2KUQA

Solution structure of the chimera of the ptb domain of snt-2 and 19-residue peptide (aa 1571-1589) of halk
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
153
structure length
153
Chain Sequence
GSSGSSGLNRDSVPDNHPTKFKVTNVDDEGVELGSGVMELTQSELVLHLHRREAVRWPYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCSRAEEIFNLLQDLMQCNSINVMEEPVIITSGSSGSSGSSGSSGLFRLRHFPCGNVNYGYQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the recognition of nucleophosmin-anaplastic lymphoma kinase oncoprotein by the phosphotyrosine binding domain of Suc1-associated neurotrophic factor-induced tyrosine-phosphorylated target-2
pubmed doi rcsb
source organism Homo sapiens, synthetic, synthetic
molecule tags Signaling protein
molecule keywords Fibroblast growth factor receptor substrate 3, LINKER, 19-re
total genus 27
structure length 153
sequence length 153
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02174 IRS PTB domain (IRS-1 type)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.250 Mainly Beta Roll PH-domain like PH-domain like 2kuqA00
2YT2A 2KUQA
chains in the Genus database with same CATH superfamily
2VKIA 2D9ZA 5LONB 1DDMA 1V61A 4KAXB 1P5TA 3A58A 2VSZA 2E2XA 1P6SA 3QIJA 4K2OA 1NTYA 5D3XA 1Q67A 1Z87A 4CHMA 5JP4A 1I2HA 3HIEA 4HHVA 4F7UP 1U27A 4KHAA 2COAA 1TXDA 1FHWA 2KUQA 3SNHA 3TCAA 2Y7BA 1MI1A 3NWDA 1WJMA 3UZTA 1AQCA 3WA0A 1FHXA 2VRWB 3IVFA 2RRFA 3D8DA 3FM8C 3SYXA 1KZGA 4NSWA 2K2UA 3ULCA 1OY2A 5C6RA 3D8FA 4PQ0A 1B55A 1NU2A 2DFKA 5KQ1A 3KRXA 3LJUX 4A6KA 1X05A 1XCGA 1I7AA 5M4YB 5HE2A 2NZ8B 1K5DB 2I5FA 1GG3A 2NBVA 3G9WA 5JLJB 1WGUA 2RUKB 4HAVB 4KHBB 5I2MA 1IRSA 5HE0A 1V88A 4DBBA 2EMSA 4DX90 2EC1A 1LW3A 3O96A 2LKOA 2K2JA 3HK0A 3AU4A 1BTKA 1RJ2A 1FGYA 2KCJA 1FAOA 2YRYA 1TQZA 1SHCA 2DA0A 3X23A 2XQNM 4GOUA 5CLQB 1U2BA 3KY9A 3DXCA 1UNQA 2LULA 4ZRKA 4A6FA 4P7IA 2J0JA 2LG1A 4NY0A 2DYQA 2DHIA 4C0AA 1U29A 1PLSA 1W1GA 2FJUB 1UNPA 2DKQA 3DXDA 2K49A 4HB4B 4A6FB 2DTCA 5IRSA 3ZVRA 4QXAB 3RCPA 5C5BB 1UNRA 3NSUA 5KCVA 1QC6A 2Z14A 2YS1A 5LG4B 2P0DA 2NMBA 4HATB 4Y94A 3OANA 