3ML4A

Crystal structure of a complex between dok7 ph-ptb and the musk juxtamembrane region
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
208
structure length
205
Chain Sequence
EAALVEGQVKLRKWKSRWLVLRKPSPVADCLLMLVYKDKCERSKGLRERSSLTLEDICGLEPALPYEGLAHTLAIICLSQAVMLGFDSHEAMCAWDTRIRYALGEVHRFHVTVAPGTKLESGPATLHLCNDILVLARDIPPTVMGQWKLSDLRRYGAVPNGFIFEGGTRCGYWAGVFFLSSAEGEQMSFLFDCIVRGISPTKGPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein Dok-7
publication title The Cytoplasmic Adaptor Protein Dok7 Activates the Receptor Tyrosine Kinase MuSK via Dimerization.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 41
structure length 205
sequence length 208
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02174 IRS PTB domain (IRS-1 type)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3ml4A01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3ml4A02
3DXDA 1MK7B 2L2IA 1ZSQA 2YS3A 1H10A 3MDBC 4HAUB 4IAPA 1DYNA 5J3YA 4GPTB 4A6FA 2EC1A 3A8PA 1UNPA 1N3HA 2KUPA 4PNKA 2RNRB 1TXDA 1H4RA 3ULCA 2Z0OA 4KHOA 1BWNA 2XQNM 1XD4A 5J3QA 4CYEA 2FJLA 4ZRKA 4GZUA 2J59M 1W1HA 4DX90 4HHVA 2LOXA 2LULA 1PMSA 1U2BA 2EJ8A 2YVCA 1OMWA 4Y94A 5HE2A 2Z0QA 2NMBA 4HDOA 3ZDTA 2ROZB 3ML4A 1GC7A 1AQCA 2QKLA 1BAKA 5DHFB 5D3WA 2VKIA 1P5TA 3BINA 1MK9B 2DHKA 1KI1B 1X1GA 2LOZA 5C79A 2AEHA 1DDMA 3N7CA 4IOYX 2MKRA 4F7HA 2J0KA 1FGZA 5C16A 1U29A 4GMVA 3PZDA 3AU4A 3V5WA 1U27A 2D9ZA 2YF0A 2Y7BA 4HATB 2V76A 2HTHB 3ODOA 1DBHA 3HQCA 1MIZB 1X05A 1FB8A 2D9XA 2JP2A 4C0AA 4B6HA 1XX0A 2DYNA 1Y5OA 2DA0A 3LJUX 2Y8GA 2COAA 3SNHA 1RRPB 2ADZA 1WVHA 2D9WA 2R0DA 3PVLA 4H8SA 2RVBB 3KRXA 3X23A 2CY4A 1PLSA 1EF1A 5J3TA 2EMSA 4K81A 1AWEA 3GYOA 2R09A 2EMTA 3CIKA 4MK0A 5EFXA 3FSSA 3IVFA 2M14A 5DHAB 1P6SA 1MKEA 2UZSA 2GS0A 4F7UP 2DTCA 4DX8A 2MDXA 5JHGA 3CXBB 3QIJA 2H7EA 4CHJA 3QBVB 1SHCA 2P0DA 5C5BA 2G35A 3TO1A 3TFMA 2YS5A 1GC6A 1Z87A 3WA0A 4EKUA 1FHOA 5GOWB 2DFKA 2DYQA 2OQBA 4YL8A 3U8ZA 2RSGA 3HK0A 5KQ4A 2K2UA 2W2XC 3MPXA 3UZTA 2D4QA 5JLJB 2Y8FA 2GJYA 1UPRA 1I7AA 2COFA 2D9YA 2DHIA 2ROVA 5CLQB 3RCPA 2N0YA 2D11A 4IFSA 4A6FB 5HE1A 2DLWA 2LG1A 3SYXA 3P6AA 4KHBB 4HB0B 4GMXB 4YONA 3AU5A 2J0MA 1V5PA 3F0WA 1K5DB 5FI0A 3M1IB 4DBBA 2MWNB 2KGXB 4HB4B 2UZRA 2DN6A 3PG7A 3G9WA 4P7IA 3PEGA 1EVHA 2D2QA 3P7ZA 1X11A 1P3RA 4F7GA 1QQGA 3WYFB 2RLOA 3SUZA 1U5FA 4L6EA 4Z2MB 1ZVRA 3PVWA 1XR0B 3ZVRA 3DXCA 1QC6A 4D0NB 1UNQA 1UEFA 4HAXB 2YT1A 3VOQA 1TJ6A 1V61A 1X1FA 1V89A 1TQZA 2IFSA 3HW2B 1BTKA 4WSFA 4XWXA 1DDVA 2CY5A 2Q13A 3ODWA 2H7DA 1Y19B 3OANA 5HE0A 5JHHA 5FI1A 4HB2B 1DDWA 2OTXA 1EGXA 4Z2NA 2HE7A 2N23A 5LONB 2VRWB 1X86A 4ZRIA 3O96A 2I5FA 2J0JA 1DROA 2L1CA 1NTYA 1UNRA 1ZC4B 4GXBA 4PQ0A 2AL6A 2YSZA 3PP2A 4KVGB 2YRYA 1E5WA 1J19A 1FGYA 4WJ7A 1K5GB 2K00A 2CRFA 2UVMA 2VSZA 5L81A 4HAWB 1FHXA 2W2XD 1NU2A 2W2WA 4NY0A 5D3VA 5DI9B 1ISNA 1WGQA 3KSYA 5C5BB 3TVVA 3KZ1A 3NSUA 4MY6A 5HE3A 3SV1A 1I2HA 3F5RA 1KZ7A 1RJ2A 4NSWA 3A8QA 1V88A 3SO6A 2X18A 3AJ4A 2DHJA 2ZPYA 