3ML4A

Crystal structure of a complex between dok7 ph-ptb and the musk juxtamembrane region
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
208
structure length
205
Chain Sequence
EAALVEGQVKLRKWKSRWLVLRKPSPVADCLLMLVYKDKCERSKGLRERSSLTLEDICGLEPALPYEGLAHTLAIICLSQAVMLGFDSHEAMCAWDTRIRYALGEVHRFHVTVAPGTKLESGPATLHLCNDILVLARDIPPTVMGQWKLSDLRRYGAVPNGFIFEGGTRCGYWAGVFFLSSAEGEQMSFLFDCIVRGISPTKGPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Cytoplasmic Adaptor Protein Dok7 Activates the Receptor Tyrosine Kinase MuSK via Dimerization.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Protein Dok-7
total genus 41
structure length 205
sequence length 208
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02174 IRS PTB domain (IRS-1 type)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3ml4A01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3ml4A02
3ZVRA 2CY4A 2DKPA 2MKRA 4BBKA 4PNKA 4TYZA 4CHMA 1P6SA 3SO6A 3TCAA 2E2XA 3SV1A 3AJ4A 4MK0A 2DHKA 3ML4A 1ZSQA 2RUKB 3BJIA 2KGXB 2YS5A 4HB2B 3MDBC 4GN1A 5FI1A 5KCVA 1EGXA 2P0HA 3P6AA 2YSZA 4GMVA 1U5DA 4KHBB 3AU5A 1UNRA 4L6EA 2MDXA 3HK0A 3KY9A 2NMBA 2OQBA 2D4QA 2D9VA 4Y94A 1TXDA 3OANA 2YT1A 5D27A 1UPRA 4ZRKA 2H7DA 3FSSA 2IYBA 4DX8A 4KHOA 5HE1A 5DI9B 1DDVA 3CXBB 1ISNA 2Y8GA 1LW3A 2LOZA 1WGUA 3KRXA 3QBVB 4D0NB 1U5GA 2D10A 4YONA 5JP4A 1MPHA 2P8VA 5JHGA 5HE0A 1V5PA 3DXDA 1NTYA 2Y7BA 2X18A 3VIAA 4F7HA 3WYFB 2DFKA 3ULBA 3ODOA 4HHVA 2RSGA 4CHJA 3CIKA 1K5GB 1SHCA 2QKLA 1XR0B 3VOQA 3U8ZA 4HAWB 3DXCA 1X11A 3QIJA 3QWMA 1DDMA 1W1GA 1V61A 2Z0QA 2LG1A 2W2WA 3T06A 4MY6A 1FAOA 4HATB 3PVLA 3KSYA 1WGQA 3A8PA 4HAZB 1GC6A 1U5FA 1I7AA 4A6FA 1KZ7A 2ELBA 5D3VA 2CRFA 3HW2B 1BTKA 2MFQA 3WA0A 2YF0A 3SUZA 1M7EA 1DROA 1WVHA 4NSWA 1MKEA 1W1DA 1NTVA 2EMTA 2GCJA 3D8DA 3HQCA 4A6KA 2D9YA 1U29A 1XODA 2L2IA 2P0FA 2PZ1A 2V76A 4EKUA 1DDWA 5KQ1A 3PSCA 1OMWA 1XD4A 1QQGA 5J3QA 1PLSA 2M14A 3TW1A 2OTXA 5LOPB 2Y8FA 2W2XD 3F0WA 4WSFA 2DHIA 3P7ZA 3SNHA 1IRSA 4GXBA 1J0WA 1B55A 3ODXA 2XQNM 3PVWA 4NY0A 1ZM0A 1TQZA 1KI1B 5CLQB 1V88A 2RNRB 4B6HA 1BAKA 1GC7A 2D9WA 1V89A 2N0YA 3G9WA 2ROZB 4DXAB 1ZC4B 4HB4B 1UNPA 1EVHA 1OY2A 2M38A 3PEGA 1Y5OA 2EJ8A 5HE3A 2VRWB 2COFA 2L1CA 2LKOA 5D3WA 2UZSA 5C5BB 1RJ2A 1TJ6A 2CY5A 4GPTB 2RGNB 2R0DA 4HAVB 4YL8A 5JHHA 2I1KA 2UZRA 2GCLA 4TKNA 2BCJA 2Z0PA 4HAUB 1K5DB 1P5TA 5C5BA 4C0AA 2DX5A 4PQ0A 1BWNA 5JLJB 5J3YA 1DBHA 5HE2A 5DHFB 1J19A 2YRYA 4K2PA 5GOWB 4A5KA 1WJ1A 1WJMA 2W2XC 3MPXA 4K2OA 2Q13A 2HE7A 1NI2A 2HTHB 1QC6A 3TFMA 3GYOA 5D3XA 1Q67A 2LOXA 3M1IB 3FM8C 2GJYA 2I5FA 1FGZA 5DH9B 3SYXA 1FHWA 2I5CA 3ZDTA 2D9XA 5DIFB 4KHAA 2GS0A 1H4RA 2D9ZA 2YS3A 4WVFB 1AQCA 3KRWA 2AL6A 2KUPA 1AWEA 3V5WA 4HB0B 2MWNB 3F5RA 3PG7A 1FOEA 2YVCA 1EF1A 3BINA 4IFSA 2J0MA 4HDOA 1MAIA 5EFXA 3UZTA 3ODWA 5FI0A 4EMOA 5DHAB 2DKQA 2K00A 3A8QA 3TO1A 1LB1A 2EMSA 2J59M 4KAXB 4HAYB 2IFSA 3PP2A 3GYPA 1UPQA 3D8FA 1DYNA 4A6HA 2DA0A 2G35A 1PFJA 1V5MA 2DHJA 2UVMA 2J0KA 5L81A 2CAYA 1ZVRA 