1AWEA

Human sos1 pleckstrin homology (ph) domain, nmr, 20 structures
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
130
structure length
130
Chain Sequence
MNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRLPGASNAEYRLKEKFFMRKVQINDKDDTNEYKHAFEIILKDENSVIFSAKSAEEKNNWMAALISLQYRSTLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SOS1
publication title The solution structure of the pleckstrin homology domain of human SOS1. A possible structural role for the sequential association of diffuse B cell lymphoma and pleckstrin homology domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signal transduction
total genus 17
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 1997-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1aweA00
4CHMA 5LONB 5JLJB 1EF1A 3PEGA 3TO1A 2R0DA 2W2XD 3KRWA 4DX90 4KHAA 1FB8A 2VSZA 2DFKA 5DIFB 4HB2B 4Z2NA 4TYZA 5C6RA 1Y5OA 2ROZB 1V61A 1DBHA 2LG1A 5D3XA 1I2HA 3HW2B 1SGHA 4HATB 1GC6A 1WJMA 3ULBA 1ZSQA 2RNRB 1FHOA 1MKEA 4H8SA 1X1FA 1PMSA 3ODXA 1EAZA 1FOEA 2AEHA 5D3WA 5HE1A 3KY9A 2DX5A 4L6EA 3LJUX 1OY2A 2YRYA 3HK0A 2ELAA 3ULCA 1X11A 2XQNM 1GC7A 4ZRJA 2BCJA 4F7UP 2YS3A 4WJ7A 1W1HA 4YONA 3CXBB 2GS0A 1ZM0A 2ROVA 2DA0A 3D8DA 3AU4A 4HDQA 2D11A 1U5GA 3P6AA 5EFXA 1RJ2A 4GXBA 5FI1A 2J59M 1WVHA 3PVUA 1XR0B 2EMSA 4DX8A 4KHOA 4HHVA 1V89A 3MPXA 4KHBB 3QBVB 2RGNB 4GMXB 2P0DA 3A8PA 2R09A 5HE0A 2K00A 2N0YA 2RLOA 3BINA 1QQGA 2MFQA 2PZ1A 1FGZA 1XCGA 4HB3B 1N3HA 4KAXB 1TJ6A 3F5RA 4A5KA 3TFMA 1WJ1A 2V76A 1DDWA 1H10A 5C5BB 1KZGA 4IOYX 2I5FA 4HAZB 2MKRA 1FHXA 2DHIA 1V5MA 3GYOA 4DXAB 1XD4A 1P6SA 1WI1A 1X1GA 5C79A 4PNKA 1TXDA 4ZRKA 3VOQA 1WGUA 3SV1A 4B6HA 2AL6A 4GPTB 4F7GA 3TVVA 2RSGA 1EGXA 2D9YA 2J0KA 1U27A 2IYBA 3V5WA 3ML4A 2YF0A 3G9WA 1WG7A 2EMTA 2M38A 3PVWA 3PSCA 4ZRIA 2CY4A 1KI1B 4WVFB 1AWEA 5CLQB 2DLWA 1SHCA 1W1GA 2D9XA 4CHJA 2CRFA 2LULA 3AU5A 1OMWA 2YVCA 5D27A 2LOXA 2UZRA 2N23A 1U5DA 3PG7A 2W2WA 3OANA 3PP2A 2ADZA 4HAVB 3SUZA 2D2QA 4KVGB 1UNPA 4P7IA 4NY0A 2L1CA 1BTNA 1MIZB 2EC1A 2ZPYA 5GOWB 2H7DA 2L2IA 3HQCA 5JP4A 5J3TA 4IAPA 3ODWA 2YT0A 1GG3A 3SO6A 3A98B 1FHWA 1Z87A 1M7EA 1B55A 4K81A 1AQCA 4MY6A 3T06A 2NMBA 1UPRA 4A6FA 2VKIA 2Z0QA 3F0WA 3SYXA 1NTYA 4MT7A 2JP2A 1XODA 3UZTA 2I1KA 2CAYA 1P3RA 4HAYB 4HB0B 1J0WA 3NSUA 2GCLA 4CYEA 2P8VA 2OQBA 3TW1A 3VIAA 1LW3A 2KCJA 1UPQA 1LB1A 4HAUB 2K2UA 1U5EA 1V5UA 2EJ8A 4XWXA 4BBKA 5JHGA 3X23A 1DYNA 1DDVA 4K2PA 3SNHA 2COFA 1KZ7A 4YL8A 3DXDA 2Z0OA 4F7HA 2Z0PA 1X05A 3D8EA 3M1IB 5KQ4A 2LYDA 2DTCA 1QC6A 2DHJA 5HE2A 1UEFA 1XX0A 5DH9B 5J3QA 2I1JA 4NSWA 3ODOA 4GZUA 5CLLB 2D10A 1ISNA 2UVMA 1DROA 1ZC4B 2HE7A 5J3YA 5JHHA 4K2OA 1V5PA 2Y8GA 1XKEA 5HE3A 3PVLA 5DI9B 2D9VA 1MIXA 2OTXA 4D0NB 2HTHB 1MAIA 2E2XA 1W1DA 3FM8C 3DXCA 3KRXA 1PFJA 2YS1A 3ZDTA 1RRPB 1BTKA 2DKPA 2KGXB 1Q67A 2RVBB 1FGYA 1Y19B 5C16A 5D3VA 2VRWB 4IFSA 1P5TA 2GCJA 5KQ1A 4K17A 1MK7B 3RCPA 3U8ZA 2J0MA 1WGQA 4EMOA 1K5DB 5KCVA 1BAKA 1K5GB 1ZC3B 4HAWB 5D3YA 