3NWAA 4B6HA 2D10A 2YVCA 3PZDA 3GYPA 3B77A 3NWFA 3P6AA 5JHGA 5DIFB 1ZVRA 2COCA 2KUPA 3TO1A 2DHJA 2I5CA 2P0FA 1EAZA 3GYOA 1UPQA 1XODA 1WVHA 2MFQA 3N7CA 4EJNA 2ZKMX 2UVMA 1U5EA 3P7ZA 4GXBA 1LB1A 3SUZA 2D9YA 3PSCA 3HQCA 4H8SA 3QBVB 4KVGB 4EMOA 2YT0A 1X1FA 1QQGA 2D4QA 2CAYA 4XWXA 1Y5OA 2QKMA 3KSYA 2AEHA 1NTVA 2IYBA 2AL6A 2V76A 4GMXB 3CIKA 4BBKA 4D0NB 1V89A 3HSAA 1ZC3B 2J0MA 2YF0A 5D3WA 2FJLA 1ZC4B 4HSIA 2R09A 2CRFA 4L1RA 2D2QA 1DBHA 5C79A 3QWMA 1WJ1A 4HB3B 2YS3A 4L6EA 3T06A 2UZRA 3M1IB 4EKUA 5KQ4A 2YT2A 3TVVA 5GOWB 3ULBA 2RNRB 4MY6A 2P8VA 3FSSA 2ELBA 3PP2A 4ZRIA 3VOQA 3ODXA 2RGNB 3BINA 5J3YA 2MKRA 1MK7B 3PVUA 4IFSA 3MPXA 2D9XA 2BCJA 3NW8A 4HAXB 4DIXA 1BAKA 5I2SA 2Z0PA 5FI0A 3OHMB 1NI2A 2CODA 2I1KA 3VIAA 2MDXA 5DI9B 3A98B 4CYEA 4GNKB 5DHAB 4YL8A 2K00A 1RRPB 3SV1A 1M7EA 4KHOA 4D6WA 2ZPYA 2ADZA 3ODOA 1H4RA 2HTHB 4Z2MB 5DHFB 1W1DA 2ROZB 4TYZA 3TFMA 4K17A 4ZRJA 1MIXA 4TKNA 4OSNA 1ZYIA 5EFXA 4GZUA 1SGHA 2UZSA 5JHHA 4HB2B 4WVFB 1DYNA 1PFJA 2EJ8A 4YONA 1Y19B 2R2YA 2D9VA 2Z13A 1ISNA 2OTXA 2RLOA 3CXBB 1FOEA 2DKPA 3PVLA 1TJ6A 2Z0QA 1GC6A 3BJIA 2CY5A 2ELAA 2Y8GA 1FGZA 2Z59A 1MAIA 1EGXA 5CLLB 2X18A 1P3RA 4K81A 5D3VA 3U12A 3D8EA 4QJ4B 2W2XC 1MK9B 1EVHA 1M7RA 2RVBB 4K2PA 4WJ7A 1FHOA 2CY4A 3KZ1A 4HAZB 1X11A 5DH9B 4GMVA 2ROVA 1V5PA 2G35A 2KGXB 2Q13A 2QKLA 3FEHA 1GC7A 2J0KA 2KIEA 1DROA 2YS5A 2LOXA 3U7DA 4HDOA 1PMSA 2DN6A 3A8QA 2GS0A 2GUMA 4Z2NA 2GCLA 1ZM0A 1T77A 1XX0A 2R0DA 3A8PA 2IFSA 2W2WA 3HW2B 3ODWA 2DHKA 4MT7A 4HDQA 1DDVA 2K8EA 3V5WA 4DX8A 4WSFA 2Z0OA 4KHBA 5D27A 1U5DA 4QJ5B 2M14A 2J59M 2Y8FA 4IAPA 1H10A 3U8ZA 2RSGA 4IOYX 5J3QA 3DCXA 4DXAB 1J0WA 1U5FA 1WI1A 1XKEA 2LYDA 5D3YA 2KIGA 2L2IA 5LOPB 2DX5A 3MDBC 3ZDTA 1KZ7A 2W2XD 5J3TA 4HAWB 3PVWA 5C5BA 2DYNA 1BTNA 2H7EA 1J19A 1DDWA 1FB8A 2D11A 3FVCA 5HE3A 2N0YA 1EF1A 1V5MA 1WGQA 1X1GA 3WYFB 2OQBA 4CSQA 1K5GB 1MIZB 2PZ1A 1E5WA 1KI1B 2LOZA 4F7HA 2DX1A 2GCJA 2L1CA 2P0HA 3AU5A 2I1JA 2M38A 2JP2A 1ZSQA 1W1HA 4PNKA 3ML4A 5L81A 2COFA 1OMWA 3DXEA 3F5RA 1UEFA 4HAUB 4GN1A 2KR0A 4MK0A 3PEGA 1U5GA 4GPTB 5HE1A 4A5KA 4QJ3B 3SO6A 4A6HA 2H7DA 4F7GA 5C16A 2YT1A 1OQNA 2DLWA 4CHJA 1MKEA 3TW1A 3AJ4A 2YSZA 1AWEA 4HB0B 2Z4DA 1BWNA 1XD4A 1XR0B 4OT1A 5FI1A 2D9WA 2EMTA 1MPHA 2N23A 3KRWA 1N3HA 3PG7A 3F0WA 1V5UA 1UPRA 1X86A 2HE7A 2GJYA 1WG7A 2MWNB 4HAYB
