2K00A

Solution structure of the talin f3 in complex with layilin cytodomain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
GVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Talin-1
publication title Structural basis for the interaction between the cytoplasmic domain of the hyaluronate receptor layilin and the talin F3 subdomain
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
total genus 17
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2k00A00
2K2JA 2K2UA 2R09A 3ODWA 2E2XA 5HE1A 2DN6A 4K81A 4GZUA 3A8QA 1BAKA 2N23A 4H8SA 3HQCA 3MDBC 3KSYA 1V5MA 3M1IB 2L2IA 3PVLA 2DKQA 2ROVA 2J0KA 2D9XA 2J59M 1EF1A 2RGNB 5HE2A 3SYXA 1NTYA 1SHCA 1ZC3B 1FGYA 2XQNM 2OTXA 4HAWB 2Z0PA 4K17A 5FI0A 2CY4A 1QC6A 1NTVA 4F7HA 3TW1A 3X23A 3ODXA 1FAOA 1RJ2A 4KVGB 2M14A 3IVFA 2W2XC 4XWXA 3LJUX 4C0AA 2LULA 3VIAA 4EMOA 1KZ7A 1J0WA 3DXEA 1UPRA 3G9WA 3KRWA 4HHVA 1MPHA 5KQ4A 4K2PA 3ODOA 4KAXB 3PG7A 4PQ0A 3ZDTA 1J19A 1U29A 2RLOA 2IFSA 4D0NB 3TFMA 1WI1A 1K5DB 2HTHB 5C79A 3ML4A 3FEHA 1I2HA 3RCPA 2HE7A 1Q67A 2DHJA 1V5PA 5JHHA 4GN1A 1TXDA 2I1JA 5D3WA 3PVUA 1V5UA 1QQGA 1Z87A 4HAXB 1EGXA 3HW2B 3KZ1A 1OMWA 3OANA 4ZRKA 1GC6A 3VOQA 2LKOA 2COCA 4P7IA 4PNKA 4NSWA 2ELAA 2V76A 3SV1A 5D27A 1V61A 2D9VA 2W2WA 5LOPB 2JP2A 1LB1A 4HDQA 4F7UP 3HK0A 2UZSA 2D9YA 2YT1A 1U5FA 2D10A 3AJ4A 1ZVRA 1U5EA 2K00A 3D8DA 2Z0QA 3U7DA 2I5FA 4HB2B 2PZ1A 3BJIA 1UEFA 2RUKB 2YF0A 2NZ8B 1DDMA 5D3VA 2P0FA 2QKMA 1XKEA 1E5WA 3PEGA 2ADZA 5DI9B 3A8PA 1FHWA 4HAZB 5D3XA 1DYNA 5D3YA 3D8FA 3TO1A 1RRPB 1UNPA 1B55A 2MWNB 1XODA 2CY5A 4DX90 5CLQB 2L1CA 3QBVB 3SUZA 5J3YA 1W1HA 4A6KA 1MK9B 3PZDA 5EFXA 1U27A 3BINA 2YSZA 1MK7B 3UZTA 1ZSQA 2DX5A 4L6EA 2COAA 1UNRA 4A6FA 4WJ7A 2ROZB 1FGZA 1P3RA 1LW3A 4HAUB 2DYQA 3P6AA 3U8ZA 2I5CA 1DBHA 4CYEA 2DYNA 1W1DA 4MT7A 1MKEA 4MK0A 3MPXA 2H7DA 4KHOA 2Z0OA 2P8VA 1X1FA 2EC1A 1XD4A 1XCGA 1KI1B 1ISNA 2DA0A 2FJLA 2NMBA 4B6HA 1FHOA 2H7EA 2DHKA 3CIKA 2CRFA 1UPQA 3DXCA 3FM8C 2DLWA 5DHFB 3SNHA 2QKLA 5C6RA 1WGQA 1BWNA 4MY6A 1M7EA 5DH9B 1XX0A 1PMSA 1H4RA 1Y5OA 1N3HA 3FSSA 2UZRA 4BBKA 4A5KA 2RVBB 4WVFB 2ELBA 2LG1A 1FB8A 3SO6A 4KHAA 2J0JA 1MIZB 2MFQA 2VRWB 1DDVA 4F7GA 4WSFA 1MIXA 2VKIA 4K2OA 1GG3A 3T06A 4NY0A 1I7AA 1WG7A 5JP4A 4ZRIA 1H10A 1M7RA 2GJYA 1GC7A 2GCLA 5CLLB 2AEHA 2DKPA 2J0MA 2G35A 2LOZA 2ZPYA 2YVCA 4GMXB 3A98B 3KRXA 3ULBA 1NU2A 1AWEA 3TVVA 1SGHA 1P6SA 2Y8GA 5HE0A 2MDXA 1K5GB 1XR0B 1EAZA 2LOXA 2KUPA 1WJMA 4YONA 4A6HA 4GPTB 1U5GA 2YT0A 4DBBA 2OQBA 2DX1A 2RSGA 2Y8FA 2EMSA 3PSCA 5HE3A 2D11A 4Y94A 3AU5A 1ZM0A 3DXDA 5J3QA 2YS3A 3V5WA 3WYFB 2DFKA 2AL6A 3QIJA 5JLJB 1AQCA 2DHIA 2YS5A 3N7CA 2EMTA 4CHMA 3ULCA 2VSZA 3AU4A 2CAYA 1KZGA 2P0HA 4ZRJA 3WA0A 5LONB 1EVHA 2I1KA 1P5TA 2DTCA 4IFSA 4YL8A 5J3TA 1ZC4B 1MAIA 1WGUA 2MKRA 4GMVA 1FHXA 4TKNA 2GCJA 4KHBB 3GYPA 