2K00A

Solution structure of the talin f3 in complex with layilin cytodomain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
GVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords Talin-1
publication title Structural basis for the interaction between the cytoplasmic domain of the hyaluronate receptor layilin and the talin F3 subdomain
pubmed doi rcsb
source organism Gallus gallus
total genus 17
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2k00A00
2K00A 5J3QA 1MK7B 2D9WA 3O96A 4KVGB 2Z0PA 3D8EA 1FHWA 4HB0B 3MDBC 2DHKA 4GMXB 2LULA 1WJMA 2I1JA 3P7ZA 5DI9B 3P6AA 1FOEA 4C0AA 1NU2A 5HE2A 2N23A 3F5RA 1PFJA 4HDOA 1UPQA 1FHOA 2GJYA 5JHHA 2LOZA 5CLQB 4HAUB 4A6FA 2YS1A 1V88A 5D3VA 3PVUA 1V5MA 2EC1A 1U2BA 3SNHA 4XWXA 4DBBA 2DA0A 2D9YA 2DX1A 1RRPB 2P8VA 3M1IB 5DIFB 2DHJA 1EAZA 1FB8A 1XODA 2GCJA 3PVLA 2M38A 4DXAB 5C79A 2YS3A 4K2OA 1PLSA 4K81A 3GYOA 3TFMA 3D8FA 1OMWA 3SV1A 1LW3A 2IYBA 1V89A 3PP2A 3CXBB 1W1HA 3FEHA 4WSFA 3QWMA 1FGZA 4TKNA 5KCVA 2OQBA 5C5BA 2DYQA 1WJ1A 5D3XA 1U5EA 4P7IA 3DXDA 3KRWA 2VKIA 4ZRIA 1H10A 1X86A 1ISNA 4MK0A 1KZ7A 3PEGA 1ZSQA 2UZSA 4ZRJA 1H4RA 2DHIA 3U8ZA 1GC7A 3LJUX 4CHMA 1SHCA 2COFA 3ODXA 4HATB 4EMOA 2UVMA 5D3WA 2H7EA 1NTVA 2I5FA 2QKMA 2KUPA 2V76A 1SGHA 5D3YA 2DLWA 1M7RA 2DTCA 4Z2NA 5KQ1A 3OANA 4ZRKA 2DX5A 3ODWA 2Q13A 4B6HA 2VSZA 2W2WA 4F7GA 3KSYA 2R0DA 1X05A 4HB3B 3F0WA 3FM8C 2X18A 4HAVB 4BBKA 5KQ4A 1DYNA 2Z0OA 4IFSA 4TYZA 2J59M 2MKRA 2MWNB 1RJ2A 4HB4B 1IRSA 2D11A 1UNPA 1LB1A 4F7HA 3IVFA 3TO1A 1XR0B 2YRYA 1ZVRA 4HAXB 1P6SA 3V5WA 1U5GA 5CLLB 4H8SA 5GOWB 1XD4A 2EJ8A 3A8PA 2COCA 3D8DA 3PG7A 2BCJA 2K2JA 5D27A 3VOQA 1DBHA 1PMSA 1NTYA 1V5UA 2Z0QA 4HDQA 2CRFA 5HE3A 3T06A 1UPRA 2KGXB 1Y5OA 1MAIA 2LYDA 4EKUA 3QBVB 2Y8FA 1XKEA 1J19A 3RCPA 2RNRB 1KI1B 2MFQA 1WVHA 2GCLA 2RUKB 2FJLA 2G35A 3SO6A 4HB2B 3SUZA 3ULCA 3ML4A 2Y7BA 2NZ8B 4Y94A 1ZM0A 2M14A 4L6EA 1DROA 5JP4A 4HHVA 4KHOA 2EMSA 1DDWA 4IAPA 4MY6A 2YSZA 1GG3A 2D9XA 4GXBA 3HQCA 3TVVA 1P5TA 2AEHA 1MKEA 3CIKA 1U27A 1QC6A 3DXCA 1AQCA 1KZGA 4GZUA 1EF1A 1XCGA 4HAZB 3AU4A 3U7DA 2P0FA 4IOYX 3PVWA 2D4QA 4YONA 3X23A 2D10A 1N3HA 1OQNA 2P0DA 1P3RA 1FAOA 2HTHB 3HK0A 2YT0A 3KRXA 2RSGA 2XQNM 4A5KA 2R09A 3A8QA 2LKOA 3PSCA 5HE1A 1TJ6A 3AJ4A 1X11A 2DN6A 2J0KA 2D9VA 1K5GB 4WJ7A 1FHXA 2QKLA 3BJIA 2ROVA 3UZTA 1NI2A 3QIJA 2LG1A 2I1KA 1Z87A 5FI0A 5HE0A 2CODA 4F7UP 1UNQA 1BTKA 2CAYA 2AL6A 2KCJA 1WGUA 5LOPB 1FGYA 4K17A 2YVCA 4DX90 3HW2B 4NSWA 4CHJA 2N0YA 1B55A 5JHGA 2GS0A 1BWNA 4NY0A 5L81A 1Y19B 4KHAA 5LONB 2LOXA 5C6RA 4EJNA 3BINA 1XX0A 3KZ1A 2J0JA 1GC6A 3ULBA 3VIAA 1V61A 2D9ZA 2ZPYA 2YF0A 2D2QA 2JP2A 4PNKA 2ROZB 3FSSA 2DYNA 1MIZB 2UZRA 5DH9B 1W1GA 4DX8A 1X1FA 2I5CA 1U5FA 2RVBB 3MPXA 4CYEA 1QQGA 1DDVA 3PZDA 5DHFB 3SYXA 4HAWB 5C5BB 4YL8A 2VRWB 1WGQA 2CY4A 3KY9A 5C16A 2OTXA 1TXDA 5JLJB 1DDMA 3G9WA 2YS5A 2HE7A 1ZC4B 3N7CA 2K2UA 3TCAA 3WYFB 1WI1A 3ZVRA 2W2XC 1MIXA 2E2XA 2NMBA 3NSUA 1X1GA 