3TVVA 2DN6A 3N7CA 4F7GA 2ZPYA 2R09A 3RCPA 4WJ7A 4K17A 2AEHA 2FJLA 3O96A 2DYNA 1MK7B 5KQ4A 2H7EA 2DLWA 1FGYA 1MIXA 2DYQA 5CLLB 1FB8A 1UNQA 4DBBA 3LJUX 4HAXB 4IOYX 1H10A 2VSZA 5LONB 2DX1A 1FHXA 2Z0OA 2KCJA 1GG3A 4ZRIA 3IVFA 1Y19B 2ELAA 3DXEA 2NZ8B 4DX90 3X23A 1U2BA 4A6FB 1U27A 2RVBB 2ROVA 1P3RA 2N23A 5J3TA 2K2UA 3A98B 1X05A 2D11A 2VKIA 4CYEA 1OQNA 1X1FA 4P7IA 1M7RA 2LULA 4GMXB 4F7UP 1XKEA 4Z2MB 3D8EA 1UEFA 2LYDA 2J0JA 1FHOA 2I1JA 2JP2A 1WG7A 1E5WA 2QKMA 3U7DA 1XCGA 3ULCA 2D2QA 3NSUA 4HDQA 1XX0A 5C16A 1V5UA 5C6RA 3FEHA 5D3YA 4EJNA 2COCA 2COAA 1W1HA 4H8SA 2P0DA 1U5EA 1RRPB 1SGHA 4GZUA 2RLOA 1N3HA 1WI1A 3AU4A 4Z2NA 1X86A 1I2HA 1NU2A 1BTNA 4XWXA 3PVUA 5C79A 1Z87A 4ZRJA 2K2JA 2YS1A 4IAPA 1ZC3B 3PZDA 1MIZB 2DTCA 2ADZA 2YT0A 1MK9B 1KZGA 1PMSA 4K81A 4MT7A 4KVGB 1X1GA 1EAZA 4HB3B 3KZ1A 2CODA 2EC1A
chains in the Genus database with same CATH superfamily
3ZVRA 2CY4A 2DKPA 2MKRA 4BBKA 4PNKA 4TYZA 4CHMA 1P6SA 3SO6A 3TCAA 2E2XA 3SV1A 3AJ4A 4MK0A 2DHKA 3ML4A 2Z4DA 1ZSQA 2RUKB 2Z13A 3BJIA 2KGXB 2YS5A 4HB2B 3MDBC 4GN1A 5FI1A 5KCVA 4QXAB 1EGXA 4GOUA 2P0HA 3P6AA 2YSZA 4GMVA 1U5DA 4KHBB 5M4YB 3AU5A 1UNRA 4L6EA 2ZKMX 2MDXA 3HK0A 3KY9A 2NMBA 2OQBA 2D4QA 2D9VA 4Y94A 1TXDA 3OANA 2YT1A 5D27A 1UPRA 4ZRKA 2H7DA 3FSSA 2IYBA 4DX8A 4KHOA 5HE1A 5DI9B 1DDVA 2YT2A 3CXBB 1ISNA 2K49A 2Y8GA 1LW3A 2LOZA 1WGUA 3KRXA 3QBVB 4D0NB 1U5GA 2D10A 4YONA 5JP4A 1MPHA 2P8VA 5JHGA 5HE0A 1T77A 1V5PA 3DXDA 1NTYA 2Y7BA 2X18A 3VIAA 4F7HA 3WYFB 2DFKA 2KIGA 3ULBA 3ODOA 4HHVA 2RSGA 4HSIA 4CHJA 3CIKA 1K5GB 1SHCA 2QKLA 1XR0B 3VOQA 3U8ZA 4HAWB 3DXCA 1X11A 3QIJA 3QWMA 1DDMA 1W1GA 1V61A 2Z0QA 2LG1A 2W2WA 3T06A 5I2MA 4MY6A 1FAOA 2R2YA 4HATB 3PVLA 3KSYA 1WGQA 3A8PA 4HAZB 3U12A 2FJUB 1GC6A 1U5FA 1I7AA 4A6FA 1KZ7A 2ELBA 5D3VA 2CRFA 3HW2B 1BTKA 2MFQA 3WA0A 2YF0A 5I2SA 3SUZA 1M7EA 1DROA 1WVHA 4NSWA 1MKEA 1W1DA 1NTVA 2EMTA 2GCJA 3D8DA 4CSQA 3HQCA 4A6KA 2D9YA 1U29A 1XODA 2L2IA 2P0FA 2PZ1A 2V76A 4EKUA 1DDWA 5KQ1A 3PSCA 1OMWA 1XD4A 1QQGA 5J3QA 1PLSA 2M14A 3TW1A 2OTXA 5LOPB 2Y8FA 2W2XD 3F0WA 4WSFA 2DHIA 3P7ZA 3SNHA 1IRSA 4GXBA 1J0WA 1B55A 3ODXA 2XQNM 3PVWA 4NY0A 4D6WA 1ZM0A 4QJ4B 1TQZA 1KI1B 5CLQB 3DCXA 1V88A 2RNRB 4B6HA 1BAKA 1GC7A 2D9WA 1V89A 2N0YA 3G9WA 2Z59A 2ROZB 3OHMB 4DXAB 1ZC4B 4HB4B 1UNPA 1EVHA 1OY2A 4DIXA 2M38A 3PEGA 1Y5OA 3NWFA 2EJ8A 5HE3A 2KR0A 2VRWB 4OT1A 2COFA 2L1CA 2LKOA 5D3WA 2UZSA 5C5BB 1ZYIA 1RJ2A 1TJ6A 2CY5A 1MI1A 4GPTB 2RGNB 2R0DA 4HAVB 4YL8A 5JHHA 2I1KA 2UZRA 2GCLA 4TKNA 2BCJA 2Z0PA 4GNKB 4HAUB 1K5DB 1P5TA 5C5BA 4C0AA 2DX5A 4PQ0A 1BWNA 5JLJB 5J3YA 1DBHA 5HE2A 5DHFB 1J19A 2YRYA 4K2PA 5GOWB 4A5KA 1WJ1A 1WJMA 2W2XC 3MPXA 4K2OA 2Q13A 2HE7A 1NI2A 2HTHB 1QC6A 3TFMA 3GYOA 5D3XA 1Q67A 2KUQA 2LOXA 3M1IB 3FM8C 2GJYA 2I5FA 1FGZA 5DH9B 3SYXA 1FHWA 2I5CA 3ZDTA 2D9XA 5DIFB 4KHAA 2GS0A 1H4RA 2D9ZA 2YS3A 4WVFB 1AQCA 3KRWA 2AL6A 2KUPA 1AWEA 3V5WA 4HB0B 2K8EA 2MWNB 3F5RA 3PG7A 1FOEA 2YVCA 1EF1A 3BINA 4IFSA 2J0MA 4HDOA 1MAIA 5EFXA 3UZTA 3ODWA 5FI0A 