1X1GA 4HATB 1TJ6A 1U2BA 3KY9A 4DX8A 4HB0B 1V89A 4HB3B 4IOYX 3PP2A 1OY2A 2X18A 4Z2MB 2D9ZA 2IYBA 4HDOA 1DDWA 2COFA 5DHAB 1FOEA 3F0WA 2M38A 4IAPA 1UNQA 4HB4B 5JHGA 4A6FB 5C5BA 1X11A 5C16A 2UVMA 2D9WA 4EJNA 5KQ1A 4HAYB 3ZVRA 5FI1A 1U5DA 3GYOA 2YS1A 3O96A 5L81A 4EKUA 1BTNA 1V88A 1PLSA 2D4QA 2KCJA 3QWMA 3TCAA 1W1GA 2KGXB 1Y19B 2RNRB 1OQNA 1X05A 4DXAB 2W2XD 2R0DA 2GS0A 2LYDA 2CODA 2EJ8A 1TQZA 5GOWB 5DIFB 4CHJA 2Q13A 5C5BB 1NI2A 1X86A 2YRYA 2D2QA 1WJ1A 5KCVA 3P7ZA 1PFJA 4HAVB 1DROA 2P0DA 3CXBB 4TYZA 2Y7BA 2N0YA 1IRSA 4GXBA 4Z2NA 3PVWA 1WVHA 2BCJA 3D8EA 3F5RA 1BTKA 3NSUA
chains in the Genus database with same CATH superfamily
2K2JA 2K2UA 2R09A 3ODWA 2E2XA 5HE1A 2DN6A 4K81A 4GZUA 3A8QA 1BAKA 2N23A 4H8SA 3HQCA 3MDBC 3KSYA 1V5MA 3M1IB 2L2IA 3HIEA 3PVLA 2DKQA 2ROVA 2J0KA 2D9XA 2J59M 1EF1A 5M4YB 2RGNB 5HE2A 3SYXA 1NTYA 1SHCA 1ZC3B 1FGYA 2XQNM 2OTXA 4HAWB 2Z0PA 4K17A 5FI0A 2CY4A 1QC6A 1NTVA 4F7HA 2K49A 4GOUA 3TW1A 3X23A 3ODXA 1FAOA 1RJ2A 4KVGB 4GNKB 2M14A 3IVFA 2W2XC 4XWXA 3LJUX 4C0AA 2LULA 3VIAA 4EMOA 1KZ7A 1J0WA 3DXEA 4OT1A 1UPRA 3G9WA 3KRWA 4HHVA 1MPHA 5KQ4A 4K2PA 4D6WA 3ODOA 4KAXB 3PG7A 4PQ0A 3ZDTA 1J19A 1U29A 2RLOA 2IFSA 2RRFA 4D0NB 3TFMA 1WI1A 1K5DB 2HTHB 5C79A 3ML4A 4QJ3B 3U12A 3FEHA 1I2HA 3RCPA 2HE7A 2KUQA 1Q67A 2DHJA 1V5PA 5JHHA 2ZKMX 4GN1A 1TXDA 2I1JA 5D3WA 3PVUA 1V5UA 1QQGA 1Z87A 4HAXB 1EGXA 3NWDA 3HW2B 3KZ1A 1OMWA 3OANA 4ZRKA 1GC6A 3VOQA 2LKOA 2COCA 4P7IA 1T77A 4PNKA 4NSWA 2ELAA 2V76A 3SV1A 5D27A 4QJ5B 1V61A 2D9VA 2W2WA 5LOPB 2JP2A 1LB1A 4HDQA 4F7UP 3HK0A 5IRSA 2UZSA 4QXAB 2D9YA 2YT1A 1U5FA 2D10A 3AJ4A 1ZVRA 1U5EA 2K00A 3D8DA 2Z0QA 3U7DA 4HSIA 5LG4B 2I5FA 4HB2B 2PZ1A 3BJIA 1UEFA 2RUKB 2YF0A 2NZ8B 1DDMA 5D3VA 2P0FA 2QKMA 1XKEA 1E5WA 3PEGA 2ADZA 5DI9B 3A8PA 1FHWA 4HAZB 5D3XA 3B77A 1DYNA 5D3YA 3D8FA 3TO1A 1RRPB 1UNPA 1B55A 2MWNB 1XODA 2CY5A 2Z4DA 4DX90 5CLQB 3OHMB 2L1CA 3QBVB 3SUZA 3A58A 4KHBA 5J3YA 1W1HA 4A6KA 1MK9B 3PZDA 5EFXA 1U27A 3BINA 2YSZA 1MK7B 3UZTA 2NBVA 1ZSQA 2DX5A 4L6EA 2R2YA 2COAA 1UNRA 4A6FA 4WJ7A 2ROZB 1FGZA 1P3RA 1LW3A 4HAUB 2DYQA 3P6AA 3U8ZA 2I5CA 1DBHA 4CYEA 2DYNA 1W1DA 4MT7A 1MKEA 4MK0A 3MPXA 5I2SA 2H7DA 4KHOA 2Z0OA 2P8VA 1X1FA 3NWAA 2EC1A 1XD4A 2Z14A 1XCGA 1KI1B 1ISNA 2DA0A 2FJLA 2NMBA 4B6HA 1FHOA 2H7EA 2DHKA 3CIKA 2CRFA 1UPQA 3DXCA 3FM8C 2DLWA 5DHFB 3SNHA 2QKLA 5C6RA 1WGQA 1BWNA 4MY6A 1M7EA 5DH9B 1XX0A 1PMSA 1H4RA 1Y5OA 1N3HA 3FSSA 2UZRA 4BBKA 4A5KA 2RVBB 4WVFB 2ELBA 2LG1A 1FB8A 3SO6A 4KHAA 2J0JA 1MIZB 2MFQA 2VRWB 1DDVA 3DCXA 4F7GA 4WSFA 1MIXA 5I2MA 2VKIA 4K2OA 1GG3A 3T06A 4NY0A 1I7AA 1WG7A 5JP4A 4ZRIA 4QJ4B 1H10A 1M7RA 2GJYA 1GC7A 2GCLA 5CLLB 2AEHA 2DKPA 2J0MA 2G35A 2LOZA 2ZPYA 2YVCA 4GMXB 3A98B 3KRXA 3ULBA 1NU2A 1AWEA 3TVVA 1SGHA 1P6SA 2Y8GA 5HE0A 2MDXA 1K5GB 1XR0B 1EAZA 2LOXA 2KUPA 