2KUQA

Solution structure of the chimera of the ptb domain of snt-2 and 19-residue peptide (aa 1571-1589) of halk
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
153
structure length
153
Chain Sequence
GSSGSSGLNRDSVPDNHPTKFKVTNVDDEGVELGSGVMELTQSELVLHLHRREAVRWPYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCSRAEEIFNLLQDLMQCNSINVMEEPVIITSGSSGSSGSSGSSGLFRLRHFPCGNVNYGYQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the recognition of nucleophosmin-anaplastic lymphoma kinase oncoprotein by the phosphotyrosine binding domain of Suc1-associated neurotrophic factor-induced tyrosine-phosphorylated target-2
pubmed doi rcsb
source organism Homo sapiens, synthetic, synthetic
molecule tags Signaling protein
molecule keywords Fibroblast growth factor receptor substrate 3, LINKER, 19-re
total genus 27
structure length 153
sequence length 153
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02174 IRS PTB domain (IRS-1 type)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.250 Mainly Beta Roll PH-domain like PH-domain like 2kuqA00
2YT2A 2KUQA
chains in the Genus database with same CATH superfamily
3NWAA 2Y8GA 1MAIA 2ROZB 1ZSQA 3HIEA 1WG7A 1E5WA 5I2MA 4GXBA 2I5FA 4WSFA 4B6HA 3VIAA 4DBBA 1IRSA 1GC6A 1TXDA 2Q13A 2DTCA 2EC1A 4Z2MB 2GJYA 3U7DA 4PNKA 2GCJA 3MPXA 4ZRJA 4NY0A 2FJUB 4DXAB 2Z14A 4NSWA 2P8VA 5CLLB 3AJ4A 1U29A 2KUQA 3AU4A 2N0YA 2K8EA 3U8ZA 4GPTB 1DDMA 5HE3A 2H7EA 3KRXA 1FAOA 1RJ2A 4QJ3B 4PQ0A 4A6FA 2R2YA 4P7IA 1P3RA 1NI2A 4A5KA 1V5MA 1EGXA 4F7HA 5LONB 4KHAA 4D0NB 2J0JA 1ZVRA 2AEHA 4L1RA 4CSQA 2W2XC 3P6AA 2DN6A 3FM8C 4C0AA 3WYFB 1Y19B 1AQCA 3D8FA 2YS1A 1T77A 2P0FA 5JHHA 3A58A 1BAKA 2YS3A 2MWNB 1KI1B 2J59M 2UZSA 4F7GA 2ELBA 1OY2A 1FHOA 2D2QA 2I1JA 5C16A 1ZM0A 4EJNA 4XWXA 4HB0B 3BINA 3WA0A 3IVFA 4A6KA 1H10A 1TQZA 2P0HA 2GCLA 1Z87A 1Y5OA 2H7DA 5I2SA 4CYEA 5C5BA 2N23A 1SHCA 5DHFB 4KVGB 4DX90 4CHJA 1WJ1A 2RRFA 2I5CA 3SYXA 3D8EA 1MI1A 1DROA 4H8SA 1MPHA 2R0DA 3TCAA 2NMBA 3A8PA 1EF1A 4K2OA 2EMTA 2K2JA 4ZRIA 2DKQA 5IRSA 2BCJA 2OQBA 4HAZB 1NTVA 2M38A 2CY5A 