1AWEA

Human sos1 pleckstrin homology (ph) domain, nmr, 20 structures
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
130
structure length
130
Chain Sequence
MNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRLPGASNAEYRLKEKFFMRKVQINDKDDTNEYKHAFEIILKDENSVIFSAKSAEEKNNWMAALISLQYRSTLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signal transduction
molecule keywords SOS1
publication title The solution structure of the pleckstrin homology domain of human SOS1. A possible structural role for the sequential association of diffuse B cell lymphoma and pleckstrin homology domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 1997-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1aweA00
3HK0A 2BCJA 3X23A 1PFJA 1H4RA 2UZSA 5C5BB 2PZ1A 1IRSA 1MK7B 5EFXA 1QQGA 1DROA 4CHMA 3KZ1A 2YVCA 1QC6A 2QKLA 5D3VA 1X86A 3PG7A 2DX5A 3SNHA 1WGUA 4EMOA 4ZRJA 2IYBA 2DX1A 1P3RA 2W2XC 1E5WA 3PVUA 2YS1A 1XX0A 5C16A 2J0KA 1H10A 5C79A 1WI1A 4A6FB 3IVFA 4HAXB 2AEHA 1MIXA 1WG7A 4B6HA 2J59M 2H7EA 5JHGA 5KCVA 2RUKB 3KSYA 4HDOA 2DA0A 4IFSA 4L6EA 3SV1A 2D9YA 1WVHA 2QKMA 2LOXA 4MT7A 4DBBA 5HE3A 2E2XA 2Y8FA 2OTXA 1KZGA 2JP2A 1EF1A 4WSFA 2YF0A 1W1GA 4YL8A 5JP4A 1ZM0A 2IFSA 3M1IB 3FEHA 1RRPB 4HAWB 2VRWB 3ODWA 2KUPA 4KHOA 4C0AA 1U5EA 3U7DA 1GG3A 3ODXA 1XD4A 3A8PA 4ZRIA 1FB8A 2H7DA 2ROZB 4HAVB 1DDVA 1V5UA 1OQNA 2XQNM 3FM8C 2EC1A 3TFMA 2ADZA 4CHJA 3D8FA 4GXBA 3PSCA 2D10A 2D9WA 5DI9B 5DHAB 4PNKA 4MK0A 2GCLA 2R0DA 2MKRA 4NY0A 1J0WA 3PVLA 2I5CA 2LULA 2DYQA 1V5PA 2K00A 2DKPA 4YONA 3QWMA 2RNRB 5HE0A 4A6KA 3ULBA 4A6FA 1W1HA 5CLLB 2ROVA 5D3YA 3RCPA 4A5KA 1MIZB 1U5GA 1U5FA 2X18A 4KVGB 4HDQA 1ZSQA 1NTVA 3SUZA 5LONB 1MPHA 4WJ7A 3TVVA 1UPRA 1V5MA 3A98B 3N7CA 2GCJA 2Q13A 4GPTB 2ELBA 1TXDA 4BBKA 3GYOA 2Y8GA 2CAYA 2DYNA 1DBHA 4EKUA 1SGHA 4F7GA 1J19A 2K2UA 2FJLA 3G9WA 3TW1A 2D11A 3KY9A 2M14A 2CY5A 3BJIA 3F5RA 2RVBB 2J0MA 1GC7A 4CYEA 1BTKA 5J3QA 4HAYB 3SO6A 3DXEA 2AL6A 2COCA 4K17A 1BWNA 3CXBB 1DDWA 2NZ8B 1FGYA 1EAZA 5KQ1A 1U29A 3BINA 3D8EA 2G35A 3PEGA 2YRYA 2DFKA 5GOWB 3FSSA 1Z87A 3TO1A 2GS0A 4DXAB 3DXCA 3WA0A 2COFA 1FAOA 2CY4A 3MPXA 4K2PA 5C6RA 1UNRA 4K2OA 2UZRA 1U5DA 3AU4A 2LKOA 4ZRKA 1TQZA 1X1FA 1NI2A 1MKEA 1XODA 1FOEA 2I1KA 1DYNA 1GC6A 1X11A 2J0JA 1V89A 3ODOA 1X1GA 5C5BA 1M7EA 1FHOA 3WYFB 5JLJB 2W2WA 4F7UP 3KRWA 2DHIA 3KRXA 4K81A 1BAKA 1FGZA 1X05A 1ZC3B 4GMVA 3OANA 2I1JA 2D4QA 5CLQB 3D8DA 1ZC4B 4HB4B 3DXDA 4D0NB 1TJ6A 5D27A 2LYDA 3MDBC 2MDXA 1SHCA 3O96A 4PQ0A 4HHVA 2L1CA 1FHWA 2RGNB 1UPQA 2HTHB 4GMXB 1DDMA 2OQBA 2YT0A 2YS3A 4HAZB 1W1DA 1B55A 4DX90 4H8SA 2UVMA 1EVHA 1RJ2A 4HAUB 4EJNA 2MFQA 1PLSA 3PVWA 5DH9B 4HATB 1BTNA 2RLOA 3HQCA 4KHBB 3TCAA 3PP2A 4A6HA 2M38A 3CIKA 5KQ4A 2MWNB 1XCGA 2N23A 1ISNA 2YSZA 2R09A 2KGXB 1Y19B 1P6SA 3ZVRA 5HE2A 1U27A 5LOPB 2N0YA 2P0FA 1N3HA 3F0WA 4KAXB 5DHFB 2P8VA 1OY2A 1M7RA 2P0DA 1KZ7A 4XWXA 4TYZA 1NTYA 2CODA 4HB2B 2YS5A 3QIJA 2I5FA 1LW3A 3QBVB 1P5TA 5J3TA 1ZVRA 