2KUQA

Solution structure of the chimera of the ptb domain of snt-2 and 19-residue peptide (aa 1571-1589) of halk
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
153
structure length
153
Chain Sequence
b'GSSGSSGLNRDSVPDNHPTKFKVTNVDDEGVELGSGVMELTQSELVLHLHRREAVRWPYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCSRAEEIFNLLQDLMQCNSINVMEEPVIITSGSSGSSGSSGSSGLFRLRHFPCGNVNYGYQQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibroblast growth factor receptor substrate 3, LINKER, 19-re
publication title Structural basis for the recognition of nucleophosmin-anaplastic lymphoma kinase oncoprotein by the phosphotyrosine binding domain of Suc1-associated neurotrophic factor-induced tyrosine-phosphorylated target-2
pubmed doi rcsb
source organism Homo sapiens, synthetic, synthetic
molecule tags Signaling protein
total genus 27
structure length 153
sequence length 153
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02174 IRS PTB domain (IRS-1 type)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.250 Mainly Beta Roll PH-domain like PH-domain like 2kuqA00
2YT2A 2KUQA
chains in the Genus database with same CATH superfamily
4WJ7A 4Y94A 2CRFA 2GUMA 2H7EA 2EJ8A 4A5KA 1ZSQA 1U5EA 4GMVA 3SV1A 1W1DA 4HB4B 3P6AA 4L6EA 1X05A 1EF1A 4MK0A 4WSFA 2NZ8B 2Z4DA 3TFMA 1MIZB 4EMOA 3OANA 1V89A 2FJUB 2YS3A 1LW3A 3HW2B 2RRFA 4MT7A 1SGHA 4QJ3B 2YT0A 5I2MA 1MKEA 4D6WA 2DTCA 1AWEA 2R2YA 1X1FA 5DHAB 5DI9B 5FI0A 1AQCA 5I2SA 4K2OA 1ZVRA 3TCAA 3F0WA 1WI1A 2P8VA 2ZPYA 2KUQA 2DLWA 1X11A 4A6FA 1E5WA 4ZRIA 2LYDA 2CODA 1FAOA 4H8SA 4DX8A 2W2XD 3A98B 2X18A 3TO1A 2P0HA 5HE3A 1WG7A 4L1RA 3DCXA 2YS1A 3T06A 1W1HA 3HSAA 1XD4A 1TXDA 2ADZA 2IFSA 1BWNA 2EMSA 2UZSA 2Y8GA 3NWDA 4IFSA 2Y7BA 2KIGA 3M1IB 3BJIA 1FHOA 4GPTB 4NY0A 2QKMA 4DIXA 1U29A 3ULBA 5M4YB 1MK9B 5C79A 1MAIA 1ZM0A 4HAVB 4KHBA 3X23A 3PSCA 5KCVA 5IRSA 2DA0A 2YT2A 3N7CA 3KSYA 4BBKA 4TYZA 4KHBB 1OQNA 1FGZA 2J59M 1UNPA 3CIKA 3FM8C 2ELAA 2MKRA 2YSZA 4CYEA 1MIXA 1U5GA 1EAZA 1H10A 2LULA 1M7RA 1WJMA 1U2BA 3DXDA 4KAXB 1M7EA 3OHMB 2Z14A 5LG4B 2MWNB 