4D6WA 1FB8A 3FSSA 3QBVB 1TJ6A 5HE1A 5DHAB 1U2BA 1EVHA 3NW8A 4TKNA 3PEGA 4BBKA 1LW3A 1XCGA 1XKEA 2COAA 5M4YB 3DXDA 4L6EA 2DX1A 1GC7A 1I7AA 2NBVA 2CRFA 2DHIA 2NZ8B 4K17A 2Z4DA 5JHGA 2COCA 1DBHA 4GMVA 4GOUA 5JLJB 5HE0A 1AWEA 2DKPA 2D9ZA 3AU5A 5D27A 2XQNM 3ML4A 1W1HA 3T06A 4Z2NA 3OHMB 1Q67A 2EMSA 1WVHA 1ZC4B 3O96A 4OSNA 3KY9A 2FJLA 1X1GA 1RRPB 3KRWA 3GYOA 2D9YA 1QC6A 5FI0A 2R09A 3HK0A 1B55A 3QIJA 1MK7B 2UVMA 4IAPA 3DXEA 2J0KA 2LYDA 2L1CA 2ROVA 4K81A 2JP2A 3V5WA 3SUZA 2IFSA 2COFA 4CHMA 2DFKA 1U5DA 4Y94A 1J0WA 2HTHB 5C5BB 2K2UA 2KR0A 4WVFB 5C79A 5KQ4A 4GNKB 2DLWA 1X1FA 2CY4A 2G35A 1W1GA 2AL6A 1FGYA 1KZ7A 2RNRB 3FEHA 2KCJA 4GMXB 3ODWA 2PZ1A 1X86A 4MK0A 3OANA 2M14A 2LG1A 2D11A 2YT2A 2HE7A 1ZC3B 3CXBB 5HE2A 4YL8A 3HSAA 5L81A 5GOWB 1DDVA 1FOEA 2LOZA 1FHXA 2P0DA 5J3YA 3ULCA 1UNPA 1PFJA 2UZRA 1N3HA 4MT7A 2D4QA 1BTKA 3PVWA 1NU2A 4MY6A 1PLSA 4HATB 5CLQB 5FI1A 1U27A 2D9WA 2EJ8A 2W2XD 3QWMA 1EAZA 4GN1A 1MIXA 1XR0B 2GS0A 2V76A 3N7CA 2DYQA 4IFSA 2Z0OA 2KIGA 3HW2B 3X23A 2LOXA 2DA0A 2D10A 2VKIA 1U5EA 3A8QA 3PG7A 2I1KA 1LB1A 1WGQA 1XD4A 3LJUX 4HB3B 1NTYA 2W2WA 3DXCA 1H4RA 1ISNA 2LULA 5D3WA 4GZUA 3PVLA 1I2HA 1X11A 3CIKA 1M7RA 3TW1A 4HB4B 4IOYX 3P7ZA 2QKLA 2Z0PA 2YSZA 1X05A 3D8DA 1BWNA 4OT1A 4KHBA 3A98B 1V5UA 5DIFB 1MK9B 1P6SA 2RGNB 1SGHA 2RSGA 2ELAA 2VSZA 3TO1A 1OMWA 2Z59A 2D9VA 1XODA 3MDBC 3GYPA 2CODA 1UEFA 3TVVA 3VOQA 1GG3A 1WI1A 3HQCA 1V88A 3F5RA 1V61A 2VRWB 3PP2A 1QQGA 4ZRKA 1U5GA 1PMSA 2MFQA 1MKEA 2GUMA 2K00A 2MDXA 3G9WA 4EMOA 3SV1A 5D3VA 3ZVRA 2Z13A 2Y7BA 2L2IA 2X18A 1DDWA 1WJMA 2DHJA 3UZTA 2QKMA 4HB2B 4EKUA 2YF0A 4QJ5B 4K2PA 2OTXA 3RCPA 1V5PA 2DX5A 4KHBB 3U12A 2IYBA 1FHWA 4HDOA 3M1IB 4KAXB 3SO6A 3DCXA 4HAYB 2RVBB 4HAXB 4F7UP 4HHVA 2D9XA 2YRYA 1UPQA 1P5TA 2KIEA 3KZ1A 3FVCA 4HSIA 2YS5A 5J3TA 3B77A 5KQ1A 3NWFA 4DIXA 1K5DB 2ZPYA 4HAUB 2ZKMX 3PSCA 1J19A 3PVUA 5DH9B 1W1DA 5DI9B 2K49A 3NSUA 3ZDTA 4TYZA 2E2XA 2ADZA 5LOPB 3PZDA 1DYNA 3F0WA 2YT0A 4YONA 1BTNA 1WGUA 3ODOA 3NWDA 4WJ7A 5JP4A 1XX0A 2DYNA 5EFXA 2Y8FA 2RLOA 2LKOA 3ULBA 1M7EA 4HAWB 3KSYA 4HAVB 2CAYA 5D3YA 2KUPA 2DHKA 2KGXB 2RUKB 2J0MA 1UNRA 1MIZB 1UPRA 4HDQA 1FGZA 5KCVA 1K5GB 3ODXA 4QXAB 4QJ4B 2MKRA 4A6FB 1ZYIA 5J3QA 5LG4B 1UNQA 3SNHA 1OQNA 1KZGA 4DX8A 5D3XA 1U5FA 1V89A 4KHOA 2YT1A 2YVCA 3TFMA 4A6HA 2Z0QA 3BJIA 5C6RA