4EMOA 5DHAB 4KHBA 2DKQA 2K00A 3A8QA 3TO1A 1LB1A 2EMSA 2J59M 4KAXB 3NW8A 2RRFA 3HSAA 4HAYB 2IFSA 3PP2A 3GYPA 4QJ3B 1UPQA 3D8FA 1DYNA 3HIEA 4A6HA 2DA0A 2G35A 1PFJA 1V5MA 2DHJA 2UVMA 2J0KA 5L81A 2CAYA 1ZVRA 3TVVA 2DN6A 3N7CA 4F7GA 2ZPYA 2R09A 3RCPA 2GUMA 4WJ7A 4K17A 2AEHA 2FJLA 3O96A 2DYNA 1MK7B 5KQ4A 2H7EA 2DLWA 1FGYA 1MIXA 2DYQA 5CLLB 1FB8A 1UNQA 4DBBA 3LJUX 4HAXB 4IOYX 1H10A 2VSZA 5LONB 2DX1A 1FHXA 2NBVA 2Z0OA 2KCJA 1GG3A 4ZRIA 3IVFA 1Y19B 2ELAA 3DXEA 2NZ8B 4DX90 3X23A 1U2BA 4A6FB 4QJ5B 1U27A 2RVBB 3A58A 2ROVA 1P3RA 2N23A 5J3TA 2K2UA 3A98B 1X05A 2D11A 2VKIA 2KIEA 4CYEA 1OQNA 1X1FA 4P7IA 1M7RA 2LULA 4GMXB 5IRSA 4F7UP 1XKEA 4Z2MB 3D8EA 1UEFA 2LYDA 2J0JA 3NWDA 4L1RA 1FHOA 2I1JA 2JP2A 1WG7A 1E5WA 2QKMA 3U7DA 1XCGA 3ULCA 2D2QA 3NSUA 4HDQA 1XX0A 5C16A 1V5UA 5C6RA 3FEHA 5D3YA 4EJNA 2COCA 2COAA 1W1HA 2Z14A 4H8SA 2P0DA 1U5EA 1RRPB 1SGHA 4GZUA 2RLOA 1N3HA 3NWAA 1WI1A 3AU4A 3B77A 3FVCA 4Z2NA 1X86A 1I2HA 1NU2A 1BTNA 4XWXA 3PVUA 5C79A 1Z87A 4ZRJA 2K2JA 2YS1A 5LG4B 4OSNA 4IAPA 1ZC3B 3PZDA 1MIZB 2DTCA 2ADZA 2YT0A 1MK9B 1KZGA 1PMSA 4K81A 4MT7A 4KVGB 1X1GA 1EAZA 4HB3B 3KZ1A 2CODA 2EC1A
chains in the Genus database with same CATH topology
3ZVRA 2CY4A 2DKPA 2MKRA 4BBKA 4PNKA 4TYZA 4CHMA 1P6SA 3SO6A 3TCAA 2E2XA 3SV1A 3AJ4A 4MK0A 2DHKA 3ML4A 1ZSQA 2RUKB 3BJIA 2KGXB 2YS5A 4HB2B 3MDBC 4GN1A 5FI1A 5KCVA 1EGXA 2P0HA 3P6AA 2YSZA 4GMVA 1U5DA 4KHBB 3AU5A 1UNRA 4L6EA 2MDXA 3HK0A 3KY9A 2NMBA 2OQBA 2D4QA 2D9VA 4Y94A 1TXDA 3OANA 2YT1A 5D27A 1UPRA 4ZRKA 2H7DA 3FSSA 2IYBA 4DX8A 4KHOA 5HE1A 5DI9B 1DDVA 3CXBB 1ISNA 2Y8GA 1LW3A 2LOZA 1WGUA 3KRXA 3QBVB 4D0NB 1U5GA 2D10A 4YONA 5JP4A 1MPHA 2P8VA 5JHGA 5HE0A 1V5PA 3DXDA 1NTYA 2Y7BA 2X18A 3VIAA 4F7HA 3WYFB 2DFKA 3ULBA 3ODOA 4HHVA 2RSGA 4CHJA 3CIKA 1K5GB 1SHCA 2QKLA 1XR0B 3VOQA 3U8ZA 4HAWB 3DXCA 1X11A 3QIJA 3QWMA 1DDMA 1W1GA 1V61A 2Z0QA 2LG1A 2W2WA 3T06A 4MY6A 1FAOA 4HATB 3PVLA 3KSYA 1WGQA 3A8PA 4HAZB 1GC6A 1U5FA 1I7AA 4A6FA 1KZ7A 2ELBA 5D3VA 2CRFA 3HW2B 1BTKA 2MFQA 3WA0A 2YF0A 3SUZA 1M7EA 1DROA 1WVHA 4NSWA 1MKEA 1W1DA 1NTVA 2EMTA 2GCJA 3D8DA 3HQCA 4A6KA 2D9YA 1U29A 1XODA 2L2IA 2P0FA 2PZ1A 2V76A 4EKUA 1DDWA 5KQ1A 3PSCA 1OMWA 1XD4A 1QQGA 5J3QA 1PLSA 2M14A 3TW1A 2OTXA 5LOPB 2Y8FA 2W2XD 3F0WA 4WSFA 2DHIA 3P7ZA 3SNHA 1IRSA 4GXBA 1J0WA 1B55A 3ODXA 2XQNM 3PVWA 4NY0A 1ZM0A 1TQZA 1KI1B 5CLQB 1V88A 2RNRB 4B6HA 1BAKA 1GC7A 2D9WA 1V89A 2N0YA 3G9WA 2ROZB 4DXAB 1ZC4B 4HB4B 1UNPA 1EVHA 1OY2A 2M38A 3PEGA 1Y5OA 2EJ8A 5HE3A 2VRWB 2COFA 2L1CA 2LKOA 5D3WA 2UZSA 5C5BB 1RJ2A 1TJ6A 2CY5A 4GPTB 2RGNB 2R0DA 4HAVB 4YL8A 5JHHA 2I1KA 2UZRA 2GCLA 4TKNA 2BCJA 2Z0PA 4HAUB 1K5DB 1P5TA 5C5BA 4C0AA 2DX5A 4PQ0A 1BWNA 5JLJB 5J3YA 1DBHA 5HE2A 5DHFB 1J19A 2YRYA 4K2PA 5GOWB 4A5KA 1WJ1A 1WJMA 2W2XC 3MPXA 4K2OA 2Q13A 2HE7A 1NI2A 2HTHB 1QC6A 3TFMA 3GYOA 5D3XA 1Q67A 2LOXA 3M1IB 3FM8C 2GJYA 2I5FA 1FGZA 5DH9B 3SYXA 1FHWA 2I5CA 3ZDTA 2D9XA 5DIFB 4KHAA 2GS0A 1H4RA 2D9ZA 2YS3A 4WVFB 1AQCA 3KRWA 2AL6A 2KUPA 1AWEA 