2KUQA

Solution structure of the chimera of the ptb domain of snt-2 and 19-residue peptide (aa 1571-1589) of halk
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
153
structure length
153
Chain Sequence
GSSGSSGLNRDSVPDNHPTKFKVTNVDDEGVELGSGVMELTQSELVLHLHRREAVRWPYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCSRAEEIFNLLQDLMQCNSINVMEEPVIITSGSSGSSGSSGSSGLFRLRHFPCGNVNYGYQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibroblast growth factor receptor substrate 3, LINKER, 19-re
publication title Structural basis for the recognition of nucleophosmin-anaplastic lymphoma kinase oncoprotein by the phosphotyrosine binding domain of Suc1-associated neurotrophic factor-induced tyrosine-phosphorylated target-2
pubmed doi rcsb
source organism Homo sapiens, synthetic, synthetic
molecule tags Signaling protein
total genus 27
structure length 153
sequence length 153
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02174 IRS PTB domain (IRS-1 type)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.250 Mainly Beta Roll PH-domain like PH-domain like 2kuqA00
2YT2A 2KUQA
chains in the Genus database with same CATH superfamily
3QWMA 4OT1A 2LOZA 1EGXA 1V61A 3FM8C 5J3TA 1U5DA 1UNRA 2GCLA 2K8EA 3DXDA 2D9VA 4GXBA 2Y8FA 1J0WA 2YT0A 3PVLA 2D4QA 2YS5A 5C79A 1SGHA 4TYZA 2R0DA 4HB2B 3U8ZA 2M38A 2ADZA 1XX0A 2E2XA 4DX8A 2P0HA 2ELAA 1DROA 2DKPA 2IFSA 3U12A 3KRWA 3T06A 2Z59A 1Y5OA 2KCJA 1UNPA 3PSCA 4GN1A 2UVMA 5C5BA 3DCXA 4HAVB 2K2JA 3SO6A 2EMTA 2NZ8B 5JHGA 2V76A 2D9ZA 4HDOA 2DHJA 2I5CA 1AQCA 2VSZA 4IOYX 2COFA 4ZRIA 4QJ4B 1FGZA 2IYBA 4A6FA 2AEHA 4BBKA 1J19A 2DYNA 4K81A 2VRWB 2N23A 2W2XC 2Z0OA 2Y8GA 5J3QA 2ROZB 3HIEA 2D10A 4K2OA 3NWAA 3BJIA 2I1JA 2KIGA 2ROVA 3ZVRA 2M14A 2YS3A 2CY5A 1V5PA 4GNKB 1GC6A 1FAOA 1MIXA 3PVWA 5EFXA 5HE0A 3SV1A 5JHHA 2DA0A 5D3WA 1OMWA 1PFJA 4ZRJA 2ELBA 1TQZA 5C5BB 1PLSA 2DFKA 2MFQA 5C6RA 3G9WA 2CAYA 1IRSA 2I5FA 2YS1A 1GG3A 2RVBB 2NBVA 2DKQA 1EF1A 3BINA 1M7EA 1KZ7A 1U5EA 3CXBB 3O96A 3AU4A 1ZVRA 3KSYA 1WI1A 4A6FB 4QXAB 1OY2A 4GPTB 4HAYB 4K2PA 5DH9B 4QJ5B 1M7RA 