chains in the Genus database with same CATH topology
3NWAA 3FVCA 3GYOA 4HSIA 3NWDA 4L1RA 4CSQA 3HIEA 2KUQA 3TO1A 5I2MA 2KR0A 2GCLA 2Z59A 3NWFA 4DIXA 2K8EA 5M4YB 3TW1A 2NBVA 4QJ5B 5I2SA 4GNKB 3GYPA 4IOYX 5IRSA 2ZKMX 4IFSA 4QXAB 3TVVA 4QJ4B 2Z4DA 1ZYIA 4Z2MB 4D6WA 2KIGA 4KHBB 3FSSA 4QJ3B 2K49A 4PQ0A 5LG4B 4GOUA 3U12A 2R2YA 2RRFA 3A58A 4OT1A 4KHBA 4KHOA 2GCJA 3NW8A 4Z2NA 2FJUB 2GUMA 3OHMB 2Z14A 4KHAA 2YT2A 2KIEA 2Z13A 4OSNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YT2 A;  2KUQ A; 
#chains in the Genus database with same CATH topology
 3NWA A;  2Y8G A;  1MAI A;  2ROZ B;  1ZSQ A;  3HIE A;  1WG7 A;  1E5W A;  5I2M A;  4GXB A;  2I5F A;  4WSF A;  4B6H A;  3VIA A;  4DBB A;  1IRS A;  1GC6 A;  1TXD A;  2Q13 A;  2DTC A;  2EC1 A;  4Z2M B;  2GJY A;  3U7D A;  4PNK A;  2GCJ A;  3MPX A;  4ZRJ A;  4NY0 A;  2FJU B;  4DXA B;  2Z14 A;  4NSW A;  2P8V A;  5CLL B;  3AJ4 A;  1U29 A;  2KUQ A;  3AU4 A;  2N0Y A;  2K8E A;  3U8Z A;  4GPT B;  1DDM A;  5HE3 A;  2H7E A;  3KRX A;  1FAO A;  1RJ2 A;  4QJ3 B;  4PQ0 A;  4A6F A;  2R2Y A;  4P7I A;  1P3R A;  1NI2 A;  4A5K A;  1V5M A;  1EGX A;  4F7H A;  5LON B;  4KHA A;  4D0N B;  2J0J A;  1ZVR A;  2AEH A;  4L1R A;  4CSQ A;  2W2X C;  3P6A A;  2DN6 A;  3FM8 C;  4C0A A;  3WYF B;  1Y19 B;  1AQC A;  3D8F A;  2YS1 A;  1T77 A;  2P0F A;  5JHH A;  3A58 A;  1BAK A;  2YS3 A;  2MWN B;  1KI1 B;  2J59 M;  2UZS A;  4F7G A;  2ELB A;  1OY2 A;  1FHO A;  2D2Q A;  2I1J A;  5C16 A;  1ZM0 A;  4EJN A;  4XWX A;  4HB0 B;  3BIN A;  3WA0 A;  3IVF A;  4A6K A;  1H10 A;  1TQZ A;  2P0H A;  2GCL A;  1Z87 A;  1Y5O A;  2H7D A;  5I2S A;  4CYE A;  5C5B A;  2N23 A;  1SHC A;  5DHF B;  4KVG B;  4DX9 0;  4CHJ A;  1WJ1 A;  2RRF A;  2I5C A;  3SYX A;  3D8E A;  1MI1 A;  1DRO A;  4H8S A;  1MPH A;  2R0D A;  3TCA A;  2NMB A;  3A8P A;  1EF1 A;  4K2O A;  2EMT A;  2K2J A;  4ZRI A;  2DKQ A;  5IRS A;  2BCJ A;  