2Y8FA 3SUZA 3ULCA 3FEHA 3NWAA 3VIAA 3RCPA 2COFA 2VRWB 2QKLA 1QC6A 1FOEA 1Y5OA 1I7AA 1BTNA 5DHFB 5HE0A 1Y19B 4HB0B 2Z59A 1DDVA 2J0MA 2RGNB 5C6RA 3MPXA 4KHAA 4HB3B 4HAUB 3V5WA 4A6KA 4PQ0A 2UZRA 3NSUA 5J3QA 2Z13A 1Q67A 2MFQA 2K8EA 4TKNA 2W2WA 2R09A 3U8ZA 3GYOA 3QWMA 4XWXA 4HAWB 5LOPB 2DHIA 2YS5A 2HTHB 1FB8A 5D3XA 1UPQA 2DHJA 4YL8A 2K2JA 4HDQA 4EJNA 2R0DA 4F7UP 4HATB 3A8QA 5FI1A 1NU2A 4HAYB 3VOQA 2DKPA 3ZVRA 2EMTA 1DBHA 2ZKMX 4QJ4B 2MDXA 2E2XA 2RVBB 4ZRKA 1GC6A 3QBVB 4B6HA 4Z2NA 1U27A 2Z0QA 3PVWA 5CLQB 1KI1B 2YVCA 2ROZB 1NTVA 4A6FB 2DFKA 1ISNA 1Z87A 3WA0A 2BCJA 5JLJB 2P0FA 2D9VA 4A6HA 1DDMA 1V5MA 2YF0A 4EKUA 1GC7A 2OTXA 4KVGB 2N23A 1MPHA 4OT1A 5DIFB 3CXBB 5L81A 5D3WA 2JP2A 2XQNM 2KCJA 4IOYX 2D9WA 5D3VA 2IYBA 3TVVA 4CSQA 5JHGA 3PG7A 2RUKB 4DX90 2L1CA 4Z2MB 3U12A 5KQ4A 3D8DA 3SYXA 1KZ7A 3FSSA 3HIEA 3O96A 1MK7B 1J19A 2D11A 4GOUA 3BINA 1XX0A 1WJ1A 2LG1A 3F5RA 3HK0A 5HE1A 1N3HA 5JHHA 3P7ZA 1UPRA 4OSNA 3DXEA 1KZGA 1RRPB 2HE7A 1BAKA 5DH9B 5J3YA 2KR0A 1P3RA 3HQCA 3ML4A 5CLLB 2AEHA 3KZ1A 1PMSA 2M14A 4F7HA 4D0NB 3KY9A 1DYNA 2OQBA 4NSWA 2H7DA 4GXBA 1B55A 4IAPA 2I1JA 2NBVA 1X86A 2CY5A 1UNRA 1IRSA 2DYQA 3TW1A 2KGXB 2RLOA 2YT1A 3D8FA 2GCLA 1LB1A 3ODWA 2I5FA 3A58A 4HHVA 4K17A 2ROVA 2Q13A 5GOWB 2P0DA 1FHWA 3DXCA 2N0YA 1H4RA 4GMXB 2KIEA 2Z0OA 3U7DA 4YONA 1V61A 1WGQA 4WVFB 1NTYA 3PVUA 1WVHA 2VSZA 2J0JA 1J0WA 3PVLA 1UEFA 3AU4A 4P7IA 5C16A 1K5DB 1V5PA 4F7GA 1SHCA 4HAZB 5KQ1A 3B77A 3NWFA 1UNQA 1XCGA 4ZRJA 2KUPA 3KRXA 4PNKA 1EGXA 2Z0PA 3SNHA 3PEGA 1NI2A 1XODA 2D2QA 2GS0A 3WYFB 1PFJA 2RNRB 1I2HA 2L2IA 1K5GB 5HE2A 2RSGA 1TQZA 2NMBA 2D9XA 3D8EA 2M38A 5JP4A 2AL6A 2D9YA 1W1GA 2DX5A 3A8PA 1ZC4B 2LOZA 4HAXB 3KRWA 3ODOA 1FGYA 1OMWA 2DHKA 3UZTA 2K00A 3QIJA 1QQGA 2V76A 3IVFA 1EVHA 3SO6A 1BTKA 2CY4A 4QXAB 2DKQA 3FVCA 2W2XC 5D3YA 2COCA 4KHOA 1GG3A 3GYPA 2COAA 1DDWA 4QJ5B 3AU5A 5EFXA 1TJ6A 2D10A 5J3TA 4K2PA 1X1GA 2VKIA 2DN6A 2J0KA 1OY2A 1P5TA 3G9WA 4HB2B 4C0AA 5LONB 1T77A 4DBBA 3ZDTA 1XKEA 2DYNA 5C5BA 3MDBC 5D27A 2FJLA 1U5DA 4DXAB 2UVMA 1WGUA 5C5BB 1XR0B 4HSIA 4GZUA 1P6SA 2ELBA 3PZDA 2G35A 2GJYA 3NW8A 2K2UA 1PLSA 2K49A 4K81A 2LKOA 2LOXA 3ODXA 2I5CA 4GNKB 2CAYA 2DX1A 1ZYIA 3PP2A 4CHJA 2D9ZA 1ZC3B 3LJUX 2PZ1A 2EC1A 2I1KA 1V88A 4CHMA 2GCJA 3AJ4A 1FHXA 2YRYA 1RJ2A 1U5FA 1DROA 4MY6A 4GN1A 4HDOA 1V5UA 2D4QA 1MI1A
