3ML4A

Crystal structure of a complex between dok7 ph-ptb and the musk juxtamembrane region
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
208
structure length
205
Chain Sequence
b'EAALVEGQVKLRKWKSRWLVLRKPSPVADCLLMLVYKDKCERSKGLRERSSLTLEDICGLEPALPYEGLAHTLAIICLSQAVMLGFDSHEAMCAWDTRIRYALGEVHRFHVTVAPGTKLESGPATLHLCNDILVLARDIPPTVMGQWKLSDLRRYGAVPNGFIFEGGTRCGYWAGVFFLSSAEGEQMSFLFDCIVRGISPTKGPF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein Dok-7
publication title The Cytoplasmic Adaptor Protein Dok7 Activates the Receptor Tyrosine Kinase MuSK via Dimerization.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 41
structure length 205
sequence length 208
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02174 IRS PTB domain (IRS-1 type)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3ml4A01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3ml4A02
2DN6A 1WGUA 1MPHA 2J0JA 4YONA 4ZRKA 4ZRJA 1FB8A 2GJYA 4HAVB 4MK0A 2VSZA 1PLSA 2ROZB 1WI1A 4GMXB 1NTYA 4GZUA 4TKNA 2CY4A 2M38A 1PFJA 3CXBB 2E2XA 2DHKA 2RLOA 1I2HA 2Y7BA 3T06A 3PZDA 1TXDA 4DX90 3SV1A 2YS1A 1MIZB 2CRFA 4GXBA 1V89A 2D9VA 3N7CA 4Z2NA 4F7GA 2Y8FA 1XKEA 2YT1A 1XCGA 2DYNA 2DYQA 2NZ8B 2DX5A 3P6AA 5HE1A 3DXDA 1U5DA 2UZRA 5KCVA 1X11A 1MKEA 1P6SA 4IFSA 5JHHA 3ZDTA 2DTCA 1RRPB 1MK9B 1H4RA 4KHAA 3D8DA 5EFXA 4HDOA 2RUKB 2ROVA 1WVHA 1TJ6A 2D9YA 4GN1A 1NTVA 2RVBB 2LKOA 3KRXA 3KZ1A 2V76A 2R09A 2NMBA 2RSGA 1X1GA 1FOEA 2GCJA 2MWNB 1OQNA 2CODA 2VKIA 4HAXB 1U2BA 1M7EA 3A8PA 2DX1A 3PVWA 3O96A 4K2PA 3ODWA 3PVLA 1NU2A 4Z2MB 1FHWA 1V88A 4HHVA 4K81A 3AU4A 5LOPB 4HB4B 4L6EA 2DKPA 2ELBA 2DA0A 2COFA 2FJLA 4A6HA 1WJ1A 4HB3B 1KZ7A 2D9XA 3ODOA 4EJNA 2I1KA 2KCJA 1FAOA 5HE3A 2HTHB 5JLJB 2LOXA 2OQBA 1V61A 1U5GA 2ZPYA 2KUPA 3A98B 3MPXA 2UVMA 4DBBA 2UZSA 2W2WA 1WG7A 5DIFB 2I5CA 3P7ZA 2EC1A 4F7UP 3ML4A 3M1IB 1MK7B 4PQ0A 1Z87A 3ULBA 1ZC4B 2IYBA 1ZM0A 1DYNA 3ULCA 2CY5A 5HE0A 4P7IA 2K00A 4A6KA 5DHFB 2K2JA 1V5PA 3FSSA 5J3YA 3SO6A 2P0DA 4NSWA 1K5GB 4EKUA 5CLLB 2QKMA 5DI9B 4F7HA 5FI0A 2N0YA 3QWMA 3WA0A 1UNPA 2I5FA 3PP2A 4YL8A 4HB2B 1OMWA 2D9ZA 5L81A 1UNRA 4HB0B 1UPQA 2M14A 5D3VA 4GPTB 3QIJA 2AEHA 2GS0A 2H7EA 3TVVA 5C79A 4HAWB 5FI1A 4H8SA 3TFMA 1W1HA 3G9WA 3RCPA 1U5EA 3HK0A 1DROA 2DHJA 1SGHA 1AWEA 1XD4A 2P8VA 2PZ1A 2DHIA 3KSYA 4HAZB 1XR0B 1J0WA 1J19A 2AL6A 3V5WA 1EAZA 1FGYA 2Z0OA 5D3XA 5C16A 3KRWA 1DDMA 2I1JA 2MDXA 4HAYB 3MDBC 1NI2A 1OY2A 1UEFA 4D0NB 5DH9B 4WVFB 3PVUA 2D4QA 2EMTA 2N23A 4A5KA 1Y5OA 4KVGB 2LOZA 3GYPA 1E5WA 2RNRB 2YT0A 5KQ4A 4ZRIA 1BTKA 3PSCA 1AQCA 2D10A 2P0FA 5D3YA 2J0KA 1Q67A 4HATB 1GG3A 1EGXA 1H10A 3PG7A 2LG1A 1V5UA 3SNHA 1GC7A 2YSZA 1V5MA 1I7AA 2J0MA 2JP2A 4HAUB 4GMVA 3D8FA 3ZVRA 3HW2B 1U5FA 3OANA 2Q13A 4BBKA 2COAA 3NSUA 5C5BA 4MY6A 2DFKA 5D27A 3DXCA 3DXEA 1P5TA 4KHBB 3AJ4A 1Y19B 1FHOA 1W1DA 4TYZA 2D11A 3ODXA 4IAPA 4NY0A 3UZTA 2EJ8A 3X23A 5HE2A 2ELAA 1MIXA 1XX0A 2YS3A 1KZGA 2MKRA 1EF1A 2W2XC 2GCLA 1QQGA 1UNQA 3IVFA 1P3RA 2YF0A 