2Z0PA 4HB4B 3F0WA 1FHXA 3A8PA 1FHWA 2DN6A 3IVFA 3A98B 4F7HA 3FEHA 2COAA 2DTCA 2KUQA 2Z13A 3OHMB 1TJ6A 4HAXB 1Z87A 2LULA 4C0AA 2MDXA 3X23A 1BWNA 5LOPB 3LJUX 3A58A 2RUKB 2CY4A 1EVHA 5D3VA 3ULCA 1XCGA 4D6WA 1H4RA 1QC6A 4L6EA 2COCA 1UPRA 1MI1A 3ML4A 3PP2A 2D2QA 3VOQA 4HAWB 5DI9B 4F7UP 4DX90 4EJNA 4HAUB 3ODXA 1I2HA 4A6KA 3TFMA 5I2MA 1X11A 4WSFA 1X05A 2LYDA 4Y94A 2J0MA 1TXDA 1FHOA 1U2BA 4HATB 1UEFA 3CIKA 4DIXA 1XD4A 2RSGA 5HE3A 2N0YA 2R2YA 1BAKA 3D8FA 3DXEA 2PZ1A 2QKLA 1U27A 1ZYIA 2CRFA 4YONA 5KCVA 4DBBA 1ZC4B 1MK7B 1EAZA 2DLWA 3SYXA 5DIFB 2LG1A 5HE1A 2Z4DA 2W2XD 1E5WA 4PQ0A 2YT2A 4DXAB 4QJ3B 4KHBB 3UZTA 3GYPA 5KQ1A 3P6AA 5D3XA 5L81A 1WJ1A 1XKEA 1P3RA 2FJLA 3NW8A 4ZRKA 3FSSA 4HSIA 1FB8A 1U5GA 1ZSQA 3PEGA 3TCAA 2JP2A 4H8SA 2P8VA 2DYQA 1MKEA 2LKOA 1FOEA 3M1IB 3VIAA 5CLLB 1DDWA 2GUMA 4HB0B 2VKIA 5LONB 1W1HA 3ODOA 1WGQA 4WJ7A 4XWXA 4HHVA 1N3HA 2J59M 2Q13A 5D3YA 2D9YA 5C16A 4OSNA 3HW2B 2L2IA 3HQCA 4P7IA 3SUZA 1V5UA 4GZUA 3WYFB 2EJ8A 4K17A 1WJMA 3NWFA 1RJ2A 1ISNA 3NSUA 2OTXA 3AJ4A 2CODA 1Q67A 5FI0A 2D9WA 4PNKA 5M4YB 3RCPA 4EKUA 5GOWB 2H7EA 3MPXA 3N7CA 2QKMA 1W1DA 2RGNB 4KAXB 1RRPB 3PG7A 1B55A 1P6SA 2FJUB 2KUPA 4D0NB 2G35A 2MKRA 1DYNA 2DHKA 2Z0QA 1DDMA 1V88A 5CLQB 3WA0A 3AU5A 2DX5A 1MK9B 4MY6A 3GYOA 1LB1A 3KZ1A 4KHBA 2H7DA 2RLOA 1GC7A 4NY0A 2UZRA 1U29A 3SNHA 1NTYA 2D11A 4YL8A 4KHOA 3V5WA 1UPQA 4GMXB 1X1FA 1T77A 2R09A 1V89A 2D9XA 2YRYA 3MDBC 5JLJB 4A5KA 2EMSA 4CYEA 2J0JA 2YSZA 1P5TA 1SHCA 4HDQA 2EC1A 3PVUA 1X86A 2K2UA 2BCJA 1XR0B 4F7GA 1NI2A 4Z2NA 1FGYA 1QQGA 3QIJA 2HTHB 4MT7A 3TW1A 1XODA 2XQNM 1WG7A 3PZDA 2GS0A 1DDVA 3QBVB 4HAZB 5J3YA 2YT1A 4TKNA 4NSWA 1U5FA 4HB3B 5DHFB 3ODWA 2OQBA 2K49A 1ZM0A 1WVHA 3HSAA 2KR0A 3OANA 1H10A 2RRFA 1OQNA 2DX1A 3KRXA 2KIEA 3TO1A 4IFSA 3D8DA 4GOUA 4WVFB 1UNQA 2RNRB 1Y19B 2Y7BA 5IRSA 2K00A 2KGXB 1KI1B 3U7DA 1K5DB 3B77A 2GJYA 1W1GA 2X18A 4GMVA 2MWNB 5KQ4A 2DHIA 3P7ZA 1NTVA 2AL6A 2ZKMX 4KVGB 2P0DA 1X1GA 4KHAA 3D8EA 2UZSA 3DXCA 2I1KA 1MPHA 4L1RA 2Z14A 4EMOA 5D27A 3ULBA 3HK0A 5HE2A 1LW3A 2P0FA 4CSQA 3F5RA 2J0KA 2GCJA 3NWDA 3TVVA 4CHMA 2HE7A 4A6HA 1DBHA 1MAIA 1NU2A 3A8QA 2YF0A 3FVCA 1WGUA 4IAPA 1K5GB 2NMBA 1PMSA 5I2SA 5LG4B 2YVCA 2LOXA 5FI1A 1BTNA 1I7AA 4B6HA 2L1CA 3KY9A 2W2WA 1V5MA 1AWEA 4CHJA 1ZC3B 4Z2MB 5JP4A 1MIZB 2ZPYA 4MK0A 1KZGA 1BTKA 5DHAB 3ZDTA