2RGNB 1U5DA 4K2PA 2PZ1A 4GPTB 1V5PA 2MDXA 2EMTA 4D0NB 4GMVA 5EFXA 3A98B 1I2HA 2ELAA 4Z2MB 1M7EA 3ZDTA 1U29A 4PQ0A 4HAYB 2P0HA 4GN1A 5J3TA 1AWEA 2DFKA 1BTNA 2ELBA 1UEFA 2DKQA 1I7AA 3AU5A 3ODOA 1EVHA 1TQZA 1OY2A 3DXEA 2IFSA 1UNRA 2L1CA 1ZC3B 2L2IA 5J3YA 2DKPA 2Y8GA 5DHAB 4KHBB 1W1DA 1K5DB 3GYPA 3WA0A 4KAXB 2RLOA 2YT1A 1BAKA 1MK9B 1WG7A 3TW1A 4A6KA 5FI1A 2J0MA 4WVFB 2CY5A 1EGXA 4MT7A 1E5WA 1J0WA 1Q67A 1MPHA 2H7DA 4A6HA 2COAA 2W2XD 2ADZA 4A6FB
chains in the Genus database with same CATH superfamily
2K00A 5J3QA 1MK7B 2D9WA 3O96A 4KVGB 2Z0PA 3D8EA 1FHWA 4HB0B 3MDBC 2DHKA 4GMXB 4DIXA 2LULA 1WJMA 2I1JA 4QJ5B 3P7ZA 5DI9B 3P6AA 1FOEA 4C0AA 1NU2A 5HE2A 2N23A 3F5RA 4OT1A 1PFJA 4HDOA 1UPQA 5M4YB 1FHOA 2GJYA 5JHHA 2LOZA 5CLQB 4HAUB 4A6FA 4D6WA 2YS1A 1V88A 5D3VA 3PVUA 1V5MA 2EC1A 1U2BA 3SNHA 4XWXA 4DBBA 2DA0A 2D9YA 2DX1A 3NWDA 1RRPB 4QXAB 2P8VA 1ZYIA 3M1IB 5DIFB 2DHJA 1EAZA 1FB8A 1XODA 2GCJA 3PVLA 1T77A 2M38A 4DXAB 5C79A 2YS3A 4K2OA 2K49A 1PLSA 2NBVA 4K81A 3GYOA 2GUMA 3TFMA 3D8FA 1OMWA 3SV1A 1LW3A 2IYBA 1V89A 3PP2A 3CXBB 1W1HA 3FEHA 3B77A 4WSFA 3QWMA 2Z59A 1FGZA 4TKNA 5KCVA 2OQBA 5C5BA 2DYQA 3A58A 1WJ1A 5D3XA 1U5EA 4P7IA 3DXDA 3KRWA 2VKIA 4ZRIA 1H10A 1X86A 1ISNA 3HIEA 4MK0A 1KZ7A 3PEGA 1ZSQA 5I2MA 2UZSA 4GOUA 4ZRJA 1H4RA 2DHIA 4OSNA 3U8ZA 1GC7A 3LJUX 4CHMA 1SHCA 2COFA 3ODXA 4HATB 4EMOA 2UVMA 5D3WA 3U12A 2H7EA 1NTVA 2I5FA 2QKMA 2KUPA 2V76A 1SGHA 5D3YA 2DLWA 1M7RA 2DTCA 4Z2NA 5KQ1A 3OANA 4ZRKA 2DX5A 3ODWA 2Q13A 4B6HA 2VSZA 2W2WA 4L1RA 4F7GA 3KSYA 2R0DA 1X05A 4KHBA 4HB3B 3F0WA 3FM8C 2X18A 4HAVB 5LG4B 4BBKA 5KQ4A 1DYNA 2Z0OA 4IFSA 4TYZA 2J59M 2MKRA 2MWNB 1RJ2A 4HB4B 1IRSA 2D11A 1UNPA 1LB1A 4F7HA 3IVFA 3TO1A 1XR0B 2YRYA 1ZVRA 4HAXB 3FVCA 1P6SA 3V5WA 1U5GA 5CLLB 4H8SA 5GOWB 1XD4A 3DCXA 2EJ8A 3A8PA 2COCA 3D8DA 3PG7A 2BCJA 2K2JA 5D27A 3VOQA 1DBHA 2KR0A 1PMSA 1NTYA 1V5UA 2KUQA 2Z0QA 4HDQA 2CRFA 5HE3A 3T06A 1UPRA 2KGXB 1Y5OA 1MAIA 2LYDA 3HSAA 4EKUA 3QBVB 2Y8FA 1XKEA 1J19A 3RCPA 2RNRB 1KI1B 2MFQA 1WVHA 2GCLA 2RUKB 2FJLA 2G35A 3SO6A 4HB2B 3SUZA 3ULCA 5IRSA 3ML4A 2Y7BA 2NZ8B 4Y94A 1ZM0A 2M14A 4L6EA 1DROA 5JP4A 4GNKB 4HHVA 4KHOA 4HSIA 2EMSA 1DDWA 4IAPA 4MY6A 2YSZA 1GG3A 2D9XA 4GXBA 3HQCA 3TVVA 1P5TA 2Z14A 2AEHA 1MKEA 3CIKA 1U27A 1QC6A 3DXCA 1AQCA 1KZGA 4GZUA 1EF1A 1XCGA 4HAZB 3AU4A 3U7DA 2P0FA 4IOYX 3PVWA 2D4QA 4YONA 3X23A 2D10A 1N3HA 1OQNA 2P0DA 1MI1A 1P3RA 1FAOA 2HTHB 3HK0A 2YT0A 3KRXA 2RSGA 2R2YA 2XQNM 4A5KA 2R09A 3A8QA 2LKOA 3PSCA 5HE1A 1TJ6A 3AJ4A 1X11A 2DN6A 2J0KA 2D9VA 1K5GB 4WJ7A 1FHXA 2QKLA 3BJIA 2ROVA 3UZTA 1NI2A 3QIJA 2LG1A 2I1KA 1Z87A 5FI0A 5HE0A 2CODA 4F7UP 1UNQA 1BTKA 2CAYA 2AL6A 2ZKMX 2KCJA 1WGUA 5LOPB 1FGYA 4K17A 2YVCA 4DX90 3HW2B 4NSWA 4CHJA 3OHMB 2N0YA 1B55A 5JHGA 2GS0A 1BWNA 2YT2A 4NY0A 5L81A 1Y19B 4KHAA 5LONB 2LOXA 3NWAA 5C6RA 4EJNA 3BINA 1XX0A 3KZ1A 2J0JA 1GC6A 3ULBA 3NW8A 3VIAA 1V61A 2D9ZA 2K8EA 2ZPYA 2YF0A 2D2QA 2JP2A 3NWFA 4PNKA 