3A8QA 2DLWA 1U2BA 5J3YA 2VSZA 2GJYA 3GYPA 1UEFA 1V88A 2YT1A 4KHAA 5HE1A 1LB1A 2VKIA 5FI0A 4Z2MB 3VOQA 3U8ZA 2V76A 2ELAA 1WJ1A 2CRFA 2D9XA 1I7AA 2K2JA 3NSUA 3AU5A 1AWEA 4DX8A 3SYXA 3AJ4A 1K5GB 1K5DB 2Z0PA 5D3WA 1WJMA 2D2QA 2DKQA 4HB3B 2P0HA 3VIAA 5DIFB 1Q67A 2DN6A 2KCJA 1AQCA 3P7ZA 4NSWA 2EMSA 1XR0B 2Z0OA 2DTCA 1KI1B 2COAA 1WGQA 1XKEA 2NMBA 3T06A 4IAPA 1UNQA 3HW2B 2HE7A 2W2XD 1UNPA 3P6AA 1PMSA 4GN1A 4Z2NA 2ZPYA 3ML4A 5L81A 4IOYX 1Y5OA 2Y7BA 2D9ZA 2LOZA 1MAIA 4GZUA 2RSGA 2EJ8A 4F7HA 3PZDA 1MK9B 1I2HA 3ZDTA 2LG1A 2EMTA 5FI1A 4Y94A 3LJUX 2D9VA 1V61A 2Z0QA 4TKNA 2L2IA 1FHXA 5D3XA 3ULCA 1EGXA 3V5WA 4HB0B 4MY6A 5JHHA 2DHKA 4P7IA 1OMWA 4WVFB 3UZTA 2DHJA 1NU2A
chains in the Genus database with same CATH superfamily
3HK0A 2BCJA 3X23A 1PFJA 1H4RA 2UZSA 5C5BB 2PZ1A 1IRSA 1MK7B 5EFXA 3HSAA 1QQGA 1DROA 4CHMA 3KZ1A 2YVCA 1QC6A 2QKLA 5D3VA 1X86A 3PG7A 2DX5A 3SNHA 1WGUA 4EMOA 2YT2A 4ZRJA 2IYBA 2DX1A 1MI1A 1P3RA 2W2XC 1E5WA 3PVUA 2YS1A 1XX0A 5C16A 2J0KA 1H10A 5C79A 1WI1A 5IRSA 3FVCA 4A6FB 3IVFA 4HAXB 2AEHA 1MIXA 1WG7A 4B6HA 2J59M 2H7EA 5JHGA 2RRFA 5KCVA 2RUKB 3KSYA 4HDOA 2DA0A 4IFSA 4L6EA 3SV1A 2D9YA 2R2YA 1WVHA 2QKMA 2LOXA 4MT7A 4DBBA 5HE3A 2E2XA 2Y8FA 3OHMB 2OTXA 1KZGA 2JP2A 1EF1A 4WSFA 1T77A 3NWFA 2YF0A 2K8EA 4QJ3B 1W1GA 4GNKB 4YL8A 5JP4A 1ZM0A 2IFSA 3M1IB 3FEHA 1RRPB 4HAWB 2VRWB 3ODWA 2KUPA 4KHOA 4C0AA 1U5EA 3U7DA 1GG3A 3ODXA 4KHBA 2GUMA 3HIEA 1XD4A 3A8PA 4ZRIA 1FB8A 2H7DA 2ROZB 4HAVB 1DDVA 1V5UA 1OQNA 2XQNM 3FM8C 2EC1A 2Z13A 3TFMA 4OSNA 2ADZA 4CHJA 3D8FA 4GXBA 3PSCA 2D10A 2D9WA 5DI9B 5DHAB 4PNKA 4MK0A 2GCLA 2R0DA 2MKRA 4OT1A 4NY0A 1J0WA 3PVLA 2I5CA 2LULA 2DYQA 1V5PA 2K00A 2DKPA 4YONA 3QWMA 2RNRB 5HE0A 4A6KA 3ULBA 4A6FA 1W1HA 5CLLB 4QJ4B 2ROVA 5D3YA 3RCPA 4A5KA 1ZYIA 1MIZB 1U5GA 1U5FA 2X18A 4KVGB 4HDQA 1ZSQA 1NTVA 3SUZA 5LONB 1MPHA 4WJ7A 3TVVA 1UPRA 1V5MA 3A98B 3N7CA 2GCJA 4L1RA 2FJUB 2Q13A 4GPTB 2ELBA 1TXDA 4BBKA 3GYOA 2Y8GA 2CAYA 2DYNA 1DBHA 4EKUA 1SGHA 4F7GA 1J19A 2Z4DA 2K2UA 2FJLA 3G9WA 3TW1A 2D11A 3KY9A 2M14A 2CY5A 3BJIA 3F5RA 2RVBB 5I2SA 2J0MA 1GC7A 4CYEA 1BTKA 5J3QA 4HAYB 3SO6A 3DXEA 4QJ5B 2AL6A 2COCA 4K17A 1BWNA 2Z59A 3CXBB 1DDWA 2NZ8B 1FGYA 1EAZA 5KQ1A 1U29A 3BINA 3D8EA 2G35A 3PEGA 2YRYA 2DFKA 5GOWB 3FSSA 4D6WA 1Z87A 3TO1A 2GS0A 4DXAB 3DXCA 3WA0A 2COFA 1FAOA 2CY4A 3MPXA 4K2PA 5C6RA 1UNRA 4K2OA 2UZRA 1U5DA 3AU4A 2LKOA 4ZRKA 1TQZA 1X1FA 1NI2A 1MKEA 1XODA 1FOEA 2I1KA 1DYNA 1GC6A 3U12A 1X11A 2J0JA 1V89A 3ODOA 1X1GA 5C5BA 1M7EA 1FHOA 5M4YB 3WYFB 5JLJB 2W2WA 2NBVA 4F7UP 3KRWA 2DHIA 3KRXA 4K81A 1BAKA 1FGZA 1X05A 1ZC3B 4GMVA 3OANA 2I1JA 2D4QA 5CLQB 3D8DA 1ZC4B 3B77A 2KIEA 4HB4B 3DXDA 4D0NB 1TJ6A 5D27A 2LYDA 2KR0A 3MDBC 2MDXA 1SHCA 3O96A 4PQ0A 4HHVA 2L1CA 1FHWA 2RGNB 1UPQA 2HTHB 4GMXB 1DDMA 2OQBA 2YT0A 2YS3A 4HAZB 1W1DA 1B55A 4DX90 4H8SA 2UVMA 1EVHA 1RJ2A 4HAUB 4EJNA 2MFQA 1PLSA 3PVWA 5DH9B 4HATB 1BTNA 2RLOA 3HQCA 4KHBB 3TCAA 3PP2A 4A6HA 2M38A 3CIKA 5KQ4A 4QXAB 2MWNB 1XCGA 