4MK0A 3BJIA 1TQZA 2MWNB 2LKOA 4WSFA 1E5WA 3KSYA 1J19A 1UNRA 4A6KA 1UNQA 2YSZA 4Z2MB 1I7AA 1X86A 3MDBC 1NTVA 4HB4B 1IRSA 2RUKB 1BWNA 1V88A 4GN1A 2ELBA 4HAXB 2UZSA 2D4QA 2GJYA 5DHFB 1U5FA 2D9WA 2P0HA 2M14A 4Y94A 2DHKA 3P7ZA 1NI2A 2Y7BA 2NZ8B 4EKUA 1H4RA 3QIJA 1NU2A 2CY5A 2COAA 2DKQA 2DYQA 1FAOA 1U2BA 4GMVA 4A6FB 3DXEA 2MDXA 3IVFA 2DYNA 5DHAB 2QKLA 3WYFB 4A6HA 4EJNA 3ZVRA 5C5BA 3A8QA 2QKMA 2Y8FA 4DBBA 3KZ1A 2H7EA 3FSSA 1MK9B 1MPHA 2D9ZA 3GYPA 3WA0A 2X18A 2LOZA 3CIKA 3QWMA 4HDOA 3O96A 4PQ0A 2DX1A 1M7RA 2K2JA 3PZDA 3TCAA 5LOPB 1U29A 2YT1A 2Q13A 2KUPA 3U7DA 4C0AA 3FEHA 2P0FA 5L81A 2DN6A 2J0JA 1ZVRA 2FJLA 2COCA 2W2XC 2YS5A 2CODA 5FI0A 2IFSA 1EVHA 3D8FA 3N7CA 1OQNA 4TKNA 2I5CA 3AJ4A 1DDMA 2G35A 1PLSA
chains in the Genus database with same CATH superfamily
4CHMA 5LONB 5JLJB 1EF1A 3PEGA 2KIGA 3TO1A 2R0DA 2W2XD 3KRWA 4DX90 4KHAA 1FB8A 2VSZA 2DFKA 5DIFB 4HB2B 4Z2NA 4TYZA 5C6RA 1Y5OA 2ROZB 1V61A 1DBHA 2LG1A 5D3XA 1I2HA 3HW2B 1SGHA 4HATB 1GC6A 1WJMA 3ULBA 5I2MA 1ZSQA 2RNRB 1FHOA 3HIEA 2Z4DA 1MKEA 4H8SA 1X1FA 1PMSA 3ODXA 1EAZA 1FOEA 2AEHA 5D3WA 5HE1A 3KY9A 2DX5A 4L6EA 4QJ5B 3LJUX 1OY2A 2YRYA 3HK0A 2ELAA 3ULCA 1X11A 2ZKMX 1T77A 3OHMB 2XQNM 1GC7A 2R2YA 4ZRJA 2BCJA 4F7UP 2YS3A 4WJ7A 1W1HA 4CSQA 4YONA 3CXBB 2GS0A 1ZM0A 2ROVA 1ZYIA 2DA0A 3D8DA 3AU4A 4HDQA 2D11A 1U5GA 2Z13A 3P6AA 5EFXA 1RJ2A 4GXBA 5FI1A 2NBVA 2J59M 1WVHA 3PVUA 1XR0B 2EMSA 4DX8A 4KHOA 4HHVA 4QXAB 1V89A 3MPXA 4GNKB 4KHBB 3QBVB 2RGNB 4GMXB 2P0DA 3A8PA 1MI1A 2R09A 5HE0A 2K00A 2N0YA 2RLOA 3BINA 1QQGA 2MFQA 2PZ1A 1FGZA 1XCGA 4HB3B 3NWAA 1N3HA 4KAXB 1TJ6A 3F5RA 4A5KA 3TFMA 1WJ1A 2V76A 1DDWA 1H10A 5C5BB 4HSIA 1KZGA 4IOYX 2I5FA 4HAZB 2MKRA 1FHXA 2K8EA 2DHIA 1V5MA 3GYOA 3NWFA 4DXAB 1XD4A 1P6SA 1WI1A 1X1GA 5C79A 4PNKA 1TXDA 4ZRKA 3VOQA 1WGUA 3SV1A 4B6HA 2AL6A 2Z14A 4GPTB 4F7GA 3TVVA 2RSGA 1EGXA 2D9YA 3B77A 2J0KA 1U27A 2IYBA 3V5WA 3ML4A 2YF0A 3G9WA 1WG7A 2EMTA 2M38A 3PVWA 3PSCA 4OSNA 2CY4A 3NW8A 4ZRIA 1KI1B 4WVFB 1AWEA 5CLQB 2DLWA 1SHCA 1W1GA 2D9XA 4CHJA 2CRFA 2LULA 3AU5A 2YT2A 1OMWA 2YVCA 5D27A 3A58A 2LOXA 3HSAA 2UZRA 5LG4B 2N23A 1U5DA 3PG7A 2W2WA 3OANA 3PP2A 2ADZA 4HAVB 4L1RA 3SUZA 2D2QA 4KVGB 1UNPA 4P7IA 4NY0A 2L1CA 1BTNA 1MIZB 2EC1A 2ZPYA 5GOWB 2H7DA 2L2IA 3HQCA 5JP4A 5J3TA 4IAPA 3ODWA 2YT0A 2Z59A 1GG3A 3SO6A 3A98B 1FHWA 1Z87A 1M7EA 1B55A 4K81A 1AQCA 5I2SA 4MY6A 3T06A 2NMBA 1UPRA 5IRSA 4A6FA 2VKIA 2Z0QA 3F0WA 3SYXA 1NTYA 2K49A 4MT7A 2JP2A 1XODA 3UZTA 2I1KA 2CAYA 1P3RA 4HAYB 4HB0B 1J0WA 3NSUA 2GCLA 4CYEA 2P8VA 2OQBA 3TW1A 3VIAA 1LW3A 4DIXA 2KCJA 1UPQA 2RRFA 1LB1A 4HAUB 2K2UA 1U5EA 1V5UA 2EJ8A 4XWXA 4BBKA 5JHGA 3X23A 1DYNA 1DDVA 4K2PA 4QJ4B 3SNHA 2COFA 1KZ7A 4YL8A 3DXDA 2Z0OA 4F7HA 2Z0PA 1X05A 3D8EA 3M1IB 5KQ4A 2LYDA 2DTCA 1QC6A 2DHJA 5HE2A 1UEFA 1XX0A 5DH9B 5J3QA 2I1JA 4NSWA 3ODOA 4GZUA 5CLLB 2D10A 1ISNA 2UVMA 1DROA 1ZC4B 2HE7A 5J3YA 5JHHA 4K2OA 1V5PA 2Y8GA 1XKEA 5HE3A 3PVLA 5DI9B 2D9VA 1MIXA 2OTXA 4D0NB 2HTHB 1MAIA 2E2XA 1W1DA 