2K2JA 5LOPB 1NI2A 2PZ1A 2I1KA 2QKMA 1OQNA 1XCGA 1WI1A 4K2OA 1W1DA 1LB1A 1KZGA 2LKOA 1V5MA 4HAYB 5DH9B 2NZ8B 2D9VA 1WJMA 4DXAB 2BCJA 2P8VA 4HAVB 2GCLA 2DKPA 2MFQA 2RUKB 1OY2A 3TCAA 1FAOA 1FHWA 1ZC3B 4TKNA 3GYPA 1LW3A 4KAXB 3VIAA 2YS1A 4K2PA 2YT0A 2I5CA 1M7RA 2KCJA 4EJNA 3D8DA 1ZM0A 5D27A 3KY9A 1WJ1A 4TYZA 5D3YA 2DX1A 3QWMA 5JP4A 2IYBA 3ODXA 3KRWA 3FEHA 1XODA 1V5UA 2ELAA 4KHAA 3BJIA 2ELBA 2RGNB 3D8EA 2P0FA 1U5EA 2CODA 2P0HA 1EAZA 2CAYA 1MPHA 1U5DA 1MAIA 1MIXA 1Q67A 3DXEA 4GN1A 4MT7A 1FOEA 4ZRJA 2D10A 4HB3B 1BTNA 3T06A 1WGUA 3A98B 2E2XA 1U5GA 4A6KA 1IRSA 1WG7A 1J0WA 2M38A 5DIFB 5CLLB 4HAZB 2DKQA 4A5KA 4A6HA 4WVFB 3D8FA 2LYDA 4CHMA 1SGHA 5KQ1A 2DX5A 2GCJA 3PSCA 5D3XA 1M7EA 2COCA 4K17A 3FM8C 1W1GA 1PFJA 5KCVA 1XKEA 4EMOA 3TW1A 3ULBA 5C6RA 3U7DA 1UPQA 1B55A 2I1JA 4HDQA 4BBKA 1GG3A 3PVUA 2Z0PA 1NTVA
chains in the Genus database with same CATH superfamily
3DXDA 2Z4DA 1MK7B 2L2IA 1ZSQA 3DCXA 2YS3A 3OHMB 1H10A 3MDBC 4HAUB 4IAPA 1DYNA 5J3YA 4GPTB 4A6FA 2EC1A 4DIXA 3A8PA 1UNPA 4KHBA 1N3HA 2KUPA 4PNKA 2RNRB 1TXDA 1H4RA 3ULCA 2Z0OA 4KHOA 1BWNA 4CSQA 2XQNM 1XD4A 5J3QA 4CYEA 2FJLA 4ZRKA 4GZUA 2J59M 1W1HA 1T77A 4DX90 4HHVA 2LOXA 2LULA 1PMSA 1U2BA 2EJ8A 2YVCA 1OMWA 4Y94A 5HE2A 4HSIA 2Z0QA 2NMBA 4HDOA 3ZDTA 2ROZB 3ML4A 1GC7A 1AQCA 2QKLA 5I2MA 1BAKA 5DHFB 5D3WA 2VKIA 1P5TA 3BINA 1MK9B 2DHKA 1KI1B 1X1GA 2LOZA 5C79A 2AEHA 1DDMA 3N7CA 4IOYX 2MKRA 4F7HA 2J0KA 1FGZA 5C16A 1U29A 4GMVA 3PZDA 3AU4A 3V5WA 1U27A 2D9ZA 2YF0A 2Y7BA 4HATB 2V76A 2HTHB 3ODOA 1DBHA 3HQCA 1MIZB 1X05A 1FB8A 2D9XA 2JP2A 4C0AA 4B6HA 1XX0A 2DYNA 1Y5OA 2DA0A 2KIGA 2Y8GA 3LJUX 2COAA 3SNHA 1RRPB 2ADZA 1WVHA 2D9WA 2R0DA 3PVLA 4H8SA 2RVBB 2FJUB 3KRXA 3X23A 2CY4A 1PLSA 1EF1A 5J3TA 4QXAB 2EMSA 4K81A 1AWEA 3GYOA 2R09A 2EMTA 3CIKA 4MK0A 5EFXA 3FSSA 3IVFA 2M14A 5DHAB 1P6SA 1MKEA 2UZSA 2GS0A 4F7UP 2DTCA 4DX8A 2MDXA 2R2YA 5JHGA 2Z13A 3CXBB 3QIJA 5M4YB 2H7EA 4CHJA 3QBVB 3NWAA 1SHCA 2P0DA 5C5BA 2KR0A 2G35A 3TO1A 3TFMA 2YS5A 2KUQA 1GC6A 1Z87A 3WA0A 4EKUA 1FHOA 5GOWB 2DFKA 1MI1A 2DYQA 2OQBA 4YL8A 3U8ZA 2RSGA 3HK0A 5KQ4A 2K2UA 2W2XC 3MPXA 3UZTA 2D4QA 5JLJB 2Y8FA 2GJYA 1UPRA 1I7AA 2COFA 2D9YA 2DHIA 2ROVA 5CLQB 3RCPA 2N0YA 2D11A 4IFSA 4A6FB 5HE1A 2DLWA 2LG1A 3SYXA 3P6AA 4KHBB 4HB0B 4GMXB 4YONA 3AU5A 2J0MA 1V5PA 3F0WA 1K5DB 5FI0A 5I2SA 3M1IB 4DBBA 4QJ4B 2MWNB 2KGXB 4HB4B 2UZRA 2DN6A 3G9WA 3PG7A 4P7IA 3PEGA 1EVHA 2D2QA 2GUMA 3P7ZA 1X11A 1P3RA 4F7GA 1QQGA 3WYFB 2RLOA 3SUZA 1U5FA 4L6EA 4Z2MB 2K8EA 1ZVRA 3PVWA 1XR0B 3ZVRA 3DXCA 1QC6A 3HSAA 4D0NB 3U12A 1UNQA 1UEFA 4HAXB 2YT1A 3VOQA 1TJ6A 1V61A 1X1FA 1V89A 1TQZA 2IFSA 3HW2B 5LG4B 1BTKA 3A58A 4WSFA 4XWXA 1DDVA 2CY5A 2Q13A 3ODWA 2H7DA 1Y19B 3OANA 5HE0A 5JHHA 5FI1A 4HB2B 1DDWA 2OTXA 1EGXA 2ZKMX 4Z2NA 2HE7A 2N23A 5LONB 2VRWB 1X86A 4ZRIA 3O96A 2I5FA 2J0JA 1DROA 4GOUA 2NBVA 4OT1A 2L1CA 1NTYA 1UNRA 3HIEA 1ZC4B 4GXBA 4PQ0A 2AL6A 2YSZA 3PP2A 4KVGB 2YRYA 1E5WA 1J19A 2RRFA 1FGYA 4WJ7A 1K5GB 2K00A 2CRFA 2UVMA 2VSZA 5L81A 