2N23A 1ISNA 2YSZA 2R09A 2KGXB 2KIGA 1Y19B 5I2MA 1P6SA 3ZVRA 5HE2A 1U27A 5LOPB 2N0YA 2P0FA 3NWDA 1N3HA 3F0WA 4KAXB 5DHFB 2P8VA 2K49A 1OY2A 1M7RA 2P0DA 1KZ7A 4XWXA 4TYZA 1NTYA 2CODA 4HB2B 2YS5A 3QIJA 2I5FA 1LW3A 3QBVB 1P5TA 5J3TA 1ZVRA 3A8QA 2DLWA 1U2BA 5J3YA 2VSZA 2GJYA 3GYPA 1UEFA 1V88A 2YT1A 4KHAA 5HE1A 1LB1A 2VKIA 5FI0A 4Z2MB 3VOQA 3U8ZA 4CSQA 2V76A 2ELAA 1WJ1A 2CRFA 2Z14A 2D9XA 1I7AA 2K2JA 3NSUA 3AU5A 1AWEA 4DX8A 3SYXA 3AJ4A 1K5GB 1K5DB 2Z0PA 5D3WA 1WJMA 2D2QA 2DKQA 4HB3B 5LG4B 2P0HA 3VIAA 5DIFB 1Q67A 2DN6A 2KCJA 1AQCA 3P7ZA 2KUQA 2EMSA 4NSWA 1XR0B 2Z0OA 2DTCA 1KI1B 2COAA 1WGQA 2ZKMX 1XKEA 2NMBA 4HSIA 3T06A 4IAPA 1UNQA 3A58A 3HW2B 2HE7A 2W2XD 1UNPA 3P6AA 1PMSA 4GN1A 4Z2NA 2ZPYA 3ML4A 5L81A 4IOYX 1Y5OA 2Y7BA 2D9ZA 3NWAA 2LOZA 1MAIA 4GZUA 2RSGA 2EJ8A 4GOUA 4F7HA 3PZDA 1MK9B 3NW8A 1I2HA 3ZDTA 2LG1A 2EMTA 5FI1A 4Y94A 3LJUX 2D9VA 1V61A 2Z0QA 4TKNA 2L2IA 1FHXA 4DIXA 5D3XA 3ULCA 1EGXA 3V5WA 3DCXA 4HB0B 4MY6A 5JHHA 2DHKA 4P7IA 1OMWA 4WVFB 3UZTA 2DHJA 1NU2A
chains in the Genus database with same CATH topology
3HK0A 2BCJA 3X23A 1PFJA 1H4RA 2UZSA 5C5BB 2PZ1A 1IRSA 1MK7B 5EFXA 1QQGA 1DROA 4CHMA 3KZ1A 2YVCA 1QC6A 2QKLA 5D3VA 1X86A 3PG7A 2DX5A 3SNHA 1WGUA 4EMOA 4ZRJA 2IYBA 2DX1A 1P3RA 2W2XC 1E5WA 3PVUA 2YS1A 1XX0A 5C16A 2J0KA 1H10A 5C79A 1WI1A 4A6FB 3IVFA 4HAXB 2AEHA 1MIXA 1WG7A 4B6HA 2J59M 2H7EA 5JHGA 5KCVA 2RUKB 3KSYA 4HDOA 2DA0A 4IFSA 4L6EA 3SV1A 2D9YA 1WVHA 2QKMA 2LOXA 4MT7A 4DBBA 5HE3A 2E2XA 2Y8FA 2OTXA 1KZGA 2JP2A 1EF1A 4WSFA 2YF0A 1W1GA 4YL8A 5JP4A 1ZM0A 2IFSA 3M1IB 3FEHA 1RRPB 4HAWB 2VRWB 3ODWA 2KUPA 4KHOA 4C0AA 1U5EA 3U7DA 1GG3A 3ODXA 1XD4A 3A8PA 4ZRIA 1FB8A 2H7DA 2ROZB 4HAVB 1DDVA 1V5UA 1OQNA 2XQNM 3FM8C 2EC1A 3TFMA 2ADZA 4CHJA 3D8FA 4GXBA 3PSCA 2D10A 2D9WA 5DI9B 5DHAB 4PNKA 4MK0A 2GCLA 2R0DA 2MKRA 4NY0A 1J0WA 3PVLA 2I5CA 2LULA 2DYQA 1V5PA 2K00A 2DKPA 4YONA 3QWMA 2RNRB 5HE0A 4A6KA 3ULBA 4A6FA 1W1HA 5CLLB 2ROVA 5D3YA 3RCPA 4A5KA 1MIZB 1U5GA 1U5FA 2X18A 4KVGB 4HDQA 1ZSQA 1NTVA 3SUZA 5LONB 1MPHA 4WJ7A 3TVVA 1UPRA 1V5MA 3A98B 3N7CA 2GCJA 2Q13A 4GPTB 2ELBA 1TXDA 4BBKA 3GYOA 2Y8GA 2CAYA 2DYNA 1DBHA 4EKUA 1SGHA 4F7GA 1J19A 2K2UA 2FJLA 3G9WA 3TW1A 2D11A 3KY9A 2M14A 2CY5A 3BJIA 3F5RA 2RVBB 2J0MA 1GC7A 4CYEA 1BTKA 5J3QA 4HAYB 3SO6A 3DXEA 2AL6A 2COCA 4K17A 1BWNA 3CXBB 1DDWA 2NZ8B 1FGYA 1EAZA 5KQ1A 1U29A 3BINA 3D8EA 2G35A 3PEGA 2YRYA 2DFKA 5GOWB 3FSSA 1Z87A 3TO1A 2GS0A 4DXAB 3DXCA 3WA0A 2COFA 1FAOA 2CY4A 3MPXA 4K2PA 5C6RA 1UNRA 4K2OA 2UZRA 1U5DA 3AU4A 2LKOA 4ZRKA 1TQZA 1X1FA 1NI2A 1MKEA 1XODA 1FOEA 2I1KA 1DYNA 1GC6A 1X11A 2J0JA 1V89A 3ODOA 1X1GA 5C5BA 1M7EA 1FHOA 3WYFB 5JLJB 2W2WA 4F7UP 3KRWA 2DHIA 3KRXA 4K81A 1BAKA 1FGZA 1X05A 1ZC3B 4GMVA 3OANA 2I1JA 2D4QA 5CLQB 3D8DA 1ZC4B 4HB4B 3DXDA 4D0NB 1TJ6A 5D27A 2LYDA 3MDBC 2MDXA 1SHCA 3O96A 4PQ0A 4HHVA 2L1CA 1FHWA 2RGNB 1UPQA 2HTHB 4GMXB 1DDMA 2OQBA 2YT0A 2YS3A 4HAZB 1W1DA 1B55A 4DX90 4H8SA 2UVMA 1EVHA 1RJ2A 4HAUB 4EJNA 2MFQA 