1AWEA

Human sos1 pleckstrin homology (ph) domain, nmr, 20 structures
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
130
structure length
130
Chain Sequence
MNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRLPGASNAEYRLKEKFFMRKVQINDKDDTNEYKHAFEIILKDENSVIFSAKSAEEKNNWMAALISLQYRSTLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of the pleckstrin homology domain of human SOS1. A possible structural role for the sequential association of diffuse B cell lymphoma and pleckstrin homology domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signal transduction
molecule keywords SOS1
total genus 17
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 1997-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1aweA00
4GMXB 4D0NB 1WI1A 1XX0A 4HAVB 5KCVA 2LG1A 2RSGA 1EGXA 2J0KA 1U29A 1IRSA 2LOXA 3DXEA 2COCA 3SV1A 4HAXB 5D27A 1LB1A 1B55A 1EVHA 5HE1A 4DBBA 4Z2NA 1Y19B 2AEHA 3PVUA 3WA0A 4B6HA 2DYNA 4WSFA 4HAWB 1PLSA 1LW3A 5LONB 2L1CA 1X1FA 3HK0A 1KI1B 1Q67A 2D2QA 1TXDA 1Z87A 5DIFB 1MPHA 5J3QA 1ZC3B 4CHJA 1ISNA 3ODXA 2E2XA 5J3TA 4A5KA 2W2XD 4Y94A 5KQ4A 1U5EA 2L2IA 4HATB 2M38A 2YVCA 1ZM0A 2H7EA 1GC7A 1M7RA 5GOWB 1TQZA 1QC6A 1U5FA 2QKMA 1RRPB 1W1DA 2Q13A 3SNHA 1I2HA 4A6FA 1MK9B 2D9YA 3PVLA 4HDQA 3G9WA 2Z0OA 2D4QA 4K17A 3ULCA 2YS1A 1XR0B 2DLWA 3F5RA 1M7EA 1E5WA 1BTNA 2DHKA 2COAA 1DDVA 2OTXA 2X18A 3ZDTA 2JP2A 3KRXA 2Y8GA 3D8DA 4DXAB 2D10A 3CXBB 3UZTA 3TFMA 2LULA 2DHIA 3RCPA 3MPXA 3GYOA 4NSWA 4F7GA 4K81A 1AQCA 2RNRB 2DTCA 2I1KA 5D3VA 2DN6A 3ODOA 5CLQB 1BWNA 4IFSA 4HHVA 1FGYA 2MDXA 2NMBA 2R0DA 2KUPA 2EMSA 3PG7A 5CLLB 5HE3A 1X11A 5D3XA 1WGQA 3P7ZA 3HW2B 2DFKA 2P0HA 1WJMA 3P6AA 3PVWA 1UNRA 1U27A 2NZ8B 4PNKA 1XCGA 3V5WA 1WVHA 3KY9A 2J0JA 1K5GB 1P5TA 1UNPA 2ELAA 1MK7B 1UPRA 2YT1A 2D9ZA 1NTYA 3VOQA 4ZRJA 1PMSA 5HE0A 3TVVA 4EJNA 2W2XC 1U5GA 5KQ1A 3KSYA 2D11A 4CHMA 3PZDA 3LJUX 2CRFA 2DA0A 2ADZA 4NY0A 1GC6A 3NSUA 1BTKA 3DXDA 1V61A 1WGUA 2P0DA 3QWMA 4K2PA 3ULBA 2K2JA 4P7IA 2LOZA 2DKPA 3AU5A 2VKIA 4KHAA 3MDBC 3WYFB 3IVFA 2LKOA 2Z0QA 4DX8A 5HE2A 2YT0A 1WJ1A 1PFJA 1W1HA 1UEFA 1X86A 4TKNA 4IOYX 1Y5OA 3DXCA 4GMVA 2DX1A 2D9XA 1J0WA 4HAUB 2ZPYA 2P0FA 1GG3A 2YRYA 4KVGB 5JP4A 4K2OA 2GJYA 1N3HA 3PSCA 5DHFB 3X23A 2PZ1A 1J19A 2YSZA 1FHWA 1MKEA 4F7UP 1I7AA 3N7CA 5C5BB 1TJ6A 5EFXA 2K2UA 3FSSA 4A6HA 4MK0A 4HDOA 4IAPA 1SGHA 4YONA 1RJ2A 2CAYA 1U2BA 1W1GA 1DDWA 3QIJA 3AU4A 1NU2A 1EAZA 1X1GA 3ML4A 5FI0A 2R09A 2IYBA 5LOPB 3ODWA 4HB4B 4MY6A 1U5DA 4HB3B 1UNQA 4HAZB 2EC1A 2Y7BA 4KAXB 1H4RA 1K5DB 2COFA 3AJ4A 1KZ7A 5C5BA 1DYNA 2D9WA 1ZC4B 2KCJA 2VSZA 4ZRKA 4L6EA 5C16A 4ZRIA 3T06A 1NTVA 5JHHA 3PP2A 1NI2A 2HTHB 1OY2A 1UPQA 2ROVA 3PEGA 3OANA 2RGNB 4DX90 3BJIA 1P6SA 4A6FB 2CY4A 2DHJA 4WVFB 2CY5A 2D9VA 2BCJA 3TCAA 2P8VA 2V76A 4HB0B 2HE7A 2XQNM 3A8QA 1V89A 3U7DA 1DROA 2MKRA 2Y8FA 4HAYB 4KHBB 2M14A 1QQGA 3KZ1A 2EMTA 3VIAA 2QKLA 3FEHA 4Z2MB 1KZGA 2I5FA 1XKEA 2MFQA 1ZVRA 3CIKA 2YS5A 2CODA 2LYDA 4F7HA 2IFSA 