3FM8C 3DXCA 4GOUA 3KRXA 1PFJA 2YS1A 3ZDTA 1RRPB 3U12A 1BTKA 2DKPA 2KGXB 1Q67A 2RVBB 1FGYA 1Y19B 5C16A 5D3VA 2VRWB 4IFSA 1P5TA 2GCJA 5KQ1A 4K17A 1MK7B 3RCPA 2KIEA 3U8ZA 2J0MA 1WGQA 4EMOA 1K5DB 5KCVA 1BAKA 1K5GB 1ZC3B 4HAWB 5D3YA 4MK0A 3BJIA 1TQZA 2MWNB 2LKOA 4WSFA 1E5WA 3KSYA 1J19A 1UNRA 4A6KA 1UNQA 2YSZA 4OT1A 4Z2MB 1I7AA 1X86A 4QJ3B 3MDBC 1NTVA 4HB4B 1IRSA 2RUKB 1BWNA 1V88A 4GN1A 2ELBA 4HAXB 2UZSA 2FJUB 2D4QA 2GJYA 5DHFB 1U5FA 2D9WA 2P0HA 2M14A 4Y94A 2DHKA 3P7ZA 1NI2A 2Y7BA 2NZ8B 4EKUA 2KR0A 1H4RA 3QIJA 3FVCA 1NU2A 2CY5A 4KHBA 2COAA 2DKQA 2DYQA 1FAOA 1U2BA 4GMVA 4A6FB 3DXEA 2MDXA 3IVFA 2DYNA 5DHAB 2QKLA 3WYFB 4A6HA 4EJNA 3ZVRA 4D6WA 5C5BA 3A8QA 2QKMA 2GUMA 3DCXA 3NWDA 2Y8FA 4DBBA 5M4YB 2KUQA 3KZ1A 2H7EA 3FSSA 1MK9B 1MPHA 2D9ZA 3GYPA 3WA0A 2X18A 2LOZA 3CIKA 3QWMA 4HDOA 3O96A 4PQ0A 2DX1A 1M7RA 2K2JA 3PZDA 3TCAA 5LOPB 1U29A 2YT1A 2Q13A 2KUPA 3U7DA 4C0AA 3FEHA 2P0FA 5L81A 2DN6A 2J0JA 1ZVRA 2FJLA 2COCA 2W2XC 2YS5A 2CODA 5FI0A 2IFSA 1EVHA 3D8FA 3N7CA 1OQNA 4TKNA 2I5CA 3AJ4A 1DDMA 2G35A 1PLSA
chains in the Genus database with same CATH topology
4CHMA 5LONB 5JLJB 1EF1A 3PEGA 3TO1A 2R0DA 2W2XD 3KRWA 4DX90 4KHAA 1FB8A 2VSZA 2DFKA 5DIFB 4HB2B 4Z2NA 4TYZA 5C6RA 1Y5OA 2ROZB 1V61A 1DBHA 2LG1A 5D3XA 1I2HA 3HW2B 1SGHA 4HATB 1GC6A 1WJMA 3ULBA 1ZSQA 2RNRB 1FHOA 1MKEA 4H8SA 1X1FA 1PMSA 3ODXA 1EAZA 1FOEA 2AEHA 5D3WA 5HE1A 3KY9A 2DX5A 4L6EA 3LJUX 1OY2A 2YRYA 3HK0A 2ELAA 3ULCA 1X11A 2XQNM 1GC7A 4ZRJA 2BCJA 4F7UP 2YS3A 4WJ7A 1W1HA 4YONA 3CXBB 2GS0A 1ZM0A 2ROVA 2DA0A 3D8DA 3AU4A 4HDQA 2D11A 1U5GA 3P6AA 5EFXA 1RJ2A 4GXBA 5FI1A 2J59M 1WVHA 3PVUA 1XR0B 2EMSA 4DX8A 4KHOA 4HHVA 1V89A 3MPXA 4KHBB 3QBVB 2RGNB 4GMXB 2P0DA 3A8PA 2R09A 5HE0A 2K00A 2N0YA 2RLOA 3BINA 1QQGA 2MFQA 2PZ1A 1FGZA 1XCGA 4HB3B 1N3HA 4KAXB 1TJ6A 3F5RA 4A5KA 3TFMA 1WJ1A 2V76A 1DDWA 1H10A 5C5BB 1KZGA 4IOYX 2I5FA 4HAZB 2MKRA 1FHXA 2DHIA 1V5MA 3GYOA 4DXAB 1XD4A 1P6SA 1WI1A 1X1GA 5C79A 4PNKA 1TXDA 4ZRKA 3VOQA 1WGUA 3SV1A 4B6HA 2AL6A 4GPTB 4F7GA 3TVVA 2RSGA 1EGXA 2D9YA 2J0KA 1U27A 2IYBA 3V5WA 3ML4A 2YF0A 3G9WA 1WG7A 2EMTA 2M38A 3PVWA 3PSCA 4ZRIA 2CY4A 1KI1B 4WVFB 1AWEA 5CLQB 2DLWA 1SHCA 1W1GA 2D9XA 4CHJA 2CRFA 2LULA 3AU5A 1OMWA 2YVCA 5D27A 2LOXA 2UZRA 2N23A 1U5DA 3PG7A 2W2WA 3OANA 3PP2A 2ADZA 4HAVB 3SUZA 2D2QA 4KVGB 1UNPA 4P7IA 4NY0A 2L1CA 1BTNA 1MIZB 2EC1A 2ZPYA 5GOWB 2H7DA 2L2IA 3HQCA 5JP4A 5J3TA 4IAPA 3ODWA 2YT0A 1GG3A 3SO6A 3A98B 1FHWA 1Z87A 1M7EA 1B55A 4K81A 1AQCA 4MY6A 3T06A 2NMBA 1UPRA 4A6FA 2VKIA 2Z0QA 3F0WA 3SYXA 1NTYA 4MT7A 2JP2A 1XODA 3UZTA 2I1KA 2CAYA 1P3RA 4HAYB 4HB0B 1J0WA 3NSUA 2GCLA 4CYEA 2P8VA 2OQBA 3TW1A 3VIAA 1LW3A 2KCJA 1UPQA 1LB1A 4HAUB 2K2UA 1U5EA 1V5UA 2EJ8A 4XWXA 4BBKA 5JHGA 3X23A 1DYNA 1DDVA 4K2PA 3SNHA 2COFA 1KZ7A 4YL8A 3DXDA 2Z0OA 4F7HA 2Z0PA 1X05A 3D8EA 3M1IB 5KQ4A 2LYDA 2DTCA 1QC6A 2DHJA 5HE2A 1UEFA 1XX0A 5DH9B 5J3QA 2I1JA 4NSWA 3ODOA 4GZUA 5CLLB 2D10A 1ISNA 2UVMA 1DROA 1ZC4B 2HE7A 5J3YA 5JHHA 