1PLSA 3PVWA 5DH9B 4HATB 1BTNA 2RLOA 3HQCA 4KHBB 3TCAA 3PP2A 4A6HA 2M38A 3CIKA 5KQ4A 2MWNB 1XCGA 2N23A 1ISNA 2YSZA 2R09A 2KGXB 1Y19B 1P6SA 3ZVRA 5HE2A 1U27A 5LOPB 2N0YA 2P0FA 1N3HA 3F0WA 4KAXB 5DHFB 2P8VA 1OY2A 1M7RA 2P0DA 1KZ7A 4XWXA 4TYZA 1NTYA 2CODA 4HB2B 2YS5A 3QIJA 2I5FA 1LW3A 3QBVB 1P5TA 5J3TA 1ZVRA 3A8QA 2DLWA 1U2BA 5J3YA 2VSZA 2GJYA 3GYPA 1UEFA 1V88A 2YT1A 4KHAA 5HE1A 1LB1A 2VKIA 5FI0A 4Z2MB 3VOQA 3U8ZA 2V76A 2ELAA 1WJ1A 2CRFA 2D9XA 1I7AA 2K2JA 3NSUA 3AU5A 1AWEA 4DX8A 3SYXA 3AJ4A 1K5GB 1K5DB 2Z0PA 5D3WA 1WJMA 2D2QA 2DKQA 4HB3B 2P0HA 3VIAA 5DIFB 1Q67A 2DN6A 2KCJA 1AQCA 3P7ZA 4NSWA 2EMSA 1XR0B 2Z0OA 2DTCA 1KI1B 2COAA 1WGQA 1XKEA 2NMBA 3T06A 4IAPA 1UNQA 3HW2B 2HE7A 2W2XD 1UNPA 3P6AA 1PMSA 4GN1A 4Z2NA 2ZPYA 3ML4A 5L81A 4IOYX 1Y5OA 2Y7BA 2D9ZA 2LOZA 1MAIA 4GZUA 2RSGA 2EJ8A 4F7HA 3PZDA 1MK9B 1I2HA 3ZDTA 2LG1A 2EMTA 5FI1A 4Y94A 3LJUX 2D9VA 1V61A 2Z0QA 4TKNA 2L2IA 1FHXA 5D3XA 3ULCA 1EGXA 3V5WA 4HB0B 4MY6A 5JHHA 2DHKA 4P7IA 1OMWA 4WVFB 3UZTA 2DHJA 1NU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HK0 A;  2BCJ A;  3X23 A;  1PFJ A;  1H4R A;  2UZS A;  5C5B B;  2PZ1 A;  1IRS A;  1MK7 B;  5EFX A;  1QQG A;  1DRO A;  4CHM A;  3KZ1 A;  2YVC A;  1QC6 A;  2QKL A;  5D3V A;  1X86 A;  3PG7 A;  2DX5 A;  3SNH A;  1WGU A;  4EMO A;  4ZRJ A;  2IYB A;  2DX1 A;  1P3R A;  2W2X C;  1E5W A;  3PVU A;  2YS1 A;  1XX0 A;  5C16 A;  2J0K A;  1H10 A;  5C79 A;  1WI1 A;  4A6F B;  3IVF A;  4HAX B;  2AEH A;  1MIX A;  1WG7 A;  4B6H A;  2J59 M;  2H7E A;  5JHG A;  5KCV A;  2RUK B;  3KSY A;  4HDO A;  2DA0 A;  4IFS A;  4L6E A;  3SV1 A;  2D9Y A;  1WVH A;  2QKM A;  2LOX A;  4MT7 A;  4DBB A;  5HE3 A;  2E2X A;  2Y8F A;  2OTX A;  1KZG A;  2JP2 A;  1EF1 A;  4WSF A;  2YF0 A;  1W1G A;  4YL8 A;  5JP4 A;  1ZM0 A;  2IFS A;  3M1I B;  3FEH A;  1RRP B;  4HAW B;  2VRW B;  3ODW A;  2KUP A;  4KHO A;  4C0A A;  1U5E A;  3U7D A;  1GG3 A;  3ODX A;  1XD4 A;  3A8P A;  4ZRI A;  1FB8 A;  2H7D A;  2ROZ B;  4HAV B;  1DDV A;  1V5U A;  1OQN A;  2XQN M;  3FM8 C;  2EC1 A;  3TFM A;  2ADZ A;  4CHJ A;  3D8F A;  4GXB A;  3PSC A;  2D10 A;  2D9W A;  5DI9 B;  5DHA B;  4PNK A;  4MK0 A;  2GCL A;  2R0D A;  2MKR A;  4NY0 A;  1J0W A;  3PVL A;  2I5C A;  2LUL A;  2DYQ A;  1V5P A;  2K00 A;  2DKP A;  4YON A;  3QWM A;  2RNR B;  5HE0 A;  4A6K A;  3ULB A;  4A6F A;  1W1H A;  5CLL B;  2ROV A;  5D3Y A;  3RCP A;  4A5K A;  1MIZ B;  1U5G A;  1U5F A;  2X18 A;  4KVG B;  4HDQ A;  1ZSQ A;  1NTV A;  3SUZ A;  5LON B;  1MPH A;  4WJ7 A;  3TVV A;  1UPR A;  1V5M A;  3A98 B;  3N7C A;  2GCJ A;  2Q13 A;  4GPT B;  2ELB A;  1TXD A;  4BBK A;  3GYO A;  2Y8G A;  2CAY A;  2DYN A;  1DBH A;  4EKU A;  1SGH A;  4F7G A;  1J19 A;  2K2U A;  2FJL A;  3G9W A;  3TW1 A;  2D11 A;  3KY9 A;  2M14 A;  2CY5 A;  3BJI A;  3F5R A;  2RVB B;  2J0M A;  1GC7 A;  4CYE A;  1BTK A;  5J3Q A;  4HAY B;  3SO6 A;  3DXE A;  2AL6 A;  2COC A;  4K17 A;  1BWN A;  3CXB B;  1DDW A;  2NZ8 B;  1FGY