3ML4A

Crystal structure of a complex between dok7 ph-ptb and the musk juxtamembrane region
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
208
structure length
205
Chain Sequence
EAALVEGQVKLRKWKSRWLVLRKPSPVADCLLMLVYKDKCERSKGLRERSSLTLEDICGLEPALPYEGLAHTLAIICLSQAVMLGFDSHEAMCAWDTRIRYALGEVHRFHVTVAPGTKLESGPATLHLCNDILVLARDIPPTVMGQWKLSDLRRYGAVPNGFIFEGGTRCGYWAGVFFLSSAEGEQMSFLFDCIVRGISPTKGPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Cytoplasmic Adaptor Protein Dok7 Activates the Receptor Tyrosine Kinase MuSK via Dimerization.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Protein Dok-7
total genus 41
structure length 205
sequence length 208
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02174 IRS PTB domain (IRS-1 type)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3ml4A01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3ml4A02
2ZPYA 4Z2MB 3SNHA 3D8EA 4HAUB 3WYFB 1WI1A 2DN6A 2IFSA 1M7EA 3SUZA 1Q67A 3D8DA 2K2UA 4HDOA 3PP2A 2RNRB 1V89A 2ROZB 1IRSA 4K2PA 1BTKA 1DBHA 3LJUX 4PNKA 3FSSA 1X11A 3ODWA 5JLJB 4GMXB 4HAWB 3F5RA 4KHOA 2UZSA 1UNRA 4K2OA 1ZVRA 3KY9A 5KCVA 3G9WA 5HE3A 4ZRIA 3P7ZA 2GJYA 4IAPA 3MPXA 1ISNA 5D3YA 1GC6A 3DXCA 1XODA 2D9YA 2KGXB 3RCPA 2DX1A 2BCJA 3KRXA 1DROA 4F7UP 2D10A 1XD4A 2DTCA 4HATB 5D3XA 2CAYA 3AU5A 1V61A 5C5BB 4HHVA 3NSUA 1Z87A 3PSCA 3UZTA 2YS3A 2DX5A 3OANA 3PEGA 1E5WA 3A8PA 2DHKA 3CIKA 4HAYB 4HAXB 2LOXA 5HE1A 2I1KA 3TO1A 2QKMA 1UNPA 5HE0A 1XX0A 1NI2A 2Z0QA 3U7DA 2QKLA 4K81A 1N3HA 2J59M 4A6HA 1MPHA 5L81A 2D9ZA 4IFSA 4XWXA 1EAZA 5DH9B 3PZDA 5J3TA 2YT0A 2X18A 1U27A 1FHWA 1OQNA 5C79A 1I2HA 2D9XA 1SHCA 5JP4A 3V5WA 3SYXA 2MDXA 2DYQA 2FJLA 5DI9B 4EKUA 2J0MA 1FGZA 2MFQA 4KAXB 4BBKA 3X23A 1U5DA 2CRFA 5DIFB 2P8VA 2OQBA 1TXDA 3DXDA 4CHJA 3AU4A 4A5KA 3T06A 3ZDTA 3HW2B 2E2XA 1V5PA 3PG7A 1X1FA 2DKQA 1UEFA 2Z0PA 4DX8A 2ADZA 3ZVRA 2LKOA 4GZUA 2LG1A 4C0AA 2YSZA 4GN1A 1BAKA 1UPRA 2G35A 2UZRA 4ZRJA 4DBBA 3BINA 3QIJA 3P6AA 1V88A 1U2BA 1PFJA 4YL8A 2DHIA 2AL6A 2NMBA 4GPTB 3KZ1A 1LB1A 5D3WA 2XQNM 4MY6A 4YONA 1ZC3B 1FGYA 1SGHA 1WVHA 3TFMA 3TW1A 3O96A 4TKNA 5HE2A 3D8FA 2W2XC 1GC7A 1P6SA 1DDWA 4HB4B 4HB2B 1DDVA 3GYOA 4H8SA 1U29A 1WJMA 1XR0B 2M14A 1ZSQA 4HB3B 1KI1B 2P0FA 4MT7A 1BWNA 4A6KA 1GG3A 1MIXA 2I1JA 3IVFA 2ELAA 2K00A 4KVGB 4NY0A 1Y5OA 5D3VA 2M38A 3PVWA 1FOEA 2H7EA 2H7DA 1DYNA 1MK9B 2COCA 5C5BA 3VIAA 1KZ7A 1U5EA 2I5CA 1NU2A 1J0WA 1LW3A 3ULCA 5KQ1A 3WA0A 2YRYA 3QBVB 1P5TA 2CY4A 5JHGA 2EJ8A 4CHMA 1H10A 2YVCA 1EGXA 4EJNA 4Y94A 4HAVB 1FAOA 4K17A 3ODXA 2D9WA 4PQ0A 1W1DA 2P0DA 1BTNA 1M7RA 4L6EA 2IYBA 2J0JA 3HQCA 1AWEA 4F7HA 2LYDA 2RUKB 4EMOA 3CXBB 2HTHB 1WGQA 2DKPA 3F0WA 5J3YA 5CLQB 3TCAA 2W2XD 1TJ6A 1XKEA 3PVUA 2EMTA 4WJ7A 4TYZA 3QWMA 5J3QA 2J0KA 2RSGA 5EFXA 2VKIA 2D9VA 2L2IA 1NTYA 2YS5A 2W2WA 1I7AA 3KSYA 4KHAA 2PZ1A 5DHAB 1OMWA 2R09A 1Y19B 5C6RA 2ELBA 2RVBB 3HK0A 1WJ1A 1V5UA 5JHHA 2LOZA 1UNQA 2GS0A 2YF0A 5CLLB 4GMVA 2L1CA 5LONB 3SV1A 2YS1A 1RJ2A 2Y8FA 