chains in the Genus database with same CATH topology
2GCLA 4OSNA 3TVVA 4CSQA 2K49A 4PQ0A 2GUMA 4D6WA 3OHMB 2Z14A 2Z13A 4Z2MB 3U12A 5LG4B 4GNKB 2KR0A 2R2YA 3TO1A 4QXAB 1ZYIA 3FSSA 3FVCA 3A58A 4L1RA 4KHBA 3NWAA 2Z4DA 5I2SA 4KHOA 2ZKMX 2K8EA 3HIEA 4QJ4B 5M4YB 5IRSA 2YT2A 4KHBB 3GYPA 3GYOA 3NWDA 4Z2NA 2KUQA 4IFSA 2KIGA 2GCJA 2NBVA 3NWFA 2FJUB 4GOUA 4OT1A 4QJ5B 2Z59A 2RRFA 4HSIA 4DIXA 3TW1A 4QJ3B 5I2MA 2KIEA 4IOYX 3NW8A 4KHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YT2 A;  2KUQ A; 
#chains in the Genus database with same CATH topology
 4WJ7 A;  4Y94 A;  2CRF A;  2GUM A;  2H7E A;  2EJ8 A;  4A5K A;  1ZSQ A;  1U5E A;  4GMV A;  3SV1 A;  1W1D A;  4HB4 B;  3P6A A;  4L6E A;  1X05 A;  1EF1 A;  4MK0 A;  4WSF A;  2NZ8 B;  2Z4D A;  3TFM A;  1MIZ B;  4EMO A;  3OAN A;  1V89 A;  2FJU B;  2YS3 A;  1LW3 A;  3HW2 B;  2RRF A;  4MT7 A;  1SGH A;  4QJ3 B;  2YT0 A;  5I2M A;  1MKE A;  4D6W A;  2DTC A;  1AWE A;  2R2Y A;  1X1F A;  5DHA B;  5DI9 B;  5FI0 A;  1AQC A;  5I2S A;  4K2O A;  1ZVR A;  3TCA A;  3F0W A;  1WI1 A;  2P8V A;  2ZPY A;  2KUQ A;  2DLW A;  1X11 A;  4A6F A;  1E5W A;  4ZRI A;  2LYD A;  2COD A;  1FAO A;  4H8S A;  4DX8 A;  2W2X D;  3A98 B;  2X18 A;  3TO1 A;  2P0H A;  5HE3 A;  1WG7 A;  4L1R A;  3DCX A;  2YS1 A;  3T06 A;  1W1H A;  3HSA A;  1XD4 A;  1TXD A;  2ADZ A;  2IFS A;  1BWN A;  2EMS A;  2UZS A;  2Y8G A;  3NWD A;  4IFS A;  2Y7B A;  2KIG A;  3M1I B;  3BJI A;  1FHO A;  4GPT B;  4NY0 A;  2QKM A;  4DIX A;  1U29 A;  3ULB A;  5M4Y B;  1MK9 B;  5C79 A;  1MAI A;  1ZM0 A;  4HAV B;  4KHB A;  3X23 A;  3PSC A;  5KCV A;  5IRS A;  2DA0 A;  2YT2 A;  3N7C A;  3KSY A;  4BBK A;  4TYZ A;  4KHB B;  1OQN A;  1FGZ A;  2J59 M;  1UNP A;  3CIK A;  3FM8 C;  2ELA A;  2MKR A;  2YSZ A;  4CYE A;  1MIX A;  1U5G A;  1EAZ A;  1H10 A;  2LUL A;  1M7R A;  1WJM A;  1U2B A;  3DXD A;  4KAX B;  1M7E A;  3OHM B;  