A;  1EAZ A;  5KQ1 A;  1U29 A;  3BIN A;  3D8E A;  2G35 A;  3PEG A;  2YRY A;  2DFK A;  5GOW B;  3FSS A;  1Z87 A;  3TO1 A;  2GS0 A;  4DXA B;  3DXC A;  3WA0 A;  2COF A;  1FAO A;  2CY4 A;  3MPX A;  4K2P A;  5C6R A;  1UNR A;  4K2O A;  2UZR A;  1U5D A;  3AU4 A;  2LKO A;  4ZRK A;  1TQZ A;  1X1F A;  1NI2 A;  1MKE A;  1XOD A;  1FOE A;  2I1K A;  1DYN A;  1GC6 A;  1X11 A;  2J0J A;  1V89 A;  3ODO A;  1X1G A;  5C5B A;  1M7E A;  1FHO A;  3WYF B;  5JLJ B;  2W2W A;  4F7U P;  3KRW A;  2DHI A;  3KRX A;  4K81 A;  1BAK A;  1FGZ A;  1X05 A;  1ZC3 B;  4GMV A;  3OAN A;  2I1J A;  2D4Q A;  5CLQ B;  3D8D A;  1ZC4 B;  4HB4 B;  3DXD A;  4D0N B;  1TJ6 A;  5D27 A;  2LYD A;  3MDB C;  2MDX A;  1SHC A;  3O96 A;  4PQ0 A;  4HHV A;  2L1C A;  1FHW A;  2RGN B;  1UPQ A;  2HTH B;  4GMX B;  1DDM A;  2OQB A;  2YT0 A;  2YS3 A;  4HAZ B;  1W1D A;  1B55 A;  4DX9 0;  4H8S A;  2UVM A;  1EVH A;  1RJ2 A;  4HAU B;  4EJN A;  2MFQ A;  1PLS A;  3PVW A;  5DH9 B;  4HAT B;  1BTN A;  2RLO A;  3HQC A;  4KHB B;  3TCA A;  3PP2 A;  4A6H A;  2M38 A;  3CIK A;  5KQ4 A;  2MWN B;  1XCG A;  2N23 A;  1ISN A;  2YSZ A;  2R09 A;  2KGX B;  1Y19 B;  1P6S A;  3ZVR A;  5HE2 A;  1U27 A;  5LOP B;  2N0Y A;  2P0F A;  1N3H A;  3F0W A;  4KAX B;  5DHF B;  2P8V A;  1OY2 A;  1M7R A;  2P0D A;  1KZ7 A;  4XWX A;  4TYZ A;  1NTY A;  2COD A;  4HB2 B;  2YS5 A;  3QIJ A;  2I5F A;  1LW3 A;  3QBV B;  1P5T A;  5J3T A;  1ZVR A;  3A8Q A;  2DLW A;  1U2B A;  5J3Y A;  2VSZ A;  2GJY A;  3GYP A;  1UEF A;  1V88 A;  2YT1 A;  4KHA A;  5HE1 A;  1LB1 A;  2VKI A;  5FI0 A;  4Z2M B;  3VOQ A;  3U8Z A;  2V76 A;  2ELA A;  1WJ1 A;  2CRF A;  2D9X A;  1I7A A;  2K2J A;  3NSU A;  3AU5 A;  1AWE A;  4DX8 A;  3SYX A;  3AJ4 A;  1K5G B;  1K5D B;  2Z0P A;  5D3W A;  1WJM A;  2D2Q A;  2DKQ A;  4HB3 B;  2P0H A;  3VIA A;  5DIF B;  1Q67 A;  2DN6 A;  2KCJ A;  1AQC A;  3P7Z A;  4NSW A;  2EMS A;  1XR0 B;  2Z0O A;  2DTC A;  1KI1 B;  2COA A;  1WGQ A;  1XKE A;  2NMB A;  3T06 A;  4IAP A;  1UNQ A;  3HW2 B;  2HE7 A;  2W2X D;  1UNP A;  3P6A A;  1PMS A;  4GN1 A;  4Z2N A;  2ZPY A;  3ML4 A;  5L81 A;  4IOY X;  1Y5O A;  2Y7B A;  2D9Z A;  2LOZ A;  1MAI A;  4GZU A;  2RSG A;  2EJ8 A;  4F7H A;  3PZD A;  1MK9 B;  1I2H A;  3ZDT A;  2LG1 A;  2EMT A;  5FI1 A;  4Y94 A;  3LJU X;  2D9V A;  1V61 A;  2Z0Q A;  4TKN A;  2L2I A;  1FHX A;  5D3X A;  3ULC A;  1EGX A;  3V5W A;  4HB0 B;  4MY6 A;  5JHH A;  2DHK A;  4P7I A;  1OMW A;  4WVF B;  3UZT A;  2DHJ A;  1NU2 A; 
#chains in the Genus database with same CATH topology