2ROZB 3FSSA 2DYNA 1MIZB 2UZRA 5DH9B 2KIEA 1W1GA 4DX8A 1X1FA 2I5CA 1U5FA 2RVBB 4QJ3B 3MPXA 4CYEA 1QQGA 1DDVA 3PZDA 5DHFB 3SYXA 4HAWB 5C5BB 4YL8A 2VRWB 1WGQA 2CY4A 4CSQA 3KY9A 5C16A 2KIGA 1TXDA 2OTXA 5JLJB 1DDMA 3G9WA 2YS5A 2HE7A 1ZC4B 3N7CA 2K2UA 3TCAA 3WYFB 1WI1A 3ZVRA 2W2XC 1MIXA 2E2XA 2NMBA 3NSUA 1X1GA 2RGNB 1U5DA 4K2PA 2PZ1A 4GPTB 1V5PA 2MDXA 2EMTA 4D0NB 4GMVA 5EFXA 3A98B 1I2HA 2ELAA 4Z2MB 1M7EA 3ZDTA 1U29A 4PQ0A 4HAYB 2P0HA 4GN1A 5J3TA 2Z4DA 1AWEA 2DFKA 1BTNA 2ELBA 1UEFA 2DKQA 1I7AA 3AU5A 3ODOA 1EVHA 1TQZA 1OY2A 3DXEA 2IFSA 1UNRA 2L1CA 1ZC3B 2L2IA 5J3YA 2DKPA 2Y8GA 5DHAB 4KHBB 1W1DA 1K5DB 3GYPA 2RRFA 3WA0A 4KAXB 2FJUB 2RLOA 4QJ4B 2YT1A 1BAKA 1MK9B 1WG7A 3TW1A 4A6KA 5FI1A 5I2SA 2J0MA 4WVFB 2CY5A 1EGXA 4MT7A 1E5WA 1J0WA 1Q67A 1MPHA 2H7DA 2Z13A 4A6HA 2COAA 2W2XD 2ADZA 4A6FB
chains in the Genus database with same CATH topology
2K00A 5J3QA 1MK7B 2D9WA 3O96A 4KVGB 2Z0PA 3D8EA 1FHWA 4HB0B 3MDBC 2DHKA 4GMXB 2LULA 1WJMA 2I1JA 3P7ZA 5DI9B 3P6AA 1FOEA 4C0AA 1NU2A 5HE2A 2N23A 3F5RA 1PFJA 4HDOA 1UPQA 1FHOA 2GJYA 5JHHA 2LOZA 5CLQB 4HAUB 4A6FA 2YS1A 1V88A 5D3VA 3PVUA 1V5MA 2EC1A 1U2BA 3SNHA 4XWXA 4DBBA 2DA0A 2D9YA 2DX1A 1RRPB 2P8VA 3M1IB 5DIFB 2DHJA 1EAZA 1FB8A 1XODA 2GCJA 3PVLA 2M38A 4DXAB 5C79A 2YS3A 4K2OA 1PLSA 4K81A 3GYOA 3TFMA 3D8FA 1OMWA 3SV1A 1LW3A 2IYBA 1V89A 3PP2A 3CXBB 1W1HA 3FEHA 4WSFA 3QWMA 1FGZA 4TKNA 5KCVA 2OQBA 5C5BA 2DYQA 1WJ1A 5D3XA 1U5EA 4P7IA 3DXDA 3KRWA 2VKIA 4ZRIA 1H10A 1X86A 1ISNA 4MK0A 1KZ7A 3PEGA 1ZSQA 2UZSA 4ZRJA 1H4RA 2DHIA 3U8ZA 1GC7A 3LJUX 4CHMA 1SHCA 2COFA 3ODXA 4HATB 4EMOA 2UVMA 5D3WA 2H7EA 1NTVA 2I5FA 2QKMA 2KUPA 2V76A 1SGHA 5D3YA 2DLWA 1M7RA 2DTCA 4Z2NA 5KQ1A 3OANA 4ZRKA 2DX5A 3ODWA 2Q13A 4B6HA 2VSZA 2W2WA 4F7GA 3KSYA 2R0DA 1X05A 4HB3B 3F0WA 3FM8C 2X18A 4HAVB 4BBKA 5KQ4A 1DYNA 2Z0OA 4IFSA 4TYZA 2J59M 2MKRA 2MWNB 1RJ2A 4HB4B 1IRSA 2D11A 1UNPA 1LB1A 4F7HA 3IVFA 3TO1A 1XR0B 2YRYA 1ZVRA 4HAXB 1P6SA 3V5WA 1U5GA 5CLLB 4H8SA 5GOWB 1XD4A 2EJ8A 3A8PA 2COCA 3D8DA 3PG7A 2BCJA 2K2JA 5D27A 3VOQA 1DBHA 1PMSA 1NTYA 1V5UA 2Z0QA 4HDQA 2CRFA 5HE3A 3T06A 1UPRA 2KGXB 1Y5OA 1MAIA 2LYDA 4EKUA 3QBVB 2Y8FA 1XKEA 1J19A 3RCPA 2RNRB 1KI1B 2MFQA 1WVHA 2GCLA 2RUKB 2FJLA 2G35A 3SO6A 4HB2B 3SUZA 3ULCA 3ML4A 2Y7BA 2NZ8B 4Y94A 1ZM0A 2M14A 4L6EA 1DROA 5JP4A 4HHVA 4KHOA 2EMSA 1DDWA 4IAPA 4MY6A 2YSZA 1GG3A 2D9XA 4GXBA 3HQCA 3TVVA 1P5TA 2AEHA 1MKEA 3CIKA 1U27A 1QC6A 3DXCA 1AQCA 1KZGA 4GZUA 1EF1A 1XCGA 4HAZB 3AU4A 3U7DA 2P0FA 4IOYX 3PVWA 2D4QA 4YONA 3X23A 2D10A 1N3HA 1OQNA 2P0DA 1P3RA 1FAOA 2HTHB 3HK0A 2YT0A 3KRXA 2RSGA 2XQNM 4A5KA 2R09A 3A8QA 2LKOA 3PSCA 5HE1A 1TJ6A 3AJ4A 1X11A 2DN6A 2J0KA 2D9VA 1K5GB 4WJ7A 1FHXA 2QKLA 3BJIA 2ROVA 3UZTA 1NI2A 3QIJA 2LG1A 2I1KA 1Z87A 5FI0A 5HE0A 2CODA 4F7UP 1UNQA 1BTKA 2CAYA 2AL6A 2KCJA 1WGUA 5LOPB 1FGYA 4K17A 2YVCA 4DX90 3HW2B 4NSWA 4CHJA 2N0YA 1B55A 5JHGA 2GS0A 1BWNA 4NY0A 5L81A 1Y19B 4KHAA 5LONB 2LOXA 5C6RA 