2Z14 A;  5LG4 B;  2MWN B;  2Y8F A;  3SUZ A;  3ULC A;  3FEH A;  3NWA A;  3VIA A;  3RCP A;  2COF A;  2VRW B;  2QKL A;  1QC6 A;  1FOE A;  1Y5O A;  1I7A A;  1BTN A;  5DHF B;  5HE0 A;  1Y19 B;  4HB0 B;  2Z59 A;  1DDV A;  2J0M A;  2RGN B;  5C6R A;  3MPX A;  4KHA A;  4HB3 B;  4HAU B;  3V5W A;  4A6K A;  4PQ0 A;  2UZR A;  3NSU A;  5J3Q A;  2Z13 A;  1Q67 A;  2MFQ A;  2K8E A;  4TKN A;  2W2W A;  2R09 A;  3U8Z A;  3GYO A;  3QWM A;  4XWX A;  4HAW B;  5LOP B;  2DHI A;  2YS5 A;  2HTH B;  1FB8 A;  5D3X A;  1UPQ A;  2DHJ A;  4YL8 A;  2K2J A;  4HDQ A;  4EJN A;  2R0D A;  4F7U P;  4HAT B;  3A8Q A;  5FI1 A;  1NU2 A;  4HAY B;  3VOQ A;  2DKP A;  3ZVR A;  2EMT A;  1DBH A;  2ZKM X;  4QJ4 B;  2MDX A;  2E2X A;  2RVB B;  4ZRK A;  1GC6 A;  3QBV B;  4B6H A;  4Z2N A;  1U27 A;  2Z0Q A;  3PVW A;  5CLQ B;  1KI1 B;  2YVC A;  2ROZ B;  1NTV A;  4A6F B;  2DFK A;  1ISN A;  1Z87 A;  3WA0 A;  2BCJ A;  5JLJ B;  2P0F A;  2D9V A;  4A6H A;  1DDM A;  1V5M A;  2YF0 A;  4EKU A;  1GC7 A;  2OTX A;  4KVG B;  2N23 A;  1MPH A;  4OT1 A;  5DIF B;  3CXB B;  5L81 A;  5D3W A;  2JP2 A;  2XQN M;  2KCJ A;  4IOY X;  2D9W A;  5D3V A;  2IYB A;  3TVV A;  4CSQ A;  5JHG A;  3PG7 A;  2RUK B;  4DX9 0;  2L1C A;  4Z2M B;  3U12 A;  5KQ4 A;  3D8D A;  3SYX A;  1KZ7 A;  3FSS A;  3HIE A;  3O96 A;  1MK7 B;  1J19 A;  2D11 A;  4GOU A;  3BIN A;  1XX0 A;  1WJ1 A;  2LG1 A;  3F5R A;  3HK0 A;  5HE1 A;  1N3H A;  5JHH A;  3P7Z A;  1UPR A;  4OSN A;  3DXE A;  1KZG A;  1RRP B;  2HE7 A;  1BAK A;  5DH9 B;  5J3Y A;  2KR0 A;  1P3R A;  3HQC A;  3ML4 A;  5CLL B;  2AEH A;  3KZ1 A;  1PMS A;  2M14 A;  4F7H A;  4D0N B;  3KY9 A;  1DYN A;  2OQB A;  4NSW A;  2H7D A;  4GXB A;  1B55 A;  4IAP A;  2I1J A;  2NBV A;  1X86 A;  2CY5 A;  1UNR A;  1IRS A;  2DYQ A;  3TW1 A;  2KGX B;  2RLO A;  2YT1 A;  3D8F A;  2GCL A;  1LB1 A;  3ODW A;  2I5F A;  3A58 A;  4HHV A;  4K17 A;  2ROV A;  2Q13 A;  5GOW B;  2P0D A;  1FHW A;  3DXC A;  2N0Y A;  1H4R A;  4GMX B;  2KIE A;  2Z0O A;  3U7D A;  4YON A;  1V61 A;  1WGQ A;  4WVF B;  1NTY A;  3PVU A;  1WVH A;  2VSZ A;  2J0J A;  1J0W A;  3PVL A;  