 3HK0 A;  2BCJ A;  3X23 A;  1PFJ A;  1H4R A;  2UZS A;  5C5B B;  2PZ1 A;  1IRS A;  1MK7 B;  5EFX A;  3HSA A;  1QQG A;  1DRO A;  4CHM A;  3KZ1 A;  2YVC A;  1QC6 A;  2QKL A;  5D3V A;  1X86 A;  3PG7 A;  2DX5 A;  3SNH A;  1WGU A;  4EMO A;  2YT2 A;  4ZRJ A;  2IYB A;  2DX1 A;  1MI1 A;  1P3R A;  2W2X C;  1E5W A;  3PVU A;  2YS1 A;  1XX0 A;  5C16 A;  2J0K A;  1H10 A;  5C79 A;  1WI1 A;  5IRS A;  3FVC A;  4A6F B;  3IVF A;  4HAX B;  2AEH A;  1MIX A;  1WG7 A;  4B6H A;  2J59 M;  2H7E A;  5JHG A;  2RRF A;  5KCV A;  2RUK B;  3KSY A;  4HDO A;  2DA0 A;  4IFS A;  4L6E A;  3SV1 A;  2D9Y A;  2R2Y A;  1WVH A;  2QKM A;  2LOX A;  4MT7 A;  4DBB A;  5HE3 A;  2E2X A;  2Y8F A;  3OHM B;  2OTX A;  1KZG A;  2JP2 A;  1EF1 A;  4WSF A;  1T77 A;  3NWF A;  2YF0 A;  2K8E A;  4QJ3 B;  1W1G A;  4GNK B;  4YL8 A;  5JP4 A;  1ZM0 A;  2IFS A;  3M1I B;  3FEH A;  1RRP B;  4HAW B;  2VRW B;  3ODW A;  2KUP A;  4KHO A;  4C0A A;  1U5E A;  3U7D A;  1GG3 A;  3ODX A;  4KHB A;  2GUM A;  3HIE A;  1XD4 A;  3A8P A;  4ZRI A;  1FB8 A;  2H7D A;  2ROZ B;  4HAV B;  1DDV A;  1V5U A;  1OQN A;  2XQN M;  3FM8 C;  2EC1 A;  2Z13 A;  3TFM A;  4OSN A;  2ADZ A;  4CHJ A;  3D8F A;  4GXB A;  3PSC A;  2D10 A;  2D9W A;  5DI9 B;  5DHA B;  4PNK A;  4MK0 A;  2GCL A;  2R0D A;  2MKR A;  4OT1 A;  4NY0 A;  1J0W A;  3PVL A;  2I5C A;  2LUL A;  2DYQ A;  1V5P A;  2K00 A;  2DKP A;  4YON A;  3QWM A;  2RNR B;  5HE0 A;  4A6K A;  3ULB A;  4A6F A;  1W1H A;  5CLL B;  4QJ4 B;  2ROV A;  5D3Y A;  3RCP A;  4A5K A;  1ZYI A;  1MIZ B;  1U5G A;  1U5F A;  2X18 A;  4KVG B;  4HDQ A;  1ZSQ A;  1NTV A;  3SUZ A;  5LON B;  1MPH A;  4WJ7 A;  3TVV A;  1UPR A;  1V5M A;  3A98 B;  3N7C A;  2GCJ A;  4L1R A;  2FJU B;  2Q13 A;  4GPT B;  2ELB A;  1TXD A;  4BBK A;  3GYO A;  2Y8G A;  2CAY A;  2DYN A;  1DBH A;  4EKU A;  1SGH A;  4F7G A;  1J19 A;  2Z4D A;  2K2U A;  2FJL A;  3G9W A;  3TW1 A;  2D11 A;  3KY9 A;  2M14 A;  2CY5 A;  3BJI A;  3F5R A;  2RVB B;  5I2S A;  2J0M A;  1GC7 A;  4CYE A;  1BTK A;  5J3Q A;  4HAY B;  3SO6 A;  3DXE A;  4QJ5 B;  2AL6 A;  2COC A;  4K17 A;  1BWN A;  2Z59 A;  3CXB B;  1DDW A;  2NZ8 B;  1FGY A;  1EAZ A;  5KQ1 A;  1U29 A;  3BIN A;  3D8E A;  2G35 A;  3PEG A;  2YRY A;  2DFK A;  5GOW B;  3FSS A;  4D6W A;  1Z87 A;  3TO1 A;  2GS0 A;  4DXA B;  3DXC A;  3WA0 A;  2COF A;  1FAO A;  2CY4 A;  3MPX A;  4K2P A;  5C6R A;  1UNR A;  4K2O A;  2UZR A;  1U5D A;  3AU4 A;  2LKO A;  4ZRK A;  1TQZ A;  1X1F A;  1NI2 A;  1MKE A;  1XOD A;  1FOE A;  2I1K A;  1DYN A;  1GC6 A;  3U12 A;  1X11 A;  2J0J A;  1V89 A;  3ODO A;  1X1G A;  5C5B A;  1M7E A;  1FHO A;  5M4Y B;  3WYF B;  5JLJ B;  2W2W A;  2NBV A;  4F7U P;  3KRW A;  2DHI A;  3KRX A;  4K81 A;  1BAK A;  1FGZ A;  1X05 A;  1ZC3 B;  4GMV A;  3OAN A;  2I1J A;  2D4Q A;  5CLQ B;  3D8D A;  1ZC4 B;  3B77 A;  2KIE A;  4HB4 B;  3DXD A;  4D0N B;  1TJ6 A;  5D27 A;  2LYD A;  2KR0 A;  3MDB C;  2MDX A;  1SHC A;  3O96 A;  4PQ0 A;  4HHV A;  2L1C A;  1FHW A;  2RGN B;  1UPQ A;  2HTH B;  4GMX B;  1DDM A;  2OQB A;  2YT0 A;  2YS3 A;  4HAZ B;  1W1D A;  1B55 A;  4DX9 0;  4H8S A;  2UVM A;  1EVH A;  1RJ2 A;  4HAU B;  4EJN A;  2MFQ A;  1PLS A;  3PVW A;  5DH9 B;  4HAT B;  1BTN A;  2RLO A;  3HQC A;  4KHB B;  3TCA A;  3PP2 A;  4A6H A;  2M38 A;  3CIK A;  5KQ4 A;  4QXA B;  2MWN B;  1XCG A;  2N23 A;  1ISN A;  2YSZ A;  2R09 A;  2KGX B;  2KIG A;  1Y19 B;  5I2M A;  