1WJMA 4YONA 4A6HA 4GPTB 1U5GA 2YT0A 4DBBA 2OQBA 2DX1A 2RSGA 2Y8FA 2EMSA 3PSCA 5HE3A 2D11A 4Y94A 2Z59A 1ZM0A 3AU5A 3DXDA 5J3QA 2YS3A 3V5WA 3WYFB 2DFKA 2AL6A 3QIJA 3FVCA 5JLJB 1AQCA 2DHIA 2YS5A 3N7CA 2EMTA 2FJUB 4CHMA 3ULCA 2VSZA 3AU4A 2CAYA 1KZGA 2P0HA 4DIXA 4ZRJA 3WA0A 4CSQA 5LONB 1EVHA 2I1KA 1P5TA 2DTCA 4IFSA 4YL8A 5J3TA 1ZC4B 1MAIA 1WGUA 2MKRA 4GMVA 1FHXA 4TKNA 2GCJA 4KHBB 3GYPA 1X1GA 4HATB 2GUMA 1TJ6A 4OSNA 1U2BA 3KY9A 4DX8A 4HB0B 1V89A 4HB3B 4IOYX 3PP2A 1OY2A 2X18A 4Z2MB 2D9ZA 2IYBA 4HDOA 1DDWA 2COFA 5DHAB 1FOEA 3F0WA 2M38A 4IAPA 1UNQA 4HB4B 5JHGA 4A6FB 5C5BA 1X11A 4L1RA 5C16A 2UVMA 2D9WA 4EJNA 5KQ1A 4HAYB 3ZVRA 2KIEA 5FI1A 1U5DA 3GYOA 2YS1A 3O96A 5L81A 4EKUA 1BTNA 1V88A 1PLSA 2D4QA 2KCJA 3QWMA 3TCAA 1W1GA 2KGXB 1Y19B 2RNRB 1OQNA 1X05A 4DXAB 2W2XD 2R0DA 2Z13A 2GS0A 1MI1A 2LYDA 2CODA 2EJ8A 2K8EA 2KIGA 3NW8A 1TQZA 5GOWB 5DIFB 4CHJA 2Q13A 5C5BB 1NI2A 1X86A 2YRYA 2D2QA 1WJ1A 5KCVA 3P7ZA 1PFJA 4HAVB 1DROA 3NWFA 2P0DA 2KR0A 3CXBB 4TYZA 2Y7BA 2N0YA 3HSAA 1IRSA 4GXBA 4Z2NA 3PVWA 1WVHA 1ZYIA 2YT2A 2BCJA 3D8EA 3F5RA 1BTKA 3NSUA
chains in the Genus database with same CATH topology
2K2JA 2K2UA 2R09A 3ODWA 2E2XA 5HE1A 2DN6A 4K81A 4GZUA 3A8QA 1BAKA 2N23A 4H8SA 3HQCA 3MDBC 3KSYA 1V5MA 3M1IB 2L2IA 3PVLA 2DKQA 2ROVA 2J0KA 2D9XA 2J59M 1EF1A 2RGNB 5HE2A 3SYXA 1NTYA 1SHCA 1ZC3B 1FGYA 2XQNM 2OTXA 4HAWB 2Z0PA 4K17A 5FI0A 2CY4A 1QC6A 1NTVA 4F7HA 3TW1A 3X23A 3ODXA 1FAOA 1RJ2A 4KVGB 2M14A 3IVFA 2W2XC 4XWXA 3LJUX 4C0AA 2LULA 3VIAA 4EMOA 1KZ7A 1J0WA 3DXEA 1UPRA 3G9WA 3KRWA 4HHVA 1MPHA 5KQ4A 4K2PA 3ODOA 4KAXB 3PG7A 4PQ0A 3ZDTA 1J19A 1U29A 2RLOA 2IFSA 4D0NB 3TFMA 1WI1A 1K5DB 2HTHB 5C79A 3ML4A 3FEHA 1I2HA 3RCPA 2HE7A 1Q67A 2DHJA 1V5PA 5JHHA 4GN1A 1TXDA 2I1JA 5D3WA 3PVUA 1V5UA 1QQGA 1Z87A 4HAXB 1EGXA 3HW2B 3KZ1A 1OMWA 3OANA 4ZRKA 1GC6A 3VOQA 2LKOA 2COCA 4P7IA 4PNKA 4NSWA 2ELAA 2V76A 3SV1A 5D27A 1V61A 2D9VA 2W2WA 5LOPB 2JP2A 1LB1A 4HDQA 4F7UP 3HK0A 2UZSA 2D9YA 2YT1A 1U5FA 2D10A 3AJ4A 1ZVRA 1U5EA 2K00A 3D8DA 2Z0QA 3U7DA 2I5FA 4HB2B 2PZ1A 3BJIA 1UEFA 2RUKB 2YF0A 2NZ8B 1DDMA 5D3VA 2P0FA 2QKMA 1XKEA 1E5WA 3PEGA 2ADZA 5DI9B 3A8PA 1FHWA 4HAZB 5D3XA 1DYNA 5D3YA 3D8FA 3TO1A 1RRPB 1UNPA 1B55A 2MWNB 1XODA 2CY5A 4DX90 5CLQB 2L1CA 3QBVB 3SUZA 5J3YA 1W1HA 4A6KA 1MK9B 3PZDA 5EFXA 1U27A 3BINA 2YSZA 1MK7B 3UZTA 1ZSQA 2DX5A 4L6EA 2COAA 1UNRA 4A6FA 4WJ7A 2ROZB 1FGZA 1P3RA 1LW3A 4HAUB 2DYQA 3P6AA 3U8ZA 2I5CA 1DBHA 4CYEA 2DYNA 1W1DA 4MT7A 1MKEA 4MK0A 3MPXA 2H7DA 4KHOA 2Z0OA 2P8VA 1X1FA 2EC1A 1XD4A 1XCGA 1KI1B 1ISNA 2DA0A 2FJLA 2NMBA 4B6HA 1FHOA 2H7EA 2DHKA 3CIKA 2CRFA 1UPQA 3DXCA 3FM8C 2DLWA 5DHFB 3SNHA 2QKLA 5C6RA 1WGQA 1BWNA 4MY6A 1M7EA 5DH9B 1XX0A 1PMSA 1H4RA 1Y5OA 1N3HA 3FSSA 2UZRA 4BBKA 4A5KA 2RVBB 4WVFB 2ELBA 2LG1A 1FB8A 3SO6A 4KHAA 2J0JA 1MIZB 2MFQA 