3V5WA 4HB0B 2MWNB 3F5RA 3PG7A 1FOEA 2YVCA 1EF1A 3BINA 4IFSA 2J0MA 4HDOA 1MAIA 5EFXA 3UZTA 3ODWA 5FI0A 4EMOA 5DHAB 2DKQA 2K00A 3A8QA 3TO1A 1LB1A 2EMSA 2J59M 4KAXB 4HAYB 2IFSA 3PP2A 3GYPA 1UPQA 3D8FA 1DYNA 4A6HA 2DA0A 2G35A 1PFJA 1V5MA 2DHJA 2UVMA 2J0KA 5L81A 2CAYA 1ZVRA 3TVVA 2DN6A 3N7CA 4F7GA 2ZPYA 2R09A 3RCPA 4WJ7A 4K17A 2AEHA 2FJLA 3O96A 2DYNA 1MK7B 5KQ4A 2H7EA 2DLWA 1FGYA 1MIXA 2DYQA 5CLLB 1FB8A 1UNQA 4DBBA 3LJUX 4HAXB 4IOYX 1H10A 2VSZA 5LONB 2DX1A 1FHXA 2Z0OA 2KCJA 1GG3A 4ZRIA 3IVFA 1Y19B 2ELAA 3DXEA 2NZ8B 4DX90 3X23A 1U2BA 4A6FB 1U27A 2RVBB 2ROVA 1P3RA 2N23A 5J3TA 2K2UA 3A98B 1X05A 2D11A 2VKIA 4CYEA 1OQNA 1X1FA 4P7IA 1M7RA 2LULA 4GMXB 4F7UP 1XKEA 4Z2MB 3D8EA 1UEFA 2LYDA 2J0JA 1FHOA 2I1JA 2JP2A 1WG7A 1E5WA 2QKMA 3U7DA 1XCGA 3ULCA 2D2QA 3NSUA 4HDQA 1XX0A 5C16A 1V5UA 5C6RA 3FEHA 5D3YA 4EJNA 2COCA 2COAA 1W1HA 4H8SA 2P0DA 1U5EA 1RRPB 1SGHA 4GZUA 2RLOA 1N3HA 1WI1A 3AU4A 4Z2NA 1X86A 1I2HA 1NU2A 1BTNA 4XWXA 3PVUA 5C79A 1Z87A 4ZRJA 2K2JA 2YS1A 4IAPA 1ZC3B 3PZDA 1MIZB 2DTCA 2ADZA 2YT0A 1MK9B 1KZGA 1PMSA 4K81A 4MT7A 4KVGB 1X1GA 1EAZA 4HB3B 3KZ1A 2CODA 2EC1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZVR A;  2CY4 A;  2DKP A;  2MKR A;  4BBK A;  4PNK A;  4TYZ A;  4CHM A;  1P6S A;  3SO6 A;  3TCA A;  2E2X A;  3SV1 A;  3AJ4 A;  4MK0 A;  2DHK A;  3ML4 A;  1ZSQ A;  2RUK B;  3BJI A;  2KGX B;  2YS5 A;  4HB2 B;  3MDB C;  4GN1 A;  5FI1 A;  5KCV A;  1EGX A;  2P0H A;  3P6A A;  2YSZ A;  4GMV A;  1U5D A;  4KHB B;  3AU5 A;  1UNR A;  4L6E A;  2MDX A;  3HK0 A;  3KY9 A;  2NMB A;  2OQB A;  2D4Q A;  2D9V A;  4Y94 A;  1TXD A;  3OAN A;  2YT1 A;  5D27 A;  1UPR A;  4ZRK A;  2H7D A;  3FSS A;  2IYB A;  4DX8 A;  4KHO A;  5HE1 A;  5DI9 B;  1DDV A;  3CXB B;  1ISN A;  2Y8G A;  1LW3 A;  2LOZ A;  1WGU A;  3KRX A;  3QBV B;  4D0N B;  1U5G A;  2D10 A;  4YON A;  5JP4 A;  1MPH A;  2P8V A;  5JHG A;  5HE0 A;  1V5P A;  3DXD A;  1NTY A;  2Y7B A;  2X18 A;  3VIA A;  4F7H A;  3WYF B;  2DFK A;  3ULB A;  3ODO A;  4HHV A;  2RSG A;  4CHJ A;  3CIK A;  1K5G B;  1SHC A;  2QKL A;  1XR0 B;  3VOQ A;  3U8Z A;  4HAW B;  3DXC A;  1X11 A;  3QIJ A;  3QWM A;  1DDM A;  1W1G A;  1V61 A;  2Z0Q A;  2LG1 A;  2W2W A;  3T06 A;  4MY6 A;  1FAO A;  4HAT B;  3PVL A;  3KSY A;  1WGQ A;  3A8P A;  4HAZ B;  1GC6 A;  1U5F A;  1I7A A;  4A6F A;  1KZ7 A;  2ELB A;  5D3V A;  2CRF A;  3HW2 B;  1BTK A;  2MFQ A;  3WA0 A;  2YF0 A;  3SUZ A;  1M7E A;  1DRO A;  1WVH A;  4NSW A;  1MKE A;  1W1D A;  1NTV A;  2EMT A;  2GCJ A;  3D8D A;  3HQC A;  4A6K A;  2D9Y A;  1U29 A;  1XOD A;  2L2I A;  2P0F A;  2PZ1 A;  2V76 A;  4EKU A;  1DDW A;  5KQ1 A;  3PSC A;  1OMW A;  1XD4 A;  1QQG A;  5J3Q A;  1PLS A;  2M14 A;  3TW1 A;  2OTX A;  5LOP B;  2Y8F A;  2W2X D;  3F0W A;  4WSF A;  2DHI A;  3P7Z A;  3SNH A;  1IRS A;  4GXB A;  1J0W A;  1B55 A;  3ODX A;  2XQN M;  3PVW A;  4NY0 A;  1ZM0 A;  1TQZ A;  1KI1 B;  5CLQ B;  1V88 A;  2RNR B;  4B6H A;  1BAK A;  1GC7 A;  2D9W A;  1V89 A;  2N0Y A;  