4DX90 2DYNA 2AEHA 2NZ8B 2EC1A 1TQZA 3GYPA 1MKEA 4D0NB 1QC6A 3ODOA 4F7GA 4HAZB 2YT1A 5LOPB 2KUPA 2DA0A 1QQGA 4WVFB 2JP2A 2OTXA 3N7CA 2K2JA 1P3RA 1ZC4B 2VRWB 2Z0OA 1FB8A 1U5FA 2UVMA 2EMSA 4HDQA 1K5GB 5GOWB 4DXAB 3U8ZA 2D4QA 4CYEA 2COAA 2D11A 4KHBB 4WSFA 2VSZA 1J19A 2I5FA 2HE7A 1EVHA 1ZM0A 3BJIA 5KQ4A 3M1IB 1V5MA 3FEHA 3MDBC 1PMSA 3TVVA 2DFKA 5D27A 2LULA 5FI1A 1FHOA 2Y8GA 2ROVA 1PLSA 1NTVA 2MKRA 4A6FA 1H4RA 4A6FB 1XCGA 2Q13A 4Z2NA 1X1GA 1U5GA 1MAIA 2D2QA 3DXEA 1K5DB 2DLWA 2N0YA 2R0DA 4MK0A 1KZGA 2CY5A 2GCJA 3A98B 3KRWA 2Y7BA 4B6HA 2CODA 3ULBA 1B55A 1WG7A 5FI0A 1MK7B 1WGUA 3AJ4A 4ZRKA 1AQCA 1W1GA 2MWNB 2RGNB 4HB0B 2DHJA 2P0HA 1FHXA 1MIZB 4GXBA 4NSWA 2GCLA 4P7IA 5C16A 1OY2A 1EF1A 3FM8C 2RLOA 2KCJA 1X05A 2COFA 2N23A 1X86A 1UPQA 4IOYX 1RRPB 2V76A 1DDMA 1W1HA 3SO6A 3VOQA 3A8QA 5DHFB 3PVLA 3ML4A
chains in the Genus database with same CATH superfamily
2ZPYA 4Z2MB 3SNHA 3D8EA 4QJ4B 4HAUB 3WYFB 1WI1A 2DN6A 2IFSA 1M7EA 3SUZA 1Q67A 3D8DA 2K2UA 4HDOA 3PP2A 2RNRB 1V89A 2ROZB 1IRSA 4K2PA 4QXAB 3NWFA 1BTKA 1DBHA 3LJUX 4PNKA 3FSSA 1X11A 3HIEA 3ODWA 5JLJB 4GMXB 4HAWB 3F5RA 4KHOA 2UZSA 1UNRA 4K2OA 1ZVRA 3KY9A 5KCVA 3G9WA 5HE3A 4ZRIA 3P7ZA 2GJYA 4IAPA 3MPXA 1ISNA 5D3YA 1GC6A 3DXCA 1XODA 2D9YA 2KGXB 3RCPA 2DX1A 2BCJA 3KRXA 1DROA 4F7UP 2D10A 1XD4A 2DTCA 4HATB 5D3XA 2CAYA 3AU5A 1V61A 5C5BB 4HHVA 3NSUA 1Z87A 3PSCA 3UZTA 2YS3A 2GUMA 3NWDA 2DX5A 3OANA 3PEGA 5LG4B 1E5WA 3A8PA 2DHKA 3CIKA 4HAYB 3A58A 4HAXB 2LOXA 5HE1A 2I1KA 2KR0A 3TO1A 2QKMA 1UNPA 5HE0A 1XX0A 1NI2A 2Z0QA 3U7DA 2QKLA 4K81A 1N3HA 2J59M 4A6HA 1MPHA 5L81A 2D9ZA 4IFSA 4XWXA 1EAZA 5DH9B 3PZDA 5J3TA 2YT0A 2X18A 1U27A 1FHWA 1OQNA 5C79A 1I2HA 2D9XA 4OSNA 1SHCA 5JP4A 3V5WA 3SYXA 2MDXA 2DYQA 2FJLA 5DI9B 4EKUA 2J0MA 1FGZA 4GNKB 2MFQA 4KAXB 4BBKA 3X23A 1U5DA 2CRFA 5DIFB 3DCXA 2P8VA 2OQBA 1TXDA 3DXDA 4CHJA 3AU4A 4A5KA 3T06A 2RRFA 3ZDTA 3HW2B 2E2XA 1V5PA 3PG7A 1X1FA 2DKQA 1UEFA 2Z0PA 4DX8A 2ADZA 3ZVRA 2LKOA 4GZUA 2LG1A 3NW8A 4C0AA 2YSZA 4GN1A 3U12A 1BAKA 1UPRA 2G35A 2UZRA 4ZRJA 4DBBA 3BINA 3QIJA 3P6AA 1V88A 1U2BA 1PFJA 4YL8A 4D6WA 2DHIA 2AL6A 2NMBA 4GPTB 3KZ1A 1LB1A 5D3WA 2XQNM 4MY6A 4YONA 1ZC3B 1FGYA 1SGHA 4CSQA 1WVHA 3TFMA 3TW1A 3O96A 4TKNA 5HE2A 3D8FA 2W2XC 1GC7A 2KUQA 1P6SA 1DDWA 4HB4B 3NWAA 1DDVA 3GYOA 4HB2B 4H8SA 1U29A 1WJMA 1XR0B 2M14A 1ZSQA 4HB3B 1KI1B 2P0FA 4MT7A 1BWNA 4A6KA 1GG3A 1MIXA 2I1JA 3IVFA 2ELAA 2K00A 4KVGB 4NY0A 1Y5OA 5D3VA 2M38A 3PVWA 2Z59A 1FOEA 2H7EA 4QJ3B 2H7DA 1DYNA 1MK9B 2COCA 5C5BA 3VIAA 1KZ7A 1U5EA 2I5CA 1NU2A 1T77A 1J0WA 1LW3A 3ULCA 5KQ1A 3WA0A 2YRYA 3QBVB 1P5TA 4GOUA 5IRSA 2CY4A 3HSAA 2Z14A 5JHGA 2EJ8A 4CHMA 1H10A 2YVCA 1EGXA 4EJNA 4Y94A 4HAVB 1FAOA 4K17A 3ODXA 2D9WA 4PQ0A 1W1DA 2P0DA 1BTNA 2ZKMX 1M7RA 4L6EA 2IYBA 2J0JA 3HQCA 1AWEA 4F7HA 2LYDA 2RUKB 4EMOA 3CXBB 2HTHB 1WGQA 2DKPA 3F0WA 5J3YA 5CLQB 3TCAA 2W2XD 1TJ6A 1XKEA 3PVUA 2EMTA 4DIXA 4WJ7A 4TYZA 3QWMA 5I2MA 5J3QA 2J0KA 2RSGA 2Z13A 2VKIA 5EFXA 2D9VA 2L2IA 1NTYA 2YS5A 2W2WA 