1X86A 2DKQA 3PEGA 2CAYA 2VRWB 5J3QA 4A6FA 2YVCA 1B55A 1U27A 2ADZA 2X18A 4IOYX 4KHOA 3FEHA 2L1CA 2Z0PA 1QC6A 4CYEA 1ISNA 5J3TA 2J59M 1ZVRA 3TW1A 3VOQA 2K2UA 4MT7A 1BTNA 3SYXA 1SHCA 1X05A 1ZSQA 2LULA 5DHAB 3KY9A 5CLQB 2COCA 2L2IA 2Y8GA 1IRSA 5JHGA 3A8QA 1LB1A 2YRYA 4KAXB 2LYDA 2QKLA 3F0WA 1UPRA 2IFSA 1GC6A 2MFQA 1M7RA 2XQNM 2DLWA 1W1GA 2D2QA 3VIAA 2W2XD 2R0DA 5GOWB 1N3HA 3U8ZA 1FGZA 3GYOA 1DBHA 2D9WA 5D3WA 4EMOA 1XODA 4WSFA 3CIKA 1KI1B 3BJIA 5LONB 2G35A 4K17A 2Z0QA 5C5BB 3FM8C 2KGXB 1ZC3B 1WGQA 1WJMA 2OTXA 1BWNA 1X1FA 5C6RA 5KQ1A 3WYFB 4C0AA 2HE7A 2YS5A 4DXAB 1PMSA 1LW3A 4CHMA 1DDWA 3BINA 1MAIA 1TQZA 3U7DA 4DX8A 3D8EA 3SUZA 4HDQA 2P0HA 3LJUX 3TO1A 2BCJA 4K2OA 3HQCA 1RJ2A 1EVHA 1BAKA 2H7DA 4WJ7A 4CHJA 1U29A 4A6FB 1DDVA 3F5RA 1FHXA 4B6HA 4PNKA 4Y94A 3QBVB 3TCAA 4XWXA 1K5DB 2EMSA 3AU5A 5JP4A 2RGNB
chains in the Genus database with same CATH superfamily
2DN6A 1WGUA 1MPHA 2J0JA 4YONA 4ZRKA 4ZRJA 1FB8A 2GJYA 3HIEA 4HAVB 4MK0A 2VSZA 1PLSA 2ROZB 1WI1A 2GUMA 4GMXB 1NTYA 4GZUA 4TKNA 2CY4A 4GOUA 2M38A 1PFJA 3CXBB 2E2XA 4GNKB 2DHKA 2RLOA 1I2HA 2KR0A 2Y7BA 3T06A 3PZDA 1TXDA 4DX90 3SV1A 2YS1A 1MIZB 2CRFA 4GXBA 1V89A 2D9VA 1ZYIA 3N7CA 1MI1A 4Z2NA 4F7GA 2Y8FA 1XKEA 2YT1A 1XCGA 2DYNA 2DYQA 2NZ8B 2DX5A 3P6AA 5HE1A 3DXDA 1U5DA 2UZRA 5KCVA 2NBVA 1X11A 1MKEA 1P6SA 4IFSA 5JHHA 3ZDTA 3HSAA 2DTCA 1RRPB 1MK9B 1H4RA 4KHAA 3D8DA 5EFXA 4QXAB 4HDOA 2RUKB 2ROVA 1WVHA 1TJ6A 2D9YA 4GN1A 1NTVA 2RVBB 2LKOA 2R2YA 3KRXA 3KZ1A 2V76A 2R09A 2NMBA 2RSGA 1X1GA 1FOEA 2GCJA 2MWNB 1OQNA 2CODA 2VKIA 4HAXB 1U2BA 2YT2A 1M7EA 3A8PA 2DX1A 3PVWA 3O96A 4K2PA 3ODWA 3PVLA 4QJ4B 1NU2A 4Z2MB 1FHWA 1V88A 4HHVA 4K81A 3AU4A 4D6WA 5LOPB 4HB4B 4L6EA 2DKPA 2ELBA 2DA0A 2COFA 2FJLA 4A6HA 1WJ1A 4HB3B 2K49A 1KZ7A 2D9XA 3ODOA 4EJNA 2I1KA 2KCJA 1FAOA 5HE3A 2HTHB 5JLJB 2LOXA 4OSNA 2OQBA 1V61A 1U5GA 2ZPYA 2KUPA 3A98B 3MPXA 2UVMA 4DBBA 2UZSA 2W2WA 5IRSA 3OHMB 1WG7A 5DIFB 2I5CA 3P7ZA 2EC1A 4F7UP 3ML4A 3M1IB 1MK7B 4PQ0A 1Z87A 3ULBA 1ZC4B 2IYBA 1ZM0A 1DYNA 3ULCA 2CY5A 4KHBA 5HE0A 4P7IA 2K00A 4A6KA 5DHFB 2K2JA 1V5PA 5I2MA 3FSSA 5J3YA 3SO6A 2P0DA 4NSWA 1K5GB 4EKUA 5CLLB 2QKMA 5DI9B 4F7HA 5FI0A 2N0YA 3QWMA 3WA0A 1UNPA 2I5FA 3PP2A 4YL8A 4HB2B 1OMWA 2D9ZA 5LG4B 5L81A 2ZKMX 1UNRA 4HB0B 1UPQA 2M14A 5D3VA 4GPTB 3QIJA 2AEHA 2GS0A 2H7EA 3TVVA 5C79A 3NWDA 4HAWB 4QJ5B 5FI1A 4H8SA 3TFMA 1W1HA 3G9WA 3RCPA 1U5EA 3HK0A 1DROA 2DHJA 1SGHA 1AWEA 1XD4A 2Z59A 2P8VA 2PZ1A 2DHIA 3KSYA 4HAZB 1XR0B 1J0WA 1J19A 2AL6A 3V5WA 3B77A 1EAZA 2KIEA 1FGYA 2Z0OA 5D3XA 5C16A 3KRWA 1DDMA 2I1JA 2MDXA 4HAYB 3MDBC 1NI2A 1OY2A 1UEFA 5I2SA 4D0NB 5DH9B 2FJUB 4WVFB 3PVUA 2D4QA 2EMTA 2N23A 4A5KA 2KIGA 1Y5OA 4KVGB 2LOZA 3GYPA 1E5WA 3U12A 2RNRB 2YT0A 5KQ4A 4ZRIA 1BTKA 3PSCA 1AQCA 2RRFA 2D10A 2P0FA 5D3YA 2J0KA 1Q67A 4HATB 1GG3A 1EGXA 1H10A 3PG7A 2LG1A 1V5UA 3SNHA 1GC7A 2YSZA 1V5MA 1I7AA 2J0MA 2JP2A 2Z4DA 4GMVA 3D8FA 4HAUB 3ZVRA 3HW2B 1U5FA 3OANA 2Q13A 4BBKA 2COAA 3NSUA 5C5BA 4MY6A 2DFKA 5D27A 3DXCA 