2VRWB 1DDVA 4F7GA 4WSFA 1MIXA 2VKIA 4K2OA 1GG3A 3T06A 4NY0A 1I7AA 1WG7A 5JP4A 4ZRIA 1H10A 1M7RA 2GJYA 1GC7A 2GCLA 5CLLB 2AEHA 2DKPA 2J0MA 2G35A 2LOZA 2ZPYA 2YVCA 4GMXB 3A98B 3KRXA 3ULBA 1NU2A 1AWEA 3TVVA 1SGHA 1P6SA 2Y8GA 5HE0A 2MDXA 1K5GB 1XR0B 1EAZA 2LOXA 2KUPA 1WJMA 4YONA 4A6HA 4GPTB 1U5GA 2YT0A 4DBBA 2OQBA 2DX1A 2RSGA 2Y8FA 2EMSA 3PSCA 5HE3A 2D11A 4Y94A 3AU5A 1ZM0A 3DXDA 5J3QA 2YS3A 3V5WA 3WYFB 2DFKA 2AL6A 3QIJA 5JLJB 1AQCA 2DHIA 2YS5A 3N7CA 2EMTA 4CHMA 3ULCA 2VSZA 3AU4A 2CAYA 1KZGA 2P0HA 4ZRJA 3WA0A 5LONB 1EVHA 2I1KA 1P5TA 2DTCA 4IFSA 4YL8A 5J3TA 1ZC4B 1MAIA 1WGUA 2MKRA 4GMVA 1FHXA 4TKNA 2GCJA 4KHBB 3GYPA 1X1GA 4HATB 1TJ6A 1U2BA 3KY9A 4DX8A 4HB0B 1V89A 4HB3B 4IOYX 3PP2A 1OY2A 2X18A 4Z2MB 2D9ZA 2IYBA 4HDOA 1DDWA 2COFA 5DHAB 1FOEA 3F0WA 2M38A 4IAPA 1UNQA 4HB4B 5JHGA 4A6FB 5C5BA 1X11A 5C16A 2UVMA 2D9WA 4EJNA 5KQ1A 4HAYB 3ZVRA 5FI1A 1U5DA 3GYOA 2YS1A 3O96A 5L81A 4EKUA 1BTNA 1V88A 1PLSA 2D4QA 2KCJA 3QWMA 3TCAA 1W1GA 2KGXB 1Y19B 2RNRB 1OQNA 1X05A 4DXAB 2W2XD 2R0DA 2GS0A 2LYDA 2CODA 2EJ8A 1TQZA 5GOWB 5DIFB 4CHJA 2Q13A 5C5BB 1NI2A 1X86A 2YRYA 2D2QA 1WJ1A 5KCVA 3P7ZA 1PFJA 4HAVB 1DROA 2P0DA 3CXBB 4TYZA 2Y7BA 2N0YA 1IRSA 4GXBA 4Z2NA 3PVWA 1WVHA 2BCJA 3D8EA 3F5RA 1BTKA 3NSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K2J A;  2K2U A;  2R09 A;  3ODW A;  2E2X A;  5HE1 A;  2DN6 A;  4K81 A;  4GZU A;  3A8Q A;  1BAK A;  2N23 A;  4H8S A;  3HQC A;  3MDB C;  3KSY A;  1V5M A;  3M1I B;  2L2I A;  3PVL A;  2DKQ A;  2ROV A;  2J0K A;  2D9X A;  2J59 M;  1EF1 A;  2RGN B;  5HE2 A;  3SYX A;  1NTY A;  1SHC A;  1ZC3 B;  1FGY A;  2XQN M;  2OTX A;  4HAW B;  2Z0P A;  4K17 A;  5FI0 A;  2CY4 A;  1QC6 A;  1NTV A;  4F7H A;  3TW1 A;  3X23 A;  3ODX A;  1FAO A;  1RJ2 A;  4KVG B;  2M14 A;  3IVF A;  2W2X C;  4XWX A;  3LJU X;  4C0A A;  2LUL A;  3VIA A;  4EMO A;  1KZ7 A;  1J0W A;  3DXE A;  1UPR A;  3G9W A;  3KRW A;  4HHV A;  1MPH A;  5KQ4 A;  4K2P A;  3ODO A;  4KAX B;  3PG7 A;  4PQ0 A;  3ZDT A;  1J19 A;  1U29 A;  2RLO A;  2IFS A;  4D0N B;  3TFM A;  1WI1 A;  1K5D B;  2HTH B;  5C79 A;  3ML4 A;  3FEH A;  1I2H A;  3RCP A;  2HE7 A;  1Q67 A;  2DHJ A;  1V5P A;  5JHH A;  4GN1 A;  1TXD A;  2I1J A;  5D3W A;  3PVU A;  1V5U A;  1QQG A;  1Z87 A;  4HAX B;  1EGX A;  3HW2 B;  3KZ1 A;  1OMW A;  3OAN A;  4ZRK A;  1GC6 A;  3VOQ A;  2LKO A;  2COC A;  4P7I A;  4PNK A;  4NSW A;  2ELA A;  2V76 A;  3SV1 A;  5D27 A;  1V61 A;  2D9V A;  2W2W A;  5LOP B;  2JP2 A;  1LB1 A;  4HDQ A;  4F7U P;  3HK0 A;  2UZS A;  2D9Y A;  2YT1 A;  1U5F A;  2D10 A;  3AJ4 A;  1ZVR A;  1U5E A;  2K00 A;  3D8D A;  2Z0Q A;  3U7D A;  2I5F A;  4HB2 B;  2PZ1 A;  3BJI A;  1UEF A;  2RUK B;  2YF0 A;  2NZ8 B;  1DDM A;  5D3V A;  2P0F A;  2QKM A;  1XKE A;  1E5W A;  3PEG A;  2ADZ A;  5DI9 B;  3A8P A;  