1I7AA 3KSYA 4KHAA 2PZ1A 2NBVA 5DHAB 5M4YB 1OMWA 2R09A 1Y19B 5C6RA 2ELBA 2RVBB 3B77A 3HK0A 1WJ1A 1V5UA 1ZYIA 5JHHA 2LOZA 1UNQA 2GS0A 2YF0A 5CLLB 4GMVA 2L1CA 5LONB 3SV1A 2YS1A 1RJ2A 2Y8FA 4DX90 2DYNA 2AEHA 4QJ5B 2NZ8B 2EC1A 1TQZA 2KIEA 3GYPA 1MKEA 2Z4DA 4D0NB 1QC6A 3ODOA 4F7GA 4HAZB 2YT1A 5LOPB 2KUPA 2DA0A 1QQGA 4WVFB 2JP2A 2OTXA 3N7CA 5I2SA 2K2JA 1P3RA 1ZC4B 2VRWB 2Z0OA 1FB8A 3FVCA 1U5FA 2UVMA 2EMSA 4HDQA 1K5GB 5GOWB 4DXAB 3U8ZA 2D4QA 4CYEA 2COAA 2D11A 4KHBB 2R2YA 4WSFA 2VSZA 1J19A 2I5FA 2HE7A 1EVHA 4L1RA 1ZM0A 3BJIA 5KQ4A 1MI1A 2K8EA 3M1IB 1V5MA 3FEHA 3MDBC 1PMSA 3TVVA 2DFKA 5D27A 2LULA 5FI1A 1FHOA 3OHMB 2Y8GA 2ROVA 1PLSA 1NTVA 2MKRA 4A6FA 1H4RA 4A6FB 1XCGA 2Q13A 4Z2NA 1X1GA 1U5GA 1MAIA 2D2QA 3DXEA 1K5DB 2DLWA 2N0YA 2R0DA 4MK0A 1KZGA 2CY5A 2GCJA 2KIGA 3A98B 3KRWA 2Y7BA 4B6HA 2CODA 3ULBA 1B55A 1WG7A 5FI0A 1MK7B 1WGUA 4KHBA 3AJ4A 4ZRKA 1AQCA 1W1GA 2MWNB 2RGNB 4HB0B 2DHJA 2P0HA 1FHXA 1MIZB 4GXBA 4HSIA 2K49A 4NSWA 4OT1A 2FJUB 2GCLA 4P7IA 5C16A 1OY2A 1EF1A 3FM8C 2RLOA 2KCJA 1X05A 2COFA 2N23A 1X86A 1UPQA 4IOYX 1RRPB 2V76A 1DDMA 1W1HA 3SO6A 3VOQA 3A8QA 5DHFB 3PVLA 2YT2A 3ML4A
chains in the Genus database with same CATH topology
2ZPYA 4Z2MB 3SNHA 3D8EA 4HAUB 3WYFB 1WI1A 2DN6A 2IFSA 1M7EA 3SUZA 1Q67A 3D8DA 2K2UA 4HDOA 3PP2A 2RNRB 1V89A 2ROZB 1IRSA 4K2PA 1BTKA 1DBHA 3LJUX 4PNKA 3FSSA 1X11A 3ODWA 5JLJB 4GMXB 4HAWB 3F5RA 4KHOA 2UZSA 1UNRA 4K2OA 1ZVRA 3KY9A 5KCVA 3G9WA 5HE3A 4ZRIA 3P7ZA 2GJYA 4IAPA 3MPXA 1ISNA 5D3YA 1GC6A 3DXCA 1XODA 2D9YA 2KGXB 3RCPA 2DX1A 2BCJA 3KRXA 1DROA 4F7UP 2D10A 1XD4A 2DTCA 4HATB 5D3XA 2CAYA 3AU5A 1V61A 5C5BB 4HHVA 3NSUA 1Z87A 3PSCA 3UZTA 2YS3A 2DX5A 3OANA 3PEGA 1E5WA 3A8PA 2DHKA 3CIKA 4HAYB 4HAXB 2LOXA 5HE1A 2I1KA 3TO1A 2QKMA 1UNPA 5HE0A 1XX0A 1NI2A 2Z0QA 3U7DA 2QKLA 4K81A 1N3HA 2J59M 4A6HA 1MPHA 5L81A 2D9ZA 4IFSA 4XWXA 1EAZA 5DH9B 3PZDA 5J3TA 2YT0A 2X18A 1U27A 1FHWA 1OQNA 5C79A 1I2HA 2D9XA 1SHCA 5JP4A 3V5WA 3SYXA 2MDXA 2DYQA 2FJLA 5DI9B 4EKUA 2J0MA 1FGZA 2MFQA 4KAXB 4BBKA 3X23A 1U5DA 2CRFA 5DIFB 2P8VA 2OQBA 1TXDA 3DXDA 4CHJA 3AU4A 4A5KA 3T06A 3ZDTA 3HW2B 2E2XA 1V5PA 3PG7A 1X1FA 2DKQA 1UEFA 2Z0PA 4DX8A 2ADZA 3ZVRA 2LKOA 4GZUA 2LG1A 4C0AA 2YSZA 4GN1A 1BAKA 1UPRA 2G35A 2UZRA 4ZRJA 4DBBA 3BINA 3QIJA 3P6AA 1V88A 1U2BA 1PFJA 4YL8A 2DHIA 2AL6A 2NMBA 4GPTB 3KZ1A 1LB1A 5D3WA 2XQNM 4MY6A 4YONA 1ZC3B 1FGYA 1SGHA 1WVHA 3TFMA 3TW1A 3O96A 4TKNA 5HE2A 3D8FA 2W2XC 1GC7A 1P6SA 1DDWA 4HB4B 4HB2B 1DDVA 3GYOA 4H8SA 1U29A 1WJMA 1XR0B 2M14A 1ZSQA 4HB3B 1KI1B 2P0FA 4MT7A 1BWNA 4A6KA 1GG3A 1MIXA 2I1JA 3IVFA 2ELAA 2K00A 4KVGB 4NY0A 1Y5OA 5D3VA 2M38A 3PVWA 1FOEA 2H7EA 2H7DA 1DYNA 1MK9B 2COCA 5C5BA 3VIAA 1KZ7A 1U5EA 2I5CA 1NU2A 1J0WA 1LW3A 3ULCA 5KQ1A 3WA0A 2YRYA 3QBVB 1P5TA 2CY4A 5JHGA 2EJ8A 4CHMA 1H10A 2YVCA 1EGXA 4EJNA 4Y94A 4HAVB 1FAOA 4K17A 3ODXA 2D9WA 4PQ0A 1W1DA 2P0DA 1BTNA 1M7RA 4L6EA 2IYBA 2J0JA 3HQCA 1AWEA 4F7HA 2LYDA 2RUKB 4EMOA 3CXBB 2HTHB 1WGQA 2DKPA 3F0WA 5J3YA 5CLQB 3TCAA 