chains in the Genus database with same CATH topology
2RRFA 3FVCA 4OT1A 3HIEA 4L1RA 2FJUB 2KIEA 4KHBB 2R2YA 3TO1A 2GUMA 2GCLA 2K8EA 2NBVA 2Z14A 3GYPA 3NWAA 2KIGA 2KUQA 2Z13A 4GOUA 4IFSA 5I2SA 3OHMB 5LG4B 3NWFA 1ZYIA 4GNKB 5IRSA 3GYOA 4QXAB 4CSQA 5M4YB 3NW8A 4KHBA 2GCJA 3NWDA 5I2MA 3A58A 3FSSA 4HSIA 3TVVA 4QJ5B 2K49A 4IOYX 4QJ4B 2Z4DA 4Z2NA 4KHOA 4OSNA 4Z2MB 4D6WA 2ZKMX 4PQ0A 2KR0A 2YT2A 4DIXA 4KHAA 4QJ3B 3U12A 3TW1A 2Z59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YT2 A;  2KUQ A; 
#chains in the Genus database with same CATH topology
 3QWM A;  4OT1 A;  2LOZ A;  1EGX A;  1V61 A;  3FM8 C;  5J3T A;  1U5D A;  1UNR A;  2GCL A;  2K8E A;  3DXD A;  2D9V A;  4GXB A;  2Y8F A;  1J0W A;  2YT0 A;  3PVL A;  2D4Q A;  2YS5 A;  5C79 A;  1SGH A;  4TYZ A;  2R0D A;  4HB2 B;  3U8Z A;  2M38 A;  2ADZ A;  1XX0 A;  2E2X A;  4DX8 A;  2P0H A;  2ELA A;  1DRO A;  2DKP A;  2IFS A;  3U12 A;  3KRW A;  3T06 A;  2Z59 A;  1Y5O A;  2KCJ A;  1UNP A;  3PSC A;  4GN1 A;  2UVM A;  5C5B A;  3DCX A;  4HAV B;  2K2J A;  3SO6 A;  2EMT A;  2NZ8 B;  5JHG A;  2V76 A;  2D9Z A;  4HDO A;  2DHJ A;  2I5C A;  1AQC A;  2VSZ A;  4IOY X;  2COF A;  4ZRI A;  4QJ4 B;  1FGZ A;  2IYB A;  4A6F A;  2AEH A;  4BBK A;  1J19 A;  2DYN A;  4K81 A;  2VRW B;  2N23 A;  2W2X C;  2Z0O A;  2Y8G A;  5J3Q A;  2ROZ B;  3HIE A;  2D10 A;  4K2O A;  3NWA A;  3BJI A;  2I1J A;  2KIG A;  2ROV A;  3ZVR A;  2M14 A;  2YS3 A;  2CY5 A;  1V5P A;  4GNK B;  1GC6 A;  1FAO A;  1MIX A;  3PVW A;  5EFX A;  5HE0 A;  3SV1 A;  5JHH A;  2DA0 A;  5D3W A;  1OMW A;  1PFJ A;  4ZRJ A;  2ELB A;  1TQZ A;  5C5B B;  1PLS A;  2DFK A;  2MFQ A;  5C6R A;  3G9W A;  2CAY A;  1IRS A;  2I5F A;  2YS1 A;  1GG3 A;  2RVB B;  2NBV A;  2DKQ A;  1EF1 A;  3BIN A;  1M7E A;  1KZ7 A;  1U5E A;  3CXB B;  3O96 A;  3AU4 A;  1ZVR A;  3KSY A;  1WI1 A;  4A6F B;  4QXA B;  1OY2 A;  4GPT B;  4HAY B;  