3G9W A;  2ROZ B;  4DXA B;  1ZC4 B;  4HB4 B;  1UNP A;  1EVH A;  1OY2 A;  2M38 A;  3PEG A;  1Y5O A;  2EJ8 A;  5HE3 A;  2VRW B;  2COF A;  2L1C A;  2LKO A;  5D3W A;  2UZS A;  5C5B B;  1RJ2 A;  1TJ6 A;  2CY5 A;  4GPT B;  2RGN B;  2R0D A;  4HAV B;  4YL8 A;  5JHH A;  2I1K A;  2UZR A;  2GCL A;  4TKN A;  2BCJ A;  2Z0P A;  4HAU B;  1K5D B;  1P5T A;  5C5B A;  4C0A A;  2DX5 A;  4PQ0 A;  1BWN A;  5JLJ B;  5J3Y A;  1DBH A;  5HE2 A;  5DHF B;  1J19 A;  2YRY A;  4K2P A;  5GOW B;  4A5K A;  1WJ1 A;  1WJM A;  2W2X C;  3MPX A;  4K2O A;  2Q13 A;  2HE7 A;  1NI2 A;  2HTH B;  1QC6 A;  3TFM A;  3GYO A;  5D3X A;  1Q67 A;  2LOX A;  3M1I B;  3FM8 C;  2GJY A;  2I5F A;  1FGZ A;  5DH9 B;  3SYX A;  1FHW A;  2I5C A;  3ZDT A;  2D9X A;  5DIF B;  4KHA A;  2GS0 A;  1H4R A;  2D9Z A;  2YS3 A;  4WVF B;  1AQC A;  3KRW A;  2AL6 A;  2KUP A;  1AWE A;  3V5W A;  4HB0 B;  2MWN B;  3F5R A;  3PG7 A;  1FOE A;  2YVC A;  1EF1 A;  3BIN A;  4IFS A;  2J0M A;  4HDO A;  1MAI A;  5EFX A;  3UZT A;  3ODW A;  5FI0 A;  4EMO A;  5DHA B;  2DKQ A;  2K00 A;  3A8Q A;  3TO1 A;  1LB1 A;  2EMS A;  2J59 M;  4KAX B;  4HAY B;  2IFS A;  3PP2 A;  3GYP A;  1UPQ A;  3D8F A;  1DYN A;  4A6H A;  2DA0 A;  2G35 A;  1PFJ A;  1V5M A;  2DHJ A;  2UVM A;  2J0K A;  5L81 A;  2CAY A;  1ZVR A;  3TVV A;  2DN6 A;  3N7C A;  4F7G A;  2ZPY A;  2R09 A;  3RCP A;  4WJ7 A;  4K17 A;  2AEH A;  2FJL A;  3O96 A;  2DYN A;  1MK7 B;  5KQ4 A;  2H7E A;  2DLW A;  1FGY A;  1MIX A;  2DYQ A;  5CLL B;  1FB8 A;  1UNQ A;  4DBB A;  3LJU X;  4HAX B;  4IOY X;  1H10 A;  2VSZ A;  5LON B;  2DX1 A;  1FHX A;  2Z0O A;  2KCJ A;  1GG3 A;  4ZRI A;  3IVF A;  1Y19 B;  2ELA A;  3DXE A;  2NZ8 B;  4DX9 0;  3X23 A;  1U2B A;  4A6F B;  1U27 A;  2RVB B;  2ROV A;  1P3R A;  2N23 A;  5J3T A;  2K2U A;  3A98 B;  1X05 A;  2D11 A;  2VKI A;  4CYE A;  1OQN A;  1X1F A;  4P7I A;  1M7R A;  2LUL A;  4GMX B;  4F7U P;  1XKE A;  4Z2M B;  3D8E A;  1UEF A;  2LYD A;  2J0J A;  1FHO A;  2I1J A;  2JP2 A;  1WG7 A;  1E5W A;  2QKM A;  3U7D A;  1XCG A;  3ULC A;  2D2Q A;  3NSU A;  4HDQ A;  1XX0 A;  5C16 A;  1V5U A;  5C6R A;  3FEH A;  5D3Y A;  4EJN A;  2COC A;  2COA A;  1W1H A;  4H8S A;  2P0D A;  1U5E A;  1RRP B;  1SGH A;  4GZU A;  2RLO A;  1N3H A;  1WI1 A;  3AU4 A;  4Z2N A;  1X86 A;  1I2H A;  1NU2 A;  1BTN A;  4XWX A;  3PVU A;  5C79 A;  1Z87 A;  4ZRJ A;  2K2J A;  2YS1 A;  4IAP A;  1ZC3 B;  3PZD A;  1MIZ B;  2DTC A;  2ADZ A;  2YT0 A;  1MK9 B;  1KZG A;  1PMS A;  4K81 A;  4MT7 A;  4KVG B;  1X1G A;  1EAZ A;  4HB3 B;  3KZ1 A;  2COD A;  2EC1 A; 
#chains in the Genus database with same CATH topology