2W2XD 1TJ6A 1XKEA 3PVUA 2EMTA 4WJ7A 4TYZA 3QWMA 5J3QA 2J0KA 2RSGA 5EFXA 2VKIA 2D9VA 2L2IA 1NTYA 2YS5A 2W2WA 1I7AA 3KSYA 4KHAA 2PZ1A 5DHAB 1OMWA 2R09A 1Y19B 5C6RA 2ELBA 2RVBB 3HK0A 1WJ1A 1V5UA 5JHHA 2LOZA 1UNQA 2GS0A 2YF0A 5CLLB 4GMVA 2L1CA 5LONB 3SV1A 2YS1A 1RJ2A 2Y8FA 4DX90 2DYNA 2AEHA 2NZ8B 2EC1A 1TQZA 3GYPA 1MKEA 4D0NB 1QC6A 3ODOA 4F7GA 4HAZB 2YT1A 5LOPB 2KUPA 2DA0A 1QQGA 4WVFB 2JP2A 2OTXA 3N7CA 2K2JA 1P3RA 1ZC4B 2VRWB 2Z0OA 1FB8A 1U5FA 2UVMA 2EMSA 4HDQA 1K5GB 5GOWB 4DXAB 3U8ZA 2D4QA 4CYEA 2COAA 2D11A 4KHBB 4WSFA 2VSZA 1J19A 2I5FA 2HE7A 1EVHA 1ZM0A 3BJIA 5KQ4A 3M1IB 1V5MA 3FEHA 3MDBC 1PMSA 3TVVA 2DFKA 5D27A 2LULA 5FI1A 1FHOA 2Y8GA 2ROVA 1PLSA 1NTVA 2MKRA 4A6FA 1H4RA 4A6FB 1XCGA 2Q13A 4Z2NA 1X1GA 1U5GA 1MAIA 2D2QA 3DXEA 1K5DB 2DLWA 2N0YA 2R0DA 4MK0A 1KZGA 2CY5A 2GCJA 3A98B 3KRWA 2Y7BA 4B6HA 2CODA 3ULBA 1B55A 1WG7A 5FI0A 1MK7B 1WGUA 3AJ4A 4ZRKA 1AQCA 1W1GA 2MWNB 2RGNB 4HB0B 2DHJA 2P0HA 1FHXA 1MIZB 4GXBA 4NSWA 2GCLA 4P7IA 5C16A 1OY2A 1EF1A 3FM8C 2RLOA 2KCJA 1X05A 2COFA 2N23A 1X86A 1UPQA 4IOYX 1RRPB 2V76A 1DDMA 1W1HA 3SO6A 3VOQA 3A8QA 5DHFB 3PVLA 3ML4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZPY A;  4Z2M B;  3SNH A;  3D8E A;  4HAU B;  3WYF B;  1WI1 A;  2DN6 A;  2IFS A;  1M7E A;  3SUZ A;  1Q67 A;  3D8D A;  2K2U A;  4HDO A;  3PP2 A;  2RNR B;  1V89 A;  2ROZ B;  1IRS A;  4K2P A;  1BTK A;  1DBH A;  3LJU X;  4PNK A;  3FSS A;  1X11 A;  3ODW A;  5JLJ B;  4GMX B;  4HAW B;  3F5R A;  4KHO A;  2UZS A;  1UNR A;  4K2O A;  1ZVR A;  3KY9 A;  5KCV A;  3G9W A;  5HE3 A;  4ZRI A;  3P7Z A;  2GJY A;  4IAP A;  3MPX A;  1ISN A;  5D3Y A;  1GC6 A;  3DXC A;  1XOD A;  2D9Y A;  2KGX B;  3RCP A;  2DX1 A;  2BCJ A;  3KRX A;  1DRO A;  4F7U P;  2D10 A;  1XD4 A;  2DTC A;  4HAT B;  5D3X A;  2CAY A;  3AU5 A;  1V61 A;  5C5B B;  4HHV A;  3NSU A;  1Z87 A;  3PSC A;  3UZT A;  2YS3 A;  2DX5 A;  3OAN A;  3PEG A;  1E5W A;  3A8P A;  2DHK A;  3CIK A;  4HAY B;  4HAX B;  2LOX A;  5HE1 A;  2I1K A;  3TO1 A;  2QKM A;  1UNP A;  5HE0 A;  1XX0 A;  1NI2 A;  2Z0Q A;  3U7D A;  2QKL A;  4K81 A;  1N3H A;  2J59 M;  4A6H A;  1MPH A;  5L81 A;  2D9Z A;  4IFS A;  4XWX A;  1EAZ A;  5DH9 B;  3PZD A;  5J3T A;  2YT0 A;  2X18 A;  1U27 A;  1FHW A;  1OQN A;  5C79 A;  1I2H A;  2D9X A;  1SHC A;  5JP4 A;  3V5W A;  3SYX A;  2MDX A;  2DYQ A;  2FJL A;  5DI9 B;  4EKU A;  2J0M A;  1FGZ A;  2MFQ A;  4KAX B;  4BBK A;  3X23 A;  1U5D A;  2CRF A;  5DIF B;  2P8V A;  2OQB A;  1TXD A;  3DXD A;  4CHJ A;  3AU4 A;  4A5K A;  3T06 A;  3ZDT A;  3HW2 B;  2E2X A;  1V5P A;  3PG7 A;  1X1F A;  2DKQ A;  1UEF A;  2Z0P A;  4DX8 A;  2ADZ A;  3ZVR A;  2LKO A;  4GZU A;  2LG1 A;  4C0A A;  2YSZ A;  4GN1 A;  1BAK A;  1UPR A;  2G35 A;  2UZR A;  4ZRJ A;  4DBB A;  3BIN A;  3QIJ A;  3P6A A;  1V88 A;  1U2B A;  1PFJ A;  4YL8 A;  2DHI A;  2AL6 A;  2NMB A;  4GPT B;  3KZ1 A;  1LB1 A;  5D3W A;  2XQN M;  4MY6 A;  4YON A;  1ZC3 B;  1FGY A;  1SGH A;  1WVH A;  3TFM A;  3TW1 A;  3O96 A;  