3DXEA 1P5TA 4KHBB 3AJ4A 1Y19B 1FHOA 1W1DA 4TYZA 2D11A 3ODXA 4IAPA 4HSIA 4NY0A 3UZTA 2EJ8A 3X23A 5HE2A 2ELAA 1MIXA 1XX0A 2YS3A 1KZGA 2MKRA 1EF1A 2W2XC 2GCLA 1QQGA 1UNQA 3IVFA 1P3RA 3NWFA 2YF0A 1X86A 2DKQA 3PEGA 2CAYA 2VRWB 5J3QA 4A6FA 2YVCA 3NWAA 1B55A 1U27A 2ADZA 2X18A 4IOYX 4KHOA 1T77A 3FEHA 2L1CA 2Z0PA 1QC6A 4DIXA 4CYEA 1ISNA 5J3TA 2J59M 1ZVRA 3TW1A 3VOQA 2K2UA 4MT7A 1BTNA 3SYXA 1SHCA 2KUQA 3DCXA 1X05A 1ZSQA 2LULA 5DHAB 2Z13A 3KY9A 5CLQB 2COCA 2L2IA 2Y8GA 1IRSA 5JHGA 3A8QA 1LB1A 2YRYA 4OT1A 4KAXB 2LYDA 2QKLA 3F0WA 1UPRA 2IFSA 1GC6A 2MFQA 1M7RA 2XQNM 2DLWA 1W1GA 2D2QA 3VIAA 2W2XD 2R0DA 5GOWB 4QJ3B 1N3HA 3U8ZA 1FGZA 3GYOA 1DBHA 2D9WA 3FVCA 5D3WA 1XODA 4WSFA 4EMOA 3CIKA 1KI1B 3BJIA 5LONB 2G35A 4K17A 2Z0QA 5C5BB 3FM8C 2KGXB 1ZC3B 1WGQA 1WJMA 2OTXA 1BWNA 1X1FA 2K8EA 5C6RA 5KQ1A 3WYFB 4C0AA 2HE7A 2YS5A 4DXAB 1PMSA 1LW3A 4CHMA 1DDWA 2Z14A 1MAIA 3BINA 1TQZA 3U7DA 4DX8A 3D8EA 5M4YB 3SUZA 3NW8A 4HDQA 2P0HA 3LJUX 3TO1A 2BCJA 4K2OA 3HQCA 1RJ2A 3A58A 1EVHA 1BAKA 2H7DA 4WJ7A 4CHJA 4L1RA 4CSQA 1U29A 4A6FB 1DDVA 3F5RA 1FHXA 4B6HA 4PNKA 4Y94A 3QBVB 3TCAA 4XWXA 1K5DB 2EMSA 3AU5A 5JP4A 2RGNB
chains in the Genus database with same CATH topology
2DN6A 1WGUA 1MPHA 2J0JA 4YONA 4ZRKA 4ZRJA 1FB8A 2GJYA 4HAVB 4MK0A 2VSZA 1PLSA 2ROZB 1WI1A 4GMXB 1NTYA 4GZUA 4TKNA 2CY4A 2M38A 1PFJA 3CXBB 2E2XA 2DHKA 2RLOA 1I2HA 2Y7BA 3T06A 3PZDA 1TXDA 4DX90 3SV1A 2YS1A 1MIZB 2CRFA 4GXBA 1V89A 2D9VA 3N7CA 4Z2NA 4F7GA 2Y8FA 1XKEA 2YT1A 1XCGA 2DYNA 2DYQA 2NZ8B 2DX5A 3P6AA 5HE1A 3DXDA 1U5DA 2UZRA 5KCVA 1X11A 1MKEA 1P6SA 4IFSA 5JHHA 3ZDTA 2DTCA 1RRPB 1MK9B 1H4RA 4KHAA 3D8DA 5EFXA 4HDOA 2RUKB 2ROVA 1WVHA 1TJ6A 2D9YA 4GN1A 1NTVA 2RVBB 2LKOA 3KRXA 3KZ1A 2V76A 2R09A 2NMBA 2RSGA 1X1GA 1FOEA 2GCJA 2MWNB 1OQNA 2CODA 2VKIA 4HAXB 1U2BA 1M7EA 3A8PA 2DX1A 3PVWA 3O96A 4K2PA 3ODWA 3PVLA 1NU2A 4Z2MB 1FHWA 1V88A 4HHVA 4K81A 3AU4A 5LOPB 4HB4B 4L6EA 2DKPA 2ELBA 2DA0A 2COFA 2FJLA 4A6HA 1WJ1A 4HB3B 1KZ7A 2D9XA 3ODOA 4EJNA 2I1KA 2KCJA 1FAOA 5HE3A 2HTHB 5JLJB 2LOXA 2OQBA 1V61A 1U5GA 2ZPYA 2KUPA 3A98B 3MPXA 2UVMA 4DBBA 2UZSA 2W2WA 1WG7A 5DIFB 2I5CA 3P7ZA 2EC1A 4F7UP 3ML4A 3M1IB 1MK7B 4PQ0A 1Z87A 3ULBA 1ZC4B 2IYBA 1ZM0A 1DYNA 3ULCA 2CY5A 5HE0A 4P7IA 2K00A 4A6KA 5DHFB 2K2JA 1V5PA 3FSSA 5J3YA 3SO6A 2P0DA 4NSWA 1K5GB 4EKUA 5CLLB 2QKMA 5DI9B 4F7HA 5FI0A 2N0YA 3QWMA 3WA0A 1UNPA 2I5FA 3PP2A 4YL8A 4HB2B 1OMWA 2D9ZA 5L81A 1UNRA 4HB0B 1UPQA 2M14A 5D3VA 4GPTB 3QIJA 2AEHA 2GS0A 2H7EA 3TVVA 5C79A 4HAWB 5FI1A 4H8SA 3TFMA 1W1HA 3G9WA 3RCPA 1U5EA 3HK0A 1DROA 2DHJA 1SGHA 1AWEA 1XD4A 2P8VA 2PZ1A 2DHIA 3KSYA 4HAZB 1XR0B 1J0WA 1J19A 2AL6A 3V5WA 1EAZA 1FGYA 2Z0OA 5D3XA 5C16A 3KRWA 1DDMA 2I1JA 2MDXA 4HAYB 3MDBC 1NI2A 1OY2A 1UEFA 4D0NB 5DH9B 4WVFB 3PVUA 2D4QA 2EMTA 2N23A 4A5KA 1Y5OA 4KVGB 2LOZA 3GYPA 1E5WA 2RNRB 2YT0A 5KQ4A 4ZRIA 1BTKA 3PSCA 1AQCA 2D10A 2P0FA 5D3YA 2J0KA 1Q67A 4HATB 1GG3A 1EGXA 1H10A 3PG7A 2LG1A 1V5UA 3SNHA 1GC7A 2YSZA 1V5MA 1I7AA 2J0MA 2JP2A 4HAUB 