 3ZVR A;  2CY4 A;  2DKP A;  2MKR A;  4BBK A;  4PNK A;  4TYZ A;  4CHM A;  1P6S A;  3SO6 A;  3TCA A;  2E2X A;  3SV1 A;  3AJ4 A;  4MK0 A;  2DHK A;  3ML4 A;  2Z4D A;  1ZSQ A;  2RUK B;  2Z13 A;  3BJI A;  2KGX B;  2YS5 A;  4HB2 B;  3MDB C;  4GN1 A;  5FI1 A;  5KCV A;  4QXA B;  1EGX A;  4GOU A;  2P0H A;  3P6A A;  2YSZ A;  4GMV A;  1U5D A;  4KHB B;  5M4Y B;  3AU5 A;  1UNR A;  4L6E A;  2ZKM X;  2MDX A;  3HK0 A;  3KY9 A;  2NMB A;  2OQB A;  2D4Q A;  2D9V A;  4Y94 A;  1TXD A;  3OAN A;  2YT1 A;  5D27 A;  1UPR A;  4ZRK A;  2H7D A;  3FSS A;  2IYB A;  4DX8 A;  4KHO A;  5HE1 A;  5DI9 B;  1DDV A;  2YT2 A;  3CXB B;  1ISN A;  2K49 A;  2Y8G A;  1LW3 A;  2LOZ A;  1WGU A;  3KRX A;  3QBV B;  4D0N B;  1U5G A;  2D10 A;  4YON A;  5JP4 A;  1MPH A;  2P8V A;  5JHG A;  5HE0 A;  1T77 A;  1V5P A;  3DXD A;  1NTY A;  2Y7B A;  2X18 A;  3VIA A;  4F7H A;  3WYF B;  2DFK A;  2KIG A;  3ULB A;  3ODO A;  4HHV A;  2RSG A;  4HSI A;  4CHJ A;  3CIK A;  1K5G B;  1SHC A;  2QKL A;  1XR0 B;  3VOQ A;  3U8Z A;  4HAW B;  3DXC A;  1X11 A;  3QIJ A;  3QWM A;  1DDM A;  1W1G A;  1V61 A;  2Z0Q A;  2LG1 A;  2W2W A;  3T06 A;  5I2M A;  4MY6 A;  1FAO A;  2R2Y A;  4HAT B;  3PVL A;  3KSY A;  1WGQ A;  3A8P A;  4HAZ B;  3U12 A;  2FJU B;  1GC6 A;  1U5F A;  1I7A A;  4A6F A;  1KZ7 A;  2ELB A;  5D3V A;  2CRF A;  3HW2 B;  1BTK A;  2MFQ A;  3WA0 A;  2YF0 A;  5I2S A;  3SUZ A;  1M7E A;  1DRO A;  1WVH A;  4NSW A;  1MKE A;  1W1D A;  1NTV A;  2EMT A;  2GCJ A;  3D8D A;  4CSQ A;  3HQC A;  4A6K A;  2D9Y A;  1U29 A;  1XOD A;  2L2I A;  2P0F A;  2PZ1 A;  2V76 A;  4EKU A;  1DDW A;  5KQ1 A;  3PSC A;  1OMW A;  1XD4 A;  1QQG A;  5J3Q A;  1PLS A;  2M14 A;  3TW1 A;  2OTX A;  5LOP B;  2Y8F A;  2W2X D;  3F0W A;  4WSF A;  2DHI A;  3P7Z A;  3SNH A;  1IRS A;  4GXB A;  1J0W A;  1B55 A;  3ODX A;  2XQN M;  3PVW A;  4NY0 A;  4D6W A;  1ZM0 A;  4QJ4 B;  1TQZ A;  1KI1 B;  5CLQ B;  3DCX A;  1V88 A;  2RNR B;  4B6H A;  1BAK A;  1GC7 A;  2D9W A;  1V89 A;  2N0Y A;  3G9W A;  2Z59 A;  2ROZ B;  3OHM B;  4DXA B;  1ZC4 B;  4HB4 B;  1UNP A;  1EVH A;  1OY2 A;  4DIX A;  2M38 A;  3PEG A;  1Y5O A;  3NWF A;  2EJ8 A;  5HE3 A;  2KR0 A;  2VRW B;  4OT1 A;  2COF A;  2L1C A;  2LKO A;  5D3W A;  2UZS A;  5C5B B;  1ZYI A;  1RJ2 A;  1TJ6 A;  2CY5 A;  1MI1 A;  4GPT B;  2RGN B;  2R0D A;  4HAV B;  4YL8 A;  5JHH A;  2I1K A;  2UZR A;  2GCL A;  4TKN A;  2BCJ A;  2Z0P A;  4GNK B;  4HAU B;  1K5D B;  1P5T A;  5C5B A;  4C0A A;  2DX5 A;  4PQ0 A;  1BWN A;  5JLJ B;  5J3Y A;  1DBH A;  5HE2 A;  5DHF B;  1J19 A;  2YRY A;  4K2P A;  5GOW B;  4A5K A;  1WJ1 A;  1WJM A;  2W2X C;  3MPX A;  4K2O A;  2Q13 A;  2HE7 A;  1NI2 A;  2HTH B;  1QC6 A;  3TFM A;  3GYO A;  5D3X A;  1Q67 A;  2KUQ A;  2LOX A;  3M1I B;  3FM8 C;  2GJY A;  2I5F A;  1FGZ A;  5DH9 B;  3SYX A;  1FHW A;  2I5C A;  3ZDT A;  2D9X A;  5DIF B;  4KHA A;  2GS0 A;  1H4R A;  2D9Z A;  2YS3 A;  4WVF B;  1AQC A;  3KRW A;  2AL6 A;  2KUP A;  1AWE A;  3V5W A;  4HB0 B;  2K8E A;  2MWN B;  3F5R A;  3PG7 A;  1FOE A;  2YVC A;  1EF1 A;  3BIN A;  4IFS A;  2J0M A;  4HDO A;  1MAI A;  5EFX A;  3UZT A;  3ODW A;  5FI0 A;  4EMO A;  5DHA B;  4KHB A;  2DKQ A;  2K00 A;  3A8Q A;  3TO1 A;  1LB1 A;  2EMS A;  2J59 M;  4KAX B;  3NW8 A;  2RRF A;  3HSA A;  4HAY B;  2IFS A;  3PP2 A;  3GYP A;  4QJ3 B;  1UPQ A;  3D8F A;  1DYN A;  3HIE A;  4A6H A;  