4K2OA 1V5PA 2Y8GA 1XKEA 5HE3A 3PVLA 5DI9B 2D9VA 1MIXA 2OTXA 4D0NB 2HTHB 1MAIA 2E2XA 1W1DA 3FM8C 3DXCA 3KRXA 1PFJA 2YS1A 3ZDTA 1RRPB 1BTKA 2DKPA 2KGXB 1Q67A 2RVBB 1FGYA 1Y19B 5C16A 5D3VA 2VRWB 4IFSA 1P5TA 2GCJA 5KQ1A 4K17A 1MK7B 3RCPA 3U8ZA 2J0MA 1WGQA 4EMOA 1K5DB 5KCVA 1BAKA 1K5GB 1ZC3B 4HAWB 5D3YA 4MK0A 3BJIA 1TQZA 2MWNB 2LKOA 4WSFA 1E5WA 3KSYA 1J19A 1UNRA 4A6KA 1UNQA 2YSZA 4Z2MB 1I7AA 1X86A 3MDBC 1NTVA 4HB4B 1IRSA 2RUKB 1BWNA 1V88A 4GN1A 2ELBA 4HAXB 2UZSA 2D4QA 2GJYA 5DHFB 1U5FA 2D9WA 2P0HA 2M14A 4Y94A 2DHKA 3P7ZA 1NI2A 2Y7BA 2NZ8B 4EKUA 1H4RA 3QIJA 1NU2A 2CY5A 2COAA 2DKQA 2DYQA 1FAOA 1U2BA 4GMVA 4A6FB 3DXEA 2MDXA 3IVFA 2DYNA 5DHAB 2QKLA 3WYFB 4A6HA 4EJNA 3ZVRA 5C5BA 3A8QA 2QKMA 2Y8FA 4DBBA 3KZ1A 2H7EA 3FSSA 1MK9B 1MPHA 2D9ZA 3GYPA 3WA0A 2X18A 2LOZA 3CIKA 3QWMA 4HDOA 3O96A 4PQ0A 2DX1A 1M7RA 2K2JA 3PZDA 3TCAA 5LOPB 1U29A 2YT1A 2Q13A 2KUPA 3U7DA 4C0AA 3FEHA 2P0FA 5L81A 2DN6A 2J0JA 1ZVRA 2FJLA 2COCA 2W2XC 2YS5A 2CODA 5FI0A 2IFSA 1EVHA 3D8FA 3N7CA 1OQNA 4TKNA 2I5CA 3AJ4A 1DDMA 2G35A 1PLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CHM A;  5LON B;  5JLJ B;  1EF1 A;  3PEG A;  3TO1 A;  2R0D A;  2W2X D;  3KRW A;  4DX9 0;  4KHA A;  1FB8 A;  2VSZ A;  2DFK A;  5DIF B;  4HB2 B;  4Z2N A;  4TYZ A;  5C6R A;  1Y5O A;  2ROZ B;  1V61 A;  1DBH A;  2LG1 A;  5D3X A;  1I2H A;  3HW2 B;  1SGH A;  4HAT B;  1GC6 A;  1WJM A;  3ULB A;  1ZSQ A;  2RNR B;  1FHO A;  1MKE A;  4H8S A;  1X1F A;  1PMS A;  3ODX A;  1EAZ A;  1FOE A;  2AEH A;  5D3W A;  5HE1 A;  3KY9 A;  2DX5 A;  4L6E A;  3LJU X;  1OY2 A;  2YRY A;  3HK0 A;  2ELA A;  3ULC A;  1X11 A;  2XQN M;  1GC7 A;  4ZRJ A;  2BCJ A;  4F7U P;  2YS3 A;  4WJ7 A;  1W1H A;  4YON A;  3CXB B;  2GS0 A;  1ZM0 A;  2ROV A;  2DA0 A;  3D8D A;  3AU4 A;  4HDQ A;  2D11 A;  1U5G A;  3P6A A;  5EFX A;  1RJ2 A;  4GXB A;  5FI1 A;  2J59 M;  1WVH A;  3PVU A;  1XR0 B;  2EMS A;  4DX8 A;  4KHO A;  4HHV A;  1V89 A;  3MPX A;  4KHB B;  3QBV B;  2RGN B;  4GMX B;  2P0D A;  3A8P A;  2R09 A;  5HE0 A;  2K00 A;  2N0Y A;  2RLO A;  3BIN A;  1QQG A;  2MFQ A;  2PZ1 A;  1FGZ A;  1XCG A;  4HB3 B;  1N3H A;  4KAX B;  1TJ6 A;  3F5R A;  4A5K A;  3TFM A;  1WJ1 A;  2V76 A;  1DDW A;  1H10 A;  5C5B B;  1KZG A;  4IOY X;  2I5F A;  4HAZ B;  2MKR A;  1FHX A;  2DHI A;  1V5M A;  3GYO A;  4DXA B;  1XD4 A;  1P6S A;  1WI1 A;  1X1G A;  5C79 A;  4PNK A;  1TXD A;  4ZRK A;  3VOQ A;  1WGU A;  3SV1 A;  4B6H A;  2AL6 A;  4GPT B;  4F7G A;  3TVV A;  2RSG A;  1EGX A;  2D9Y A;  2J0K A;  1U27 A;  2IYB A;  3V5W A;  3ML4 A;  2YF0 A;  3G9W A;  1WG7 A;  2EMT A;  2M38 A;  3PVW A;  3PSC A;  4ZRI A;  2CY4 A;  1KI1 B;  4WVF B;  1AWE A;  5CLQ B;  2DLW A;  1SHC A;  1W1G A;  2D9X A;  4CHJ A;  2CRF A;  2LUL A;  3AU5 A;  1OMW A;  2YVC A;  5D27 A;  2LOX A;  2UZR A;  2N23 A;  1U5D A;  3PG7 A;  2W2W A;  3OAN A;  3PP2 A;  2ADZ A;  4HAV B;  3SUZ A;  2D2Q A;  4KVG B;  1UNP A;  4P7I A;  4NY0 A;  2L1C A;  1BTN A;  1MIZ B;  2EC1 A;  