4TKN A;  5HE2 A;  3D8F A;  2W2X C;  1GC7 A;  1P6S A;  1DDW A;  4HB4 B;  4HB2 B;  1DDV A;  3GYO A;  4H8S A;  1U29 A;  1WJM A;  1XR0 B;  2M14 A;  1ZSQ A;  4HB3 B;  1KI1 B;  2P0F A;  4MT7 A;  1BWN A;  4A6K A;  1GG3 A;  1MIX A;  2I1J A;  3IVF A;  2ELA A;  2K00 A;  4KVG B;  4NY0 A;  1Y5O A;  5D3V A;  2M38 A;  3PVW A;  1FOE A;  2H7E A;  2H7D A;  1DYN A;  1MK9 B;  2COC A;  5C5B A;  3VIA A;  1KZ7 A;  1U5E A;  2I5C A;  1NU2 A;  1J0W A;  1LW3 A;  3ULC A;  5KQ1 A;  3WA0 A;  2YRY A;  3QBV B;  1P5T A;  2CY4 A;  5JHG A;  2EJ8 A;  4CHM A;  1H10 A;  2YVC A;  1EGX A;  4EJN A;  4Y94 A;  4HAV B;  1FAO A;  4K17 A;  3ODX A;  2D9W A;  4PQ0 A;  1W1D A;  2P0D A;  1BTN A;  1M7R A;  4L6E A;  2IYB A;  2J0J A;  3HQC A;  1AWE A;  4F7H A;  2LYD A;  2RUK B;  4EMO A;  3CXB B;  2HTH B;  1WGQ A;  2DKP A;  3F0W A;  5J3Y A;  5CLQ B;  3TCA A;  2W2X D;  1TJ6 A;  1XKE A;  3PVU A;  2EMT A;  4WJ7 A;  4TYZ A;  3QWM A;  5J3Q A;  2J0K A;  2RSG A;  5EFX A;  2VKI A;  2D9V A;  2L2I A;  1NTY A;  2YS5 A;  2W2W A;  1I7A A;  3KSY A;  4KHA A;  2PZ1 A;  5DHA B;  1OMW A;  2R09 A;  1Y19 B;  5C6R A;  2ELB A;  2RVB B;  3HK0 A;  1WJ1 A;  1V5U A;  5JHH A;  2LOZ A;  1UNQ A;  2GS0 A;  2YF0 A;  5CLL B;  4GMV A;  2L1C A;  5LON B;  3SV1 A;  2YS1 A;  1RJ2 A;  2Y8F A;  4DX9 0;  2DYN A;  2AEH A;  2NZ8 B;  2EC1 A;  1TQZ A;  3GYP A;  1MKE A;  4D0N B;  1QC6 A;  3ODO A;  4F7G A;  4HAZ B;  2YT1 A;  5LOP B;  2KUP A;  2DA0 A;  1QQG A;  4WVF B;  2JP2 A;  2OTX A;  3N7C A;  2K2J A;  1P3R A;  1ZC4 B;  2VRW B;  2Z0O A;  1FB8 A;  1U5F A;  2UVM A;  2EMS A;  4HDQ A;  1K5G B;  5GOW B;  4DXA B;  3U8Z A;  2D4Q A;  4CYE A;  2COA A;  2D11 A;  4KHB B;  4WSF A;  2VSZ A;  1J19 A;  2I5F A;  2HE7 A;  1EVH A;  1ZM0 A;  3BJI A;  5KQ4 A;  3M1I B;  1V5M A;  3FEH A;  3MDB C;  1PMS A;  3TVV A;  2DFK A;  5D27 A;  2LUL A;  5FI1 A;  1FHO A;  2Y8G A;  2ROV A;  1PLS A;  1NTV A;  2MKR A;  4A6F A;  1H4R A;  4A6F B;  1XCG A;  2Q13 A;  4Z2N A;  1X1G A;  1U5G A;  1MAI A;  2D2Q A;  3DXE A;  1K5D B;  2DLW A;  2N0Y A;  2R0D A;  4MK0 A;  1KZG A;  2CY5 A;  2GCJ A;  3A98 B;  3KRW A;  2Y7B A;  4B6H A;  2COD A;  3ULB A;  1B55 A;  1WG7 A;  5FI0 A;  1MK7 B;  1WGU A;  3AJ4 A;  4ZRK A;  1AQC A;  1W1G A;  2MWN B;  2RGN B;  4HB0 B;  2DHJ A;  2P0H A;  1FHX A;  1MIZ B;  4GXB A;  4NSW A;  2GCL A;  4P7I A;  5C16 A;  1OY2 A;  1EF1 A;  3FM8 C;  2RLO A;  2KCJ A;  1X05 A;  2COF A;  2N23 A;  1X86 A;  1UPQ A;  4IOY X;  1RRP B;  2V76 A;  1DDM A;  1W1H A;  3SO6 A;  3VOQ A;  3A8Q A;  5DHF B;  3PVL A;  3ML4 A; 
#chains in the Genus database with same CATH topology