2DA0 A;  2G35 A;  1PFJ A;  1V5M A;  2DHJ A;  2UVM A;  2J0K A;  5L81 A;  2CAY A;  1ZVR A;  3TVV A;  2DN6 A;  3N7C A;  4F7G A;  2ZPY A;  2R09 A;  3RCP A;  2GUM A;  4WJ7 A;  4K17 A;  2AEH A;  2FJL A;  3O96 A;  2DYN A;  1MK7 B;  5KQ4 A;  2H7E A;  2DLW A;  1FGY A;  1MIX A;  2DYQ A;  5CLL B;  1FB8 A;  1UNQ A;  4DBB A;  3LJU X;  4HAX B;  4IOY X;  1H10 A;  2VSZ A;  5LON B;  2DX1 A;  1FHX A;  2NBV A;  2Z0O A;  2KCJ A;  1GG3 A;  4ZRI A;  3IVF A;  1Y19 B;  2ELA A;  3DXE A;  2NZ8 B;  4DX9 0;  3X23 A;  1U2B A;  4A6F B;  4QJ5 B;  1U27 A;  2RVB B;  3A58 A;  2ROV A;  1P3R A;  2N23 A;  5J3T A;  2K2U A;  3A98 B;  1X05 A;  2D11 A;  2VKI A;  2KIE A;  4CYE A;  1OQN A;  1X1F A;  4P7I A;  1M7R A;  2LUL A;  4GMX B;  5IRS A;  4F7U P;  1XKE A;  4Z2M B;  3D8E A;  1UEF A;  2LYD A;  2J0J A;  3NWD A;  4L1R A;  1FHO A;  2I1J A;  2JP2 A;  1WG7 A;  1E5W A;  2QKM A;  3U7D A;  1XCG A;  3ULC A;  2D2Q A;  3NSU A;  4HDQ A;  1XX0 A;  5C16 A;  1V5U A;  5C6R A;  3FEH A;  5D3Y A;  4EJN A;  2COC A;  2COA A;  1W1H A;  2Z14 A;  4H8S A;  2P0D A;  1U5E A;  1RRP B;  1SGH A;  4GZU A;  2RLO A;  1N3H A;  3NWA A;  1WI1 A;  3AU4 A;  3B77 A;  3FVC A;  4Z2N A;  1X86 A;  1I2H A;  1NU2 A;  1BTN A;  4XWX A;  3PVU A;  5C79 A;  1Z87 A;  4ZRJ A;  2K2J A;  2YS1 A;  5LG4 B;  4OSN A;  4IAP A;  1ZC3 B;  3PZD A;  1MIZ B;  2DTC A;  2ADZ A;  2YT0 A;  1MK9 B;  1KZG A;  1PMS A;  4K81 A;  4MT7 A;  4KVG B;  1X1G A;  1EAZ A;  4HB3 B;  3KZ1 A;  2COD A;  2EC1 A; 
#chains in the Genus database with same CATH homology
 3ZVR A;  2CY4 A;  2DKP A;  2MKR A;  4BBK A;  4PNK A;  4TYZ A;  4CHM A;  1P6S A;  3SO6 A;  3TCA A;  2E2X A;  3SV1 A;  3AJ4 A;  4MK0 A;  2DHK A;  3ML4 A;  1ZSQ A;  2RUK B;  3BJI A;  2KGX B;  2YS5 A;  4HB2 B;  3MDB C;  4GN1 A;  5FI1 A;  5KCV A;  1EGX A;  2P0H A;  3P6A A;  2YSZ A;  4GMV A;  1U5D A;  4KHB B;  3AU5 A;  1UNR A;  4L6E A;  2MDX A;  3HK0 A;  3KY9 A;  2NMB A;  2OQB A;  2D4Q A;  2D9V A;  4Y94 A;  1TXD A;  3OAN A;  2YT1 A;  5D27 A;  1UPR A;  4ZRK A;  2H7D A;  3FSS A;  2IYB A;  4DX8 A;  4KHO A;  5HE1 A;  5DI9 B;  1DDV A;  3CXB B;  1ISN A;  2Y8G A;  1LW3 A;  2LOZ A;  1WGU A;  3KRX A;  3QBV B;  4D0N B;  1U5G A;  2D10 A;  4YON A;  5JP4 A;  1MPH A;  2P8V A;  5JHG A;  5HE0 A;  1V5P A;  3DXD A;  1NTY A;  2Y7B A;  2X18 A;  3VIA A;  4F7H A;  3WYF B;  2DFK A;  3ULB A;  3ODO A;  4HHV A;  2RSG A;  4CHJ A;  3CIK A;  1K5G B;  1SHC A;  2QKL A;  1XR0 B;  3VOQ A;  3U8Z A;  4HAW B;  3DXC A;  1X11 A;  3QIJ A;  3QWM A;  1DDM A;  1W1G A;  1V61 A;  2Z0Q A;  2LG1 A;  2W2W A;  3T06 A;  4MY6 A;  1FAO A;  4HAT B;  3PVL A;  3KSY A;  1WGQ A;  3A8P A;  4HAZ B;  1GC6 A;  1U5F A;  1I7A A;  4A6F A;  1KZ7 A;  2ELB A;  5D3V A;  2CRF A;  3HW2 B;  1BTK A;  2MFQ A;  3WA0 A;  2YF0 A;  3SUZ A;  1M7E A;  1DRO A;  1WVH A;  4NSW A;  1MKE A;  1W1D A;  1NTV A;  2EMT A;  2GCJ A;  3D8D A;  3HQC A;  4A6K A;  2D9Y A;  1U29 A;  1XOD A;  2L2I A;  2P0F A;  2PZ1 A;  2V76 A;  4EKU