3D8EA 1FHOA 2G35A 1V5UA 3HQCA 4GN1A 1X05A 3FM8C 4XWXA 4A6KA 2VRWB 2N0YA 2GS0A 4GPTB 5J3YA 3A8PA 2RVBB 5C6RA 2DKQA 2UZSA 2N23A 1ZSQA 1V5PA 2OQBA 4PQ0A 2KGXB 1FOEA 3M1IB 3ZVRA 3SO6A 2W2WA 1MAIA 2ELBA 1DDMA 2UVMA 2ROZB 1AWEA 5DH9B 3D8FA 1FB8A 5DHAB 1H10A 2I1JA 3A98B 2YS3A 4C0AA 3U8ZA 4EMOA 5C79A 1SHCA 3KRWA 4GZUA 5L81A 2AL6A 3F0WA 3QBVB 2K00A 2RUKB 1DBHA 4HB2B 2H7DA 2YF0A 4YL8A 3GYPA 4GXBA 5FI1A 3SUZA 5JLJB 1BAKA 5JHGA 1V5MA 4WJ7A 5D3YA 1OMWA 4H8SA 1EF1A 4MT7A 2DX5A 3TW1A 2J0MA 1MIZB 2EJ8A 4BBKA 2GCJA 1FGZA 1V88A 4TYZA 2RLOA 1P3RA 4CYEA 2Z0PA 3TO1A 2J59M 1OQNA 2GCLA 1FAOA 2MWNB 1MIXA 2FJLA 2UZRA 1FHXA 2I5CA 1WG7A 1XD4A 3O96A 2DYQA 4EKUA 1XODA 4KHOA 5D3WA 5DI9B 3SYXA 3BINA
chains in the Genus database with same CATH superfamily
4GMXB 4D0NB 1WI1A 1XX0A 4HAVB 5KCVA 2LG1A 2RSGA 1EGXA 2J0KA 1U29A 1IRSA 2LOXA 3DXEA 2COCA 3SV1A 4HAXB 4GNKB 4QJ5B 5D27A 1LB1A 1B55A 2RRFA 1EVHA 2R2YA 5HE1A 4DBBA 1Y19B 2AEHA 4Z2NA 3PVUA 3WA0A 4B6HA 2DYNA 4L1RA 4WSFA 4HAWB 1PLSA 1LW3A 5LONB 2L1CA 1X1FA 3HK0A 1KI1B 1Q67A 2D2QA 1TXDA 1Z87A 5DIFB 1MPHA 5J3QA 1ZC3B 4CHJA 1ISNA 3NW8A 3ODXA 2E2XA 5J3TA 4A5KA 2W2XD 4Y94A 5KQ4A 1U5EA 2L2IA 2GUMA 4HATB 2M38A 2YVCA 1ZM0A 2H7EA 1GC7A 1M7RA 5GOWB 1TQZA 1T77A 1QC6A 1U5FA 2QKMA 1RRPB 1W1DA 2Q13A 3SNHA 1I2HA 4A6FA 1MK9B 2D9YA 3PVLA 4HDQA 3G9WA 2Z0OA 2D4QA 4K17A 3ULCA 4QJ4B 2YS1A 1XR0B 2DLWA 2KIEA 1M7EA 1E5WA 3F5RA 1BTNA 5IRSA 2DHKA 2COAA 1DDVA 2OTXA 2X18A 3ZDTA 2JP2A 3KRXA 2Y8GA 3D8DA 4DXAB 2D10A 3CXBB 3UZTA 3TFMA 2LULA 2DHIA 3RCPA 3MPXA 3GYOA 4NSWA 4F7GA 4K81A 1AQCA 2RNRB 2DTCA 2I1KA 5D3VA 2DN6A 3ODOA 5CLQB 1BWNA 4IFSA 4HHVA 1FGYA 2MDXA 2NMBA 2R0DA 2KUPA 2EMSA 2K8EA 3PG7A 5CLLB 4QJ3B 5HE3A 1X11A 5D3XA 1WGQA 3P7ZA 3HW2B 2DFKA 2P0HA 1WJMA 3P6AA 3PVWA 1UNRA 1U27A 2NZ8B 3HSAA 4PNKA 1XCGA 3V5WA 1WVHA 3KY9A 2J0JA 1K5GB 1P5TA 1UNPA 2ELAA 1MK7B 1UPRA 2YT1A 2D9ZA 1NTYA 3VOQA 4ZRJA 1PMSA 5HE0A 3TVVA 4EJNA 2W2XC 1U5GA 2K49A 5KQ1A 3KSYA 2D11A 3DCXA 4CHMA 4OT1A 3PZDA 3LJUX 2CRFA 2DA0A 2ADZA 4NY0A 1GC6A 3NSUA 1BTKA 3DXDA 1V61A 1WGUA 2P0DA 3A58A 3QWMA 4K2PA 3ULBA 2K2JA 5M4YB 4P7IA 2LOZA 2DKPA 3AU5A 2VKIA 4KHAA 3MDBC 3WYFB 4KHBA 5LG4B 3IVFA 2LKOA 2Z0QA 4DX8A 5HE2A 2YT0A 1WJ1A 1PFJA 1W1HA 1UEFA 1X86A 4TKNA 4IOYX 2Z14A 1Y5OA 3DXCA 4GMVA 2DX1A 2D9XA 1J0WA 3OHMB 4HAUB 2ZPYA 2P0FA 1GG3A 2YRYA 4KVGB 5JP4A 2KUQA 5I2MA 4K2OA 2GJYA 1N3HA 3PSCA 5DHFB 3X23A 2PZ1A 1J19A 2YSZA 1FHWA 1MKEA 4F7UP 1I7AA 4HSIA 3N7CA 5C5BB 1TJ6A 5EFXA 2K2UA 3FSSA 4A6HA 4MK0A 4HDOA 4IAPA 3NWFA 1SGHA 4YONA 1RJ2A 2CAYA 1U2BA 1W1GA 1DDWA 3QIJA 3AU4A 1NU2A 1EAZA 1X1GA 3ML4A 5FI0A 2R09A 2IYBA 2KR0A 5LOPB 3ODWA 3NWDA 4HB4B 4MY6A 3HIEA 1U5DA 4HB3B 2NBVA 1UNQA 4HAZB 2EC1A 2Y7BA 4KAXB 1H4RA 1K5DB 2COFA 3AJ4A 1KZ7A 5C5BA 1DYNA 2D9WA 1ZC4B 2KCJA 2VSZA 4ZRKA 4L6EA 5C16A 4ZRIA 3NWAA 3T06A 1NTVA 2KIGA 5JHHA 3PP2A 1NI2A 2HTHB 1OY2A 1UPQA 2ROVA 3PEGA 3OANA 2RGNB 4DX90 3BJIA 1P6SA 4A6FB 2CY4A 2DHJA 4WVFB 2CY5A 2D9VA 