4EJNA 3BINA 1XX0A 3KZ1A 2J0JA 1GC6A 3ULBA 3VIAA 1V61A 2D9ZA 2ZPYA 2YF0A 2D2QA 2JP2A 4PNKA 2ROZB 3FSSA 2DYNA 1MIZB 2UZRA 5DH9B 1W1GA 4DX8A 1X1FA 2I5CA 1U5FA 2RVBB 3MPXA 4CYEA 1QQGA 1DDVA 3PZDA 5DHFB 3SYXA 4HAWB 5C5BB 4YL8A 2VRWB 1WGQA 2CY4A 3KY9A 5C16A 2OTXA 1TXDA 5JLJB 1DDMA 3G9WA 2YS5A 2HE7A 1ZC4B 3N7CA 2K2UA 3TCAA 3WYFB 1WI1A 3ZVRA 2W2XC 1MIXA 2E2XA 2NMBA 3NSUA 1X1GA 2RGNB 1U5DA 4K2PA 2PZ1A 4GPTB 1V5PA 2MDXA 2EMTA 4D0NB 4GMVA 5EFXA 3A98B 1I2HA 2ELAA 4Z2MB 1M7EA 3ZDTA 1U29A 4PQ0A 4HAYB 2P0HA 4GN1A 5J3TA 1AWEA 2DFKA 1BTNA 2ELBA 1UEFA 2DKQA 1I7AA 3AU5A 3ODOA 1EVHA 1TQZA 1OY2A 3DXEA 2IFSA 1UNRA 2L1CA 1ZC3B 2L2IA 5J3YA 2DKPA 2Y8GA 5DHAB 4KHBB 1W1DA 1K5DB 3GYPA 3WA0A 4KAXB 2RLOA 2YT1A 1BAKA 1MK9B 1WG7A 3TW1A 4A6KA 5FI1A 2J0MA 4WVFB 2CY5A 1EGXA 4MT7A 1E5WA 1J0WA 1Q67A 1MPHA 2H7DA 4A6HA 2COAA 2W2XD 2ADZA 4A6FB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K00 A;  5J3Q A;  1MK7 B;  2D9W A;  3O96 A;  4KVG B;  2Z0P A;  3D8E A;  1FHW A;  4HB0 B;  3MDB C;  2DHK A;  4GMX B;  2LUL A;  1WJM A;  2I1J A;  3P7Z A;  5DI9 B;  3P6A A;  1FOE A;  4C0A A;  1NU2 A;  5HE2 A;  2N23 A;  3F5R A;  1PFJ A;  4HDO A;  1UPQ A;  1FHO A;  2GJY A;  5JHH A;  2LOZ A;  5CLQ B;  4HAU B;  4A6F A;  2YS1 A;  1V88 A;  5D3V A;  3PVU A;  1V5M A;  2EC1 A;  1U2B A;  3SNH A;  4XWX A;  4DBB A;  2DA0 A;  2D9Y A;  2DX1 A;  1RRP B;  2P8V A;  3M1I B;  5DIF B;  2DHJ A;  1EAZ A;  1FB8 A;  1XOD A;  2GCJ A;  3PVL A;  2M38 A;  4DXA B;  5C79 A;  2YS3 A;  4K2O A;  1PLS A;  4K81 A;  3GYO A;  3TFM A;  3D8F A;  1OMW A;  3SV1 A;  1LW3 A;  2IYB A;  1V89 A;  3PP2 A;  3CXB B;  1W1H A;  3FEH A;  4WSF A;  3QWM A;  1FGZ A;  4TKN A;  5KCV A;  2OQB A;  5C5B A;  2DYQ A;  1WJ1 A;  5D3X A;  1U5E A;  4P7I A;  3DXD A;  3KRW A;  2VKI A;  4ZRI A;  1H10 A;  1X86 A;  1ISN A;  4MK0 A;  1KZ7 A;  3PEG A;  1ZSQ A;  2UZS A;  4ZRJ A;  1H4R A;  2DHI A;  3U8Z A;  1GC7 A;  3LJU X;  4CHM A;  1SHC A;  2COF A;  3ODX A;  4HAT B;  4EMO A;  2UVM A;  5D3W A;  2H7E A;  1NTV A;  2I5F A;  2QKM A;  2KUP A;  2V76 A;  1SGH A;  5D3Y A;  2DLW A;  1M7R A;  2DTC A;  4Z2N A;  5KQ1 A;  3OAN A;  4ZRK A;  2DX5 A;  3ODW A;  2Q13 A;  4B6H A;  2VSZ A;  2W2W A;  4F7G A;  3KSY A;  2R0D A;  1X05 A;  4HB3 B;  3F0W A;  3FM8 C;  2X18 A;  4HAV B;  4BBK A;  5KQ4 A;  1DYN A;  2Z0O A;  4IFS A;  4TYZ A;  2J59 M;  2MKR A;  2MWN B;  1RJ2 A;  4HB4 B;  1IRS A;  2D11 A;  1UNP A;  1LB1 A;  4F7H A;  3IVF A;  3TO1 A;  1XR0 B;  2YRY A;  1ZVR A;  4HAX B;  1P6S A;  3V5W A;  1U5G A;  5CLL B;  4H8S A;  5GOW B;  1XD4 A;  2EJ8 A;  3A8P A;  2COC A;  3D8D A;  3PG7 A;  2BCJ A;  2K2J A;  5D27 A;  3VOQ A;  1DBH A;  1PMS A;  1NTY A;  1V5U A;  2Z0Q A;  4HDQ A;  2CRF A;  5HE3 A;  3T06 A;  1UPR A;  2KGX B;  1Y5O A;  1MAI A;  2LYD A;  4EKU A;  3QBV B;  2Y8F A;  1XKE A;  1J19 A;  3RCP A;  2RNR B;  1KI1 B;  2MFQ A;  1WVH A;  2GCL A;  2RUK B;  2FJL A;  2G35 A;  3SO6 A;  