4HAWB 1FHXA 2W2XD 1NU2A 2W2WA 4NY0A 5D3VA 5DI9B 1ISNA 1WGQA 3KSYA 4L1RA 5C5BB 3TVVA 3NW8A 3KZ1A 3NSUA 4MY6A 5HE3A 3SV1A 1I2HA 3F5RA 1KZ7A 1RJ2A 4NSWA 3A8QA 1V88A 3SO6A 2X18A 3AJ4A 2Z14A 2DHJA 2ZPYA 2K2JA 5LOPB 1NI2A 2PZ1A 2I1KA 2QKMA 1ZYIA 1OQNA 1XCGA 1WI1A 4K2OA 1W1DA 1LB1A 1KZGA 2LKOA 4D6WA 1V5MA 4HAYB 5DH9B 2NZ8B 2D9VA 1WJMA 4DXAB 2BCJA 2P8VA 4HAVB 2GCLA 2DKPA 2MFQA 2RUKB 1OY2A 3TCAA 4QJ3B 1FAOA 1FHWA 1ZC3B 4TKNA 3GYPA 1LW3A 4KAXB 4QJ5B 2KIEA 3VIAA 2YS1A 4K2PA 2YT0A 2I5CA 1M7RA 2KCJA 4EJNA 3D8DA 1ZM0A 5D27A 3KY9A 1WJ1A 4TYZA 5D3YA 2DX1A 3QWMA 5JP4A 2IYBA 3ODXA 3KRWA 3FEHA 1XODA 1V5UA 2ELAA 4KHAA 3BJIA 2ELBA 2RGNB 2Z59A 3D8EA 2P0FA 1U5EA 2CODA 2P0HA 3B77A 1EAZA 2CAYA 1MPHA 1U5DA 1MAIA 1MIXA 1Q67A 3DXEA 4GN1A 4OSNA 4MT7A 1FOEA 4ZRJA 2D10A 4HB3B 1BTNA 3T06A 1WGUA 3A98B 2E2XA 2YT2A 5IRSA 1U5GA 4A6KA 3FVCA 1IRSA 1WG7A 1J0WA 2M38A 5DIFB 5CLLB 4HAZB 4GNKB 2DKQA 4A5KA 3NWFA 4A6HA 4WVFB 3D8FA 2LYDA 4CHMA 1SGHA 5KQ1A 2DX5A 2GCJA 3PSCA 3NWDA 2K49A 1M7EA 2COCA 5D3XA 4K17A 3FM8C 1W1GA 1PFJA 5KCVA 1XKEA 4EMOA 3TW1A 3ULBA 5C6RA 3U7DA 1UPQA 1B55A 2I1JA 4HDQA 4BBKA 1GG3A 3PVUA 2Z0PA 1NTVA
chains in the Genus database with same CATH topology
3DXDA 1MK7B 2L2IA 1ZSQA 2YS3A 1H10A 3MDBC 4HAUB 4IAPA 1DYNA 5J3YA 4GPTB 4A6FA 2EC1A 3A8PA 1UNPA 1N3HA 2KUPA 4PNKA 2RNRB 1TXDA 1H4RA 3ULCA 2Z0OA 4KHOA 1BWNA 2XQNM 1XD4A 5J3QA 4CYEA 2FJLA 4ZRKA 4GZUA 2J59M 1W1HA 4DX90 4HHVA 2LOXA 2LULA 1PMSA 1U2BA 2EJ8A 2YVCA 1OMWA 4Y94A 5HE2A 2Z0QA 2NMBA 4HDOA 3ZDTA 2ROZB 3ML4A 1GC7A 1AQCA 2QKLA 1BAKA 5DHFB 5D3WA 2VKIA 1P5TA 3BINA 1MK9B 2DHKA 1KI1B 1X1GA 2LOZA 5C79A 2AEHA 1DDMA 3N7CA 4IOYX 2MKRA 4F7HA 2J0KA 1FGZA 5C16A 1U29A 4GMVA 3PZDA 3AU4A 3V5WA 1U27A 2D9ZA 2YF0A 2Y7BA 4HATB 2V76A 2HTHB 3ODOA 1DBHA 3HQCA 1MIZB 1X05A 1FB8A 2D9XA 2JP2A 4C0AA 4B6HA 1XX0A 2DYNA 1Y5OA 2DA0A 3LJUX 2Y8GA 2COAA 3SNHA 1RRPB 2ADZA 1WVHA 2D9WA 2R0DA 3PVLA 4H8SA 2RVBB 3KRXA 3X23A 2CY4A 1PLSA 1EF1A 5J3TA 2EMSA 4K81A 1AWEA 3GYOA 2R09A 2EMTA 3CIKA 4MK0A 5EFXA 3FSSA 3IVFA 2M14A 5DHAB 1P6SA 1MKEA 2UZSA 2GS0A 4F7UP 2DTCA 4DX8A 2MDXA 5JHGA 3CXBB 3QIJA 2H7EA 4CHJA 3QBVB 1SHCA 2P0DA 5C5BA 2G35A 3TO1A 3TFMA 2YS5A 1GC6A 1Z87A 3WA0A 4EKUA 1FHOA 5GOWB 2DFKA 2DYQA 2OQBA 4YL8A 3U8ZA 2RSGA 3HK0A 5KQ4A 2K2UA 2W2XC 3MPXA 3UZTA 2D4QA 5JLJB 2Y8FA 2GJYA 1UPRA 1I7AA 2COFA 2D9YA 2DHIA 2ROVA 5CLQB 3RCPA 2N0YA 2D11A 4IFSA 4A6FB 5HE1A 2DLWA 2LG1A 3SYXA 3P6AA 4KHBB 4HB0B 4GMXB 4YONA 3AU5A 2J0MA 1V5PA 3F0WA 1K5DB 5FI0A 3M1IB 4DBBA 2MWNB 2KGXB 4HB4B 2UZRA 2DN6A 3PG7A 3G9WA 4P7IA 3PEGA 1EVHA 2D2QA 3P7ZA 1X11A 1P3RA 4F7GA 1QQGA 3WYFB 2RLOA 3SUZA 1U5FA 4L6EA 4Z2MB 1ZVRA 3PVWA 1XR0B 3ZVRA 3DXCA 1QC6A 4D0NB 1UNQA 1UEFA 4HAXB 2YT1A 3VOQA 1TJ6A 1V61A 1X1FA 1V89A 1TQZA 2IFSA 3HW2B 1BTKA 4WSFA 4XWXA 1DDVA 2CY5A 2Q13A 3ODWA 2H7DA 1Y19B 3OANA 5HE0A 5JHHA 5FI1A 4HB2B 1DDWA 2OTXA 1EGXA 4Z2NA 2HE7A 2N23A 5LONB 2VRWB 1X86A 4ZRIA 3O96A 2I5FA 2J0JA 1DROA 2L1CA 1NTYA 1UNRA 1ZC4B 4GXBA 4PQ0A 