2ZPY A;  5GOW B;  2H7D A;  2L2I A;  3HQC A;  5JP4 A;  5J3T A;  4IAP A;  3ODW A;  2YT0 A;  1GG3 A;  3SO6 A;  3A98 B;  1FHW A;  1Z87 A;  1M7E A;  1B55 A;  4K81 A;  1AQC A;  4MY6 A;  3T06 A;  2NMB A;  1UPR A;  4A6F A;  2VKI A;  2Z0Q A;  3F0W A;  3SYX A;  1NTY A;  4MT7 A;  2JP2 A;  1XOD A;  3UZT A;  2I1K A;  2CAY A;  1P3R A;  4HAY B;  4HB0 B;  1J0W A;  3NSU A;  2GCL A;  4CYE A;  2P8V A;  2OQB A;  3TW1 A;  3VIA A;  1LW3 A;  2KCJ A;  1UPQ A;  1LB1 A;  4HAU B;  2K2U A;  1U5E A;  1V5U A;  2EJ8 A;  4XWX A;  4BBK A;  5JHG A;  3X23 A;  1DYN A;  1DDV A;  4K2P A;  3SNH A;  2COF A;  1KZ7 A;  4YL8 A;  3DXD A;  2Z0O A;  4F7H A;  2Z0P A;  1X05 A;  3D8E A;  3M1I B;  5KQ4 A;  2LYD A;  2DTC A;  1QC6 A;  2DHJ A;  5HE2 A;  1UEF A;  1XX0 A;  5DH9 B;  5J3Q A;  2I1J A;  4NSW A;  3ODO A;  4GZU A;  5CLL B;  2D10 A;  1ISN A;  2UVM A;  1DRO A;  1ZC4 B;  2HE7 A;  5J3Y A;  5JHH A;  4K2O A;  1V5P A;  2Y8G A;  1XKE A;  5HE3 A;  3PVL A;  5DI9 B;  2D9V A;  1MIX A;  2OTX A;  4D0N B;  2HTH B;  1MAI A;  2E2X A;  1W1D A;  3FM8 C;  3DXC A;  3KRX A;  1PFJ A;  2YS1 A;  3ZDT A;  1RRP B;  1BTK A;  2DKP A;  2KGX B;  1Q67 A;  2RVB B;  1FGY A;  1Y19 B;  5C16 A;  5D3V A;  2VRW B;  4IFS A;  1P5T A;  2GCJ A;  5KQ1 A;  4K17 A;  1MK7 B;  3RCP A;  3U8Z A;  2J0M A;  1WGQ A;  4EMO A;  1K5D B;  5KCV A;  1BAK A;  1K5G B;  1ZC3 B;  4HAW B;  5D3Y A;  4MK0 A;  3BJI A;  1TQZ A;  2MWN B;  2LKO A;  4WSF A;  1E5W A;  3KSY A;  1J19 A;  1UNR A;  4A6K A;  1UNQ A;  2YSZ A;  4Z2M B;  1I7A A;  1X86 A;  3MDB C;  1NTV A;  4HB4 B;  1IRS A;  2RUK B;  1BWN A;  1V88 A;  4GN1 A;  2ELB A;  4HAX B;  2UZS A;  2D4Q A;  2GJY A;  5DHF B;  1U5F A;  2D9W A;  2P0H A;  2M14 A;  4Y94 A;  2DHK A;  3P7Z A;  1NI2 A;  2Y7B A;  2NZ8 B;  4EKU A;  1H4R A;  3QIJ A;  1NU2 A;  2CY5 A;  2COA A;  2DKQ A;  2DYQ A;  1FAO A;  1U2B A;  4GMV A;  4A6F B;  3DXE A;  2MDX A;  3IVF A;  2DYN A;  5DHA B;  2QKL A;  3WYF B;  4A6H A;  4EJN A;  3ZVR A;  5C5B A;  3A8Q A;  2QKM A;  2Y8F A;  4DBB A;  3KZ1 A;  2H7E A;  3FSS A;  1MK9 B;  1MPH A;  2D9Z A;  3GYP A;  3WA0 A;  2X18 A;  2LOZ A;  3CIK A;  3QWM A;  4HDO A;  3O96 A;  4PQ0 A;  2DX1 A;  1M7R A;  2K2J A;  3PZD A;  3TCA A;  5LOP B;  1U29 A;  2YT1 A;  2Q13 A;  2KUP A;  3U7D A;  4C0A A;  3FEH A;  2P0F A;  5L81 A;  2DN6 A;  2J0J A;  1ZVR A;  2FJL A;  2COC A;  2W2X C;  2YS5 A;  2COD A;  5FI0 A;  2IFS A;  1EVH A;  3D8F A;  3N7C A;  1OQN A;  4TKN A;  2I5C A;  3AJ4 A;  1DDM A;  2G35 A;  1PLS A; 
#chains in the Genus database with same CATH topology