4K2P A;  5DH9 B;  4QJ5 B;  1M7R A;  2Z0P A;  4HB4 B;  3F0W A;  1FHX A;  3A8P A;  1FHW A;  2DN6 A;  3IVF A;  3A98 B;  4F7H A;  3FEH A;  2COA A;  2DTC A;  2KUQ A;  2Z13 A;  3OHM B;  1TJ6 A;  4HAX B;  1Z87 A;  2LUL A;  4C0A A;  2MDX A;  3X23 A;  1BWN A;  5LOP B;  3LJU X;  3A58 A;  2RUK B;  2CY4 A;  1EVH A;  5D3V A;  3ULC A;  1XCG A;  4D6W A;  1H4R A;  1QC6 A;  4L6E A;  2COC A;  1UPR A;  1MI1 A;  3ML4 A;  3PP2 A;  2D2Q A;  3VOQ A;  4HAW B;  5DI9 B;  4F7U P;  4DX9 0;  4EJN A;  4HAU B;  3ODX A;  1I2H A;  4A6K A;  3TFM A;  5I2M A;  1X11 A;  4WSF A;  1X05 A;  2LYD A;  4Y94 A;  2J0M A;  1TXD A;  1FHO A;  1U2B A;  4HAT B;  1UEF A;  3CIK A;  4DIX A;  1XD4 A;  2RSG A;  5HE3 A;  2N0Y A;  2R2Y A;  1BAK A;  3D8F A;  3DXE A;  2PZ1 A;  2QKL A;  1U27 A;  1ZYI A;  2CRF A;  4YON A;  5KCV A;  4DBB A;  1ZC4 B;  1MK7 B;  1EAZ A;  2DLW A;  3SYX A;  5DIF B;  2LG1 A;  5HE1 A;  2Z4D A;  2W2X D;  1E5W A;  4PQ0 A;  2YT2 A;  4DXA B;  4QJ3 B;  4KHB B;  3UZT A;  3GYP A;  5KQ1 A;  3P6A A;  5D3X A;  5L81 A;  1WJ1 A;  1XKE A;  1P3R A;  2FJL A;  3NW8 A;  4ZRK A;  3FSS A;  4HSI A;  1FB8 A;  1U5G A;  1ZSQ A;  3PEG A;  3TCA A;  2JP2 A;  4H8S A;  2P8V A;  2DYQ A;  1MKE A;  2LKO A;  1FOE A;  3M1I B;  3VIA A;  5CLL B;  1DDW A;  2GUM A;  4HB0 B;  2VKI A;  5LON B;  1W1H A;  3ODO A;  1WGQ A;  4WJ7 A;  4XWX A;  4HHV A;  1N3H A;  2J59 M;  2Q13 A;  5D3Y A;  2D9Y A;  5C16 A;  4OSN A;  3HW2 B;  2L2I A;  3HQC A;  4P7I A;  3SUZ A;  1V5U A;  4GZU A;  3WYF B;  2EJ8 A;  4K17 A;  1WJM A;  3NWF A;  1RJ2 A;  1ISN A;  3NSU A;  2OTX A;  3AJ4 A;  2COD A;  1Q67 A;  5FI0 A;  2D9W A;  4PNK A;  5M4Y B;  3RCP A;  4EKU A;  5GOW B;  2H7E A;  3MPX A;  3N7C A;  2QKM A;  1W1D A;  2RGN B;  4KAX B;  1RRP B;  3PG7 A;  1B55 A;  1P6S A;  2FJU B;  2KUP A;  4D0N B;  2G35 A;  2MKR A;  1DYN A;  2DHK A;  2Z0Q A;  1DDM A;  1V88 A;  5CLQ B;  3WA0 A;  3AU5 A;  2DX5 A;  1MK9 B;  4MY6 A;  3GYO A;  1LB1 A;  3KZ1 A;  4KHB A;  2H7D A;  2RLO A;  1GC7 A;  4NY0 A;  2UZR A;  1U29 A;  3SNH A;  1NTY A;  2D11 A;  4YL8 A;  4KHO A;  3V5W A;  1UPQ A;  4GMX B;  1X1F