2BCJA 4OSNA 3TCAA 4D6WA 2P8VA 2V76A 4HB0B 2HE7A 2XQNM 3A8QA 1V89A 3U7DA 1DROA 2MKRA 2Y8FA 2ZKMX 4HAYB 2YT2A 4KHBB 2M14A 4CSQA 1QQGA 3KZ1A 2EMTA 3VIAA 2QKLA 3FEHA 4Z2MB 1KZGA 2I5FA 2FJUB 1XKEA 2MFQA 1ZVRA 3CIKA 2YS5A 2CODA 2LYDA 4F7HA 2IFSA 3D8EA 1FHOA 2G35A 1V5UA 3HQCA 4GN1A 1X05A 3FM8C 4XWXA 4A6KA 3U12A 2VRWB 2N0YA 2GS0A 4GPTB 5J3YA 3A8PA 2RVBB 5C6RA 2DKQA 2UZSA 2N23A 1ZSQA 1V5PA 2OQBA 1MI1A 4PQ0A 2KGXB 1FOEA 3M1IB 3ZVRA 3SO6A 2W2WA 1MAIA 2ELBA 1DDMA 2UVMA 2ROZB 1AWEA 5DH9B 2Z59A 3D8FA 1FB8A 1ZYIA 5DHAB 4DIXA 1H10A 2I1JA 3A98B 2YS3A 4C0AA 3U8ZA 4EMOA 5C79A 1SHCA 3KRWA 4GZUA 5L81A 2AL6A 3F0WA 3QBVB 4GOUA 2Z4DA 2K00A 2RUKB 1DBHA 4HB2B 2H7DA 2YF0A 4YL8A 3B77A 3GYPA 4GXBA 4QXAB 5FI1A 3SUZA 5JLJB 1BAKA 5JHGA 1V5MA 4WJ7A 5D3YA 1OMWA 4H8SA 1EF1A 4MT7A 2DX5A 3TW1A 2J0MA 2Z13A 1MIZB 2EJ8A 4BBKA 2GCJA 1FGZA 1V88A 4TYZA 2RLOA 1P3RA 3FVCA 4CYEA 2Z0PA 3TO1A 2J59M 1OQNA 2GCLA 1FAOA 2MWNB 1MIXA 2FJLA 2UZRA 1FHXA 2I5CA 1WG7A 1XD4A 3O96A 2DYQA 4EKUA 1XODA 5I2SA 4KHOA 5D3WA 5DI9B 3SYXA 3BINA
chains in the Genus database with same CATH topology
4GMXB 4D0NB 1WI1A 1XX0A 4HAVB 5KCVA 2LG1A 2RSGA 1EGXA 2J0KA 1U29A 1IRSA 2LOXA 3DXEA 2COCA 3SV1A 4HAXB 5D27A 1LB1A 1B55A 1EVHA 5HE1A 4DBBA 4Z2NA 1Y19B 2AEHA 3PVUA 3WA0A 4B6HA 2DYNA 4WSFA 4HAWB 1PLSA 1LW3A 5LONB 2L1CA 1X1FA 3HK0A 1KI1B 1Q67A 2D2QA 1TXDA 1Z87A 5DIFB 1MPHA 5J3QA 1ZC3B 4CHJA 1ISNA 3ODXA 2E2XA 5J3TA 4A5KA 2W2XD 4Y94A 5KQ4A 1U5EA 2L2IA 4HATB 2M38A 2YVCA 1ZM0A 2H7EA 1GC7A 1M7RA 5GOWB 1TQZA 1QC6A 1U5FA 2QKMA 1RRPB 1W1DA 2Q13A 3SNHA 1I2HA 4A6FA 1MK9B 2D9YA 3PVLA 4HDQA 3G9WA 2Z0OA 2D4QA 4K17A 3ULCA 2YS1A 1XR0B 2DLWA 3F5RA 1M7EA 1E5WA 1BTNA 2DHKA 2COAA 1DDVA 2OTXA 2X18A 3ZDTA 2JP2A 3KRXA 2Y8GA 3D8DA 4DXAB 2D10A 3CXBB 3UZTA 3TFMA 2LULA 2DHIA 3RCPA 3MPXA 3GYOA 4NSWA 4F7GA 4K81A 1AQCA 2RNRB 2DTCA 2I1KA 5D3VA 2DN6A 3ODOA 5CLQB 1BWNA 4IFSA 4HHVA 1FGYA 2MDXA 2NMBA 2R0DA 2KUPA 2EMSA 3PG7A 5CLLB 5HE3A 1X11A 5D3XA 1WGQA 3P7ZA 3HW2B 2DFKA 2P0HA 1WJMA 3P6AA 3PVWA 1UNRA 1U27A 2NZ8B 4PNKA 1XCGA 3V5WA 1WVHA 3KY9A 2J0JA 1K5GB 1P5TA 1UNPA 2ELAA 1MK7B 1UPRA 2YT1A 2D9ZA 1NTYA 3VOQA 4ZRJA 1PMSA 5HE0A 3TVVA 4EJNA 2W2XC 1U5GA 5KQ1A 3KSYA 2D11A 4CHMA 3PZDA 3LJUX 2CRFA 2DA0A 2ADZA 4NY0A 1GC6A 3NSUA 1BTKA 3DXDA 1V61A 1WGUA 2P0DA 3QWMA 4K2PA 3ULBA 2K2JA 4P7IA 2LOZA 2DKPA 3AU5A 2VKIA 4KHAA 3MDBC 3WYFB 3IVFA 2LKOA 2Z0QA 4DX8A 5HE2A 2YT0A 1WJ1A 1PFJA 1W1HA 1UEFA 1X86A 4TKNA 4IOYX 1Y5OA 3DXCA 4GMVA 2DX1A 2D9XA 1J0WA 4HAUB 2ZPYA 2P0FA 1GG3A 2YRYA 4KVGB 5JP4A 4K2OA 2GJYA 1N3HA 3PSCA 5DHFB 3X23A 2PZ1A 1J19A 2YSZA 1FHWA 1MKEA 4F7UP 1I7AA 3N7CA 5C5BB 1TJ6A 5EFXA 2K2UA 3FSSA 4A6HA 4MK0A 4HDOA 4IAPA 1SGHA 4YONA 1RJ2A 2CAYA 1U2BA 1W1GA 1DDWA 3QIJA 3AU4A 1NU2A 1EAZA 1X1GA 3ML4A 5FI0A 2R09A 2IYBA 5LOPB 3ODWA 4HB4B 4MY6A 1U5DA 4HB3B 1UNQA 4HAZB 2EC1A 2Y7BA 4KAXB 1H4RA 1K5DB 2COFA 3AJ4A 1KZ7A 5C5BA 1DYNA 2D9WA 1ZC4B 2KCJA 2VSZA 4ZRKA 4L6EA 5C16A 4ZRIA 3T06A 1NTVA 5JHHA 3PP2A 