 4CHM A;  5LON B;  5JLJ B;  1EF1 A;  3PEG A;  2KIG A;  3TO1 A;  2R0D A;  2W2X D;  3KRW A;  4DX9 0;  4KHA A;  1FB8 A;  2VSZ A;  2DFK A;  5DIF B;  4HB2 B;  4Z2N A;  4TYZ A;  5C6R A;  1Y5O A;  2ROZ B;  1V61 A;  1DBH A;  2LG1 A;  5D3X A;  1I2H A;  3HW2 B;  1SGH A;  4HAT B;  1GC6 A;  1WJM A;  3ULB A;  5I2M A;  1ZSQ A;  2RNR B;  1FHO A;  3HIE A;  2Z4D A;  1MKE A;  4H8S A;  1X1F A;  1PMS A;  3ODX A;  1EAZ A;  1FOE A;  2AEH A;  5D3W A;  5HE1 A;  3KY9 A;  2DX5 A;  4L6E A;  4QJ5 B;  3LJU X;  1OY2 A;  2YRY A;  3HK0 A;  2ELA A;  3ULC A;  1X11 A;  2ZKM X;  1T77 A;  3OHM B;  2XQN M;  1GC7 A;  2R2Y A;  4ZRJ A;  2BCJ A;  4F7U P;  2YS3 A;  4WJ7 A;  1W1H A;  4CSQ A;  4YON A;  3CXB B;  2GS0 A;  1ZM0 A;  2ROV A;  1ZYI A;  2DA0 A;  3D8D A;  3AU4 A;  4HDQ A;  2D11 A;  1U5G A;  2Z13 A;  3P6A A;  5EFX A;  1RJ2 A;  4GXB A;  5FI1 A;  2NBV A;  2J59 M;  1WVH A;  3PVU A;  1XR0 B;  2EMS A;  4DX8 A;  4KHO A;  4HHV A;  4QXA B;  1V89 A;  3MPX A;  4GNK B;  4KHB B;  3QBV B;  2RGN B;  4GMX B;  2P0D A;  3A8P A;  1MI1 A;  2R09 A;  5HE0 A;  2K00 A;  2N0Y A;  2RLO A;  3BIN A;  1QQG A;  2MFQ A;  2PZ1 A;  1FGZ A;  1XCG A;  4HB3 B;  3NWA A;  1N3H A;  4KAX B;  1TJ6 A;  3F5R A;  4A5K A;  3TFM A;  1WJ1 A;  2V76 A;  1DDW A;  1H10 A;  5C5B B;  4HSI A;  1KZG A;  4IOY X;  2I5F A;  4HAZ B;  2MKR A;  1FHX A;  2K8E A;  2DHI A;  1V5M A;  3GYO A;  3NWF A;  4DXA B;  1XD4 A;  1P6S A;  1WI1 A;  1X1G A;  5C79 A;  4PNK A;  1TXD A;  4ZRK A;  3VOQ A;  1WGU A;  3SV1 A;  4B6H A;  2AL6 A;  2Z14 A;  4GPT B;  4F7G A;  3TVV A;  2RSG A;  1EGX A;  2D9Y A;  3B77 A;  2J0K A;  1U27 A;  2IYB A;  3V5W A;  3ML4 A;  2YF0 A;  3G9W A;  1WG7 A;  2EMT A;  2M38 A;  3PVW A;  3PSC A;  4OSN A;  2CY4 A;  3NW8 A;  4ZRI A;  1KI1 B;  4WVF B;  1AWE A;  5CLQ B;  2DLW A;  1SHC A;  1W1G A;  2D9X A;  4CHJ A;  2CRF A;  2LUL A;  3AU5 A;  2YT2 A;  1OMW A;  2YVC A;  5D27 A;  3A58 A;  2LOX A;  3HSA A;  2UZR A;  5LG4 B;  2N23 A;  1U5D A;  3PG7 A;  2W2W A;  3OAN A;  3PP2 A;  2ADZ A;  4HAV B;  4L1R A;  3SUZ A;  2D2Q A;  4KVG B;  1UNP A;  4P7I A;  4NY0 A;  2L1C A;  1BTN A;  1MIZ B;  2EC1 A;  2ZPY A;  5GOW B;  2H7D A;  2L2I A;  3HQC A;  5JP4 A;  5J3T A;  4IAP A;  3ODW A;  2YT0 A;  2Z59 A;  1GG3 A;  3SO6 A;  3A98 B;  1FHW A;  1Z87 A;  1M7E A;  1B55 A;  4K81 A;  1AQC A;  5I2S A;  4MY6 A;  3T06 A;  2NMB A;  1UPR A;  5IRS A;  4A6F A;  2VKI A;  2Z0Q A;  3F0W A;  3SYX A;  1NTY A;  2K49 A;  4MT7 A;  2JP2 A;  1XOD A;  3UZT A;  2I1K A;  2CAY A;  1P3R A;  4HAY B;  4HB0 B;  1J0W A;  3NSU A;  2GCL A;  4CYE A;  2P8V A;  2OQB A;  3TW1 A;  3VIA A;  1LW3 A;  4DIX A;  2KCJ A;  1UPQ A;  2RRF A;  1LB1 A;  4HAU B;  2K2U A;  1U5E A;  1V5U A;  2EJ8 A;  4XWX A;  4BBK A;  5JHG A;  3X23 A;  1DYN A;  1DDV A;  4K2P A;  4QJ4 B;  3SNH A;  2COF A;  1KZ7 A;  4YL8 A;  3DXD A;  2Z0O A;  4F7H A;  2Z0P A;  1X05 A;  3D8E A;  3M1I B;  5KQ4 A;  2LYD A;  2DTC A;  1QC6 A;  2DHJ A;  5HE2 A;  1UEF A;  1XX0 A;  5DH9 B;  5J3Q A;  2I1J A;  4NSW A;  3ODO A;  4GZU A;  5CLL B;  2D10 A;  1ISN A;  2UVM A;  1DRO A;  1ZC4 B;  2HE7 A;  5J3Y A;  5JHH A;  4K2O A;  1V5P A;  2Y8G A;  1XKE A;  5HE3 A;  3PVL A;  5DI9 B;  2D9V A;  1MIX A;  2OTX A;  4D0N B;  2HTH B;  1MAI A;  2E2X A;  1W1D A;  3FM8 C;  3DXC A;  4GOU A;  3KRX A;  1PFJ A;  2YS1 A;  3ZDT A;  1RRP B;  3U12 A;  1BTK A;  2DKP A;  2KGX B;  1Q67 