4HB2 B;  3SUZ A;  3ULC A;  3ML4 A;  2Y7B A;  2NZ8 B;  4Y94 A;  1ZM0 A;  2M14 A;  4L6E A;  1DRO A;  5JP4 A;  4HHV A;  4KHO A;  2EMS A;  1DDW A;  4IAP A;  4MY6 A;  2YSZ A;  1GG3 A;  2D9X A;  4GXB A;  3HQC A;  3TVV A;  1P5T A;  2AEH A;  1MKE A;  3CIK A;  1U27 A;  1QC6 A;  3DXC A;  1AQC A;  1KZG A;  4GZU A;  1EF1 A;  1XCG A;  4HAZ B;  3AU4 A;  3U7D A;  2P0F A;  4IOY X;  3PVW A;  2D4Q A;  4YON A;  3X23 A;  2D10 A;  1N3H A;  1OQN A;  2P0D A;  1P3R A;  1FAO A;  2HTH B;  3HK0 A;  2YT0 A;  3KRX A;  2RSG A;  2XQN M;  4A5K A;  2R09 A;  3A8Q A;  2LKO A;  3PSC A;  5HE1 A;  1TJ6 A;  3AJ4 A;  1X11 A;  2DN6 A;  2J0K A;  2D9V A;  1K5G B;  4WJ7 A;  1FHX A;  2QKL A;  3BJI A;  2ROV A;  3UZT A;  1NI2 A;  3QIJ A;  2LG1 A;  2I1K A;  1Z87 A;  5FI0 A;  5HE0 A;  2COD A;  4F7U P;  1UNQ A;  1BTK A;  2CAY A;  2AL6 A;  2KCJ A;  1WGU A;  5LOP B;  1FGY A;  4K17 A;  2YVC A;  4DX9 0;  3HW2 B;  4NSW A;  4CHJ A;  2N0Y A;  1B55 A;  5JHG A;  2GS0 A;  1BWN A;  4NY0 A;  5L81 A;  1Y19 B;  4KHA A;  5LON B;  2LOX A;  5C6R A;  4EJN A;  3BIN A;  1XX0 A;  3KZ1 A;  2J0J A;  1GC6 A;  3ULB A;  3VIA A;  1V61 A;  2D9Z A;  2ZPY A;  2YF0 A;  2D2Q A;  2JP2 A;  4PNK A;  2ROZ B;  3FSS A;  2DYN A;  1MIZ B;  2UZR A;  5DH9 B;  1W1G A;  4DX8 A;  1X1F A;  2I5C A;  1U5F A;  2RVB B;  3MPX A;  4CYE A;  1QQG A;  1DDV A;  3PZD A;  5DHF B;  3SYX A;  4HAW B;  5C5B B;  4YL8 A;  2VRW B;  1WGQ A;  2CY4 A;  3KY9 A;  5C16 A;  2OTX A;  1TXD A;  5JLJ B;  1DDM A;  3G9W A;  2YS5 A;  2HE7 A;  1ZC4 B;  3N7C A;  2K2U A;  3TCA A;  3WYF B;  1WI1 A;  3ZVR A;  2W2X C;  1MIX A;  2E2X A;  2NMB A;  3NSU A;  1X1G A;  2RGN B;  1U5D A;  4K2P A;  2PZ1 A;  4GPT B;  1V5P A;  2MDX A;  2EMT A;  4D0N B;  4GMV A;  5EFX A;  3A98 B;  1I2H A;  2ELA A;  4Z2M B;  1M7E A;  3ZDT A;  1U29 A;  4PQ0 A;  4HAY B;  2P0H A;  4GN1 A;  5J3T A;  1AWE A;  2DFK A;  1BTN A;  2ELB A;  1UEF A;  2DKQ A;  1I7A A;  3AU5 A;  3ODO A;  1EVH A;  1TQZ A;  1OY2 A;  3DXE A;  2IFS A;  1UNR A;  2L1C A;  1ZC3 B;  2L2I A;  5J3Y A;  2DKP A;  2Y8G A;  5DHA B;  4KHB B;  1W1D A;  1K5D B;  3GYP A;  3WA0 A;  4KAX B;  2RLO A;  2YT1 A;  1BAK A;  1MK9 B;  1WG7 A;  3TW1 A;  4A6K A;  5FI1 A;  2J0M A;  4WVF B;  2CY5 A;  1EGX A;  4MT7 A;  1E5W A;  1J0W A;  1Q67 A;  1MPH A;  2H7D A;  4A6H A;  2COA A;  2W2X D;  2ADZ A;  4A6F B; 
#chains in the Genus database with same CATH topology
 2K00 A;  5J3Q A;  1MK7 B;  2D9W A;  3O96 A;  4KVG B;  2Z0P A;  3D8E A;  1FHW A;  4HB0 B;  3MDB C;  2DHK A;  4GMX B;  4DIX A;  2LUL A;  1WJM A;  2I1J A;  4QJ5 B;  3P7Z A;  5DI9 B;  3P6A A;  1FOE A;  4C0A A;  1NU2 A;  5HE2 A;  2N23 A;  3F5R A;  4OT1 A;  1PFJ A;  4HDO A;  1UPQ A;  5M4Y B;  1FHO A;  2GJY A;  5JHH A;  2LOZ A;  5CLQ B;  4HAU B;  4A6F A;  4D6W A;  2YS1 A;  1V88 A;  5D3V A;  3PVU A;  1V5M A;  2EC1 A;  1U2B A;  3SNH A;  4XWX A;  4DBB A;  2DA0 A;  2D9Y A;  2DX1 A;  3NWD A;  1RRP B;  4QXA