chains in the Genus database with same CATH topology
2KIGA 4GOUA 2NBVA 3OHMB 2Z59A 5I2SA 2KIEA 5IRSA 4QXAB 2GCJA 3A58A 2RRFA 3TO1A 3TW1A 4KHBB 4OSNA 2K8EA 2Z4DA 1ZYIA 2YT2A 3GYOA 3TVVA 5I2MA 4GNKB 3U12A 4PQ0A 2ZKMX 4OT1A 3FSSA 2Z14A 4QJ4B 5LG4B 4KHBA 3FVCA 3HIEA 4QJ5B 2R2YA 2GUMA 2KR0A 4KHAA 2Z13A 4Z2NA 4IFSA 4HSIA 2GCLA 4IOYX 4KHOA 2KUQA 4L1RA 4D6WA 3NWAA 5M4YB 4QJ3B 4CSQA 2FJUB 3GYPA 3NW8A 4Z2MB 3NWDA 4DIXA 2K49A 3NWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YT2 A;  2KUQ A; 
#chains in the Genus database with same CATH topology
 2VKI A;  2D9Z A;  5LON B;  1DDM A;  1V61 A;  4KAX B;  1P5T A;  3A58 A;  2VSZ A;  2E2X A;  1P6S A;  3QIJ A;  4K2O A;  1NTY A;  5D3X A;  1Q67 A;  1Z87 A;  4CHM A;  5JP4 A;  1I2H A;  3HIE A;  4HHV A;  4F7U P;  1U27 A;  4KHA A;  2COA A;  1TXD A;  1FHW A;  2KUQ A;  3SNH A;  3TCA A;  2Y7B A;  1MI1 A;  3NWD A;  1WJM A;  3UZT A;  1AQC A;  3WA0 A;  1FHX A;  2VRW B;  3IVF A;  2RRF A;  3D8D A;  3FM8 C;  3SYX A;  1KZG A;  4NSW A;  2K2U A;  3ULC A;  1OY2 A;  5C6R A;  3D8F A;  4PQ0 A;  1B55 A;  1NU2 A;  2DFK A;  5KQ1 A;  3KRX A;  3LJU X;  4A6K A;  1X05 A;  1XCG A;  1I7A A;  5M4Y B;  5HE2 A;  2NZ8 B;  1K5D B;  2I5F A;  1GG3 A;  2NBV A;  3G9W A;  5JLJ B;  1WGU A;  2RUK B;  4HAV B;  4KHB B;  5I2M A;  1IRS A;  5HE0 A;  1V88 A;  4DBB A;  2EMS A;  4DX9 0;  2EC1 A;  1LW3 A;  3O96 A;  2LKO A;  2K2J A;  3HK0 A;  3AU4 A;  1BTK A;  1RJ2 A;  1FGY A;  2KCJ A;  1FAO A;  2YRY A;  1TQZ A;  1SHC A;  2DA0 A;  3X23 A;  2XQN M;  4GOU A;  5CLQ B;  1U2B A;  3KY9 A;  3DXC A;  1UNQ A;  2LUL A;  4ZRK A;  4A6F A;  4P7I A;  2J0J A;  2LG1 A;  4NY0 A;  2DYQ A;  2DHI A;  4C0A A;  1U29 A;  1PLS A;  1W1G A;  2FJU B;  1UNP A;  2DKQ A;  3DXD A;  2K49 A;  4HB4 B;  4A6F B;  2DTC A;  5IRS A;  3ZVR A;  4QXA B;  3RCP A;  5C5B B;  1UNR A;  3NSU A;  5KCV A;  1QC6 A;  2Z14 A;  2YS1 A;  5LG4 B;  