1NI2A 2HTHB 1OY2A 1UPQA 2ROVA 3PEGA 3OANA 2RGNB 4DX90 3BJIA 1P6SA 4A6FB 2CY4A 2DHJA 4WVFB 2CY5A 2D9VA 2BCJA 3TCAA 2P8VA 2V76A 4HB0B 2HE7A 2XQNM 3A8QA 1V89A 3U7DA 1DROA 2MKRA 2Y8FA 4HAYB 4KHBB 2M14A 1QQGA 3KZ1A 2EMTA 3VIAA 2QKLA 3FEHA 4Z2MB 1KZGA 2I5FA 1XKEA 2MFQA 1ZVRA 3CIKA 2YS5A 2CODA 2LYDA 4F7HA 2IFSA 3D8EA 1FHOA 2G35A 1V5UA 3HQCA 4GN1A 1X05A 3FM8C 4XWXA 4A6KA 2VRWB 2N0YA 2GS0A 4GPTB 5J3YA 3A8PA 2RVBB 5C6RA 2DKQA 2UZSA 2N23A 1ZSQA 1V5PA 2OQBA 4PQ0A 2KGXB 1FOEA 3M1IB 3ZVRA 3SO6A 2W2WA 1MAIA 2ELBA 1DDMA 2UVMA 2ROZB 1AWEA 5DH9B 3D8FA 1FB8A 5DHAB 1H10A 2I1JA 3A98B 2YS3A 4C0AA 3U8ZA 4EMOA 5C79A 1SHCA 3KRWA 4GZUA 5L81A 2AL6A 3F0WA 3QBVB 2K00A 2RUKB 1DBHA 4HB2B 2H7DA 2YF0A 4YL8A 3GYPA 4GXBA 5FI1A 3SUZA 5JLJB 1BAKA 5JHGA 1V5MA 4WJ7A 5D3YA 1OMWA 4H8SA 1EF1A 4MT7A 2DX5A 3TW1A 2J0MA 1MIZB 2EJ8A 4BBKA 2GCJA 1FGZA 1V88A 4TYZA 2RLOA 1P3RA 4CYEA 2Z0PA 3TO1A 2J59M 1OQNA 2GCLA 1FAOA 2MWNB 1MIXA 2FJLA 2UZRA 1FHXA 2I5CA 1WG7A 1XD4A 3O96A 2DYQA 4EKUA 1XODA 4KHOA 5D3WA 5DI9B 3SYXA 3BINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GMX B;  4D0N B;  1WI1 A;  1XX0 A;  4HAV B;  5KCV A;  2LG1 A;  2RSG A;  1EGX A;  2J0K A;  1U29 A;  1IRS A;  2LOX A;  3DXE A;  2COC A;  3SV1 A;  4HAX B;  5D27 A;  1LB1 A;  1B55 A;  1EVH A;  5HE1 A;  4DBB A;  4Z2N A;  1Y19 B;  2AEH A;  3PVU A;  3WA0 A;  4B6H A;  2DYN A;  4WSF A;  4HAW B;  1PLS A;  1LW3 A;  5LON B;  2L1C A;  1X1F A;  3HK0 A;  1KI1 B;  1Q67 A;  2D2Q A;  1TXD A;  1Z87 A;  5DIF B;  1MPH A;  5J3Q A;  1ZC3 B;  4CHJ A;  1ISN A;  3ODX A;  2E2X A;  5J3T A;  4A5K A;  2W2X D;  4Y94 A;  5KQ4 A;  1U5E A;  2L2I A;  4HAT B;  2M38 A;  2YVC A;  1ZM0 A;  2H7E A;  1GC7 A;  1M7R A;  5GOW B;  1TQZ A;  1QC6 A;  1U5F A;  2QKM A;  1RRP B;  1W1D A;  2Q13 A;  3SNH A;  1I2H A;  4A6F A;  1MK9 B;  2D9Y A;  3PVL A;  4HDQ A;  3G9W A;  2Z0O A;  2D4Q A;  4K17 A;  3ULC A;  2YS1 A;  1XR0 B;  2DLW A;  3F5R A;  1M7E A;  1E5W A;  1BTN A;  2DHK A;  2COA A;  1DDV A;  2OTX A;  2X18 A;  3ZDT A;  2JP2 A;  3KRX A;  2Y8G A;  3D8D A;  4DXA B;  2D10 A;  3CXB B;  3UZT A;  3TFM A;  2LUL A;  2DHI A;  3RCP A;  3MPX A;  3GYO A;  4NSW A;  4F7G A;  4K81 A;  1AQC A;  2RNR B;  2DTC A;  2I1K A;  5D3V A;  2DN6 A;  3ODO A;  5CLQ B;  1BWN A;  4IFS A;  4HHV A;  1FGY A;  2MDX A;  2NMB A;  2R0D A;  2KUP A;  2EMS A;  3PG7 A;  5CLL B;  5HE3 A;  1X11 A;  5D3X A;  1WGQ A;  3P7Z A;  3HW2 B;  2DFK A;  2P0H A;  1WJM A;  3P6A A;  3PVW A;  1UNR A;  1U27 A;  2NZ8 B;  4PNK A;  1XCG A;  3V5W A;  1WVH A;  3KY9 A;  2J0J A;  1K5G B;  1P5T A;  1UNP A;  2ELA A;  1MK7 B;  1UPR A;  2YT1 A;  2D9Z A;  1NTY A;  3VOQ A;  4ZRJ A;  1PMS A;  5HE0 A;  3TVV A;  4EJN A;  2W2X C;  1U5G A;  5KQ1 A;  3KSY A;  2D11 A;  4CHM A;  3PZD A;  3LJU X;  2CRF A;  2DA0 A;  2ADZ A;  4NY0 A;  1GC6 A;  3NSU A;  1BTK A;  3DXD A;  1V61 A;  1WGU A;  2P0D A;  3QWM A;  4K2P A;  3ULB A;  2K2J A;  4P7I A;  2LOZ A;  2DKP A;  3AU5 A;  2VKI A;  