4GMVA 3D8FA 3ZVRA 3HW2B 1U5FA 3OANA 2Q13A 4BBKA 2COAA 3NSUA 5C5BA 4MY6A 2DFKA 5D27A 3DXCA 3DXEA 1P5TA 4KHBB 3AJ4A 1Y19B 1FHOA 1W1DA 4TYZA 2D11A 3ODXA 4IAPA 4NY0A 3UZTA 2EJ8A 3X23A 5HE2A 2ELAA 1MIXA 1XX0A 2YS3A 1KZGA 2MKRA 1EF1A 2W2XC 2GCLA 1QQGA 1UNQA 3IVFA 1P3RA 2YF0A 1X86A 2DKQA 3PEGA 2CAYA 2VRWB 5J3QA 4A6FA 2YVCA 1B55A 1U27A 2ADZA 2X18A 4IOYX 4KHOA 3FEHA 2L1CA 2Z0PA 1QC6A 4CYEA 1ISNA 5J3TA 2J59M 1ZVRA 3TW1A 3VOQA 2K2UA 4MT7A 1BTNA 3SYXA 1SHCA 1X05A 1ZSQA 2LULA 5DHAB 3KY9A 5CLQB 2COCA 2L2IA 2Y8GA 1IRSA 5JHGA 3A8QA 1LB1A 2YRYA 4KAXB 2LYDA 2QKLA 3F0WA 1UPRA 2IFSA 1GC6A 2MFQA 1M7RA 2XQNM 2DLWA 1W1GA 2D2QA 3VIAA 2W2XD 2R0DA 5GOWB 1N3HA 3U8ZA 1FGZA 3GYOA 1DBHA 2D9WA 5D3WA 4EMOA 1XODA 4WSFA 3CIKA 1KI1B 3BJIA 5LONB 2G35A 4K17A 2Z0QA 5C5BB 3FM8C 2KGXB 1ZC3B 1WGQA 1WJMA 2OTXA 1BWNA 1X1FA 5C6RA 5KQ1A 3WYFB 4C0AA 2HE7A 2YS5A 4DXAB 1PMSA 1LW3A 4CHMA 1DDWA 3BINA 1MAIA 1TQZA 3U7DA 4DX8A 3D8EA 3SUZA 4HDQA 2P0HA 3LJUX 3TO1A 2BCJA 4K2OA 3HQCA 1RJ2A 1EVHA 1BAKA 2H7DA 4WJ7A 4CHJA 1U29A 4A6FB 1DDVA 3F5RA 1FHXA 4B6HA 4PNKA 4Y94A 3QBVB 3TCAA 4XWXA 1K5DB 2EMSA 3AU5A 5JP4A 2RGNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DN6 A;  1WGU A;  1MPH A;  2J0J A;  4YON A;  4ZRK A;  4ZRJ A;  1FB8 A;  2GJY A;  4HAV B;  4MK0 A;  2VSZ A;  1PLS A;  2ROZ B;  1WI1 A;  4GMX B;  1NTY A;  4GZU A;  4TKN A;  2CY4 A;  2M38 A;  1PFJ A;  3CXB B;  2E2X A;  2DHK A;  2RLO A;  1I2H A;  2Y7B A;  3T06 A;  3PZD A;  1TXD A;  4DX9 0;  3SV1 A;  2YS1 A;  1MIZ B;  2CRF A;  4GXB A;  1V89 A;  2D9V A;  3N7C A;  4Z2N A;  4F7G A;  2Y8F A;  1XKE A;  2YT1 A;  1XCG A;  2DYN A;  2DYQ A;  2NZ8 B;  2DX5 A;  3P6A A;  5HE1 A;  3DXD A;  1U5D A;  2UZR A;  5KCV A;  1X11 A;  1MKE A;  1P6S A;  4IFS A;  5JHH A;  3ZDT A;  2DTC A;  1RRP B;  1MK9 B;  1H4R A;  4KHA A;  3D8D A;  5EFX A;  4HDO A;  2RUK B;  2ROV A;  1WVH A;  1TJ6 A;  2D9Y A;  4GN1 A;  1NTV A;  2RVB B;  2LKO A;  3KRX A;  3KZ1 A;  2V76 A;  2R09 A;  2NMB A;  2RSG A;  1X1G A;  1FOE A;  2GCJ A;  2MWN B;  1OQN A;  2COD A;  2VKI A;  4HAX B;  1U2B A;  1M7E A;  3A8P A;  2DX1 A;  3PVW A;  3O96 A;  4K2P A;  3ODW A;  3PVL A;  1NU2 A;  4Z2M B;  1FHW A;  1V88 A;  4HHV A;  4K81 A;  3AU4 A;  5LOP B;  4HB4 B;  4L6E A;  2DKP A;  2ELB A;  2DA0 A;  2COF A;  2FJL A;  4A6H A;  1WJ1 A;  4HB3 B;  1KZ7 A;  2D9X A;  3ODO A;  4EJN A;  2I1K A;  2KCJ A;  1FAO A;  5HE3 A;  2HTH B;  5JLJ B;  2LOX A;  2OQB A;  1V61 A;  1U5G A;  2ZPY A;  2KUP A;  3A98 B;  3MPX A;  2UVM A;  4DBB A;  2UZS A;  2W2W A;  1WG7 A;  5DIF B;  2I5C A;  3P7Z A;  2EC1 A;  4F7U P;  3ML4 A;  3M1I B;  1MK7 B;  4PQ0 A;  1Z87 A;  3ULB A;  1ZC4 B;  2IYB A;  1ZM0 A;  1DYN A;  3ULC A;  2CY5 A;  5HE0 A;  4P7I A;  2K00 A;  4A6K A;  5DHF B;  2K2J A;  1V5P A;  3FSS A;  5J3Y A;  3SO6 A;  2P0D A;  4NSW A;  1K5G B;  4EKU A;  5CLL B;  2QKM A;  5DI9 B;  4F7H A;  5FI0 A;  2N0Y A;  3QWM A;  3WA0 A;  1UNP A;  2I5F A;  3PP2 A;  4YL8 A;  4HB2 B;  1OMW A;  2D9Z A;  5L81 