1FHW A;  4HAZ B;  5D3X A;  1DYN A;  5D3Y A;  3D8F A;  3TO1 A;  1RRP B;  1UNP A;  1B55 A;  2MWN B;  1XOD A;  2CY5 A;  4DX9 0;  5CLQ B;  2L1C A;  3QBV B;  3SUZ A;  5J3Y A;  1W1H A;  4A6K A;  1MK9 B;  3PZD A;  5EFX A;  1U27 A;  3BIN A;  2YSZ A;  1MK7 B;  3UZT A;  1ZSQ A;  2DX5 A;  4L6E A;  2COA A;  1UNR A;  4A6F A;  4WJ7 A;  2ROZ B;  1FGZ A;  1P3R A;  1LW3 A;  4HAU B;  2DYQ A;  3P6A A;  3U8Z A;  2I5C A;  1DBH A;  4CYE A;  2DYN A;  1W1D A;  4MT7 A;  1MKE A;  4MK0 A;  3MPX A;  2H7D A;  4KHO A;  2Z0O A;  2P8V A;  1X1F A;  2EC1 A;  1XD4 A;  1XCG A;  1KI1 B;  1ISN A;  2DA0 A;  2FJL A;  2NMB A;  4B6H A;  1FHO A;  2H7E A;  2DHK A;  3CIK A;  2CRF A;  1UPQ A;  3DXC A;  3FM8 C;  2DLW A;  5DHF B;  3SNH A;  2QKL A;  5C6R A;  1WGQ A;  1BWN A;  4MY6 A;  1M7E A;  5DH9 B;  1XX0 A;  1PMS A;  1H4R A;  1Y5O A;  1N3H A;  3FSS A;  2UZR A;  4BBK A;  4A5K A;  2RVB B;  4WVF B;  2ELB A;  2LG1 A;  1FB8 A;  3SO6 A;  4KHA A;  2J0J A;  1MIZ B;  2MFQ A;  2VRW B;  1DDV A;  4F7G A;  4WSF A;  1MIX A;  2VKI A;  4K2O A;  1GG3 A;  3T06 A;  4NY0 A;  1I7A A;  1WG7 A;  5JP4 A;  4ZRI A;  1H10 A;  1M7R A;  2GJY A;  1GC7 A;  2GCL A;  5CLL B;  2AEH A;  2DKP A;  2J0M A;  2G35 A;  2LOZ A;  2ZPY A;  2YVC A;  4GMX B;  3A98 B;  3KRX A;  3ULB A;  1NU2 A;  1AWE A;  3TVV A;  1SGH A;  1P6S A;  2Y8G A;  5HE0 A;  2MDX A;  1K5G B;  1XR0 B;  1EAZ A;  2LOX A;  2KUP A;  1WJM A;  4YON A;  4A6H A;  4GPT B;  1U5G A;  2YT0 A;  4DBB A;  2OQB A;  2DX1 A;  2RSG A;  2Y8F A;  2EMS A;  3PSC A;  5HE3 A;  2D11 A;  4Y94 A;  3AU5 A;  1ZM0 A;  3DXD A;  5J3Q A;  2YS3 A;  3V5W A;  3WYF B;  2DFK A;  2AL6 A;  3QIJ A;  5JLJ B;  1AQC A;  2DHI A;  2YS5 A;  3N7C A;  2EMT A;  4CHM A;  3ULC A;  2VSZ A;  3AU4 A;  2CAY A;  1KZG A;  2P0H A;  4ZRJ A;  3WA0 A;  5LON B;  1EVH A;  2I1K A;  1P5T A;  2DTC A;  4IFS A;  4YL8 A;  5J3T A;  1ZC4 B;  1MAI A;  1WGU A;  2MKR A;  4GMV A;  1FHX A;  4TKN A;  2GCJ A;  4KHB B;  3GYP A;  1X1G A;  4HAT B;  1TJ6 A;  1U2B A;  3KY9 A;  4DX8 A;  4HB0 B;  1V89 A;  4HB3 B;  4IOY X;  3PP2 A;  1OY2 A;  2X18 A;  4Z2M B;  2D9Z A;  2IYB A;  4HDO A;  1DDW A;  2COF A;  5DHA B;  1FOE A;  3F0W A;  2M38 A;  4IAP A;  1UNQ A;  4HB4 B;  5JHG A;  4A6F B;  5C5B A;  1X11 A;  5C16 A;  2UVM A;  2D9W A;  4EJN A;  5KQ1 A;  4HAY B;  3ZVR A;  5FI1 A;  1U5D A;  3GYO A;  2YS1 A;  3O96 A;  5L81 A;  4EKU A;  1BTN A;  1V88 A;  1PLS A;  2D4Q A;  2KCJ A;  3QWM A;  3TCA A;  1W1G A;  2KGX B;  1Y19 B;  2RNR B;  1OQN A;  1X05 A;  4DXA B;  2W2X D;  2R0D A;  2GS0 A;  2LYD A;  2COD A;  2EJ8 A;  1TQZ A;  5GOW B;  5DIF B;  4CHJ A;  2Q13 A;  5C5B B;  1NI2 A;  1X86 A;  2YRY A;  2D2Q A;  1WJ1 A;  5KCV A;  3P7Z A;  1PFJ A;  4HAV B;  1DRO A;  2P0D A;  3CXB B;  4TYZ A;  2Y7B A;  2N0Y A;  1IRS A;  4GXB A;  4Z2N A;  3PVW A;  1WVH A;  2BCJ A;  3D8E A;  3F5R A;  1BTK A;  3NSU A; 