2P0D A;  2NMB A;  4HAT B;  4Y94 A;  3OAN A;  3NWA A;  4B6H A;  2D10 A;  2YVC A;  3PZD A;  3GYP A;  3B77 A;  3NWF A;  3P6A A;  5JHG A;  5DIF B;  1ZVR A;  2COC A;  2KUP A;  3TO1 A;  2DHJ A;  2I5C A;  2P0F A;  1EAZ A;  3GYO A;  1UPQ A;  1XOD A;  1WVH A;  2MFQ A;  3N7C A;  4EJN A;  2ZKM X;  2UVM A;  1U5E A;  3P7Z A;  4GXB A;  1LB1 A;  3SUZ A;  2D9Y A;  3PSC A;  3HQC A;  4H8S A;  3QBV B;  4KVG B;  4EMO A;  2YT0 A;  1X1F A;  1QQG A;  2D4Q A;  2CAY A;  4XWX A;  1Y5O A;  2QKM A;  3KSY A;  2AEH A;  1NTV A;  2IYB A;  2AL6 A;  2V76 A;  4GMX B;  3CIK A;  4BBK A;  4D0N B;  1V89 A;  3HSA A;  1ZC3 B;  2J0M A;  2YF0 A;  5D3W A;  2FJL A;  1ZC4 B;  4HSI A;  2R09 A;  2CRF A;  4L1R A;  2D2Q A;  1DBH A;  5C79 A;  3QWM A;  1WJ1 A;  4HB3 B;  2YS3 A;  4L6E A;  3T06 A;  2UZR A;  3M1I B;  4EKU A;  5KQ4 A;  2YT2 A;  3TVV A;  5GOW B;  3ULB A;  2RNR B;  4MY6 A;  2P8V A;  3FSS A;  2ELB A;  3PP2 A;  4ZRI A;  3VOQ A;  3ODX A;  2RGN B;  3BIN A;  5J3Y A;  2MKR A;  1MK7 B;  3PVU A;  4IFS A;  3MPX A;  2D9X A;  2BCJ A;  3NW8 A;  4HAX B;  4DIX A;  1BAK A;  5I2S A;  2Z0P A;  5FI0 A;  3OHM B;  1NI2 A;  2COD A;  2I1K A;  3VIA A;  2MDX A;  5DI9 B;  3A98 B;  4CYE A;  4GNK B;  5DHA B;  4YL8 A;  2K00 A;  1RRP B;  3SV1 A;  1M7E A;  4KHO A;  4D6W A;  2ZPY A;  2ADZ A;  3ODO A;  1H4R A;  2HTH B;  4Z2M B;  5DHF B;  1W1D A;  2ROZ B;  4TYZ A;  3TFM A;  4K17 A;  4ZRJ A;  1MIX A;  4TKN A;  4OSN A;  1ZYI A;  5EFX A;  4GZU A;  1SGH A;  2UZS A;  5JHH A;  4HB2 B;  4WVF B;  1DYN A;  1PFJ A;  2EJ8 A;  4YON A;  1Y19 B;  2R2Y A;  2D9V A;  2Z13 A;  1ISN A;  2OTX A;  2RLO A;  3CXB B;  1FOE A;  2DKP A;  3PVL A;  1TJ6 A;  2Z0Q A;  1GC6 A;  3BJI A;  2CY5 A;  2ELA A;  2Y8G A;  1FGZ A;  2Z59 A;  1MAI A;  1EGX A;  5CLL B;  2X18 A;  1P3R A;  4K81 A;  5D3V A;  3U12 A;  3D8E A;  4QJ4 B;  2W2X C;  1MK9 B;  1EVH A;  1M7R A;  2RVB B;  4K2P A;  4WJ7 A;  1FHO A;  2CY4 A;  3KZ1 A;  4HAZ B;  1X11 A;  5DH9 B;  4GMV A;  2ROV A;  1V5P A;  2G35 A;  2KGX B;  2Q13 A;  2QKL A;  3FEH A;  1GC7 A;  2J0K A;  2KIE A;  1DRO A;  2YS5 A;  2LOX A;  3U7D