A;  1UNR A;  4HB0 B;  1UPQ A;  2M14 A;  5D3V A;  4GPT B;  3QIJ A;  2AEH A;  2GS0 A;  2H7E A;  3TVV A;  5C79 A;  4HAW B;  5FI1 A;  4H8S A;  3TFM A;  1W1H A;  3G9W A;  3RCP A;  1U5E A;  3HK0 A;  1DRO A;  2DHJ A;  1SGH A;  1AWE A;  1XD4 A;  2P8V A;  2PZ1 A;  2DHI A;  3KSY A;  4HAZ B;  1XR0 B;  1J0W A;  1J19 A;  2AL6 A;  3V5W A;  1EAZ A;  1FGY A;  2Z0O A;  5D3X A;  5C16 A;  3KRW A;  1DDM A;  2I1J A;  2MDX A;  4HAY B;  3MDB C;  1NI2 A;  1OY2 A;  1UEF A;  4D0N B;  5DH9 B;  4WVF B;  3PVU A;  2D4Q A;  2EMT A;  2N23 A;  4A5K A;  1Y5O A;  4KVG B;  2LOZ A;  3GYP A;  1E5W A;  2RNR B;  2YT0 A;  5KQ4 A;  4ZRI A;  1BTK A;  3PSC A;  1AQC A;  2D10 A;  2P0F A;  5D3Y A;  2J0K A;  1Q67 A;  4HAT B;  1GG3 A;  1EGX A;  1H10 A;  3PG7 A;  2LG1 A;  1V5U A;  3SNH A;  1GC7 A;  2YSZ A;  1V5M A;  1I7A A;  2J0M A;  2JP2 A;  4HAU B;  4GMV A;  3D8F A;  3ZVR A;  3HW2 B;  1U5F A;  3OAN A;  2Q13 A;  4BBK A;  2COA A;  3NSU A;  5C5B A;  4MY6 A;  2DFK A;  5D27 A;  3DXC A;  3DXE A;  1P5T A;  4KHB B;  3AJ4 A;  1Y19 B;  1FHO A;  1W1D A;  4TYZ A;  2D11 A;  3ODX A;  4IAP A;  4NY0 A;  3UZT A;  2EJ8 A;  3X23 A;  5HE2 A;  2ELA A;  1MIX A;  1XX0 A;  2YS3 A;  1KZG A;  2MKR A;  1EF1 A;  2W2X C;  2GCL A;  1QQG A;  1UNQ A;  3IVF A;  1P3R A;  2YF0 A;  1X86 A;  2DKQ A;  3PEG A;  2CAY A;  2VRW B;  5J3Q A;  4A6F A;  2YVC A;  1B55 A;  1U27 A;  2ADZ A;  2X18 A;  4IOY X;  4KHO A;  3FEH A;  2L1C A;  2Z0P A;  1QC6 A;  4CYE A;  1ISN A;  5J3T A;  2J59 M;  1ZVR A;  3TW1 A;  3VOQ A;  2K2U A;  4MT7 A;  1BTN A;  3SYX A;  1SHC A;  1X05 A;  1ZSQ A;  2LUL A;  5DHA B;  3KY9 A;  5CLQ B;  2COC A;  2L2I A;  2Y8G A;  1IRS A;  5JHG A;  3A8Q A;  1LB1 A;  2YRY A;  4KAX B;  2LYD A;  2QKL A;  3F0W A;  1UPR A;  2IFS A;  1GC6 A;  2MFQ A;  1M7R A;  2XQN M;  2DLW A;  1W1G A;  2D2Q A;  3VIA A;  2W2X D;  2R0D A;  5GOW B;  1N3H A;  3U8Z A;  1FGZ A;  3GYO A;  1DBH A;  2D9W A;  5D3W A;  4EMO A;  1XOD A;  4WSF A;  3CIK A;  1KI1 B;  3BJI A;  5LON B;  2G35 A;  4K17 A;  2Z0Q A;  5C5B B;  3FM8 C;  2KGX B;  1ZC3 B;  1WGQ A;  1WJM A;  2OTX A;  1BWN A;  1X1F A;  5C6R A;  5KQ1 A;  3WYF B;  4C0A A;  2HE7 A;  2YS5 A;  4DXA B;  1PMS A;  1LW3 A;  4CHM A;  1DDW A;  3BIN A;  1MAI A;  1TQZ A;  3U7D A;  4DX8 A;  3D8E A;  3SUZ A;  4HDQ A;  2P0H A;  3LJU X;  3TO1 A;  2BCJ A;  4K2O A;  3HQC A;  1RJ2 A;  1EVH A;  1BAK A;  2H7D A;  4WJ7 A;  4CHJ A;  1U29 A;  4A6F B;  1DDV A;  3F5R A;  1FHX A;  4B6H A;  4PNK A;  4Y94 A;  3QBV B;  3TCA A;  4XWX A;  1K5D B;  2EMS A;  3AU5 A;  5JP4 A;  2RGN B; 
#chains in the Genus database with same CATH topology