2AL6A 2YSZA 3PP2A 4KVGB 2YRYA 1E5WA 1J19A 1FGYA 4WJ7A 1K5GB 2K00A 2CRFA 2UVMA 2VSZA 5L81A 4HAWB 1FHXA 2W2XD 1NU2A 2W2WA 4NY0A 5D3VA 5DI9B 1ISNA 1WGQA 3KSYA 5C5BB 3TVVA 3KZ1A 3NSUA 4MY6A 5HE3A 3SV1A 1I2HA 3F5RA 1KZ7A 1RJ2A 4NSWA 3A8QA 1V88A 3SO6A 2X18A 3AJ4A 2DHJA 2ZPYA 2K2JA 5LOPB 1NI2A 2PZ1A 2I1KA 2QKMA 1OQNA 1XCGA 1WI1A 4K2OA 1W1DA 1LB1A 1KZGA 2LKOA 1V5MA 4HAYB 5DH9B 2NZ8B 2D9VA 1WJMA 4DXAB 2BCJA 2P8VA 4HAVB 2GCLA 2DKPA 2MFQA 2RUKB 1OY2A 3TCAA 1FAOA 1FHWA 1ZC3B 4TKNA 3GYPA 1LW3A 4KAXB 3VIAA 2YS1A 4K2PA 2YT0A 2I5CA 1M7RA 2KCJA 4EJNA 3D8DA 1ZM0A 5D27A 3KY9A 1WJ1A 4TYZA 5D3YA 2DX1A 3QWMA 5JP4A 2IYBA 3ODXA 3KRWA 3FEHA 1XODA 1V5UA 2ELAA 4KHAA 3BJIA 2ELBA 2RGNB 3D8EA 2P0FA 1U5EA 2CODA 2P0HA 1EAZA 2CAYA 1MPHA 1U5DA 1MAIA 1MIXA 1Q67A 3DXEA 4GN1A 4MT7A 1FOEA 4ZRJA 2D10A 4HB3B 1BTNA 3T06A 1WGUA 3A98B 2E2XA 1U5GA 4A6KA 1IRSA 1WG7A 1J0WA 2M38A 5DIFB 5CLLB 4HAZB 2DKQA 4A5KA 4A6HA 4WVFB 3D8FA 2LYDA 4CHMA 1SGHA 5KQ1A 2DX5A 2GCJA 3PSCA 5D3XA 1M7EA 2COCA 4K17A 3FM8C 1W1GA 1PFJA 5KCVA 1XKEA 4EMOA 3TW1A 3ULBA 5C6RA 3U7DA 1UPQA 1B55A 2I1JA 4HDQA 4BBKA 1GG3A 3PVUA 2Z0PA 1NTVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXD A;  1MK7 B;  2L2I A;  1ZSQ A;  2YS3 A;  1H10 A;  3MDB C;  4HAU B;  4IAP A;  1DYN A;  5J3Y A;  4GPT B;  4A6F A;  2EC1 A;  3A8P A;  1UNP A;  1N3H A;  2KUP A;  4PNK A;  2RNR B;  1TXD A;  1H4R A;  3ULC A;  2Z0O A;  4KHO A;  1BWN A;  2XQN M;  1XD4 A;  5J3Q A;  4CYE A;  2FJL A;  4ZRK A;  4GZU A;  2J59 M;  1W1H A;  4DX9 0;  4HHV A;  2LOX A;  2LUL A;  1PMS A;  1U2B A;  2EJ8 A;  2YVC A;  1OMW A;  4Y94 A;  5HE2 A;  2Z0Q A;  2NMB A;  4HDO A;  3ZDT A;  2ROZ B;  3ML4 A;  1GC7 A;  1AQC A;  2QKL A;  1BAK A;  5DHF B;  5D3W A;  2VKI A;  1P5T A;  3BIN A;  1MK9 B;  2DHK A;  1KI1 B;  1X1G A;  2LOZ A;  5C79 A;  2AEH A;  1DDM A;  3N7C A;  4IOY X;  2MKR A;  4F7H A;  2J0K A;  1FGZ A;  5C16 A;  1U29 A;  4GMV A;  3PZD A;  3AU4 A;  3V5W A;  1U27 A;  2D9Z A;  2YF0 A;  2Y7B A;  4HAT B;  2V76 A;  2HTH B;  3ODO A;  1DBH A;  3HQC A;  1MIZ B;  1X05 A;  1FB8 A;  2D9X A;  2JP2 A;  4C0A A;  4B6H A;  1XX0 A;  2DYN A;  1Y5O A;  2DA0 A;  3LJU X;  2Y8G A;  2COA A;  3SNH A;  1RRP B;  2ADZ A;  1WVH A;  2D9W A;  2R0D A;  3PVL A;  4H8S A;  2RVB B;  3KRX A;  3X23 A;  2CY4 A;  1PLS A;  1EF1 A;  5J3T A;  2EMS A;  4K81 A;  1AWE A;  3GYO A;  2R09 A;  2EMT A;  3CIK A;  4MK0 A;  5EFX A;  3FSS A;  3IVF A;  2M14 A;  5DHA B;  1P6S A;  1MKE A;  2UZS A;  2GS0 A;  4F7U P;  2DTC A;  4DX8 A;  2MDX A;  5JHG A;  3CXB B;  3QIJ A;  2H7E A;  4CHJ A;  3QBV B;  1SHC A;  2P0D A;  5C5B A;  2G35 A;  3TO1 A;  3TFM A;  2YS5 A;  1GC6 A;  1Z87 A;  3WA0 A;  4EKU A;  1FHO A;  5GOW B;  2DFK A;  2DYQ A;  2OQB A;  4YL8 A;  3U8Z A;  2RSG A;  3HK0 A;  5KQ4 A;  2K2U A;  2W2X C;  3MPX A;  3UZT A;  2D4Q A;  5JLJ B;  2Y8F A;  2GJY A;  1UPR A;  1I7A A;  2COF A;  2D9Y A;  2DHI A;  2ROV A;  5CLQ B;  3RCP A;  2N0Y A;  2D11 A;  4IFS A;  4A6F B;  5HE1 A;  2DLW