1P6S A;  3ZVR A;  5HE2 A;  1U27 A;  5LOP B;  2N0Y A;  2P0F A;  3NWD A;  1N3H A;  3F0W A;  4KAX B;  5DHF B;  2P8V A;  2K49 A;  1OY2 A;  1M7R A;  2P0D A;  1KZ7 A;  4XWX A;  4TYZ A;  1NTY A;  2COD A;  4HB2 B;  2YS5 A;  3QIJ A;  2I5F A;  1LW3 A;  3QBV B;  1P5T A;  5J3T A;  1ZVR A;  3A8Q A;  2DLW A;  1U2B A;  5J3Y A;  2VSZ A;  2GJY A;  3GYP A;  1UEF A;  1V88 A;  2YT1 A;  4KHA A;  5HE1 A;  1LB1 A;  2VKI A;  5FI0 A;  4Z2M B;  3VOQ A;  3U8Z A;  4CSQ A;  2V76 A;  2ELA A;  1WJ1 A;  2CRF A;  2Z14 A;  2D9X A;  1I7A A;  2K2J A;  3NSU A;  3AU5 A;  1AWE A;  4DX8 A;  3SYX A;  3AJ4 A;  1K5G B;  1K5D B;  2Z0P A;  5D3W A;  1WJM A;  2D2Q A;  2DKQ A;  4HB3 B;  5LG4 B;  2P0H A;  3VIA A;  5DIF B;  1Q67 A;  2DN6 A;  2KCJ A;  1AQC A;  3P7Z A;  2KUQ A;  2EMS A;  4NSW A;  1XR0 B;  2Z0O A;  2DTC A;  1KI1 B;  2COA A;  1WGQ A;  2ZKM X;  1XKE A;  2NMB A;  4HSI A;  3T06 A;  4IAP A;  1UNQ A;  3A58 A;  3HW2 B;  2HE7 A;  2W2X D;  1UNP A;  3P6A A;  1PMS A;  4GN1 A;  4Z2N A;  2ZPY A;  3ML4 A;  5L81 A;  4IOY X;  1Y5O A;  2Y7B A;  2D9Z A;  3NWA A;  2LOZ A;  1MAI A;  4GZU A;  2RSG A;  2EJ8 A;  4GOU A;  4F7H A;  3PZD A;  1MK9 B;  3NW8 A;  1I2H A;  3ZDT A;  2LG1 A;  2EMT A;  5FI1 A;  4Y94 A;  3LJU X;  2D9V A;  1V61 A;  2Z0Q A;  4TKN A;  2L2I A;  1FHX A;  4DIX A;  5D3X A;  3ULC A;  1EGX A;  3V5W A;  3DCX A;  4HB0 B;  4MY6 A;  5JHH A;  2DHK A;  4P7I A;  1OMW A;  4WVF B;  3UZT A;  2DHJ A;  1NU2 A; 
#chains in the Genus database with same CATH homology
 3HK0 A;  2BCJ A;  3X23 A;  1PFJ A;  1H4R A;  2UZS A;  5C5B B;  2PZ1 A;  1IRS A;  1MK7 B;  5EFX A;  1QQG A;  1DRO A;  4CHM A;  3KZ1 A;  2YVC A;  1QC6 A;  2QKL A;  5D3V A;  1X86 A;  3PG7 A;  2DX5 A;  3SNH A;  1WGU A;  4EMO A;  4ZRJ A;  2IYB A;  2DX1 A;  1P3R A;  2W2X C;  1E5W A;  3PVU A;  2YS1 A;  1XX0 A;  5C16 A;  2J0K A;  1H10 A;  5C79 A;  1WI1 A;  4A6F B;  3IVF A;  4HAX B;  2AEH A;  1MIX A;  1WG7 A;  4B6H A;  2J59 M;  2H7E A;  5JHG A;  5KCV A;  2RUK B;  3KSY A;  4HDO A;  2DA0 A;  4IFS A;  4L6E A;  3SV1 A;  2D9Y A;  1WVH A;  2QKM A;  2LOX A;  4MT7 A;  4DBB A;  5HE3 A;  2E2X A;  2Y8F A;  2OTX A;  1KZG A;  2JP2 A;  1EF1 A;  4WSF A;  2YF0 A;  1W1G A;  4YL8 A;  5JP4 A;  1ZM0 A;  2IFS A;  3M1I B;  3FEH A;  1RRP B;  4HAW B;  2VRW B;  3ODW A;  2KUP A;  4KHO A;  4C0A A;  1U5E A;  3U7D A;  1GG3 A;  3ODX A;  1XD4 A;  3A8P A;  4ZRI A;  1FB8 A;  2H7D A;  2ROZ B;  4HAV B;  1DDV A;  1V5U A;  1OQN A;  2XQN M;  3FM8 C;  2EC1 A;  3TFM A;  2ADZ A;  4CHJ A;  3D8F A;  4GXB A;  3PSC A;  2D10 A;  2D9W A;  5DI9 B;  5DHA B;  4PNK A;  4MK0 A;  2GCL A;  2R0D A;  2MKR A;  4NY0 A;  1J0W A;  3PVL A;  2I5C A;  2LUL A;  2DYQ A;  1V5P A;  2K00 A;  2DKP A;  4YON A;  3QWM A;  2RNR B;  5HE0 A;  4A6K A;  3ULB A;  4A6F A;  1W1H A;  5CLL B;  2ROV A;  5D3Y A;  3RCP A;  4A5K A;  1MIZ B;  1U5G A;  1U5F A;  2X18 A;  4KVG B;  4HDQ A;  1ZSQ A;  1NTV A;  3SUZ A;  5LON B;  1MPH A;  4WJ7 A;  3TVV A;  