B;  2P8V A;  1ZYI A;  3M1I B;  5DIF B;  2DHJ A;  1EAZ A;  1FB8 A;  1XOD A;  2GCJ A;  3PVL A;  1T77 A;  2M38 A;  4DXA B;  5C79 A;  2YS3 A;  4K2O A;  2K49 A;  1PLS A;  2NBV A;  4K81 A;  3GYO A;  2GUM A;  3TFM A;  3D8F A;  1OMW A;  3SV1 A;  1LW3 A;  2IYB A;  1V89 A;  3PP2 A;  3CXB B;  1W1H A;  3FEH A;  3B77 A;  4WSF A;  3QWM A;  2Z59 A;  1FGZ A;  4TKN A;  5KCV A;  2OQB A;  5C5B A;  2DYQ A;  3A58 A;  1WJ1 A;  5D3X A;  1U5E A;  4P7I A;  3DXD A;  3KRW A;  2VKI A;  4ZRI A;  1H10 A;  1X86 A;  1ISN A;  3HIE A;  4MK0 A;  1KZ7 A;  3PEG A;  1ZSQ A;  5I2M A;  2UZS A;  4GOU A;  4ZRJ A;  1H4R A;  2DHI A;  4OSN A;  3U8Z A;  1GC7 A;  3LJU X;  4CHM A;  1SHC A;  2COF A;  3ODX A;  4HAT B;  4EMO A;  2UVM A;  5D3W A;  3U12 A;  2H7E A;  1NTV A;  2I5F A;  2QKM A;  2KUP A;  2V76 A;  1SGH A;  5D3Y A;  2DLW A;  1M7R A;  2DTC A;  4Z2N A;  5KQ1 A;  3OAN A;  4ZRK A;  2DX5 A;  3ODW A;  2Q13 A;  4B6H A;  2VSZ A;  2W2W A;  4L1R A;  4F7G A;  3KSY A;  2R0D A;  1X05 A;  4KHB A;  4HB3 B;  3F0W A;  3FM8 C;  2X18 A;  4HAV B;  5LG4 B;  4BBK A;  5KQ4 A;  1DYN A;  2Z0O A;  4IFS A;  4TYZ A;  2J59 M;  2MKR A;  2MWN B;  1RJ2 A;  4HB4 B;  1IRS A;  2D11 A;  1UNP A;  1LB1 A;  4F7H A;  3IVF A;  3TO1 A;  1XR0 B;  2YRY A;  1ZVR A;  4HAX B;  3FVC A;  1P6S A;  3V5W A;  1U5G A;  5CLL B;  4H8S A;  5GOW B;  1XD4 A;  3DCX A;  2EJ8 A;  3A8P A;  2COC A;  3D8D A;  3PG7 A;  2BCJ A;  2K2J A;  5D27 A;  3VOQ A;  1DBH A;  2KR0 A;  1PMS A;  1NTY A;  1V5U A;  2KUQ A;  2Z0Q A;  4HDQ A;  2CRF A;  5HE3 A;  3T06 A;  1UPR A;  2KGX B;  1Y5O A;  1MAI A;  2LYD A;  3HSA A;  4EKU A;  3QBV B;  2Y8F A;  1XKE A;  1J19 A;  3RCP A;  2RNR B;  1KI1 B;  2MFQ A;  1WVH A;  2GCL A;  2RUK B;  2FJL A;  2G35 A;  3SO6 A;  4HB2 B;  3SUZ A;  3ULC A;  5IRS A;  3ML4 A;  2Y7B A;  2NZ8 B;  4Y94 A;  1ZM0 A;  2M14 A;  4L6E A;  1DRO A;  5JP4 A;  4GNK B;  4HHV A;  4KHO A;  4HSI A;  2EMS A;  1DDW A;  4IAP A;  4MY6 A;  2YSZ A;  1GG3 A;  2D9X A;  4GXB A;  3HQC A;  3TVV A;  1P5T A;  2Z14 A;  2AEH A;  1MKE A;  3CIK A;  1U27 A;  1QC6 A;  3DXC A;  1AQC A;  1KZG A;  4GZU A;  1EF1 A;  1XCG A;  4HAZ B;  3AU4 A;  3U7D A;  2P0F A;  4IOY X;  3PVW A;  2D4Q A;  4YON A;  3X23 A;  2D10 A;  1N3H A;  1OQN A;  2P0D A;  1MI1 A;  1P3R A;  1FAO A;  2HTH B;  3HK0 A;  2YT0 A;  3KRX A;  2RSG A;  2R2Y A;  2XQN M;  4A5K A;  2R09 A;  3A8Q A;  2LKO A;  3PSC A;  5HE1 A;  1TJ6 A;  3AJ4 A;  1X11 A;  2DN6 A;  2J0K A;  2D9V A;  1K5G B;  4WJ7 A;  1FHX A;  2QKL A;  3BJI A;  2ROV A;  3UZT A;  1NI2 A;  3QIJ A;  2LG1 A;  2I1K A;  1Z87 A;  5FI0 A;  5HE0 A;  2COD A;  4F7U P;  1UNQ A;  1BTK A;  2CAY A;  2AL6 A;  2ZKM X;  2KCJ A;  1WGU A;  5LOP B;  1FGY A;  4K17 A;  2YVC A;  4DX9 0;  3HW2 B;  4NSW A;  4CHJ A;  3OHM B;  2N0Y A;  1B55 A;  5JHG A;  2GS0 A;  1BWN A;  2YT2 A;  4NY0 A;  5L81 A;  1Y19 B;  4KHA A;  5LON B;  2LOX A;  3NWA A;  5C6R A;  4EJN A;  3BIN A;  1XX0 A;  