A;  2LG1 A;  3SYX A;  3P6A A;  4KHB B;  4HB0 B;  4GMX B;  4YON A;  3AU5 A;  2J0M A;  1V5P A;  3F0W A;  1K5D B;  5FI0 A;  3M1I B;  4DBB A;  2MWN B;  2KGX B;  4HB4 B;  2UZR A;  2DN6 A;  3PG7 A;  3G9W A;  4P7I A;  3PEG A;  1EVH A;  2D2Q A;  3P7Z A;  1X11 A;  1P3R A;  4F7G A;  1QQG A;  3WYF B;  2RLO A;  3SUZ A;  1U5F A;  4L6E A;  4Z2M B;  1ZVR A;  3PVW A;  1XR0 B;  3ZVR A;  3DXC A;  1QC6 A;  4D0N B;  1UNQ A;  1UEF A;  4HAX B;  2YT1 A;  3VOQ A;  1TJ6 A;  1V61 A;  1X1F A;  1V89 A;  1TQZ A;  2IFS A;  3HW2 B;  1BTK A;  4WSF A;  4XWX A;  1DDV A;  2CY5 A;  2Q13 A;  3ODW A;  2H7D A;  1Y19 B;  3OAN A;  5HE0 A;  5JHH A;  5FI1 A;  4HB2 B;  1DDW A;  2OTX A;  1EGX A;  4Z2N A;  2HE7 A;  2N23 A;  5LON B;  2VRW B;  1X86 A;  4ZRI A;  3O96 A;  2I5F A;  2J0J A;  1DRO A;  2L1C A;  1NTY A;  1UNR A;  1ZC4 B;  4GXB A;  4PQ0 A;  2AL6 A;  2YSZ A;  3PP2 A;  4KVG B;  2YRY A;  1E5W A;  1J19 A;  1FGY A;  4WJ7 A;  1K5G B;  2K00 A;  2CRF A;  2UVM A;  2VSZ A;  5L81 A;  4HAW B;  1FHX A;  2W2X D;  1NU2 A;  2W2W A;  4NY0 A;  5D3V A;  5DI9 B;  1ISN A;  1WGQ A;  3KSY A;  5C5B B;  3TVV A;  3KZ1 A;  3NSU A;  4MY6 A;  5HE3 A;  3SV1 A;  1I2H A;  3F5R A;  1KZ7 A;  1RJ2 A;  4NSW A;  3A8Q A;  1V88 A;  3SO6 A;  2X18 A;  3AJ4 A;  2DHJ A;  2ZPY A;  2K2J A;  5LOP B;  1NI2 A;  2PZ1 A;  2I1K A;  2QKM A;  1OQN A;  1XCG A;  1WI1 A;  4K2O A;  1W1D A;  1LB1 A;  1KZG A;  2LKO A;  1V5M A;  4HAY B;  5DH9 B;  2NZ8 B;  2D9V A;  1WJM A;  4DXA B;  2BCJ A;  2P8V A;  4HAV B;  2GCL A;  2DKP A;  2MFQ A;  2RUK B;  1OY2 A;  3TCA A;  1FAO A;  1FHW A;  1ZC3 B;  4TKN A;  3GYP A;  1LW3 A;  4KAX B;  3VIA A;  2YS1 A;  4K2P A;  2YT0 A;  2I5C A;  1M7R A;  2KCJ A;  4EJN A;  3D8D A;  1ZM0 A;  5D27 A;  3KY9 A;  1WJ1 A;  4TYZ A;  5D3Y A;  2DX1 A;  3QWM A;  5JP4 A;  2IYB A;  3ODX A;  3KRW A;  3FEH A;  1XOD A;  1V5U A;  2ELA A;  4KHA A;  3BJI A;  2ELB A;  2RGN B;  3D8E A;  2P0F A;  1U5E A;  2COD A;  2P0H A;  1EAZ A;  2CAY A;  1MPH A;  1U5D A;  1MAI A;  1MIX A;  1Q67 A;  3DXE A;  4GN1 A;  4MT7 A;  1FOE A;  4ZRJ A;  2D10 A;  4HB3 B;  1BTN A;  3T06 A;  1WGU A;  3A98 B;  2E2X A;  1U5G A;  4A6K A;  1IRS A;  1WG7 A;  1J0W A;  2M38 A;  5DIF B;  5CLL B;  4HAZ B;  2DKQ A;  4A5K A;  4A6H A;  4WVF B;  3D8F A;  2LYD A;  4CHM A;  1SGH A;  5KQ1 A;  2DX5 A;  2GCJ A;  3PSC A;  5D3X A;  1M7E A;  2COC A;  4K17 A;  3FM8 C;  1W1G A;  1PFJ A;  5KCV A;  1XKE A;  4EMO A;  3TW1 A;  3ULB A;  5C6R A;  3U7D A;  1UPQ A;  1B55 A;  2I1J A;  4HDQ A;  4BBK A;  1GG3 A;  3PVU A;  2Z0P A;  1NTV A; 
#chains in the Genus database with same CATH topology