2OQB A;  4HAZ B;  1NTV A;  2M38 A;  2CY5 A;  4D6W A;  1FB8 A;  3FSS A;  3QBV B;  1TJ6 A;  5HE1 A;  5DHA B;  1U2B A;  1EVH A;  3NW8 A;  4TKN A;  3PEG A;  4BBK A;  1LW3 A;  1XCG A;  1XKE A;  2COA A;  5M4Y B;  3DXD A;  4L6E A;  2DX1 A;  1GC7 A;  1I7A A;  2NBV A;  2CRF A;  2DHI A;  2NZ8 B;  4K17 A;  2Z4D A;  5JHG A;  2COC A;  1DBH A;  4GMV A;  4GOU A;  5JLJ B;  5HE0 A;  1AWE A;  2DKP A;  2D9Z A;  3AU5 A;  5D27 A;  2XQN M;  3ML4 A;  1W1H A;  3T06 A;  4Z2N A;  3OHM B;  1Q67 A;  2EMS A;  1WVH A;  1ZC4 B;  3O96 A;  4OSN A;  3KY9 A;  2FJL A;  1X1G A;  1RRP B;  3KRW A;  3GYO A;  2D9Y A;  1QC6 A;  5FI0 A;  2R09 A;  3HK0 A;  1B55 A;  3QIJ A;  1MK7 B;  2UVM A;  4IAP A;  3DXE A;  2J0K A;  2LYD A;  2L1C A;  2ROV A;  4K81 A;  2JP2 A;  3V5W A;  3SUZ A;  2IFS A;  2COF A;  4CHM A;  2DFK A;  1U5D A;  4Y94 A;  1J0W A;  2HTH B;  5C5B B;  2K2U A;  2KR0 A;  4WVF B;  5C79 A;  5KQ4 A;  4GNK B;  2DLW A;  1X1F A;  2CY4 A;  2G35 A;  1W1G A;  2AL6 A;  1FGY A;  1KZ7 A;  2RNR B;  3FEH A;  2KCJ A;  4GMX B;  3ODW A;  2PZ1 A;  1X86 A;  4MK0 A;  3OAN A;  2M14 A;  2LG1 A;  2D11 A;  2YT2 A;  2HE7 A;  1ZC3 B;  3CXB B;  5HE2 A;  4YL8 A;  3HSA A;  5L81 A;  5GOW B;  1DDV A;  1FOE A;  2LOZ A;  1FHX A;  2P0D A;  5J3Y A;  3ULC A;  1UNP A;  1PFJ A;  2UZR A;  1N3H A;  4MT7 A;  2D4Q A;  1BTK A;  3PVW A;  1NU2 A;  4MY6 A;  1PLS A;  4HAT B;  5CLQ B;  5FI1 A;  1U27 A;  2D9W A;  2EJ8 A;  2W2X D;  3QWM A;  1EAZ A;  4GN1 A;  1MIX A;  1XR0 B;  2GS0 A;  2V76 A;  3N7C A;  2DYQ A;  4IFS A;  2Z0O A;  2KIG A;  3HW2 B;  3X23 A;  2LOX A;  2DA0 A;  2D10 A;  2VKI A;  1U5E A;  3A8Q A;  3PG7 A;  2I1K A;  1LB1 A;  1WGQ A;  1XD4 A;  3LJU X;  4HB3 B;  1NTY A;  2W2W A;  3DXC A;  1H4R A;  1ISN A;  2LUL A;  5D3W A;  4GZU A;  3PVL A;  1I2H A;  1X11 A;  3CIK A;  1M7R A;  3TW1 A;  4HB4 B;  4IOY X;  3P7Z A;  2QKL A;  2Z0P A;  2YSZ A;  1X05 A;  3D8D A;  1BWN A;  4OT1 A;  4KHB A;  3A98 B;  1V5U A;  5DIF B;  1MK9 B;  1P6S A;  2RGN B;  1SGH A;  2RSG A;  2ELA A;  2VSZ A;  3TO1 A;  1OMW A;  2Z59 A;  2D9V A;  1XOD A;  3MDB C;  3GYP A;  2COD A;  