 2DN6 A;  1WGU A;  1MPH A;  2J0J A;  4YON A;  4ZRK A;  4ZRJ A;  1FB8 A;  2GJY A;  3HIE A;  4HAV B;  4MK0 A;  2VSZ A;  1PLS A;  2ROZ B;  1WI1 A;  2GUM A;  4GMX B;  1NTY A;  4GZU A;  4TKN A;  2CY4 A;  4GOU A;  2M38 A;  1PFJ A;  3CXB B;  2E2X A;  4GNK B;  2DHK A;  2RLO A;  1I2H A;  2KR0 A;  2Y7B A;  3T06 A;  3PZD A;  1TXD A;  4DX9 0;  3SV1 A;  2YS1 A;  1MIZ B;  2CRF A;  4GXB A;  1V89 A;  2D9V A;  1ZYI A;  3N7C A;  1MI1 A;  4Z2N A;  4F7G A;  2Y8F A;  1XKE A;  2YT1 A;  1XCG A;  2DYN A;  2DYQ A;  2NZ8 B;  2DX5 A;  3P6A A;  5HE1 A;  3DXD A;  1U5D A;  2UZR A;  5KCV A;  2NBV A;  1X11 A;  1MKE A;  1P6S A;  4IFS A;  5JHH A;  3ZDT A;  3HSA A;  2DTC A;  1RRP B;  1MK9 B;  1H4R A;  4KHA A;  3D8D A;  5EFX A;  4QXA B;  4HDO A;  2RUK B;  2ROV A;  1WVH A;  1TJ6 A;  2D9Y A;  4GN1 A;  1NTV A;  2RVB B;  2LKO A;  2R2Y A;  3KRX A;  3KZ1 A;  2V76 A;  2R09 A;  2NMB A;  2RSG A;  1X1G A;  1FOE A;  2GCJ A;  2MWN B;  1OQN A;  2COD A;  2VKI A;  4HAX B;  1U2B A;  2YT2 A;  1M7E A;  3A8P A;  2DX1 A;  3PVW A;  3O96 A;  4K2P A;  3ODW A;  3PVL A;  4QJ4 B;  1NU2 A;  4Z2M B;  1FHW A;  1V88 A;  4HHV A;  4K81 A;  3AU4 A;  4D6W A;  5LOP B;  4HB4 B;  4L6E A;  2DKP A;  2ELB A;  2DA0 A;  2COF A;  2FJL A;  4A6H A;  1WJ1 A;  4HB3 B;  2K49 A;  1KZ7 A;  2D9X A;  3ODO A;  4EJN A;  2I1K A;  2KCJ A;  1FAO A;  5HE3 A;  2HTH B;  5JLJ B;  2LOX A;  4OSN A;  2OQB A;  1V61 A;  1U5G A;  2ZPY A;  2KUP A;  3A98 B;  3MPX A;  2UVM A;  4DBB A;  2UZS A;  2W2W A;  5IRS A;  3OHM B;  1WG7 A;  5DIF B;  2I5C A;  3P7Z A;  2EC1 A;  4F7U P;  3ML4 A;  3M1I B;  1MK7 B;  4PQ0 A;  1Z87 A;  3ULB A;  1ZC4 B;  2IYB A;  1ZM0 A;  1DYN A;  3ULC A;  2CY5 A;  4KHB A;  5HE0 A;  4P7I A;  2K00 A;  4A6K A;  5DHF B;  2K2J A;  1V5P A;  5I2M A;  3FSS A;  5J3Y A;  3SO6 A;  2P0D A;  4NSW A;  1K5G B;  4EKU A;  5CLL B;  2QKM A;  5DI9 B;  4F7H A;  5FI0 A;  2N0Y A;  3QWM A;  3WA0 A;  1UNP A;  2I5F A;  3PP2 A;  4YL8 A;  4HB2 B;  1OMW A;  2D9Z A;  5LG4 B;  5L81 A;  2ZKM X;  1UNR A;  4HB0 B;  1UPQ A;  2M14 A;  5D3V A;  4GPT B;  3QIJ A;  2AEH A;  2GS0 A;  2H7E A;  3TVV A;  5C79 A;  3NWD A;  4HAW B;  4QJ5 B;  5FI1 A;  4H8S A;  3TFM A;  1W1H A;  3G9W A;  3RCP A;  1U5E A;  3HK0 A;  1DRO A;  2DHJ A;  1SGH A;  1AWE A;  1XD4 A;  2Z59 A;  2P8V A;  2PZ1 A;  2DHI A;  3KSY A;  4HAZ B;  1XR0 B;  1J0W A;  1J19 A;  2AL6 A;  3V5W A;  3B77 A;  1EAZ A;  2KIE A;  1FGY A;  2Z0O A;  5D3X A;  5C16 A;  3KRW A;  1DDM A;  2I1J A;  2MDX A;  4HAY B;  3MDB C;  1NI2 A;  1OY2 A;  1UEF A;  5I2S A;  4D0N B;  5DH9 B;  2FJU B;  4WVF B;  3PVU A;  2D4Q A;  2EMT A;  2N23 A;  4A5K A;  2KIG A;  1Y5O A;  4KVG B;  2LOZ A;  3GYP A;  1E5W A;  3U12 A;  2RNR B;  2YT0 A;  5KQ4 A;  4ZRI A;  1BTK A;  3PSC A;  1AQC A;  2RRF A;  2D10 A;  2P0F A;  5D3Y A;  2J0K A;  1Q67 A;  4HAT B;  1GG3 A;  1EGX A;  1H10 A;  3PG7 A;  2LG1 A;  1V5U A;  3SNH A;  1GC7 A;  2YSZ A;  1V5M A;  1I7A A;  2J0M A;  2JP2 A;  2Z4D A;  4GMV A;  3D8F A;  4HAU B;  3ZVR A;  3HW2 B;  1U5F A;  3OAN A;  2Q13 A;  4BBK A;  2COA A;  3NSU A;  5C5B A;  4MY6 A;  2DFK A;  5D27 A;  3DXC A;  3DXE A;  1P5T A;  4KHB B;  3AJ4 A;  1Y19 B;  1FHO A;  1W1D A;  4TYZ A;  2D11 A;  3ODX A;  4IAP A;  4HSI A;  4NY0 A;  3UZT A;  2EJ8 A;  3X23 A;  5HE2 A;  2ELA A;  1MIX A;  1XX0 A;  2YS3 A;  1KZG A;  2MKR A;  1EF1 A;  2W2X