 3DXD A;  2Z4D A;  1MK7 B;  2L2I A;  1ZSQ A;  3DCX A;  2YS3 A;  3OHM B;  1H10 A;  3MDB C;  4HAU B;  4IAP A;  1DYN A;  5J3Y A;  4GPT B;  4A6F A;  2EC1 A;  4DIX A;  3A8P A;  1UNP A;  4KHB A;  1N3H A;  2KUP A;  4PNK A;  2RNR B;  1TXD A;  1H4R A;  3ULC A;  2Z0O A;  4KHO A;  1BWN A;  4CSQ A;  2XQN M;  1XD4 A;  5J3Q A;  4CYE A;  2FJL A;  4ZRK A;  4GZU A;  2J59 M;  1W1H A;  1T77 A;  4DX9 0;  4HHV A;  2LOX A;  2LUL A;  1PMS A;  1U2B A;  2EJ8 A;  2YVC A;  1OMW A;  4Y94 A;  5HE2 A;  4HSI A;  2Z0Q A;  2NMB A;  4HDO A;  3ZDT A;  2ROZ B;  3ML4 A;  1GC7 A;  1AQC A;  2QKL A;  5I2M A;  1BAK A;  5DHF B;  5D3W A;  2VKI A;  1P5T A;  3BIN A;  1MK9 B;  2DHK A;  1KI1 B;  1X1G A;  2LOZ A;  5C79 A;  2AEH A;  1DDM A;  3N7C A;  4IOY X;  2MKR A;  4F7H A;  2J0K A;  1FGZ A;  5C16 A;  1U29 A;  4GMV A;  3PZD A;  3AU4 A;  3V5W A;  1U27 A;  2D9Z A;  2YF0 A;  2Y7B A;  4HAT B;  2V76 A;  2HTH B;  3ODO A;  1DBH A;  3HQC A;  1MIZ B;  1X05 A;  1FB8 A;  2D9X A;  2JP2 A;  4C0A A;  4B6H A;  1XX0 A;  2DYN A;  1Y5O A;  2DA0 A;  2KIG A;  2Y8G A;  3LJU X;  2COA A;  3SNH A;  1RRP B;  2ADZ A;  1WVH A;  2D9W A;  2R0D A;  3PVL A;  4H8S A;  2RVB B;  2FJU B;  3KRX A;  3X23 A;  2CY4 A;  1PLS A;  1EF1 A;  5J3T A;  4QXA B;  2EMS A;  4K81 A;  1AWE A;  3GYO A;  2R09 A;  2EMT A;  3CIK A;  4MK0 A;  5EFX A;  3FSS A;  3IVF A;  2M14 A;  5DHA B;  1P6S A;  1MKE A;  2UZS A;  2GS0 A;  4F7U P;  2DTC A;  4DX8 A;  2MDX A;  2R2Y A;  5JHG A;  2Z13 A;  3CXB B;  3QIJ A;  5M4Y B;  2H7E A;  4CHJ A;  3QBV B;  3NWA A;  1SHC A;  2P0D A;  5C5B A;  2KR0 A;  2G35 A;  3TO1 A;  3TFM A;  2YS5 A;  2KUQ A;  1GC6 A;  1Z87 A;  3WA0 A;  4EKU A;  1FHO A;  5GOW B;  2DFK A;  1MI1 A;  2DYQ A;  2OQB A;  4YL8 A;  3U8Z A;  2RSG A;  3HK0 A;  5KQ4 A;  2K2U A;  2W2X C;  3MPX A;  3UZT A;  2D4Q A;  5JLJ B;  2Y8F A;  2GJY A;  1UPR A;  1I7A A;  2COF A;  2D9Y A;  2DHI A;  2ROV A;  5CLQ B;  3RCP A;  2N0Y A;  2D11 A;  4IFS A;  4A6F B;  5HE1 A;  2DLW A;  2LG1 A;  3SYX A;  3P6A A;  4KHB B;  4HB0 B;  4GMX B;  4YON A;  3AU5 A;  2J0M A;  1V5P A;  3F0W A;  1K5D B;  5FI0 A;  5I2S A;  3M1I B;  4DBB A;  4QJ4 B;  2MWN B;  2KGX B;  4HB4 B;  2UZR A;  2DN6 A;  3G9W A;  3PG7 A;  4P7I A;  3PEG A;  1EVH A;  2D2Q A;  2GUM A;  3P7Z A;  1X11 A;  1P3R A;  4F7G A;  1QQG A;  3WYF B;  2RLO A;  3SUZ A;  1U5F A;  4L6E A;  4Z2M B;  2K8E A;  1ZVR A;  3PVW A;  1XR0 B;  3ZVR A;  3DXC A;  1QC6 A;  3HSA A;  4D0N B;  3U12 A;  1UNQ A;  1UEF A;  4HAX B;  2YT1 A;  3VOQ A;  1TJ6 A;  1V61 A;  1X1F A;  1V89 A;  1TQZ A;  2IFS A;  3HW2 B;  5LG4 B;  1BTK A;  3A58 A;  4WSF A;  4XWX A;  1DDV A;  2CY5 A;  2Q13 A;  3ODW A;  2H7D A;  1Y19 B;  3OAN A;  5HE0 A;  5JHH A;  5FI1 A;  4HB2 B;  1DDW A;  2OTX A;  1EGX A;  2ZKM X;  4Z2N A;  2HE7 A;  2N23 A;  5LON B;  2VRW B;  1X86 A;  4ZRI A;  3O96 A;  2I5F A;  2J0J A;  1DRO A;  4GOU A;  2NBV A;  4OT1 A;  2L1C A;  1NTY A;  1UNR A;  3HIE A;  1ZC4 B;  4GXB A;  4PQ0 A;  2AL6 A;  2YSZ A;  3PP2 A;  4KVG B;  2YRY A;  1E5W A;  1J19 A;  2RRF A;  1FGY A;  4WJ7 A;  1K5G B;  2K00 A;  2CRF A;  2UVM A;  2VSZ A;  5L81 A;  4HAW B;  1FHX A;  2W2X D;  1NU2 A;  2W2W A;  4NY0 A;  5D3V A;  5DI9 B;  1ISN A;  1WGQ A;  3KSY A;  4L1R A;  5C5B B;  3TVV A;  3NW8 A;  3KZ1 A;  3NSU A;  4MY6 A;  5HE3 A;  3SV1 A;  1I2H A;  3F5R A;  1KZ7 A;  1RJ2 A;  4NSW