A;  1DDW A;  5KQ1 A;  3PSC A;  1OMW A;  1XD4 A;  1QQG A;  5J3Q A;  1PLS A;  2M14 A;  3TW1 A;  2OTX A;  5LOP B;  2Y8F A;  2W2X D;  3F0W A;  4WSF A;  2DHI A;  3P7Z A;  3SNH A;  1IRS A;  4GXB A;  1J0W A;  1B55 A;  3ODX A;  2XQN M;  3PVW A;  4NY0 A;  1ZM0 A;  1TQZ A;  1KI1 B;  5CLQ B;  1V88 A;  2RNR B;  4B6H A;  1BAK A;  1GC7 A;  2D9W A;  1V89 A;  2N0Y A;  3G9W A;  2ROZ B;  4DXA B;  1ZC4 B;  4HB4 B;  1UNP A;  1EVH A;  1OY2 A;  2M38 A;  3PEG A;  1Y5O A;  2EJ8 A;  5HE3 A;  2VRW B;  2COF A;  2L1C A;  2LKO A;  5D3W A;  2UZS A;  5C5B B;  1RJ2 A;  1TJ6 A;  2CY5 A;  4GPT B;  2RGN B;  2R0D A;  4HAV B;  4YL8 A;  5JHH A;  2I1K A;  2UZR A;  2GCL A;  4TKN A;  2BCJ A;  2Z0P A;  4HAU B;  1K5D B;  1P5T A;  5C5B A;  4C0A A;  2DX5 A;  4PQ0 A;  1BWN A;  5JLJ B;  5J3Y A;  1DBH A;  5HE2 A;  5DHF B;  1J19 A;  2YRY A;  4K2P A;  5GOW B;  4A5K A;  1WJ1 A;  1WJM A;  2W2X C;  3MPX A;  4K2O A;  2Q13 A;  2HE7 A;  1NI2 A;  2HTH B;  1QC6 A;  3TFM A;  3GYO A;  5D3X A;  1Q67 A;  2LOX A;  3M1I B;  3FM8 C;  2GJY A;  2I5F A;  1FGZ A;  5DH9 B;  3SYX A;  1FHW A;  2I5C A;  3ZDT A;  2D9X A;  5DIF B;  4KHA A;  2GS0 A;  1H4R A;  2D9Z A;  2YS3 A;  4WVF B;  1AQC A;  3KRW A;  2AL6 A;  2KUP A;  1AWE A;  3V5W A;  4HB0 B;  2MWN B;  3F5R A;  3PG7 A;  1FOE A;  2YVC A;  1EF1 A;  3BIN A;  4IFS A;  2J0M A;  4HDO A;  1MAI A;  5EFX A;  3UZT A;  3ODW A;  5FI0 A;  4EMO A;  5DHA B;  2DKQ A;  2K00 A;  3A8Q A;  3TO1 A;  1LB1 A;  2EMS A;  2J59 M;  4KAX B;  4HAY B;  2IFS A;  3PP2 A;  3GYP A;  1UPQ A;  3D8F A;  1DYN A;  4A6H A;  2DA0 A;  2G35 A;  1PFJ A;  1V5M A;  2DHJ A;  2UVM A;  2J0K A;  5L81 A;  2CAY A;  1ZVR A;  3TVV A;  2DN6 A;  3N7C A;  4F7G A;  2ZPY A;  2R09 A;  3RCP A;  4WJ7 A;  4K17 A;  2AEH A;  2FJL A;  3O96 A;  2DYN A;  1MK7 B;  5KQ4 A;  2H7E A;  2DLW A;  1FGY A;  1MIX A;  2DYQ A;  5CLL B;  1FB8 A;  1UNQ A;  4DBB A;  3LJU X;  4HAX B;  4IOY X;  1H10 A;  2VSZ A;  5LON B;  2DX1 A;  1FHX A;  2Z0O A;  2KCJ A;  1GG3 A;  4ZRI A;  3IVF A;  1Y19 B;  2ELA A;  3DXE A;  2NZ8 B;  4DX9 0;  3X23 A;  1U2B A;  4A6F B;  1U27 A;  2RVB B;  2ROV A;  1P3R A;  2N23 A;  5J3T A;  2K2U A;  3A98 B;  1X05 A;  2D11 A;  2VKI A;  4CYE A;  1OQN A;  1X1F A;  4P7I A;  1M7R A;  2LUL A;  4GMX B;  4F7U P;  1XKE A;  4Z2M B;  3D8E A;  1UEF A;  2LYD A;  2J0J A;  1FHO A;  2I1J A;  2JP2 A;  1WG7 A;  1E5W A;  2QKM A;  3U7D A;  1XCG A;  3ULC A;  2D2Q A;  3NSU A;  4HDQ A;  1XX0 A;  5C16 A;  1V5U A;  5C6R A;  3FEH A;  5D3Y A;  4EJN A;  2COC A;  2COA A;  1W1H A;  4H8S A;  2P0D A;  1U5E A;  1RRP B;  1SGH A;  4GZU A;  2RLO A;  1N3H A;  1WI1 A;  3AU4 A;  4Z2N A;  1X86 A;  1I2H A;  1NU2 A;  1BTN A;  4XWX A;  3PVU A;  5C79 A;  1Z87 A;  4ZRJ A;  2K2J A;  2YS1 A;  4IAP A;  1ZC3 B;  3PZD A;  1MIZ B;  2DTC A;  2ADZ A;  2YT0 A;  1MK9 B;  1KZG A;  1PMS A;  4K81 A;  4MT7 A;  4KVG B;  1X1G A;  1EAZ A;  4HB3 B;  3KZ1 A;  2COD A;  2EC1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...