C;  2GCL A;  1QQG A;  1UNQ A;  3IVF A;  1P3R A;  3NWF A;  2YF0 A;  1X86 A;  2DKQ A;  3PEG A;  2CAY A;  2VRW B;  5J3Q A;  4A6F A;  2YVC A;  3NWA A;  1B55 A;  1U27 A;  2ADZ A;  2X18 A;  4IOY X;  4KHO A;  1T77 A;  3FEH A;  2L1C A;  2Z0P A;  1QC6 A;  4DIX A;  4CYE A;  1ISN A;  5J3T A;  2J59 M;  1ZVR A;  3TW1 A;  3VOQ A;  2K2U A;  4MT7 A;  1BTN A;  3SYX A;  1SHC A;  2KUQ A;  3DCX A;  1X05 A;  1ZSQ A;  2LUL A;  5DHA B;  2Z13 A;  3KY9 A;  5CLQ B;  2COC A;  2L2I A;  2Y8G A;  1IRS A;  5JHG A;  3A8Q A;  1LB1 A;  2YRY A;  4OT1 A;  4KAX B;  2LYD A;  2QKL A;  3F0W A;  1UPR A;  2IFS A;  1GC6 A;  2MFQ A;  1M7R A;  2XQN M;  2DLW A;  1W1G A;  2D2Q A;  3VIA A;  2W2X D;  2R0D A;  5GOW B;  4QJ3 B;  1N3H A;  3U8Z A;  1FGZ A;  3GYO A;  1DBH A;  2D9W A;  3FVC A;  5D3W A;  1XOD A;  4WSF A;  4EMO A;  3CIK A;  1KI1 B;  3BJI A;  5LON B;  2G35 A;  4K17 A;  2Z0Q A;  5C5B B;  3FM8 C;  2KGX B;  1ZC3 B;  1WGQ A;  1WJM A;  2OTX A;  1BWN A;  1X1F A;  2K8E A;  5C6R A;  5KQ1 A;  3WYF B;  4C0A A;  2HE7 A;  2YS5 A;  4DXA B;  1PMS A;  1LW3 A;  4CHM A;  1DDW A;  2Z14 A;  1MAI A;  3BIN A;  1TQZ A;  3U7D A;  4DX8 A;  3D8E A;  5M4Y B;  3SUZ A;  3NW8 A;  4HDQ A;  2P0H A;  3LJU X;  3TO1 A;  2BCJ A;  4K2O A;  3HQC A;  1RJ2 A;  3A58 A;  1EVH A;  1BAK A;  2H7D A;  4WJ7 A;  4CHJ A;  4L1R A;  4CSQ A;  1U29 A;  4A6F B;  1DDV A;  3F5R A;  1FHX A;  4B6H A;  4PNK A;  4Y94 A;  3QBV B;  3TCA A;  4XWX A;  1K5D B;  2EMS A;  3AU5 A;  5JP4 A;  2RGN B; 
#chains in the Genus database with same CATH homology
 2DN6 A;  1WGU A;  1MPH A;  2J0J A;  4YON A;  4ZRK A;  4ZRJ A;  1FB8 A;  2GJY A;  4HAV B;  4MK0 A;  2VSZ A;  1PLS A;  2ROZ B;  1WI1 A;  4GMX B;  1NTY A;  4GZU A;  4TKN A;  2CY4 A;  2M38 A;  1PFJ A;  3CXB B;  2E2X A;  2DHK A;  2RLO A;  1I2H A;  2Y7B A;  3T06 A;  3PZD A;  1TXD A;  4DX9 0;  3SV1 A;  2YS1 A;  1MIZ B;  2CRF A;  4GXB A;  1V89 A;  2D9V A;  3N7C A;  4Z2N A;  4F7G A;  2Y8F A;  1XKE A;  2YT1 A;  1XCG A;  2DYN A;  2DYQ A;  2NZ8 B;  2DX5 A;  3P6A A;  5HE1 A;  3DXD A;  1U5D A;  2UZR A;  5KCV A;  1X11 A;  1MKE A;  1P6S A;  4IFS A;  5JHH A;  3ZDT A;  2DTC A;  1RRP B;  1MK9 B;  1H4R A;  4KHA A;  3D8D A;  5EFX A;  4HDO A;  2RUK B;  2ROV A;  1WVH A;  1TJ6 A;  2D9Y A;  4GN1 A;  1NTV A;  2RVB B;  2LKO A;  3KRX A;  3KZ1 A;  2V76 A;  2R09 A;  2NMB A;  2RSG A;  1X1G A;  1FOE A;  2GCJ A;  2MWN B;  1OQN A;  2COD A;  2VKI A;  4HAX B;  1U2B A;  1M7E A;  3A8P A;  2DX1 A;  3PVW A;  3O96 A;  4K2P A;  3ODW A;  3PVL A;  1NU2 A;  4Z2M B;  1FHW A;  1V88 A;  4HHV A;  4K81 A;  3AU4 A;  5LOP B;  4HB4 B;  4L6E A;  2DKP A;  2ELB A;  2DA0 A;  2COF A;  2FJL A;  4A6H A;  1WJ1 A;  4HB3 B;  1KZ7 A;  2D9X A;  3ODO A;  4EJN A;  2I1K A;  2KCJ A;  1FAO A;  5HE3 A;  2HTH B;  5JLJ B;  2LOX A;  2OQB A;  1V61 A;  1U5G A;  2ZPY A;  2KUP A;  3A98 B;  3MPX A;  2UVM A;  4DBB A;  2UZS A;  2W2W A;  1WG7 A;  5DIF B;  2I5C A;  3P7Z A;  2EC1 A;  4F7U P;  3ML4 A;  3M1I B;  1MK7 