A;  3A8Q A;  1V88 A;  3SO6 A;  2X18 A;  3AJ4 A;  2Z14 A;  2DHJ A;  2ZPY A;  2K2J A;  5LOP B;  1NI2 A;  2PZ1 A;  2I1K A;  2QKM A;  1ZYI A;  1OQN A;  1XCG A;  1WI1 A;  4K2O A;  1W1D A;  1LB1 A;  1KZG A;  2LKO A;  4D6W A;  1V5M A;  4HAY B;  5DH9 B;  2NZ8 B;  2D9V A;  1WJM A;  4DXA B;  2BCJ A;  2P8V A;  4HAV B;  2GCL A;  2DKP A;  2MFQ A;  2RUK B;  1OY2 A;  3TCA A;  4QJ3 B;  1FAO A;  1FHW A;  1ZC3 B;  4TKN A;  3GYP A;  1LW3 A;  4KAX B;  4QJ5 B;  2KIE A;  3VIA A;  2YS1 A;  4K2P A;  2YT0 A;  2I5C A;  1M7R A;  2KCJ A;  4EJN A;  3D8D A;  1ZM0 A;  5D27 A;  3KY9 A;  1WJ1 A;  4TYZ A;  5D3Y A;  2DX1 A;  3QWM A;  5JP4 A;  2IYB A;  3ODX A;  3KRW A;  3FEH A;  1XOD A;  1V5U A;  2ELA A;  4KHA A;  3BJI A;  2ELB A;  2RGN B;  2Z59 A;  3D8E A;  2P0F A;  1U5E A;  2COD A;  2P0H A;  3B77 A;  1EAZ A;  2CAY A;  1MPH A;  1U5D A;  1MAI A;  1MIX A;  1Q67 A;  3DXE A;  4GN1 A;  4OSN A;  4MT7 A;  1FOE A;  4ZRJ A;  2D10 A;  4HB3 B;  1BTN A;  3T06 A;  1WGU A;  3A98 B;  2E2X A;  2YT2 A;  5IRS A;  1U5G A;  4A6K A;  3FVC A;  1IRS A;  1WG7 A;  1J0W A;  2M38 A;  5DIF B;  5CLL B;  4HAZ B;  4GNK B;  2DKQ A;  4A5K A;  3NWF A;  4A6H A;  4WVF B;  3D8F A;  2LYD A;  4CHM A;  1SGH A;  5KQ1 A;  2DX5 A;  2GCJ A;  3PSC A;  3NWD A;  2K49 A;  1M7E A;  2COC A;  5D3X A;  4K17 A;  3FM8 C;  1W1G A;  1PFJ A;  5KCV A;  1XKE A;  4EMO A;  3TW1 A;  3ULB A;  5C6R A;  3U7D A;  1UPQ A;  1B55 A;  2I1J A;  4HDQ A;  4BBK A;  1GG3 A;  3PVU A;  2Z0P A;  1NTV A; 
#chains in the Genus database with same CATH homology
 3DXD A;  1MK7 B;  2L2I A;  1ZSQ A;  2YS3 A;  1H10 A;  3MDB C;  4HAU B;  4IAP A;  1DYN A;  5J3Y A;  4GPT B;  4A6F A;  2EC1 A;  3A8P A;  1UNP A;  1N3H A;  2KUP A;  4PNK A;  2RNR B;  1TXD A;  1H4R A;  3ULC A;  2Z0O A;  4KHO A;  1BWN A;  2XQN M;  1XD4 A;  5J3Q A;  4CYE A;  2FJL A;  4ZRK A;  4GZU A;  2J59 M;  1W1H A;  4DX9 0;  4HHV A;  2LOX A;  2LUL A;  1PMS A;  1U2B A;  2EJ8 A;  2YVC A;  1OMW A;  4Y94 A;  5HE2 A;  2Z0Q A;  2NMB A;  4HDO A;  3ZDT A;  2ROZ B;  3ML4 A;  1GC7 A;  1AQC A;  2QKL A;  1BAK A;  5DHF B;  5D3W A;  2VKI A;  1P5T A;  3BIN A;  1MK9 B;  2DHK A;  1KI1 B;  1X1G A;  2LOZ A;  5C79 A;  2AEH A;  1DDM A;  3N7C A;  4IOY X;  2MKR A;  4F7H A;  2J0K A;  1FGZ A;  5C16 A;  1U29 A;  4GMV A;  3PZD A;  3AU4 A;  3V5W A;  1U27 A;  2D9Z A;  2YF0 A;  2Y7B A;  4HAT B;  2V76 A;  2HTH B;  3ODO A;  1DBH A;  3HQC A;  1MIZ B;  1X05 A;  1FB8 A;  2D9X A;  2JP2 A;  4C0A A;  4B6H A;  1XX0 A;  2DYN A;  1Y5O A;  2DA0 A;  3LJU X;  2Y8G A;  2COA A;  3SNH A;  1RRP B;  2ADZ A;  1WVH A;  2D9W A;  2R0D A;  3PVL A;  4H8S A;  2RVB B;  3KRX A;  3X23 A;  2CY4 A;  1PLS A;  1EF1 A;  5J3T A;  2EMS A;  4K81 A;  1AWE A;  3GYO A;  2R09 A;  2EMT A;  3CIK A;  4MK0 A;  5EFX A;  3FSS A;  3IVF A;  2M14 A;  5DHA B;  1P6S A;  1MKE A;  2UZS A;  2GS0 A;  4F7U P;  2DTC A;  4DX8 A;  2MDX A;  5JHG A;  3CXB B;  3QIJ A;  2H7E A;  4CHJ A;  3QBV B;  1SHC A;  2P0D A;  5C5B A;  2G35 