4KHA A;  3MDB C;  3WYF B;  3IVF A;  2LKO A;  2Z0Q A;  4DX8 A;  5HE2 A;  2YT0 A;  1WJ1 A;  1PFJ A;  1W1H A;  1UEF A;  1X86 A;  4TKN A;  4IOY X;  1Y5O A;  3DXC A;  4GMV A;  2DX1 A;  2D9X A;  1J0W A;  4HAU B;  2ZPY A;  2P0F A;  1GG3 A;  2YRY A;  4KVG B;  5JP4 A;  4K2O A;  2GJY A;  1N3H A;  3PSC A;  5DHF B;  3X23 A;  2PZ1 A;  1J19 A;  2YSZ A;  1FHW A;  1MKE A;  4F7U P;  1I7A A;  3N7C A;  5C5B B;  1TJ6 A;  5EFX A;  2K2U A;  3FSS A;  4A6H A;  4MK0 A;  4HDO A;  4IAP A;  1SGH A;  4YON A;  1RJ2 A;  2CAY A;  1U2B A;  1W1G A;  1DDW A;  3QIJ A;  3AU4 A;  1NU2 A;  1EAZ A;  1X1G A;  3ML4 A;  5FI0 A;  2R09 A;  2IYB A;  5LOP B;  3ODW A;  4HB4 B;  4MY6 A;  1U5D A;  4HB3 B;  1UNQ A;  4HAZ B;  2EC1 A;  2Y7B A;  4KAX B;  1H4R A;  1K5D B;  2COF A;  3AJ4 A;  1KZ7 A;  5C5B A;  1DYN A;  2D9W A;  1ZC4 B;  2KCJ A;  2VSZ A;  4ZRK A;  4L6E A;  5C16 A;  4ZRI A;  3T06 A;  1NTV A;  5JHH A;  3PP2 A;  1NI2 A;  2HTH B;  1OY2 A;  1UPQ A;  2ROV A;  3PEG A;  3OAN A;  2RGN B;  4DX9 0;  3BJI A;  1P6S A;  4A6F B;  2CY4 A;  2DHJ A;  4WVF B;  2CY5 A;  2D9V A;  2BCJ A;  3TCA A;  2P8V A;  2V76 A;  4HB0 B;  2HE7 A;  2XQN M;  3A8Q A;  1V89 A;  3U7D A;  1DRO A;  2MKR A;  2Y8F A;  4HAY B;  4KHB B;  2M14 A;  1QQG A;  3KZ1 A;  2EMT A;  3VIA A;  2QKL A;  3FEH A;  4Z2M B;  1KZG A;  2I5F A;  1XKE A;  2MFQ A;  1ZVR A;  3CIK A;  2YS5 A;  2COD A;  2LYD A;  4F7H A;  2IFS A;  3D8E A;  1FHO A;  2G35 A;  1V5U A;  3HQC A;  4GN1 A;  1X05 A;  3FM8 C;  4XWX A;  4A6K A;  2VRW B;  2N0Y A;  2GS0 A;  4GPT B;  5J3Y A;  3A8P A;  2RVB B;  5C6R A;  2DKQ A;  2UZS A;  2N23 A;  1ZSQ A;  1V5P A;  2OQB A;  4PQ0 A;  2KGX B;  1FOE A;  3M1I B;  3ZVR A;  3SO6 A;  2W2W A;  1MAI A;  2ELB A;  1DDM A;  2UVM A;  2ROZ B;  1AWE A;  5DH9 B;  3D8F A;  1FB8 A;  5DHA B;  1H10 A;  2I1J A;  3A98 B;  2YS3 A;  4C0A A;  3U8Z A;  4EMO A;  5C79 A;  1SHC A;  3KRW A;  4GZU A;  5L81 A;  2AL6 A;  3F0W A;  3QBV B;  2K00 A;  2RUK B;  1DBH A;  4HB2 B;  2H7D A;  2YF0 A;  4YL8 A;  3GYP A;  4GXB A;  5FI1 A;  3SUZ A;  5JLJ B;  1BAK A;  5JHG A;  1V5M A;  4WJ7 A;  5D3Y A;  1OMW A;  4H8S A;  1EF1 A;  4MT7 A;  2DX5 A;  3TW1 A;  2J0M A;  1MIZ B;  2EJ8 A;  4BBK A;  2GCJ A;  1FGZ A;  1V88 A;  4TYZ A;  2RLO A;  1P3R A;  4CYE A;  2Z0P A;  3TO1 A;  2J59 M;  1OQN A;  2GCL A;  1FAO A;  2MWN B;  1MIX A;  2FJL A;  2UZR A;  1FHX A;  2I5C A;  1WG7 A;  1XD4 A;  3O96 A;  2DYQ A;  4EKU A;  1XOD A;  4KHO A;  5D3W A;  5DI9 B;  3SYX A;  3BIN A; 
#chains in the Genus database with same CATH topology