B;  4PQ0 A;  1Z87 A;  3ULB A;  1ZC4 B;  2IYB A;  1ZM0 A;  1DYN A;  3ULC A;  2CY5 A;  5HE0 A;  4P7I A;  2K00 A;  4A6K A;  5DHF B;  2K2J A;  1V5P A;  3FSS A;  5J3Y A;  3SO6 A;  2P0D A;  4NSW A;  1K5G B;  4EKU A;  5CLL B;  2QKM A;  5DI9 B;  4F7H A;  5FI0 A;  2N0Y A;  3QWM A;  3WA0 A;  1UNP A;  2I5F A;  3PP2 A;  4YL8 A;  4HB2 B;  1OMW A;  2D9Z A;  5L81 A;  1UNR A;  4HB0 B;  1UPQ A;  2M14 A;  5D3V A;  4GPT B;  3QIJ A;  2AEH A;  2GS0 A;  2H7E A;  3TVV A;  5C79 A;  4HAW B;  5FI1 A;  4H8S A;  3TFM A;  1W1H A;  3G9W A;  3RCP A;  1U5E A;  3HK0 A;  1DRO A;  2DHJ A;  1SGH A;  1AWE A;  1XD4 A;  2P8V A;  2PZ1 A;  2DHI A;  3KSY A;  4HAZ B;  1XR0 B;  1J0W A;  1J19 A;  2AL6 A;  3V5W A;  1EAZ A;  1FGY A;  2Z0O A;  5D3X A;  5C16 A;  3KRW A;  1DDM A;  2I1J A;  2MDX A;  4HAY B;  3MDB C;  1NI2 A;  1OY2 A;  1UEF A;  4D0N B;  5DH9 B;  4WVF B;  3PVU A;  2D4Q A;  2EMT A;  2N23 A;  4A5K A;  1Y5O A;  4KVG B;  2LOZ A;  3GYP A;  1E5W A;  2RNR B;  2YT0 A;  5KQ4 A;  4ZRI A;  1BTK A;  3PSC A;  1AQC A;  2D10 A;  2P0F A;  5D3Y A;  2J0K A;  1Q67 A;  4HAT B;  1GG3 A;  1EGX A;  1H10 A;  3PG7 A;  2LG1 A;  1V5U A;  3SNH A;  1GC7 A;  2YSZ A;  1V5M A;  1I7A A;  2J0M A;  2JP2 A;  4HAU B;  4GMV A;  3D8F A;  3ZVR A;  3HW2 B;  1U5F A;  3OAN A;  2Q13 A;  4BBK A;  2COA A;  3NSU A;  5C5B A;  4MY6 A;  2DFK A;  5D27 A;  3DXC A;  3DXE A;  1P5T A;  4KHB B;  3AJ4 A;  1Y19 B;  1FHO A;  1W1D A;  4TYZ A;  2D11 A;  3ODX A;  4IAP A;  4NY0 A;  3UZT A;  2EJ8 A;  3X23 A;  5HE2 A;  2ELA A;  1MIX A;  1XX0 A;  2YS3 A;  1KZG A;  2MKR A;  1EF1 A;  2W2X C;  2GCL A;  1QQG A;  1UNQ A;  3IVF A;  1P3R A;  2YF0 A;  1X86 A;  2DKQ A;  3PEG A;  2CAY A;  2VRW B;  5J3Q A;  4A6F A;  2YVC A;  1B55 A;  1U27 A;  2ADZ A;  2X18 A;  4IOY X;  4KHO A;  3FEH A;  2L1C A;  2Z0P A;  1QC6 A;  4CYE A;  1ISN A;  5J3T A;  2J59 M;  1ZVR A;  3TW1 A;  3VOQ A;  2K2U A;  4MT7 A;  1BTN A;  3SYX A;  1SHC A;  1X05 A;  1ZSQ A;  2LUL A;  5DHA B;  3KY9 A;  5CLQ B;  2COC A;  2L2I A;  2Y8G A;  1IRS A;  5JHG A;  3A8Q A;  1LB1 A;  2YRY A;  4KAX B;  2LYD A;  2QKL A;  3F0W A;  1UPR A;  2IFS A;  1GC6 A;  2MFQ A;  1M7R A;  2XQN M;  2DLW A;  1W1G A;  2D2Q A;  3VIA A;  2W2X D;  2R0D A;  5GOW B;  1N3H A;  3U8Z A;  1FGZ A;  3GYO A;  1DBH A;  2D9W A;  5D3W A;  4EMO A;  1XOD A;  4WSF A;  3CIK A;  1KI1 B;  3BJI A;  5LON B;  2G35 A;  4K17 A;  2Z0Q A;  5C5B B;  3FM8 C;  2KGX B;  1ZC3 B;  1WGQ A;  1WJM A;  2OTX A;  1BWN A;  1X1F A;  5C6R A;  5KQ1 A;  3WYF B;  4C0A A;  2HE7 A;  2YS5 A;  4DXA B;  1PMS A;  1LW3 A;  4CHM A;  1DDW A;  3BIN A;  1MAI A;  1TQZ A;  3U7D A;  4DX8 A;  3D8E A;  3SUZ A;  4HDQ A;  2P0H A;  3LJU X;  3TO1 A;  2BCJ A;  4K2O A;  3HQC A;  1RJ2 A;  1EVH A;  1BAK A;  2H7D A;  4WJ7 A;  4CHJ A;  1U29 A;  4A6F B;  1DDV A;  3F5R A;  1FHX A;  4B6H A;  4PNK A;  4Y94 A;  3QBV B;  3TCA A;  4XWX A;  1K5D B;  2EMS A;  3AU5 A;  5JP4 A;  2RGN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...