A;  3TO1 A;  3TFM A;  2YS5 A;  1GC6 A;  1Z87 A;  3WA0 A;  4EKU A;  1FHO A;  5GOW B;  2DFK A;  2DYQ A;  2OQB A;  4YL8 A;  3U8Z A;  2RSG A;  3HK0 A;  5KQ4 A;  2K2U A;  2W2X C;  3MPX A;  3UZT A;  2D4Q A;  5JLJ B;  2Y8F A;  2GJY A;  1UPR A;  1I7A A;  2COF A;  2D9Y A;  2DHI A;  2ROV A;  5CLQ B;  3RCP A;  2N0Y A;  2D11 A;  4IFS A;  4A6F B;  5HE1 A;  2DLW A;  2LG1 A;  3SYX A;  3P6A A;  4KHB B;  4HB0 B;  4GMX B;  4YON A;  3AU5 A;  2J0M A;  1V5P A;  3F0W A;  1K5D B;  5FI0 A;  3M1I B;  4DBB A;  2MWN B;  2KGX B;  4HB4 B;  2UZR A;  2DN6 A;  3PG7 A;  3G9W A;  4P7I A;  3PEG A;  1EVH A;  2D2Q A;  3P7Z A;  1X11 A;  1P3R A;  4F7G A;  1QQG A;  3WYF B;  2RLO A;  3SUZ A;  1U5F A;  4L6E A;  4Z2M B;  1ZVR A;  3PVW A;  1XR0 B;  3ZVR A;  3DXC A;  1QC6 A;  4D0N B;  1UNQ A;  1UEF A;  4HAX B;  2YT1 A;  3VOQ A;  1TJ6 A;  1V61 A;  1X1F A;  1V89 A;  1TQZ A;  2IFS A;  3HW2 B;  1BTK A;  4WSF A;  4XWX A;  1DDV A;  2CY5 A;  2Q13 A;  3ODW A;  2H7D A;  1Y19 B;  3OAN A;  5HE0 A;  5JHH A;  5FI1 A;  4HB2 B;  1DDW A;  2OTX A;  1EGX A;  4Z2N A;  2HE7 A;  2N23 A;  5LON B;  2VRW B;  1X86 A;  4ZRI A;  3O96 A;  2I5F A;  2J0J A;  1DRO A;  2L1C A;  1NTY A;  1UNR A;  1ZC4 B;  4GXB A;  4PQ0 A;  2AL6 A;  2YSZ A;  3PP2 A;  4KVG B;  2YRY A;  1E5W A;  1J19 A;  1FGY A;  4WJ7 A;  1K5G B;  2K00 A;  2CRF A;  2UVM A;  2VSZ A;  5L81 A;  4HAW B;  1FHX A;  2W2X D;  1NU2 A;  2W2W A;  4NY0 A;  5D3V A;  5DI9 B;  1ISN A;  1WGQ A;  3KSY A;  5C5B B;  3TVV A;  3KZ1 A;  3NSU A;  4MY6 A;  5HE3 A;  3SV1 A;  1I2H A;  3F5R A;  1KZ7 A;  1RJ2 A;  4NSW A;  3A8Q A;  1V88 A;  3SO6 A;  2X18 A;  3AJ4 A;  2DHJ A;  2ZPY A;  2K2J A;  5LOP B;  1NI2 A;  2PZ1 A;  2I1K A;  2QKM A;  1OQN A;  1XCG A;  1WI1 A;  4K2O A;  1W1D A;  1LB1 A;  1KZG A;  2LKO A;  1V5M A;  4HAY B;  5DH9 B;  2NZ8 B;  2D9V A;  1WJM A;  4DXA B;  2BCJ A;  2P8V A;  4HAV B;  2GCL A;  2DKP A;  2MFQ A;  2RUK B;  1OY2 A;  3TCA A;  1FAO A;  1FHW A;  1ZC3 B;  4TKN A;  3GYP A;  1LW3 A;  4KAX B;  3VIA A;  2YS1 A;  4K2P A;  2YT0 A;  2I5C A;  1M7R A;  2KCJ A;  4EJN A;  3D8D A;  1ZM0 A;  5D27 A;  3KY9 A;  1WJ1 A;  4TYZ A;  5D3Y A;  2DX1 A;  3QWM A;  5JP4 A;  2IYB A;  3ODX A;  3KRW A;  3FEH A;  1XOD A;  1V5U A;  2ELA A;  4KHA A;  3BJI A;  2ELB A;  2RGN B;  3D8E A;  2P0F A;  1U5E A;  2COD A;  2P0H A;  1EAZ A;  2CAY A;  1MPH A;  1U5D A;  1MAI A;  1MIX A;  1Q67 A;  3DXE A;  4GN1 A;  4MT7 A;  1FOE A;  4ZRJ A;  2D10 A;  4HB3 B;  1BTN A;  3T06 A;  1WGU A;  3A98 B;  2E2X A;  1U5G A;  4A6K A;  1IRS A;  1WG7 A;  1J0W A;  2M38 A;  5DIF B;  5CLL B;  4HAZ B;  2DKQ A;  4A5K A;  4A6H A;  4WVF B;  3D8F A;  2LYD A;  4CHM A;  1SGH A;  5KQ1 A;  2DX5 A;  2GCJ A;  3PSC A;  5D3X A;  1M7E A;  2COC A;  4K17 A;  3FM8 C;  1W1G A;  1PFJ A;  5KCV A;  1XKE A;  4EMO A;  3TW1 A;  3ULB A;  5C6R A;  3U7D A;  1UPQ A;  1B55 A;  2I1J A;  4HDQ A;  4BBK A;  1GG3 A;  3PVU A;  2Z0P A;  1NTV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...