO A;  2V76 A;  3HW2 B;  2GS0 A;  5KCV A;  2CY5 A;  1XOD A;  1ZSQ A;  1WI1 A;  2ROV A;  1LW3 A;  1EF1 A;  2GJY A;  2ADZ A;  1QQG A;  2UZS A;  3ML4 A;  5GOW B;  1FAO A;  1ZC3 B;  1B55 A;  1M7E A;  1W1H A;  1UNQ A;  1W1D A;  2X18 A;  1KZ7 A;  2VKI A;  2RNR B;  4GPT B;  1P5T A;  3N7C A;  2COD A;  1OMW A;  2FJL A;  3TFM A;  1DYN A;  2P0H A;  2M14 A;  1MK7 B;  2E2X A;  5DI9 B;  3SO6 A;  4HB2 B;  3KY9 A;  2ELA A;  5KQ4 A;  3GYO A;  1PMS A;  3O96 A;  3U8Z A;  3WYF B;  1Y5O A;  5J3Y A;  1U5F A;  5HE3 A;  2NMB A;  5C5B A;  1PFJ A;  3BJI A;  4MK0 A;  4K2P A;  1X05 A;  5EFX A;  4ZRJ A;  1U2B A;  2EJ8 A;  1W1G A;  2DYQ A;  2AL6 A;  3D8E A;  2CRF A;  2HTH B;  2M38 A;  3KZ1 A;  5C6R A;  4A6F B;  2DLW A;  5D3V A;  1WJ1 A;  2OQB A;  4HB0 B;  2HE7 A;  3QIJ A;  1J0W A;  5FI1 A;  4GMV A;  2I5F A;  1U27 A;  2K00 A;  3QBV B;  4PQ0 A;  3PVL A;  3DXC A;  3M1I B;  4WVF B;  1FB8 A;  4TKN A;  4F7G A;  3A98 B;  3F0W A;  1ZC4 B;  2DYN A;  4KHB B;  3ZDT A;  3DXD A;  1SGH A;  1MIX A;  4ZRK A;  2H7D A;  1NU2 A;  1DRO A;  4K17 A;  1NI2 A;  4GMX B;  3A8P A;  2EC1 A;  1K5D B;  1QC6 A;  2VSZ A;  2BCJ A;  5JHH A;  1UNR A;  4KAX B;  2G35 A;  4HDQ A;  3CXB B;  2D9W A;  2UVM A;  2K2J A;  3P6A A;  1DDM A;  1FHW A;  1BWN A;  3ULC A;  5J3T A;  2R0D A;  2MFQ A;  1TXD A;  2J0J A;  2RUK B;  1EVH A;  2YVC A;  2D9Z A;  4DXA B;  2IFS A;  2Z0Q A;  2J0M A;  1IRS A;  3KRW A;  1Y19 B;  2RVB B;  4IAP A;  3PSC A;  1UNP A;  2IYB A;  3A8Q A;  1GC6 A;  3AJ4 A;  1FGY A;  1H10 A;  5JHG A;  3ULB A;  4GN1 A;  2LUL A;  1XKE A;  5J3Q A;  2DFK A;  4H8S A;  1NTV A;  2CY4 A;  2AEH A;  1U5E A;  2PZ1 A;  3MPX A;  2W2X C;  3HK0 A;  1I2H A;  4HAU B;  5DHF B;  2MDX A;  1X11 A;  3QWM A;  3ODO A;  4C0A A;  5C5B B;  2DTC A;  3AU5 A;  4DX9 0;  3SUZ A;  5L81 A;  5KQ1 A;  3SYX A;  1MIZ B;  3SV1 A;  4YON A;  1V61 A;  4IOY X;  1KI1 B;  4HAW B;  1X1F A;  3WA0 A;  2EMS A;  1ZM0 A;  3UZT A;  4F7U P;  1TJ6 A;  3AU4 A;  1DDW A;  4HAX B;  2J0K A;  3NSU A;  5CLL B;  1MK9 B;  4MT7 A;  2DHJ A;  3D8D A;  4KVG B;  1TQZ A;  1EGX A;  4HAT B;  2R09 A;  1UEF A;  3GYP A;  4CHM A;  3PEG A;  2EMT A;  2MKR A;  4IFS A;  2DN6 A;  4YL8 A;  5HE0 A;  5D3X A;  2I1K A;  1BTN A;  4Z2M B;  2KGX B;  1MAI A;  2D4Q A;  5LOP B;  3FM8 C;  1U5G A;  4K81 A;  1PLS A;  1Q67 A;  2Y8G A;  1X1G A;  1FGZ A;  2L1C A;  3HQC A;  1J19 A;  2P0F A;  2LYD A;  2MWN B;  1WVH A;  2YT1 A;  3KRX A;  5FI0 A;  2COC A;  1FOE A;  2QKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...