A;  2RVB B;  1FGY A;  1Y19 B;  5C16 A;  5D3V A;  2VRW B;  4IFS A;  1P5T A;  2GCJ A;  5KQ1 A;  4K17 A;  1MK7 B;  3RCP A;  2KIE A;  3U8Z A;  2J0M A;  1WGQ A;  4EMO A;  1K5D B;  5KCV A;  1BAK A;  1K5G B;  1ZC3 B;  4HAW B;  5D3Y A;  4MK0 A;  3BJI A;  1TQZ A;  2MWN B;  2LKO A;  4WSF A;  1E5W A;  3KSY A;  1J19 A;  1UNR A;  4A6K A;  1UNQ A;  2YSZ A;  4OT1 A;  4Z2M B;  1I7A A;  1X86 A;  4QJ3 B;  3MDB C;  1NTV A;  4HB4 B;  1IRS A;  2RUK B;  1BWN A;  1V88 A;  4GN1 A;  2ELB A;  4HAX B;  2UZS A;  2FJU B;  2D4Q A;  2GJY A;  5DHF B;  1U5F A;  2D9W A;  2P0H A;  2M14 A;  4Y94 A;  2DHK A;  3P7Z A;  1NI2 A;  2Y7B A;  2NZ8 B;  4EKU A;  2KR0 A;  1H4R A;  3QIJ A;  3FVC A;  1NU2 A;  2CY5 A;  4KHB A;  2COA A;  2DKQ A;  2DYQ A;  1FAO A;  1U2B A;  4GMV A;  4A6F B;  3DXE A;  2MDX A;  3IVF A;  2DYN A;  5DHA B;  2QKL A;  3WYF B;  4A6H A;  4EJN A;  3ZVR A;  4D6W A;  5C5B A;  3A8Q A;  2QKM A;  2GUM A;  3DCX A;  3NWD A;  2Y8F A;  4DBB A;  5M4Y B;  2KUQ A;  3KZ1 A;  2H7E A;  3FSS A;  1MK9 B;  1MPH A;  2D9Z A;  3GYP A;  3WA0 A;  2X18 A;  2LOZ A;  3CIK A;  3QWM A;  4HDO A;  3O96 A;  4PQ0 A;  2DX1 A;  1M7R A;  2K2J A;  3PZD A;  3TCA A;  5LOP B;  1U29 A;  2YT1 A;  2Q13 A;  2KUP A;  3U7D A;  4C0A A;  3FEH A;  2P0F A;  5L81 A;  2DN6 A;  2J0J A;  1ZVR A;  2FJL A;  2COC A;  2W2X C;  2YS5 A;  2COD A;  5FI0 A;  2IFS A;  1EVH A;  3D8F A;  3N7C A;  1OQN A;  4TKN A;  2I5C A;  3AJ4 A;  1DDM A;  2G35 A;  1PLS A; 
#chains in the Genus database with same CATH homology
 4CHM A;  5LON B;  5JLJ B;  1EF1 A;  3PEG A;  3TO1 A;  2R0D A;  2W2X D;  3KRW A;  4DX9 0;  4KHA A;  1FB8 A;  2VSZ A;  2DFK A;  5DIF B;  4HB2 B;  4Z2N A;  4TYZ A;  5C6R A;  1Y5O A;  2ROZ B;  1V61 A;  1DBH A;  2LG1 A;  5D3X A;  1I2H A;  3HW2 B;  1SGH A;  4HAT B;  1GC6 A;  1WJM A;  3ULB A;  1ZSQ A;  2RNR B;  1FHO A;  1MKE A;  4H8S A;  1X1F A;  1PMS A;  3ODX A;  1EAZ A;  1FOE A;  2AEH A;  5D3W A;  5HE1 A;  3KY9 A;  2DX5 A;  4L6E A;  3LJU X;  1OY2 A;  2YRY A;  3HK0 A;  2ELA A;  3ULC A;  1X11 A;  2XQN M;  1GC7 A;  4ZRJ A;  2BCJ A;  4F7U P;  2YS3 A;  4WJ7 A;  1W1H A;  4YON A;  3CXB B;  2GS0 A;  1ZM0 A;  2ROV A;  2DA0 A;  3D8D A;  3AU4 A;  4HDQ A;  2D11 A;  1U5G A;  3P6A A;  5EFX A;  1RJ2 A;  4GXB A;  5FI1 A;  2J59 M;  1WVH A;  3PVU A;  1XR0 B;  2EMS A;  4DX8 A;  4KHO A;  4HHV A;  1V89 A;  3MPX A;  4KHB B;  3QBV B;  2RGN B;  4GMX B;  2P0D A;  3A8P A;  2R09 A;  5HE0 A;  2K00 A;  2N0Y A;  2RLO A;  3BIN A;  1QQG A;  2MFQ A;  2PZ1 A;  1FGZ A;  1XCG A;  4HB3 B;  1N3H A;  4KAX B;  1TJ6 A;  3F5R A;  4A5K A;  3TFM A;  1WJ1 A;  2V76 A;  1DDW A;  1H10 A;  5C5B B;  1KZG A;  4IOY X;  2I5F A;  4HAZ B;  2MKR A;  1FHX A;  2DHI A;  1V5M A;  3GYO A;  4DXA B;  1XD4 A;  1P6S A;  1WI1 A;  1X1G A;  5C79 A;  4PNK A;  1TXD A;  4ZRK A;  3VOQ A;  1WGU A;  3SV1 A;  4B6H A;  2AL6 A;  4GPT B;  4F7G A;  3TVV A;  2RSG A;  1EGX A;  2D9Y A;  2J0K A;  1U27 A;  2IYB A;  3V5W A;  3ML4 A;  