 2ZPY A;  4Z2M B;  3SNH A;  3D8E A;  4QJ4 B;  4HAU B;  3WYF B;  1WI1 A;  2DN6 A;  2IFS A;  1M7E A;  3SUZ A;  1Q67 A;  3D8D A;  2K2U A;  4HDO A;  3PP2 A;  2RNR B;  1V89 A;  2ROZ B;  1IRS A;  4K2P A;  4QXA B;  3NWF A;  1BTK A;  1DBH A;  3LJU X;  4PNK A;  3FSS A;  1X11 A;  3HIE A;  3ODW A;  5JLJ B;  4GMX B;  4HAW B;  3F5R A;  4KHO A;  2UZS A;  1UNR A;  4K2O A;  1ZVR A;  3KY9 A;  5KCV A;  3G9W A;  5HE3 A;  4ZRI A;  3P7Z A;  2GJY A;  4IAP A;  3MPX A;  1ISN A;  5D3Y A;  1GC6 A;  3DXC A;  1XOD A;  2D9Y A;  2KGX B;  3RCP A;  2DX1 A;  2BCJ A;  3KRX A;  1DRO A;  4F7U P;  2D10 A;  1XD4 A;  2DTC A;  4HAT B;  5D3X A;  2CAY A;  3AU5 A;  1V61 A;  5C5B B;  4HHV A;  3NSU A;  1Z87 A;  3PSC A;  3UZT A;  2YS3 A;  2GUM A;  3NWD A;  2DX5 A;  3OAN A;  3PEG A;  5LG4 B;  1E5W A;  3A8P A;  2DHK A;  3CIK A;  4HAY B;  3A58 A;  4HAX B;  2LOX A;  5HE1 A;  2I1K A;  2KR0 A;  3TO1 A;  2QKM A;  1UNP A;  5HE0 A;  1XX0 A;  1NI2 A;  2Z0Q A;  3U7D A;  2QKL A;  4K81 A;  1N3H A;  2J59 M;  4A6H A;  1MPH A;  5L81 A;  2D9Z A;  4IFS A;  4XWX A;  1EAZ A;  5DH9 B;  3PZD A;  5J3T A;  2YT0 A;  2X18 A;  1U27 A;  1FHW A;  1OQN A;  5C79 A;  1I2H A;  2D9X A;  4OSN A;  1SHC A;  5JP4 A;  3V5W A;  3SYX A;  2MDX A;  2DYQ A;  2FJL A;  5DI9 B;  4EKU A;  2J0M A;  1FGZ A;  4GNK B;  2MFQ A;  4KAX B;  4BBK A;  3X23 A;  1U5D A;  2CRF A;  5DIF B;  3DCX A;  2P8V A;  2OQB A;  1TXD A;  3DXD A;  4CHJ A;  3AU4 A;  4A5K A;  3T06 A;  2RRF A;  3ZDT A;  3HW2 B;  2E2X A;  1V5P A;  3PG7 A;  1X1F A;  2DKQ A;  1UEF A;  2Z0P A;  4DX8 A;  2ADZ A;  3ZVR A;  2LKO A;  4GZU A;  2LG1 A;  3NW8 A;  4C0A A;  2YSZ A;  4GN1 A;  3U12 A;  1BAK A;  1UPR A;  2G35 A;  2UZR A;  4ZRJ A;  4DBB A;  3BIN A;  3QIJ A;  3P6A A;  1V88 A;  1U2B A;  1PFJ A;  4YL8 A;  4D6W A;  2DHI A;  2AL6 A;  2NMB A;  4GPT B;  3KZ1 A;  1LB1 A;  5D3W A;  2XQN M;  4MY6 A;  4YON A;  1ZC3 B;  1FGY A;  1SGH A;  4CSQ A;  1WVH A;  3TFM A;  3TW1 A;  3O96 A;  4TKN A;  5HE2 A;  3D8F A;  2W2X C;  1GC7 A;  2KUQ A;  1P6S A;  1DDW A;  4HB4 B;  3NWA A;  1DDV A;  3GYO A;  4HB2 B;  4H8S A;  1U29 A;  1WJM A;  1XR0 B;  2M14 A;  1ZSQ A;  4HB3 B;  1KI1 B;  2P0F A;  4MT7 A;  1BWN A;  4A6K A;  1GG3 A;  1MIX A;  2I1J A;  3IVF A;  2ELA A;  2K00 A;  4KVG B;  4NY0 A;  1Y5O A;  5D3V A;  2M38 A;  3PVW A;  2Z59 A;  1FOE A;  2H7E A;  4QJ3 B;  2H7D A;  1DYN A;  1MK9 B;  2COC A;  5C5B A;  3VIA A;  1KZ7 A;  1U5E A;  2I5C A;  1NU2 A;  1T77 A;  1J0W A;  1LW3 A;  3ULC A;  5KQ1 A;  3WA0 A;  2YRY A;  3QBV B;  1P5T A;  4GOU A;  5IRS A;  2CY4 A;  3HSA A;  2Z14 A;  5JHG A;  2EJ8 A;  4CHM A;  1H10 A;  2YVC A;  1EGX A;  4EJN A;  4Y94 A;  4HAV B;  1FAO A;  4K17 A;  3ODX A;  2D9W A;  4PQ0 A;  1W1D A;  2P0D A;  1BTN A;  2ZKM X;  1M7R A;  4L6E A;  2IYB A;  2J0J A;  3HQC A;  1AWE A;  4F7H A;  2LYD A;  2RUK B;  4EMO A;  3CXB B;  2HTH B;  1WGQ A;  2DKP A;  3F0W A;  5J3Y A;  5CLQ B;  3TCA A;  2W2X D;  1TJ6 A;  1XKE A;  3PVU A;  2EMT A;  4DIX A;  4WJ7 A;  4TYZ A;  3QWM A;  5I2M A;  5J3Q A;  2J0K A;  2RSG A;  2Z13 A;  2VKI A;  5EFX A;  2D9V A;  2L2I A;  1NTY A;  2YS5 A;  2W2W A;  1I7A A;  3KSY A;  4KHA A;  2PZ1 A;  2NBV A;  5DHA B;  5M4Y B;  1OMW A;  2R09 A;  1Y19 B;  5C6R A;  2ELB A;  2RVB B;  3B77 A;  3HK0 A;  1WJ1 A;  1V5U A;  1ZYI A;  5JHH A;  2LOZ A;  1UNQ A;  2GS0 A;  2YF0 A;  5CLL B;  