3KZ1 A;  2J0J A;  1GC6 A;  3ULB A;  3NW8 A;  3VIA A;  1V61 A;  2D9Z A;  2K8E A;  2ZPY A;  2YF0 A;  2D2Q A;  2JP2 A;  3NWF A;  4PNK A;  2ROZ B;  3FSS A;  2DYN A;  1MIZ B;  2UZR A;  5DH9 B;  2KIE A;  1W1G A;  4DX8 A;  1X1F A;  2I5C A;  1U5F A;  2RVB B;  4QJ3 B;  3MPX A;  4CYE A;  1QQG A;  1DDV A;  3PZD A;  5DHF B;  3SYX A;  4HAW B;  5C5B B;  4YL8 A;  2VRW B;  1WGQ A;  2CY4 A;  4CSQ A;  3KY9 A;  5C16 A;  2KIG A;  1TXD A;  2OTX A;  5JLJ B;  1DDM A;  3G9W A;  2YS5 A;  2HE7 A;  1ZC4 B;  3N7C A;  2K2U A;  3TCA A;  3WYF B;  1WI1 A;  3ZVR A;  2W2X C;  1MIX A;  2E2X A;  2NMB A;  3NSU A;  1X1G A;  2RGN B;  1U5D A;  4K2P A;  2PZ1 A;  4GPT B;  1V5P A;  2MDX A;  2EMT A;  4D0N B;  4GMV A;  5EFX A;  3A98 B;  1I2H A;  2ELA A;  4Z2M B;  1M7E A;  3ZDT A;  1U29 A;  4PQ0 A;  4HAY B;  2P0H A;  4GN1 A;  5J3T A;  2Z4D A;  1AWE A;  2DFK A;  1BTN A;  2ELB A;  1UEF A;  2DKQ A;  1I7A A;  3AU5 A;  3ODO A;  1EVH A;  1TQZ A;  1OY2 A;  3DXE A;  2IFS A;  1UNR A;  2L1C A;  1ZC3 B;  2L2I A;  5J3Y A;  2DKP A;  2Y8G A;  5DHA B;  4KHB B;  1W1D A;  1K5D B;  3GYP A;  2RRF A;  3WA0 A;  4KAX B;  2FJU B;  2RLO A;  4QJ4 B;  2YT1 A;  1BAK A;  1MK9 B;  1WG7 A;  3TW1 A;  4A6K A;  5FI1 A;  5I2S A;  2J0M A;  4WVF B;  2CY5 A;  1EGX A;  4MT7 A;  1E5W A;  1J0W A;  1Q67 A;  1MPH A;  2H7D A;  2Z13 A;  4A6H A;  2COA A;  2W2X D;  2ADZ A;  4A6F B; 
#chains in the Genus database with same CATH homology
 2K00 A;  5J3Q A;  1MK7 B;  2D9W A;  3O96 A;  4KVG B;  2Z0P A;  3D8E A;  1FHW A;  4HB0 B;  3MDB C;  2DHK A;  4GMX B;  2LUL A;  1WJM A;  2I1J A;  3P7Z A;  5DI9 B;  3P6A A;  1FOE A;  4C0A A;  1NU2 A;  5HE2 A;  2N23 A;  3F5R A;  1PFJ A;  4HDO A;  1UPQ A;  1FHO A;  2GJY A;  5JHH A;  2LOZ A;  5CLQ B;  4HAU B;  4A6F A;  2YS1 A;  1V88 A;  5D3V A;  3PVU A;  1V5M A;  2EC1 A;  1U2B A;  3SNH A;  4XWX A;  4DBB A;  2DA0 A;  2D9Y A;  2DX1 A;  1RRP B;  2P8V A;  3M1I B;  5DIF B;  2DHJ A;  1EAZ A;  1FB8 A;  1XOD A;  2GCJ A;  3PVL A;  2M38 A;  4DXA B;  5C79 A;  2YS3 A;  4K2O A;  1PLS A;  4K81 A;  3GYO A;  3TFM A;  3D8F A;  1OMW A;  3SV1 A;  1LW3 A;  2IYB A;  1V89 A;  3PP2 A;  3CXB B;  1W1H A;  3FEH A;  4WSF A;  3QWM A;  1FGZ A;  4TKN A;  5KCV A;  2OQB A;  5C5B A;  2DYQ A;  1WJ1 A;  5D3X A;  1U5E A;  4P7I A;  3DXD A;  3KRW A;  2VKI A;  4ZRI A;  1H10 A;  1X86 A;  1ISN A;  4MK0 A;  1KZ7 A;  3PEG A;  1ZSQ A;  2UZS A;  4ZRJ A;  1H4R A;  2DHI A;  3U8Z A;  1GC7 A;  3LJU X;  4CHM A;  1SHC A;  2COF A;  3ODX A;  4HAT B;  4EMO A;  2UVM A;  5D3W A;  2H7E A;  1NTV A;  2I5F A;  2QKM A;  2KUP A;  2V76 A;  1SGH A;  5D3Y A;  2DLW A;  1M7R A;  2DTC A;  4Z2N A;  5KQ1 A;  3OAN A;  4ZRK A;  2DX5 A;  3ODW A;  2Q13 A;  4B6H A;  2VSZ A;  2W2W A;  4F7G A;  3KSY A;  2R0D A;  1X05 A;  4HB3 B;  3F0W A;  3FM8 C;  2X18 A;  4HAV B;  4BBK A;  5KQ4 A;  1DYN A;  2Z0O A;  4IFS A;  4TYZ A;  2J59 M;  2MKR A;  2MWN B;  1RJ2 A;  4HB4 B;  1IRS