A;  4HDO A;  1PMS A;  2DN6 A;  3A8Q A;  2GS0 A;  2GUM A;  4Z2N A;  2GCL A;  1ZM0 A;  1T77 A;  1XX0 A;  2R0D A;  3A8P A;  2IFS A;  2W2W A;  3HW2 B;  3ODW A;  2DHK A;  4MT7 A;  4HDQ A;  1DDV A;  2K8E A;  3V5W A;  4DX8 A;  4WSF A;  2Z0O A;  4KHB A;  5D27 A;  1U5D A;  4QJ5 B;  2M14 A;  2J59 M;  2Y8F A;  4IAP A;  1H10 A;  3U8Z A;  2RSG A;  4IOY X;  5J3Q A;  3DCX A;  4DXA B;  1J0W A;  1U5F A;  1WI1 A;  1XKE A;  2LYD A;  5D3Y A;  2KIG A;  2L2I A;  5LOP B;  2DX5 A;  3MDB C;  3ZDT A;  1KZ7 A;  2W2X D;  5J3T A;  4HAW B;  3PVW A;  5C5B A;  2DYN A;  1BTN A;  2H7E A;  1J19 A;  1DDW A;  1FB8 A;  2D11 A;  3FVC A;  5HE3 A;  2N0Y A;  1EF1 A;  1V5M A;  1WGQ A;  1X1G A;  3WYF B;  2OQB A;  4CSQ A;  1K5G B;  1MIZ B;  2PZ1 A;  1E5W A;  1KI1 B;  2LOZ A;  4F7H A;  2DX1 A;  2GCJ A;  2L1C A;  2P0H A;  3AU5 A;  2I1J A;  2M38 A;  2JP2 A;  1ZSQ A;  1W1H A;  4PNK A;  3ML4 A;  5L81 A;  2COF A;  1OMW A;  3DXE A;  3F5R A;  1UEF A;  4HAU B;  4GN1 A;  2KR0 A;  4MK0 A;  3PEG A;  1U5G A;  4GPT B;  5HE1 A;  4A5K A;  4QJ3 B;  3SO6 A;  4A6H A;  2H7D A;  4F7G A;  5C16 A;  2YT1 A;  1OQN A;  2DLW A;  4CHJ A;  1MKE A;  3TW1 A;  3AJ4 A;  2YSZ A;  1AWE A;  4HB0 B;  2Z4D A;  1BWN A;  1XD4 A;  1XR0 B;  4OT1 A;  5FI1 A;  2D9W A;  2EMT A;  1MPH A;  2N23 A;  3KRW A;  1N3H A;  3PG7 A;  3F0W A;  1V5U A;  1UPR A;  1X86 A;  2HE7 A;  2GJY A;  1WG7 A;  2MWN B;  4HAY B; 
#chains in the Genus database with same CATH homology
 2KIG A;  4GOU A;  2NBV A;  3OHM B;  2Z59 A;  5I2S A;  2KIE A;  5IRS A;  4QXA B;  2GCJ A;  3A58 A;  2RRF A;  3TO1 A;  3TW1 A;  4KHB B;  4OSN A;  2K8E A;  2Z4D A;  1ZYI A;  2YT2 A;  3GYO A;  3TVV A;  5I2M A;  4GNK B;  3U12 A;  4PQ0 A;  2ZKM X;  4OT1 A;  3FSS A;  2Z14 A;  4QJ4 B;  5LG4 B;  4KHB A;  3FVC A;  3HIE A;  4QJ5 B;  2R2Y A;  2GUM A;  2KR0 A;  4KHA A;  2Z13 A;  4Z2N A;  4IFS A;  4HSI A;  2GCL A;  4IOY X;  4KHO A;  2KUQ A;  4L1R A;  4D6W A;  3NWA A;  5M4Y B;  4QJ3 B;  4CSQ A;  2FJU B;  3GYP A;  3NW8 A;  4Z2M B;  3NWD A;  4DIX A;  2K49 A;  3NWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...