1UPR A;  1V5M A;  3A98 B;  3N7C A;  2GCJ A;  2Q13 A;  4GPT B;  2ELB A;  1TXD A;  4BBK A;  3GYO A;  2Y8G A;  2CAY A;  2DYN A;  1DBH A;  4EKU A;  1SGH A;  4F7G A;  1J19 A;  2K2U A;  2FJL A;  3G9W A;  3TW1 A;  2D11 A;  3KY9 A;  2M14 A;  2CY5 A;  3BJI A;  3F5R A;  2RVB B;  2J0M A;  1GC7 A;  4CYE A;  1BTK A;  5J3Q A;  4HAY B;  3SO6 A;  3DXE A;  2AL6 A;  2COC A;  4K17 A;  1BWN A;  3CXB B;  1DDW A;  2NZ8 B;  1FGY A;  1EAZ A;  5KQ1 A;  1U29 A;  3BIN A;  3D8E A;  2G35 A;  3PEG A;  2YRY A;  2DFK A;  5GOW B;  3FSS A;  1Z87 A;  3TO1 A;  2GS0 A;  4DXA B;  3DXC A;  3WA0 A;  2COF A;  1FAO A;  2CY4 A;  3MPX A;  4K2P A;  5C6R A;  1UNR A;  4K2O A;  2UZR A;  1U5D A;  3AU4 A;  2LKO A;  4ZRK A;  1TQZ A;  1X1F A;  1NI2 A;  1MKE A;  1XOD A;  1FOE A;  2I1K A;  1DYN A;  1GC6 A;  1X11 A;  2J0J A;  1V89 A;  3ODO A;  1X1G A;  5C5B A;  1M7E A;  1FHO A;  3WYF B;  5JLJ B;  2W2W A;  4F7U P;  3KRW A;  2DHI A;  3KRX A;  4K81 A;  1BAK A;  1FGZ A;  1X05 A;  1ZC3 B;  4GMV A;  3OAN A;  2I1J A;  2D4Q A;  5CLQ B;  3D8D A;  1ZC4 B;  4HB4 B;  3DXD A;  4D0N B;  1TJ6 A;  5D27 A;  2LYD A;  3MDB C;  2MDX A;  1SHC A;  3O96 A;  4PQ0 A;  4HHV A;  2L1C A;  1FHW A;  2RGN B;  1UPQ A;  2HTH B;  4GMX B;  1DDM A;  2OQB A;  2YT0 A;  2YS3 A;  4HAZ B;  1W1D A;  1B55 A;  4DX9 0;  4H8S A;  2UVM A;  1EVH A;  1RJ2 A;  4HAU B;  4EJN A;  2MFQ A;  1PLS A;  3PVW A;  5DH9 B;  4HAT B;  1BTN A;  2RLO A;  3HQC A;  4KHB B;  3TCA A;  3PP2 A;  4A6H A;  2M38 A;  3CIK A;  5KQ4 A;  2MWN B;  1XCG A;  2N23 A;  1ISN A;  2YSZ A;  2R09 A;  2KGX B;  1Y19 B;  1P6S A;  3ZVR A;  5HE2 A;  1U27 A;  5LOP B;  2N0Y A;  2P0F A;  1N3H A;  3F0W A;  4KAX B;  5DHF B;  2P8V A;  1OY2 A;  1M7R A;  2P0D A;  1KZ7 A;  4XWX A;  4TYZ A;  1NTY A;  2COD A;  4HB2 B;  2YS5 A;  3QIJ A;  2I5F A;  1LW3 A;  3QBV B;  1P5T A;  5J3T A;  1ZVR A;  3A8Q A;  2DLW A;  1U2B A;  5J3Y A;  2VSZ A;  2GJY A;  3GYP A;  1UEF A;  1V88 A;  2YT1 A;  4KHA A;  5HE1 A;  1LB1 A;  2VKI A;  5FI0 A;  4Z2M B;  3VOQ A;  3U8Z A;  2V76 A;  2ELA A;  1WJ1 A;  2CRF A;  2D9X A;  1I7A A;  2K2J A;  3NSU A;  3AU5 A;  1AWE A;  4DX8 A;  3SYX A;  3AJ4 A;  1K5G B;  1K5D B;  2Z0P A;  5D3W A;  1WJM A;  2D2Q A;  2DKQ A;  4HB3 B;  2P0H A;  3VIA A;  5DIF B;  1Q67 A;  2DN6 A;  2KCJ A;  1AQC A;  3P7Z A;  4NSW A;  2EMS A;  1XR0 B;  2Z0O A;  2DTC A;  1KI1 B;  2COA A;  1WGQ A;  1XKE A;  2NMB A;  3T06 A;  4IAP A;  1UNQ A;  3HW2 B;  2HE7 A;  2W2X D;  1UNP A;  3P6A A;  1PMS A;  4GN1 A;  4Z2N A;  2ZPY A;  3ML4 A;  5L81 A;  4IOY X;  1Y5O A;  2Y7B A;  2D9Z A;  2LOZ A;  1MAI A;  4GZU A;  2RSG A;  2EJ8 A;  4F7H A;  3PZD A;  1MK9 B;  1I2H A;  3ZDT A;  2LG1 A;  2EMT A;  5FI1 A;  4Y94 A;  3LJU X;  2D9V A;  1V61 A;  2Z0Q A;  4TKN A;  2L2I A;  1FHX A;  5D3X A;  3ULC A;  1EGX A;  3V5W A;  4HB0 B;  4MY6 A;  5JHH A;  2DHK A;  4P7I A;  1OMW A;  4WVF B;  3UZT A;  2DHJ A;  1NU2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...