#chains in the Genus database with same CATH topology
 2K2J A;  2K2U A;  2R09 A;  3ODW A;  2E2X A;  5HE1 A;  2DN6 A;  4K81 A;  4GZU A;  3A8Q A;  1BAK A;  2N23 A;  4H8S A;  3HQC A;  3MDB C;  3KSY A;  1V5M A;  3M1I B;  2L2I A;  3HIE A;  3PVL A;  2DKQ A;  2ROV A;  2J0K A;  2D9X A;  2J59 M;  1EF1 A;  5M4Y B;  2RGN B;  5HE2 A;  3SYX A;  1NTY A;  1SHC A;  1ZC3 B;  1FGY A;  2XQN M;  2OTX A;  4HAW B;  2Z0P A;  4K17 A;  5FI0 A;  2CY4 A;  1QC6 A;  1NTV A;  4F7H A;  2K49 A;  4GOU A;  3TW1 A;  3X23 A;  3ODX A;  1FAO A;  1RJ2 A;  4KVG B;  4GNK B;  2M14 A;  3IVF A;  2W2X C;  4XWX A;  3LJU X;  4C0A A;  2LUL A;  3VIA A;  4EMO A;  1KZ7 A;  1J0W A;  3DXE A;  4OT1 A;  1UPR A;  3G9W A;  3KRW A;  4HHV A;  1MPH A;  5KQ4 A;  4K2P A;  4D6W A;  3ODO A;  4KAX B;  3PG7 A;  4PQ0 A;  3ZDT A;  1J19 A;  1U29 A;  2RLO A;  2IFS A;  2RRF A;  4D0N B;  3TFM A;  1WI1 A;  1K5D B;  2HTH B;  5C79 A;  3ML4 A;  4QJ3 B;  3U12 A;  3FEH A;  1I2H A;  3RCP A;  2HE7 A;  2KUQ A;  1Q67 A;  2DHJ A;  1V5P A;  5JHH A;  2ZKM X;  4GN1 A;  1TXD A;  2I1J A;  5D3W A;  3PVU A;  1V5U A;  1QQG A;  1Z87 A;  4HAX B;  1EGX A;  3NWD A;  3HW2 B;  3KZ1 A;  1OMW A;  3OAN A;  4ZRK A;  1GC6 A;  3VOQ A;  2LKO A;  2COC A;  4P7I A;  1T77 A;  4PNK A;  4NSW A;  2ELA A;  2V76 A;  3SV1 A;  5D27 A;  4QJ5 B;  1V61 A;  2D9V A;  2W2W A;  5LOP B;  2JP2 A;  1LB1 A;  4HDQ A;  4F7U P;  3HK0 A;  5IRS A;  2UZS A;  4QXA B;  2D9Y A;  2YT1 A;  1U5F A;  2D10 A;  3AJ4 A;  1ZVR A;  1U5E A;  2K00 A;  3D8D A;  2Z0Q A;  3U7D A;  4HSI A;  5LG4 B;  2I5F A;  4HB2 B;  2PZ1 A;  3BJI A;  1UEF A;  2RUK B;  2YF0 A;  2NZ8 B;  1DDM A;  5D3V A;  2P0F A;  2QKM A;  1XKE A;  1E5W A;  3PEG A;  2ADZ A;  5DI9 B;  3A8P A;  1FHW A;  4HAZ B;  5D3X A;  3B77 A;  1DYN A;  5D3Y A;  3D8F A;  3TO1 A;  1RRP B;  1UNP A;  1B55 A;  2MWN B;  1XOD A;  2CY5 A;  2Z4D A;  4DX9 0;  5CLQ B;  3OHM B;  2L1C A;  3QBV B;  3SUZ A;  3A58 A;  4KHB A;  5J3Y A;  1W1H A;  4A6K A;  1MK9 B;  3PZD A;  5EFX A;  1U27 A;  3BIN A;  2YSZ A;  1MK7 B;  3UZT A;  2NBV A;  1ZSQ A;  2DX5 A;  4L6E A;  2R2Y A;  2COA A;  1UNR A;  4A6F A;  4WJ7 A;  2ROZ B;  1FGZ A;  1P3R A;  1LW3 A;  4HAU B;  2DYQ A;  3P6A A;  3U8Z A;  2I5C A;  1DBH A;  4CYE A;  2DYN A;  1W1D A;  4MT7 A;  1MKE A;  4MK0 A;  3MPX A;  5I2S A;  2H7D A;  4KHO A;  2Z0O A;  2P8V A;  1X1F A;  3NWA A;  2EC1 A;  1XD4 A;  2Z14 A;  1XCG A;  1KI1 B;  1ISN A;  2DA0 A;  2FJL A;  2NMB A;  4B6H A;  1FHO A;  2H7E A;  2DHK A;  3CIK A;  2CRF A;  1UPQ A;  3DXC A;  3FM8 C;  2DLW A;  5DHF B;  3SNH A;  2QKL A;  5C6R A;  1WGQ A;  1BWN A;  4MY6 A;  1M7E A;  5DH9 B;  1XX0 A;  1PMS A;  1H4R A;  1Y5O A;  1N3H A;  3FSS A;  2UZR A;  4BBK A;  4A5K A;  2RVB B;  4WVF