 4GMX B;  4D0N B;  1WI1 A;  1XX0 A;  4HAV B;  5KCV A;  2LG1 A;  2RSG A;  1EGX A;  2J0K A;  1U29 A;  1IRS A;  2LOX A;  3DXE A;  2COC A;  3SV1 A;  4HAX B;  4GNK B;  4QJ5 B;  5D27 A;  1LB1 A;  1B55 A;  2RRF A;  1EVH A;  2R2Y A;  5HE1 A;  4DBB A;  1Y19 B;  2AEH A;  4Z2N A;  3PVU A;  3WA0 A;  4B6H A;  2DYN A;  4L1R A;  4WSF A;  4HAW B;  1PLS A;  1LW3 A;  5LON B;  2L1C A;  1X1F A;  3HK0 A;  1KI1 B;  1Q67 A;  2D2Q A;  1TXD A;  1Z87 A;  5DIF B;  1MPH A;  5J3Q A;  1ZC3 B;  4CHJ A;  1ISN A;  3NW8 A;  3ODX A;  2E2X A;  5J3T A;  4A5K A;  2W2X D;  4Y94 A;  5KQ4 A;  1U5E A;  2L2I A;  2GUM A;  4HAT B;  2M38 A;  2YVC A;  1ZM0 A;  2H7E A;  1GC7 A;  1M7R A;  5GOW B;  1TQZ A;  1T77 A;  1QC6 A;  1U5F A;  2QKM A;  1RRP B;  1W1D A;  2Q13 A;  3SNH A;  1I2H A;  4A6F A;  1MK9 B;  2D9Y A;  3PVL A;  4HDQ A;  3G9W A;  2Z0O A;  2D4Q A;  4K17 A;  3ULC A;  4QJ4 B;  2YS1 A;  1XR0 B;  2DLW A;  2KIE A;  1M7E A;  1E5W A;  3F5R A;  1BTN A;  5IRS A;  2DHK A;  2COA A;  1DDV A;  2OTX A;  2X18 A;  3ZDT A;  2JP2 A;  3KRX A;  2Y8G A;  3D8D A;  4DXA B;  2D10 A;  3CXB B;  3UZT A;  3TFM A;  2LUL A;  2DHI A;  3RCP A;  3MPX A;  3GYO A;  4NSW A;  4F7G A;  4K81 A;  1AQC A;  2RNR B;  2DTC A;  2I1K A;  5D3V A;  2DN6 A;  3ODO A;  5CLQ B;  1BWN A;  4IFS A;  4HHV A;  1FGY A;  2MDX A;  2NMB A;  2R0D A;  2KUP A;  2EMS A;  2K8E A;  3PG7 A;  5CLL B;  4QJ3 B;  5HE3 A;  1X11 A;  5D3X A;  1WGQ A;  3P7Z A;  3HW2 B;  2DFK A;  2P0H A;  1WJM A;  3P6A A;  3PVW A;  1UNR A;  1U27 A;  2NZ8 B;  3HSA A;  4PNK A;  1XCG A;  3V5W A;  1WVH A;  3KY9 A;  2J0J A;  1K5G B;  1P5T A;  1UNP A;  2ELA A;  1MK7 B;  1UPR A;  2YT1 A;  2D9Z A;  1NTY A;  3VOQ A;  4ZRJ A;  1PMS A;  5HE0 A;  3TVV A;  4EJN A;  2W2X C;  1U5G A;  2K49 A;  5KQ1 A;  3KSY A;  2D11 A;  3DCX A;  4CHM A;  4OT1 A;  3PZD A;  3LJU X;  2CRF A;  2DA0 A;  2ADZ A;  4NY0 A;  1GC6 A;  3NSU A;  1BTK A;  3DXD A;  1V61 A;  1WGU A;  2P0D A;  3A58 A;  3QWM A;  4K2P A;  3ULB A;  2K2J A;  5M4Y B;  4P7I A;  2LOZ A;  2DKP A;  3AU5 A;  2VKI A;  4KHA A;  3MDB C;  3WYF B;  4KHB A;  5LG4 B;  3IVF A;  2LKO A;  2Z0Q A;  4DX8 A;  5HE2 A;  2YT0 A;  1WJ1 A;  1PFJ A;  1W1H A;  1UEF A;  1X86 A;  4TKN A;  4IOY X;  2Z14 A;  1Y5O A;  3DXC A;  4GMV A;  2DX1 A;  2D9X A;  1J0W A;  3OHM B;  4HAU B;  2ZPY A;  2P0F A;  1GG3 A;  2YRY A;  4KVG B;  5JP4 A;  2KUQ A;  5I2M A;  4K2O A;  2GJY A;  1N3H A;  3PSC A;  5DHF B;  3X23 A;  2PZ1 A;  1J19 A;  2YSZ A;  1FHW A;  1MKE A;  4F7U P;  1I7A A;  4HSI A;  3N7C A;  5C5B B;  1TJ6 A;  5EFX A;  2K2U A;  3FSS A;  4A6H A;  4MK0 A;  4HDO A;  4IAP A;  3NWF A;  1SGH A;  4YON A;  1RJ2 A;  2CAY A;  1U2B A;  1W1G A;  1DDW A;  3QIJ A;  3AU4 A;  1NU2 A;  1EAZ A;  1X1G A;  3ML4 A;  5FI0 A;  2R09 A;  2IYB A;  2KR0 A;  5LOP B;  3ODW A;  3NWD A;  4HB4 B;  4MY6 A;  3HIE A;  1U5D A;  4HB3 B;  2NBV A;  1UNQ A;  4HAZ B;  2EC1 A;  2Y7B A;  4KAX B;  1H4R A;  1K5D B;  2COF A;  3AJ4 A;  1KZ7 A;  5C5B A;  1DYN A;  2D9W A;  1ZC4 B;  2KCJ A;  2VSZ A;  4ZRK A;  4L6E A;  5C16 A;  4ZRI A;  3NWA A;  3T06 A;  1NTV A;  2KIG A;  5JHH A;  3PP2 A;  1NI2 A;  2HTH B;  1OY2 A;  1UPQ A;  2ROV A;  3PEG A;  3OAN A;  2RGN B;  4DX9 0;  3BJI A;  1P6S A;  4A6F B;  2CY4 A;  2DHJ A;  4WVF B;  2CY5 A;  2D9V A;  2BCJ A;  4OSN A;  3TCA A;  4D6W A;  2P8V A;  2V76 A;  4HB0 B;  2HE7 A;  2XQN M;  3A8Q A;  1V89 A;  3U7D