1UEF A;  3AU4 A;  4P7I A;  5C16 A;  1K5D B;  1V5P A;  4F7G A;  1SHC A;  4HAZ B;  5KQ1 A;  3B77 A;  3NWF A;  1UNQ A;  1XCG A;  4ZRJ A;  2KUP A;  3KRX A;  4PNK A;  1EGX A;  2Z0P A;  3SNH A;  3PEG A;  1NI2 A;  1XOD A;  2D2Q A;  2GS0 A;  3WYF B;  1PFJ A;  2RNR B;  1I2H A;  2L2I A;  1K5G B;  5HE2 A;  2RSG A;  1TQZ A;  2NMB A;  2D9X A;  3D8E A;  2M38 A;  5JP4 A;  2AL6 A;  2D9Y A;  1W1G A;  2DX5 A;  3A8P A;  1ZC4 B;  2LOZ A;  4HAX B;  3KRW A;  3ODO A;  1FGY A;  1OMW A;  2DHK A;  3UZT A;  2K00 A;  3QIJ A;  1QQG A;  2V76 A;  3IVF A;  1EVH A;  3SO6 A;  1BTK A;  2CY4 A;  4QXA B;  2DKQ A;  3FVC A;  2W2X C;  5D3Y A;  2COC A;  4KHO A;  1GG3 A;  3GYP A;  2COA A;  1DDW A;  4QJ5 B;  3AU5 A;  5EFX A;  1TJ6 A;  2D10 A;  5J3T A;  4K2P A;  1X1G A;  2VKI A;  2DN6 A;  2J0K A;  1OY2 A;  1P5T A;  3G9W A;  4HB2 B;  4C0A A;  5LON B;  1T77 A;  4DBB A;  3ZDT A;  1XKE A;  2DYN A;  5C5B A;  3MDB C;  5D27 A;  2FJL A;  1U5D A;  4DXA B;  2UVM A;  1WGU A;  5C5B B;  1XR0 B;  4HSI A;  4GZU A;  1P6S A;  2ELB A;  3PZD A;  2G35 A;  2GJY A;  3NW8 A;  2K2U A;  1PLS A;  2K49 A;  4K81 A;  2LKO A;  2LOX A;  3ODX A;  2I5C A;  4GNK B;  2CAY A;  2DX1 A;  1ZYI A;  3PP2 A;  4CHJ A;  2D9Z A;  1ZC3 B;  3LJU X;  2PZ1 A;  2EC1 A;  2I1K A;  1V88 A;  4CHM A;  2GCJ A;  3AJ4 A;  1FHX A;  2YRY A;  1RJ2 A;  1U5F A;  1DRO A;  4MY6 A;  4GN1 A;  4HDO A;  1V5U A;  2D4Q A;  1MI1 A; 
#chains in the Genus database with same CATH homology
 2GCL A;  4OSN A;  3TVV A;  4CSQ A;  2K49 A;  4PQ0 A;  2GUM A;  4D6W A;  3OHM B;  2Z14 A;  2Z13 A;  4Z2M B;  3U12 A;  5LG4 B;  4GNK B;  2KR0 A;  2R2Y A;  3TO1 A;  4QXA B;  1ZYI A;  3FSS A;  3FVC A;  3A58 A;  4L1R A;  4KHB A;  3NWA A;  2Z4D A;  5I2S A;  4KHO A;  2ZKM X;  2K8E A;  3HIE A;  4QJ4 B;  5M4Y B;  5IRS A;  2YT2 A;  4KHB B;  3GYP A;  3GYO A;  3NWD A;  4Z2N A;  2KUQ A;  4IFS A;  2KIG A;  2GCJ A;  2NBV A;  3NWF A;  2FJU B;  4GOU A;  4OT1 A;  4QJ5 B;  2Z59 A;  2RRF A;  4HSI A;  4DIX A;  3TW1 A;  4QJ3 B;  5I2M A;  2KIE A;  4IOY X;  3NW8 A;  4KHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...