B;  2ELB A;  2LG1 A;  1FB8 A;  3SO6 A;  4KHA A;  2J0J A;  1MIZ B;  2MFQ A;  2VRW B;  1DDV A;  3DCX A;  4F7G A;  4WSF A;  1MIX A;  5I2M A;  2VKI A;  4K2O A;  1GG3 A;  3T06 A;  4NY0 A;  1I7A A;  1WG7 A;  5JP4 A;  4ZRI A;  4QJ4 B;  1H10 A;  1M7R A;  2GJY A;  1GC7 A;  2GCL A;  5CLL B;  2AEH A;  2DKP A;  2J0M A;  2G35 A;  2LOZ A;  2ZPY A;  2YVC A;  4GMX B;  3A98 B;  3KRX A;  3ULB A;  1NU2 A;  1AWE A;  3TVV A;  1SGH A;  1P6S A;  2Y8G A;  5HE0 A;  2MDX A;  1K5G B;  1XR0 B;  1EAZ A;  2LOX A;  2KUP A;  1WJM A;  4YON A;  4A6H A;  4GPT B;  1U5G A;  2YT0 A;  4DBB A;  2OQB A;  2DX1 A;  2RSG A;  2Y8F A;  2EMS A;  3PSC A;  5HE3 A;  2D11 A;  4Y94 A;  2Z59 A;  1ZM0 A;  3AU5 A;  3DXD A;  5J3Q A;  2YS3 A;  3V5W A;  3WYF B;  2DFK A;  2AL6 A;  3QIJ A;  3FVC A;  5JLJ B;  1AQC A;  2DHI A;  2YS5 A;  3N7C A;  2EMT A;  2FJU B;  4CHM A;  3ULC A;  2VSZ A;  3AU4 A;  2CAY A;  1KZG A;  2P0H A;  4DIX A;  4ZRJ A;  3WA0 A;  4CSQ A;  5LON B;  1EVH A;  2I1K A;  1P5T A;  2DTC A;  4IFS A;  4YL8 A;  5J3T A;  1ZC4 B;  1MAI A;  1WGU A;  2MKR A;  4GMV A;  1FHX A;  4TKN A;  2GCJ A;  4KHB B;  3GYP A;  1X1G A;  4HAT B;  2GUM A;  1TJ6 A;  4OSN A;  1U2B A;  3KY9 A;  4DX8 A;  4HB0 B;  1V89 A;  4HB3 B;  4IOY X;  3PP2 A;  1OY2 A;  2X18 A;  4Z2M B;  2D9Z A;  2IYB A;  4HDO A;  1DDW A;  2COF A;  5DHA B;  1FOE A;  3F0W A;  2M38 A;  4IAP A;  1UNQ A;  4HB4 B;  5JHG A;  4A6F B;  5C5B A;  1X11 A;  4L1R A;  5C16 A;  2UVM A;  2D9W A;  4EJN A;  5KQ1 A;  4HAY B;  3ZVR A;  2KIE A;  5FI1 A;  1U5D A;  3GYO A;  2YS1 A;  3O96 A;  5L81 A;  4EKU A;  1BTN A;  1V88 A;  1PLS A;  2D4Q A;  2KCJ A;  3QWM A;  3TCA A;  1W1G A;  2KGX B;  1Y19 B;  2RNR B;  1OQN A;  1X05 A;  4DXA B;  2W2X D;  2R0D A;  2Z13 A;  2GS0 A;  1MI1 A;  2LYD A;  2COD A;  2EJ8 A;  2K8E A;  2KIG A;  3NW8 A;  1TQZ A;  5GOW B;  5DIF B;  4CHJ A;  2Q13 A;  5C5B B;  1NI2 A;  1X86 A;  2YRY A;  2D2Q A;  1WJ1 A;  5KCV A;  3P7Z A;  1PFJ A;  4HAV B;  1DRO A;  3NWF A;  2P0D A;  2KR0 A;  3CXB B;  4TYZ A;  2Y7B A;  2N0Y A;  3HSA A;  1IRS A;  4GXB A;  4Z2N A;  3PVW A;  1WVH A;  1ZYI A;  2YT2 A;  2BCJ A;  3D8E A;  3F5R A;  1BTK A;  3NSU A; 
#chains in the Genus database with same CATH homology
 2K2J A;  2K2U A;  2R09 A;  3ODW A;  2E2X A;  5HE1 A;  2DN6 A;  4K81 A;  4GZU A;  3A8Q A;  1BAK A;  2N23 A;  4H8S A;  3HQC A;  3MDB C;  3KSY A;  1V5M A;  3M1I B;  2L2I A;  3PVL A;  2DKQ A;  2ROV A;  2J0K A;  2D9X A;  2J59 M;  1EF1 A;  2RGN B;  5HE2 A;  3SYX A;  1NTY A;  1SHC A;  1ZC3 B;  1FGY A;  2XQN M;  2OTX A;  4HAW B;  2Z0P A;  4K17 A;  5FI0 A;  2CY4 A;  1QC6 A;  1NTV A;  4F7H A;  3TW1 A;  3X23 A;  3ODX A;  1FAO A;  1RJ2 A;  4KVG B;  2M14 A;  3IVF A;  2W2X C;  4XWX A;  3LJU X;  4C0A A;  2LUL A;  3VIA A;  4EMO A;  1KZ7 A;  1J0W A;  3DXE