2YF0 A;  3G9W A;  1WG7 A;  2EMT A;  2M38 A;  3PVW A;  3PSC A;  4ZRI A;  2CY4 A;  1KI1 B;  4WVF B;  1AWE A;  5CLQ B;  2DLW A;  1SHC A;  1W1G A;  2D9X A;  4CHJ A;  2CRF A;  2LUL A;  3AU5 A;  1OMW A;  2YVC A;  5D27 A;  2LOX A;  2UZR A;  2N23 A;  1U5D A;  3PG7 A;  2W2W A;  3OAN A;  3PP2 A;  2ADZ A;  4HAV B;  3SUZ A;  2D2Q A;  4KVG B;  1UNP A;  4P7I A;  4NY0 A;  2L1C A;  1BTN A;  1MIZ B;  2EC1 A;  2ZPY A;  5GOW B;  2H7D A;  2L2I A;  3HQC A;  5JP4 A;  5J3T A;  4IAP A;  3ODW A;  2YT0 A;  1GG3 A;  3SO6 A;  3A98 B;  1FHW A;  1Z87 A;  1M7E A;  1B55 A;  4K81 A;  1AQC A;  4MY6 A;  3T06 A;  2NMB A;  1UPR A;  4A6F A;  2VKI A;  2Z0Q A;  3F0W A;  3SYX A;  1NTY A;  4MT7 A;  2JP2 A;  1XOD A;  3UZT A;  2I1K A;  2CAY A;  1P3R A;  4HAY B;  4HB0 B;  1J0W A;  3NSU A;  2GCL A;  4CYE A;  2P8V A;  2OQB A;  3TW1 A;  3VIA A;  1LW3 A;  2KCJ A;  1UPQ A;  1LB1 A;  4HAU B;  2K2U A;  1U5E A;  1V5U A;  2EJ8 A;  4XWX A;  4BBK A;  5JHG A;  3X23 A;  1DYN A;  1DDV A;  4K2P A;  3SNH A;  2COF A;  1KZ7 A;  4YL8 A;  3DXD A;  2Z0O A;  4F7H A;  2Z0P A;  1X05 A;  3D8E A;  3M1I B;  5KQ4 A;  2LYD A;  2DTC A;  1QC6 A;  2DHJ A;  5HE2 A;  1UEF A;  1XX0 A;  5DH9 B;  5J3Q A;  2I1J A;  4NSW A;  3ODO A;  4GZU A;  5CLL B;  2D10 A;  1ISN A;  2UVM A;  1DRO A;  1ZC4 B;  2HE7 A;  5J3Y A;  5JHH A;  4K2O A;  1V5P A;  2Y8G A;  1XKE A;  5HE3 A;  3PVL A;  5DI9 B;  2D9V A;  1MIX A;  2OTX A;  4D0N B;  2HTH B;  1MAI A;  2E2X A;  1W1D A;  3FM8 C;  3DXC A;  3KRX A;  1PFJ A;  2YS1 A;  3ZDT A;  1RRP B;  1BTK A;  2DKP A;  2KGX B;  1Q67 A;  2RVB B;  1FGY A;  1Y19 B;  5C16 A;  5D3V A;  2VRW B;  4IFS A;  1P5T A;  2GCJ A;  5KQ1 A;  4K17 A;  1MK7 B;  3RCP A;  3U8Z A;  2J0M A;  1WGQ A;  4EMO A;  1K5D B;  5KCV A;  1BAK A;  1K5G B;  1ZC3 B;  4HAW B;  5D3Y A;  4MK0 A;  3BJI A;  1TQZ A;  2MWN B;  2LKO A;  4WSF A;  1E5W A;  3KSY A;  1J19 A;  1UNR A;  4A6K A;  1UNQ A;  2YSZ A;  4Z2M B;  1I7A A;  1X86 A;  3MDB C;  1NTV A;  4HB4 B;  1IRS A;  2RUK B;  1BWN A;  1V88 A;  4GN1 A;  2ELB A;  4HAX B;  2UZS A;  2D4Q A;  2GJY A;  5DHF B;  1U5F A;  2D9W A;  2P0H A;  2M14 A;  4Y94 A;  2DHK A;  3P7Z A;  1NI2 A;  2Y7B A;  2NZ8 B;  4EKU A;  1H4R A;  3QIJ A;  1NU2 A;  2CY5 A;  2COA A;  2DKQ A;  2DYQ A;  1FAO A;  1U2B A;  4GMV A;  4A6F B;  3DXE A;  2MDX A;  3IVF A;  2DYN A;  5DHA B;  2QKL A;  3WYF B;  4A6H A;  4EJN A;  3ZVR A;  5C5B A;  3A8Q A;  2QKM A;  2Y8F A;  4DBB A;  3KZ1 A;  2H7E A;  3FSS A;  1MK9 B;  1MPH A;  2D9Z A;  3GYP A;  3WA0 A;  2X18 A;  2LOZ A;  3CIK A;  3QWM A;  4HDO A;  3O96 A;  4PQ0 A;  2DX1 A;  1M7R A;  2K2J A;  3PZD A;  3TCA A;  5LOP B;  1U29 A;  2YT1 A;  2Q13 A;  2KUP A;  3U7D A;  4C0A A;  3FEH A;  2P0F A;  5L81 A;  2DN6 A;  2J0J A;  1ZVR A;  2FJL A;  2COC A;  2W2X C;  2YS5 A;  2COD A;  5FI0 A;  2IFS A;  1EVH A;  3D8F A;  3N7C A;  1OQN A;  4TKN A;  2I5C A;  3AJ4 A;  1DDM A;  2G35 A;  1PLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...