A;  1T77 A;  2R09 A;  1V89 A;  2D9X A;  2YRY A;  3MDB C;  5JLJ B;  4A5K A;  2EMS A;  4CYE A;  2J0J A;  2YSZ A;  1P5T A;  1SHC A;  4HDQ A;  2EC1 A;  3PVU A;  1X86 A;  2K2U A;  2BCJ A;  1XR0 B;  4F7G A;  1NI2 A;  4Z2N A;  1FGY A;  1QQG A;  3QIJ A;  2HTH B;  4MT7 A;  3TW1 A;  1XOD A;  2XQN M;  1WG7 A;  3PZD A;  2GS0 A;  1DDV A;  3QBV B;  4HAZ B;  5J3Y A;  2YT1 A;  4TKN A;  4NSW A;  1U5F A;  4HB3 B;  5DHF B;  3ODW A;  2OQB A;  2K49 A;  1ZM0 A;  1WVH A;  3HSA A;  2KR0 A;  3OAN A;  1H10 A;  2RRF A;  1OQN A;  2DX1 A;  3KRX A;  2KIE A;  3TO1 A;  4IFS A;  3D8D A;  4GOU A;  4WVF B;  1UNQ A;  2RNR B;  1Y19 B;  2Y7B A;  5IRS A;  2K00 A;  2KGX B;  1KI1 B;  3U7D A;  1K5D B;  3B77 A;  2GJY A;  1W1G A;  2X18 A;  4GMV A;  2MWN B;  5KQ4 A;  2DHI A;  3P7Z A;  1NTV A;  2AL6 A;  2ZKM X;  4KVG B;  2P0D A;  1X1G A;  4KHA A;  3D8E A;  2UZS A;  3DXC A;  2I1K A;  1MPH A;  4L1R A;  2Z14 A;  4EMO A;  5D27 A;  3ULB A;  3HK0 A;  5HE2 A;  1LW3 A;  2P0F A;  4CSQ A;  3F5R A;  2J0K A;  2GCJ A;  3NWD A;  3TVV A;  4CHM A;  2HE7 A;  4A6H A;  1DBH A;  1MAI A;  1NU2 A;  3A8Q A;  2YF0 A;  3FVC A;  1WGU A;  4IAP A;  1K5G B;  2NMB A;  1PMS A;  5I2S A;  5LG4 B;  2YVC A;  2LOX A;  5FI1 A;  1BTN A;  1I7A A;  4B6H A;  2L1C A;  3KY9 A;  2W2W A;  1V5M A;  1AWE A;  4CHJ A;  1ZC3 B;  4Z2M B;  5JP4 A;  1MIZ B;  2ZPY A;  4MK0 A;  1KZG A;  1BTK A;  5DHA B;  3ZDT A; 
#chains in the Genus database with same CATH homology
 2RRF A;  3FVC A;  4OT1 A;  3HIE A;  4L1R A;  2FJU B;  2KIE A;  4KHB B;  2R2Y A;  3TO1 A;  2GUM A;  2GCL A;  2K8E A;  2NBV A;  2Z14 A;  3GYP A;  3NWA A;  2KIG A;  2KUQ A;  2Z13 A;  4GOU A;  4IFS A;  5I2S A;  3OHM B;  5LG4 B;  3NWF A;  1ZYI A;  4GNK B;  5IRS A;  3GYO A;  4QXA B;  4CSQ A;  5M4Y B;  3NW8 A;  4KHB A;  2GCJ A;  3NWD A;  5I2M A;  3A58 A;  3FSS A;  4HSI A;  3TVV A;  4QJ5 B;  2K49 A;  4IOY X;  4QJ4 B;  2Z4D A;  4Z2N A;  4KHO A;  4OSN A;  4Z2M B;  4D6W A;  2ZKM X;  4PQ0 A;  2KR0 A;  2YT2 A;  4DIX A;  4KHA A;  4QJ3 B;  3U12 A;  3TW1 A;  2Z59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...