A;  2D11 A;  1UNP A;  1LB1 A;  4F7H A;  3IVF A;  3TO1 A;  1XR0 B;  2YRY A;  1ZVR A;  4HAX B;  1P6S A;  3V5W A;  1U5G A;  5CLL B;  4H8S A;  5GOW B;  1XD4 A;  2EJ8 A;  3A8P A;  2COC A;  3D8D A;  3PG7 A;  2BCJ A;  2K2J A;  5D27 A;  3VOQ A;  1DBH A;  1PMS A;  1NTY A;  1V5U A;  2Z0Q A;  4HDQ A;  2CRF A;  5HE3 A;  3T06 A;  1UPR A;  2KGX B;  1Y5O A;  1MAI A;  2LYD A;  4EKU A;  3QBV B;  2Y8F A;  1XKE A;  1J19 A;  3RCP A;  2RNR B;  1KI1 B;  2MFQ A;  1WVH A;  2GCL A;  2RUK B;  2FJL A;  2G35 A;  3SO6 A;  4HB2 B;  3SUZ A;  3ULC A;  3ML4 A;  2Y7B A;  2NZ8 B;  4Y94 A;  1ZM0 A;  2M14 A;  4L6E A;  1DRO A;  5JP4 A;  4HHV A;  4KHO A;  2EMS A;  1DDW A;  4IAP A;  4MY6 A;  2YSZ A;  1GG3 A;  2D9X A;  4GXB A;  3HQC A;  3TVV A;  1P5T A;  2AEH A;  1MKE A;  3CIK A;  1U27 A;  1QC6 A;  3DXC A;  1AQC A;  1KZG A;  4GZU A;  1EF1 A;  1XCG A;  4HAZ B;  3AU4 A;  3U7D A;  2P0F A;  4IOY X;  3PVW A;  2D4Q A;  4YON A;  3X23 A;  2D10 A;  1N3H A;  1OQN A;  2P0D A;  1P3R A;  1FAO A;  2HTH B;  3HK0 A;  2YT0 A;  3KRX A;  2RSG A;  2XQN M;  4A5K A;  2R09 A;  3A8Q A;  2LKO A;  3PSC A;  5HE1 A;  1TJ6 A;  3AJ4 A;  1X11 A;  2DN6 A;  2J0K A;  2D9V A;  1K5G B;  4WJ7 A;  1FHX A;  2QKL A;  3BJI A;  2ROV A;  3UZT A;  1NI2 A;  3QIJ A;  2LG1 A;  2I1K A;  1Z87 A;  5FI0 A;  5HE0 A;  2COD A;  4F7U P;  1UNQ A;  1BTK A;  2CAY A;  2AL6 A;  2KCJ A;  1WGU A;  5LOP B;  1FGY A;  4K17 A;  2YVC A;  4DX9 0;  3HW2 B;  4NSW A;  4CHJ A;  2N0Y A;  1B55 A;  5JHG A;  2GS0 A;  1BWN A;  4NY0 A;  5L81 A;  1Y19 B;  4KHA A;  5LON B;  2LOX A;  5C6R A;  4EJN A;  3BIN A;  1XX0 A;  3KZ1 A;  2J0J A;  1GC6 A;  3ULB A;  3VIA A;  1V61 A;  2D9Z A;  2ZPY A;  2YF0 A;  2D2Q A;  2JP2 A;  4PNK A;  2ROZ B;  3FSS A;  2DYN A;  1MIZ B;  2UZR A;  5DH9 B;  1W1G A;  4DX8 A;  1X1F A;  2I5C A;  1U5F A;  2RVB B;  3MPX A;  4CYE A;  1QQG A;  1DDV A;  3PZD A;  5DHF B;  3SYX A;  4HAW B;  5C5B B;  4YL8 A;  2VRW B;  1WGQ A;  2CY4 A;  3KY9 A;  5C16 A;  2OTX A;  1TXD A;  5JLJ B;  1DDM A;  3G9W A;  2YS5 A;  2HE7 A;  1ZC4 B;  3N7C A;  2K2U A;  3TCA A;  3WYF B;  1WI1 A;  3ZVR A;  2W2X C;  1MIX A;  2E2X A;  2NMB A;  3NSU A;  1X1G A;  2RGN B;  1U5D A;  4K2P A;  2PZ1 A;  4GPT B;  1V5P A;  2MDX A;  2EMT A;  4D0N B;  4GMV A;  5EFX A;  3A98 B;  1I2H A;  2ELA A;  4Z2M B;  1M7E A;  3ZDT A;  1U29 A;  4PQ0 A;  4HAY B;  2P0H A;  4GN1 A;  5J3T A;  1AWE A;  2DFK A;  1BTN A;  2ELB A;  1UEF A;  2DKQ A;  1I7A A;  3AU5 A;  3ODO A;  1EVH A;  1TQZ A;  1OY2 A;  3DXE A;  2IFS A;  1UNR A;  2L1C A;  1ZC3 B;  2L2I A;  5J3Y A;  2DKP A;  2Y8G A;  5DHA B;  4KHB B;  1W1D A;  1K5D B;  3GYP A;  3WA0 A;  4KAX B;  2RLO A;  2YT1 A;  1BAK A;  1MK9 B;  1WG7 A;  3TW1 A;  4A6K A;  5FI1 A;  2J0M A;  4WVF B;  2CY5 A;  1EGX A;  4MT7 A;  1E5W A;  1J0W A;  1Q67 A;  1MPH A;  2H7D A;  4A6H A;  2COA A;  2W2X D;  2ADZ A;  4A6F B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...