4GMV A;  2L1C A;  5LON B;  3SV1 A;  2YS1 A;  1RJ2 A;  2Y8F A;  4DX9 0;  2DYN A;  2AEH A;  4QJ5 B;  2NZ8 B;  2EC1 A;  1TQZ A;  2KIE A;  3GYP A;  1MKE A;  2Z4D A;  4D0N B;  1QC6 A;  3ODO A;  4F7G A;  4HAZ B;  2YT1 A;  5LOP B;  2KUP A;  2DA0 A;  1QQG A;  4WVF B;  2JP2 A;  2OTX A;  3N7C A;  5I2S A;  2K2J A;  1P3R A;  1ZC4 B;  2VRW B;  2Z0O A;  1FB8 A;  3FVC A;  1U5F A;  2UVM A;  2EMS A;  4HDQ A;  1K5G B;  5GOW B;  4DXA B;  3U8Z A;  2D4Q A;  4CYE A;  2COA A;  2D11 A;  4KHB B;  2R2Y A;  4WSF A;  2VSZ A;  1J19 A;  2I5F A;  2HE7 A;  1EVH A;  4L1R A;  1ZM0 A;  3BJI A;  5KQ4 A;  1MI1 A;  2K8E A;  3M1I B;  1V5M A;  3FEH A;  3MDB C;  1PMS A;  3TVV A;  2DFK A;  5D27 A;  2LUL A;  5FI1 A;  1FHO A;  3OHM B;  2Y8G A;  2ROV A;  1PLS A;  1NTV A;  2MKR A;  4A6F A;  1H4R A;  4A6F B;  1XCG A;  2Q13 A;  4Z2N A;  1X1G A;  1U5G A;  1MAI A;  2D2Q A;  3DXE A;  1K5D B;  2DLW A;  2N0Y A;  2R0D A;  4MK0 A;  1KZG A;  2CY5 A;  2GCJ A;  2KIG A;  3A98 B;  3KRW A;  2Y7B A;  4B6H A;  2COD A;  3ULB A;  1B55 A;  1WG7 A;  5FI0 A;  1MK7 B;  1WGU A;  4KHB A;  3AJ4 A;  4ZRK A;  1AQC A;  1W1G A;  2MWN B;  2RGN B;  4HB0 B;  2DHJ A;  2P0H A;  1FHX A;  1MIZ B;  4GXB A;  4HSI A;  2K49 A;  4NSW A;  4OT1 A;  2FJU B;  2GCL A;  4P7I A;  5C16 A;  1OY2 A;  1EF1 A;  3FM8 C;  2RLO A;  2KCJ A;  1X05 A;  2COF A;  2N23 A;  1X86 A;  1UPQ A;  4IOY X;  1RRP B;  2V76 A;  1DDM A;  1W1H A;  3SO6 A;  3VOQ A;  3A8Q A;  5DHF B;  3PVL A;  2YT2 A;  3ML4 A; 
#chains in the Genus database with same CATH homology
 2ZPY A;  4Z2M B;  3SNH A;  3D8E A;  4HAU B;  3WYF B;  1WI1 A;  2DN6 A;  2IFS A;  1M7E A;  3SUZ A;  1Q67 A;  3D8D A;  2K2U A;  4HDO A;  3PP2 A;  2RNR B;  1V89 A;  2ROZ B;  1IRS A;  4K2P A;  1BTK A;  1DBH A;  3LJU X;  4PNK A;  3FSS A;  1X11 A;  3ODW A;  5JLJ B;  4GMX B;  4HAW B;  3F5R A;  4KHO A;  2UZS A;  1UNR A;  4K2O A;  1ZVR A;  3KY9 A;  5KCV A;  3G9W A;  5HE3 A;  4ZRI A;  3P7Z A;  2GJY A;  4IAP A;  3MPX A;  1ISN A;  5D3Y A;  1GC6 A;  3DXC A;  1XOD A;  2D9Y A;  2KGX B;  3RCP A;  2DX1 A;  2BCJ A;  3KRX A;  1DRO A;  4F7U P;  2D10 A;  1XD4 A;  2DTC A;  4HAT B;  5D3X A;  2CAY A;  3AU5 A;  1V61 A;  5C5B B;  4HHV A;  3NSU A;  1Z87 A;  3PSC A;  3UZT A;  2YS3 A;  2DX5 A;  3OAN A;  3PEG A;  1E5W A;  3A8P A;  2DHK A;  3CIK A;  4HAY B;  4HAX B;  2LOX A;  5HE1 A;  2I1K A;  3TO1 A;  2QKM A;  1UNP A;  5HE0 A;  1XX0 A;  1NI2 A;  2Z0Q A;  3U7D A;  2QKL A;  4K81 A;  1N3H A;  2J59 M;  4A6H A;  1MPH A;  5L81 A;  2D9Z A;  4IFS A;  4XWX A;  1EAZ A;  5DH9 B;  3PZD A;  5J3T A;  2YT0 A;  2X18 A;  1U27 A;  1FHW A;  1OQN A;  5C79 A;  1I2H A;  2D9X A;  1SHC A;  5JP4 A;  3V5W A;  3SYX A;  2MDX A;  2DYQ A;  2FJL A;  5DI9 B;  4EKU A;  2J0M A;  1FGZ A;  2MFQ A;  4KAX B;  4BBK A;  3X23 A;  1U5D A;  2CRF A;  5DIF B;  2P8V A;  2OQB A;  1TXD A;  3DXD A;  4CHJ A;  3AU4 A;  4A5K A;  3T06 A;  3ZDT A;  3HW2 B;  2E2X A;  1V5P A;  3PG7 A;  1X1F A;  2DKQ A;  1UEF A;  2Z0P