A;  1DRO A;  2MKR A;  2Y8F A;  2ZKM X;  4HAY B;  2YT2 A;  4KHB B;  2M14 A;  4CSQ A;  1QQG A;  3KZ1 A;  2EMT A;  3VIA A;  2QKL A;  3FEH A;  4Z2M B;  1KZG A;  2I5F A;  2FJU B;  1XKE A;  2MFQ A;  1ZVR A;  3CIK A;  2YS5 A;  2COD A;  2LYD A;  4F7H A;  2IFS A;  3D8E A;  1FHO A;  2G35 A;  1V5U A;  3HQC A;  4GN1 A;  1X05 A;  3FM8 C;  4XWX A;  4A6K A;  3U12 A;  2VRW B;  2N0Y A;  2GS0 A;  4GPT B;  5J3Y A;  3A8P A;  2RVB B;  5C6R A;  2DKQ A;  2UZS A;  2N23 A;  1ZSQ A;  1V5P A;  2OQB A;  1MI1 A;  4PQ0 A;  2KGX B;  1FOE A;  3M1I B;  3ZVR A;  3SO6 A;  2W2W A;  1MAI A;  2ELB A;  1DDM A;  2UVM A;  2ROZ B;  1AWE A;  5DH9 B;  2Z59 A;  3D8F A;  1FB8 A;  1ZYI A;  5DHA B;  4DIX A;  1H10 A;  2I1J A;  3A98 B;  2YS3 A;  4C0A A;  3U8Z A;  4EMO A;  5C79 A;  1SHC A;  3KRW A;  4GZU A;  5L81 A;  2AL6 A;  3F0W A;  3QBV B;  4GOU A;  2Z4D A;  2K00 A;  2RUK B;  1DBH A;  4HB2 B;  2H7D A;  2YF0 A;  4YL8 A;  3B77 A;  3GYP A;  4GXB A;  4QXA B;  5FI1 A;  3SUZ A;  5JLJ B;  1BAK A;  5JHG A;  1V5M A;  4WJ7 A;  5D3Y A;  1OMW A;  4H8S A;  1EF1 A;  4MT7 A;  2DX5 A;  3TW1 A;  2J0M A;  2Z13 A;  1MIZ B;  2EJ8 A;  4BBK A;  2GCJ A;  1FGZ A;  1V88 A;  4TYZ A;  2RLO A;  1P3R A;  3FVC A;  4CYE A;  2Z0P A;  3TO1 A;  2J59 M;  1OQN A;  2GCL A;  1FAO A;  2MWN B;  1MIX A;  2FJL A;  2UZR A;  1FHX A;  2I5C A;  1WG7 A;  1XD4 A;  3O96 A;  2DYQ A;  4EKU A;  1XOD A;  5I2S A;  4KHO A;  5D3W A;  5DI9 B;  3SYX A;  3BIN A; 
#chains in the Genus database with same CATH homology
 4GMX B;  4D0N B;  1WI1 A;  1XX0 A;  4HAV B;  5KCV A;  2LG1 A;  2RSG A;  1EGX A;  2J0K A;  1U29 A;  1IRS A;  2LOX A;  3DXE A;  2COC A;  3SV1 A;  4HAX B;  5D27 A;  1LB1 A;  1B55 A;  1EVH A;  5HE1 A;  4DBB A;  4Z2N A;  1Y19 B;  2AEH A;  3PVU A;  3WA0 A;  4B6H A;  2DYN A;  4WSF A;  4HAW B;  1PLS A;  1LW3 A;  5LON B;  2L1C A;  1X1F A;  3HK0 A;  1KI1 B;  1Q67 A;  2D2Q A;  1TXD A;  1Z87 A;  5DIF B;  1MPH A;  5J3Q A;  1ZC3 B;  4CHJ A;  1ISN A;  3ODX A;  2E2X A;  5J3T A;  4A5K A;  2W2X D;  4Y94 A;  5KQ4 A;  1U5E A;  2L2I A;  4HAT B;  2M38 A;  2YVC A;  1ZM0 A;  2H7E A;  1GC7 A;  1M7R A;  5GOW B;  1TQZ A;  1QC6 A;  1U5F A;  2QKM A;  1RRP B;  1W1D A;  2Q13 A;  3SNH A;  1I2H A;  4A6F A;  1MK9 B;  2D9Y A;  3PVL A;  4HDQ A;  3G9W A;  2Z0O A;  2D4Q A;  4K17 A;  3ULC A;  2YS1 A;  1XR0 B;  2DLW A;  3F5R A;  1M7E A;  1E5W A;  1BTN A;  2DHK A;  2COA A;  1DDV A;  2OTX A;  2X18 A;  3ZDT A;  2JP2 A;  3KRX A;  2Y8G A;  3D8D A;  4DXA B;  2D10 A;  3CXB B;  3UZT A;  3TFM A;  2LUL A;  2DHI A;  3RCP A;  3MPX A;  3GYO A;  4NSW A;  4F7G A;  4K81 A;  1AQC A;  2RNR B;  2DTC A;  2I1K A;  5D3V A;  2DN6 A;  3ODO A;  5CLQ B;  1BWN A;  4IFS A;  4HHV A;  1FGY A;  2MDX A;  2NMB A;  2R0D A;  2KUP A;  2EMS A;  3PG7 A;  5CLL B;  5HE3 A;  1X11 A;  5D3X A;  1WGQ A;  3P7Z A;  3HW2 B;  2DFK A;  2P0H A;  1WJM A;  3P6A A;  3PVW A;  1UNR A;  1U27 A;  2NZ8 B;  4PNK A;  1XCG A;  3V5W A;  1WVH A;  3KY9 