1UEF A;  3TVV A;  3VOQ A;  1GG3 A;  1WI1 A;  3HQC A;  1V88 A;  3F5R A;  1V61 A;  2VRW B;  3PP2 A;  1QQG A;  4ZRK A;  1U5G A;  1PMS A;  2MFQ A;  1MKE A;  2GUM A;  2K00 A;  2MDX A;  3G9W A;  4EMO A;  3SV1 A;  5D3V A;  3ZVR A;  2Z13 A;  2Y7B A;  2L2I A;  2X18 A;  1DDW A;  1WJM A;  2DHJ A;  3UZT A;  2QKM A;  4HB2 B;  4EKU A;  2YF0 A;  4QJ5 B;  4K2P A;  2OTX A;  3RCP A;  1V5P A;  2DX5 A;  4KHB B;  3U12 A;  2IYB A;  1FHW A;  4HDO A;  3M1I B;  4KAX B;  3SO6 A;  3DCX A;  4HAY B;  2RVB B;  4HAX B;  4F7U P;  4HHV A;  2D9X A;  2YRY A;  1UPQ A;  1P5T A;  2KIE A;  3KZ1 A;  3FVC A;  4HSI A;  2YS5 A;  5J3T A;  3B77 A;  5KQ1 A;  3NWF A;  4DIX A;  1K5D B;  2ZPY A;  4HAU B;  2ZKM X;  3PSC A;  1J19 A;  3PVU A;  5DH9 B;  1W1D A;  5DI9 B;  2K49 A;  3NSU A;  3ZDT A;  4TYZ A;  2E2X A;  2ADZ A;  5LOP B;  3PZD A;  1DYN A;  3F0W A;  2YT0 A;  4YON A;  1BTN A;  1WGU A;  3ODO A;  3NWD A;  4WJ7 A;  5JP4 A;  1XX0 A;  2DYN A;  5EFX A;  2Y8F A;  2RLO A;  2LKO A;  3ULB A;  1M7E A;  4HAW B;  3KSY A;  4HAV B;  2CAY A;  5D3Y A;  2KUP A;  2DHK A;  2KGX B;  2RUK B;  2J0M A;  1UNR A;  1MIZ B;  1UPR A;  4HDQ A;  1FGZ A;  5KCV A;  1K5G B;  3ODX A;  4QXA B;  4QJ4 B;  2MKR A;  4A6F B;  1ZYI A;  5J3Q A;  5LG4 B;  1UNQ A;  3SNH A;  1OQN A;  1KZG A;  4DX8 A;  5D3X A;  1U5F A;  1V89 A;  4KHO A;  2YT1 A;  2YVC A;  3TFM A;  4A6H A;  2Z0Q A;  3BJI A;  5C6R A; 
#chains in the Genus database with same CATH homology
 3NWA A;  3FVC A;  3GYO A;  4HSI A;  3NWD A;  4L1R A;  4CSQ A;  3HIE A;  2KUQ A;  3TO1 A;  5I2M A;  2KR0 A;  2GCL A;  2Z59 A;  3NWF A;  4DIX A;  2K8E A;  5M4Y B;  3TW1 A;  2NBV A;  4QJ5 B;  5I2S A;  4GNK B;  3GYP A;  4IOY X;  5IRS A;  2ZKM X;  4IFS A;  4QXA B;  3TVV A;  4QJ4 B;  2Z4D A;  1ZYI A;  4Z2M B;  4D6W A;  2KIG A;  4KHB B;  3FSS A;  4QJ3 B;  2K49 A;  4PQ0 A;  5LG4 B;  4GOU A;  3U12 A;  2R2Y A;  2RRF A;  3A58 A;  4OT1 A;  4KHB A;  4KHO A;  2GCJ A;  3NW8 A;  4Z2N A;  2FJU B;  2GUM A;  3OHM B;  2Z14 A;  4KHA A;  2YT2 A;  2KIE A;  2Z13 A;  4OSN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...