A;  4DX8 A;  2ADZ A;  3ZVR A;  2LKO A;  4GZU A;  2LG1 A;  4C0A A;  2YSZ A;  4GN1 A;  1BAK A;  1UPR A;  2G35 A;  2UZR A;  4ZRJ A;  4DBB A;  3BIN A;  3QIJ A;  3P6A A;  1V88 A;  1U2B A;  1PFJ A;  4YL8 A;  2DHI A;  2AL6 A;  2NMB A;  4GPT B;  3KZ1 A;  1LB1 A;  5D3W A;  2XQN M;  4MY6 A;  4YON A;  1ZC3 B;  1FGY A;  1SGH A;  1WVH A;  3TFM A;  3TW1 A;  3O96 A;  4TKN A;  5HE2 A;  3D8F A;  2W2X C;  1GC7 A;  1P6S A;  1DDW A;  4HB4 B;  4HB2 B;  1DDV A;  3GYO A;  4H8S A;  1U29 A;  1WJM A;  1XR0 B;  2M14 A;  1ZSQ A;  4HB3 B;  1KI1 B;  2P0F A;  4MT7 A;  1BWN A;  4A6K A;  1GG3 A;  1MIX A;  2I1J A;  3IVF A;  2ELA A;  2K00 A;  4KVG B;  4NY0 A;  1Y5O A;  5D3V A;  2M38 A;  3PVW A;  1FOE A;  2H7E A;  2H7D A;  1DYN A;  1MK9 B;  2COC A;  5C5B A;  3VIA A;  1KZ7 A;  1U5E A;  2I5C A;  1NU2 A;  1J0W A;  1LW3 A;  3ULC A;  5KQ1 A;  3WA0 A;  2YRY A;  3QBV B;  1P5T A;  2CY4 A;  5JHG A;  2EJ8 A;  4CHM A;  1H10 A;  2YVC A;  1EGX A;  4EJN A;  4Y94 A;  4HAV B;  1FAO A;  4K17 A;  3ODX A;  2D9W A;  4PQ0 A;  1W1D A;  2P0D A;  1BTN A;  1M7R A;  4L6E A;  2IYB A;  2J0J A;  3HQC A;  1AWE A;  4F7H A;  2LYD A;  2RUK B;  4EMO A;  3CXB B;  2HTH B;  1WGQ A;  2DKP A;  3F0W A;  5J3Y A;  5CLQ B;  3TCA A;  2W2X D;  1TJ6 A;  1XKE A;  3PVU A;  2EMT A;  4WJ7 A;  4TYZ A;  3QWM A;  5J3Q A;  2J0K A;  2RSG A;  5EFX A;  2VKI A;  2D9V A;  2L2I A;  1NTY A;  2YS5 A;  2W2W A;  1I7A A;  3KSY A;  4KHA A;  2PZ1 A;  5DHA B;  1OMW A;  2R09 A;  1Y19 B;  5C6R A;  2ELB A;  2RVB B;  3HK0 A;  1WJ1 A;  1V5U A;  5JHH A;  2LOZ A;  1UNQ A;  2GS0 A;  2YF0 A;  5CLL B;  4GMV A;  2L1C A;  5LON B;  3SV1 A;  2YS1 A;  1RJ2 A;  2Y8F A;  4DX9 0;  2DYN A;  2AEH A;  2NZ8 B;  2EC1 A;  1TQZ A;  3GYP A;  1MKE A;  4D0N B;  1QC6 A;  3ODO A;  4F7G A;  4HAZ B;  2YT1 A;  5LOP B;  2KUP A;  2DA0 A;  1QQG A;  4WVF B;  2JP2 A;  2OTX A;  3N7C A;  2K2J A;  1P3R A;  1ZC4 B;  2VRW B;  2Z0O A;  1FB8 A;  1U5F A;  2UVM A;  2EMS A;  4HDQ A;  1K5G B;  5GOW B;  4DXA B;  3U8Z A;  2D4Q A;  4CYE A;  2COA A;  2D11 A;  4KHB B;  4WSF A;  2VSZ A;  1J19 A;  2I5F A;  2HE7 A;  1EVH A;  1ZM0 A;  3BJI A;  5KQ4 A;  3M1I B;  1V5M A;  3FEH A;  3MDB C;  1PMS A;  3TVV A;  2DFK A;  5D27 A;  2LUL A;  5FI1 A;  1FHO A;  2Y8G A;  2ROV A;  1PLS A;  1NTV A;  2MKR A;  4A6F A;  1H4R A;  4A6F B;  1XCG A;  2Q13 A;  4Z2N A;  1X1G A;  1U5G A;  1MAI A;  2D2Q A;  3DXE A;  1K5D B;  2DLW A;  2N0Y A;  2R0D A;  4MK0 A;  1KZG A;  2CY5 A;  2GCJ A;  3A98 B;  3KRW A;  2Y7B A;  4B6H A;  2COD A;  3ULB A;  1B55 A;  1WG7 A;  5FI0 A;  1MK7 B;  1WGU A;  3AJ4 A;  4ZRK A;  1AQC A;  1W1G A;  2MWN B;  2RGN B;  4HB0 B;  2DHJ A;  2P0H A;  1FHX A;  1MIZ B;  4GXB A;  4NSW A;  2GCL A;  4P7I A;  5C16 A;  1OY2 A;  1EF1 A;  3FM8 C;  2RLO A;  2KCJ A;  1X05 A;  2COF A;  2N23 A;  1X86 A;  1UPQ A;  4IOY X;  1RRP B;  2V76 A;  1DDM A;  1W1H A;  3SO6 A;  3VOQ A;  3A8Q A;  5DHF B;  3PVL A;  3ML4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...