A;  2J0J A;  1K5G B;  1P5T A;  1UNP A;  2ELA A;  1MK7 B;  1UPR A;  2YT1 A;  2D9Z A;  1NTY A;  3VOQ A;  4ZRJ A;  1PMS A;  5HE0 A;  3TVV A;  4EJN A;  2W2X C;  1U5G A;  5KQ1 A;  3KSY A;  2D11 A;  4CHM A;  3PZD A;  3LJU X;  2CRF A;  2DA0 A;  2ADZ A;  4NY0 A;  1GC6 A;  3NSU A;  1BTK A;  3DXD A;  1V61 A;  1WGU A;  2P0D A;  3QWM A;  4K2P A;  3ULB A;  2K2J A;  4P7I A;  2LOZ A;  2DKP A;  3AU5 A;  2VKI A;  4KHA A;  3MDB C;  3WYF B;  3IVF A;  2LKO A;  2Z0Q A;  4DX8 A;  5HE2 A;  2YT0 A;  1WJ1 A;  1PFJ A;  1W1H A;  1UEF A;  1X86 A;  4TKN A;  4IOY X;  1Y5O A;  3DXC A;  4GMV A;  2DX1 A;  2D9X A;  1J0W A;  4HAU B;  2ZPY A;  2P0F A;  1GG3 A;  2YRY A;  4KVG B;  5JP4 A;  4K2O A;  2GJY A;  1N3H A;  3PSC A;  5DHF B;  3X23 A;  2PZ1 A;  1J19 A;  2YSZ A;  1FHW A;  1MKE A;  4F7U P;  1I7A A;  3N7C A;  5C5B B;  1TJ6 A;  5EFX A;  2K2U A;  3FSS A;  4A6H A;  4MK0 A;  4HDO A;  4IAP A;  1SGH A;  4YON A;  1RJ2 A;  2CAY A;  1U2B A;  1W1G A;  1DDW A;  3QIJ A;  3AU4 A;  1NU2 A;  1EAZ A;  1X1G A;  3ML4 A;  5FI0 A;  2R09 A;  2IYB A;  5LOP B;  3ODW A;  4HB4 B;  4MY6 A;  1U5D A;  4HB3 B;  1UNQ A;  4HAZ B;  2EC1 A;  2Y7B A;  4KAX B;  1H4R A;  1K5D B;  2COF A;  3AJ4 A;  1KZ7 A;  5C5B A;  1DYN A;  2D9W A;  1ZC4 B;  2KCJ A;  2VSZ A;  4ZRK A;  4L6E A;  5C16 A;  4ZRI A;  3T06 A;  1NTV A;  5JHH A;  3PP2 A;  1NI2 A;  2HTH B;  1OY2 A;  1UPQ A;  2ROV A;  3PEG A;  3OAN A;  2RGN B;  4DX9 0;  3BJI A;  1P6S A;  4A6F B;  2CY4 A;  2DHJ A;  4WVF B;  2CY5 A;  2D9V A;  2BCJ A;  3TCA A;  2P8V A;  2V76 A;  4HB0 B;  2HE7 A;  2XQN M;  3A8Q A;  1V89 A;  3U7D A;  1DRO A;  2MKR A;  2Y8F A;  4HAY B;  4KHB B;  2M14 A;  1QQG A;  3KZ1 A;  2EMT A;  3VIA A;  2QKL A;  3FEH A;  4Z2M B;  1KZG A;  2I5F A;  1XKE A;  2MFQ A;  1ZVR A;  3CIK A;  2YS5 A;  2COD A;  2LYD A;  4F7H A;  2IFS A;  3D8E A;  1FHO A;  2G35 A;  1V5U A;  3HQC A;  4GN1 A;  1X05 A;  3FM8 C;  4XWX A;  4A6K A;  2VRW B;  2N0Y A;  2GS0 A;  4GPT B;  5J3Y A;  3A8P A;  2RVB B;  5C6R A;  2DKQ A;  2UZS A;  2N23 A;  1ZSQ A;  1V5P A;  2OQB A;  4PQ0 A;  2KGX B;  1FOE A;  3M1I B;  3ZVR A;  3SO6 A;  2W2W A;  1MAI A;  2ELB A;  1DDM A;  2UVM A;  2ROZ B;  1AWE A;  5DH9 B;  3D8F A;  1FB8 A;  5DHA B;  1H10 A;  2I1J A;  3A98 B;  2YS3 A;  4C0A A;  3U8Z A;  4EMO A;  5C79 A;  1SHC A;  3KRW A;  4GZU A;  5L81 A;  2AL6 A;  3F0W A;  3QBV B;  2K00 A;  2RUK B;  1DBH A;  4HB2 B;  2H7D A;  2YF0 A;  4YL8 A;  3GYP A;  4GXB A;  5FI1 A;  3SUZ A;  5JLJ B;  1BAK A;  5JHG A;  1V5M A;  4WJ7 A;  5D3Y A;  1OMW A;  4H8S A;  1EF1 A;  4MT7 A;  2DX5 A;  3TW1 A;  2J0M A;  1MIZ B;  2EJ8 A;  4BBK A;  2GCJ A;  1FGZ A;  1V88 A;  4TYZ A;  2RLO A;  1P3R A;  4CYE A;  2Z0P A;  3TO1 A;  2J59 M;  1OQN A;  2GCL A;  1FAO A;  2MWN B;  1MIX A;  2FJL A;  2UZR A;  1FHX A;  2I5C A;  1WG7 A;  1XD4 A;  3O96 A;  2DYQ A;  4EKU A;  1XOD A;  4KHO A;  5D3W A;  5DI9 B;  3SYX A;  3BIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...