A;  1UPR A;  3G9W A;  3KRW A;  4HHV A;  1MPH A;  5KQ4 A;  4K2P A;  3ODO A;  4KAX B;  3PG7 A;  4PQ0 A;  3ZDT A;  1J19 A;  1U29 A;  2RLO A;  2IFS A;  4D0N B;  3TFM A;  1WI1 A;  1K5D B;  2HTH B;  5C79 A;  3ML4 A;  3FEH A;  1I2H A;  3RCP A;  2HE7 A;  1Q67 A;  2DHJ A;  1V5P A;  5JHH A;  4GN1 A;  1TXD A;  2I1J A;  5D3W A;  3PVU A;  1V5U A;  1QQG A;  1Z87 A;  4HAX B;  1EGX A;  3HW2 B;  3KZ1 A;  1OMW A;  3OAN A;  4ZRK A;  1GC6 A;  3VOQ A;  2LKO A;  2COC A;  4P7I A;  4PNK A;  4NSW A;  2ELA A;  2V76 A;  3SV1 A;  5D27 A;  1V61 A;  2D9V A;  2W2W A;  5LOP B;  2JP2 A;  1LB1 A;  4HDQ A;  4F7U P;  3HK0 A;  2UZS A;  2D9Y A;  2YT1 A;  1U5F A;  2D10 A;  3AJ4 A;  1ZVR A;  1U5E A;  2K00 A;  3D8D A;  2Z0Q A;  3U7D A;  2I5F A;  4HB2 B;  2PZ1 A;  3BJI A;  1UEF A;  2RUK B;  2YF0 A;  2NZ8 B;  1DDM A;  5D3V A;  2P0F A;  2QKM A;  1XKE A;  1E5W A;  3PEG A;  2ADZ A;  5DI9 B;  3A8P A;  1FHW A;  4HAZ B;  5D3X A;  1DYN A;  5D3Y A;  3D8F A;  3TO1 A;  1RRP B;  1UNP A;  1B55 A;  2MWN B;  1XOD A;  2CY5 A;  4DX9 0;  5CLQ B;  2L1C A;  3QBV B;  3SUZ A;  5J3Y A;  1W1H A;  4A6K A;  1MK9 B;  3PZD A;  5EFX A;  1U27 A;  3BIN A;  2YSZ A;  1MK7 B;  3UZT A;  1ZSQ A;  2DX5 A;  4L6E A;  2COA A;  1UNR A;  4A6F A;  4WJ7 A;  2ROZ B;  1FGZ A;  1P3R A;  1LW3 A;  4HAU B;  2DYQ A;  3P6A A;  3U8Z A;  2I5C A;  1DBH A;  4CYE A;  2DYN A;  1W1D A;  4MT7 A;  1MKE A;  4MK0 A;  3MPX A;  2H7D A;  4KHO A;  2Z0O A;  2P8V A;  1X1F A;  2EC1 A;  1XD4 A;  1XCG A;  1KI1 B;  1ISN A;  2DA0 A;  2FJL A;  2NMB A;  4B6H A;  1FHO A;  2H7E A;  2DHK A;  3CIK A;  2CRF A;  1UPQ A;  3DXC A;  3FM8 C;  2DLW A;  5DHF B;  3SNH A;  2QKL A;  5C6R A;  1WGQ A;  1BWN A;  4MY6 A;  1M7E A;  5DH9 B;  1XX0 A;  1PMS A;  1H4R A;  1Y5O A;  1N3H A;  3FSS A;  2UZR A;  4BBK A;  4A5K A;  2RVB B;  4WVF B;  2ELB A;  2LG1 A;  1FB8 A;  3SO6 A;  4KHA A;  2J0J A;  1MIZ B;  2MFQ A;  2VRW B;  1DDV A;  4F7G A;  4WSF A;  1MIX A;  2VKI A;  4K2O A;  1GG3 A;  3T06 A;  4NY0 A;  1I7A A;  1WG7 A;  5JP4 A;  4ZRI A;  1H10 A;  1M7R A;  2GJY A;  1GC7 A;  2GCL A;  5CLL B;  2AEH A;  2DKP A;  2J0M A;  2G35 A;  2LOZ A;  2ZPY A;  2YVC A;  4GMX B;  3A98 B;  3KRX A;  3ULB A;  1NU2 A;  1AWE A;  3TVV A;  1SGH A;  1P6S A;  2Y8G A;  5HE0 A;  2MDX A;  1K5G B;  1XR0 B;  1EAZ A;  2LOX A;  2KUP A;  1WJM A;  4YON A;  4A6H A;  4GPT B;  1U5G A;  2YT0 A;  4DBB A;  2OQB A;  2DX1 A;  2RSG A;  2Y8F A;  2EMS A;  3PSC A;  5HE3 A;  2D11 A;  4Y94 A;  3AU5 A;  1ZM0 A;  3DXD A;  5J3Q A;  2YS3 A;  3V5W A;  3WYF B;  2DFK A;  2AL6 A;  3QIJ A;  5JLJ B;  1AQC A;  2DHI A;  2YS5 A;  3N7C A;  2EMT A;  4CHM A;  3ULC A;  2VSZ A;  3AU4 A;  2CAY A;  1KZG A;  2P0H A;  4ZRJ A;  3WA0 A;  5LON B;  1EVH A;  2I1K A;  1P5T A;  2DTC A;  4IFS A;  4YL8 A;  5J3T A;  1ZC4 B;  1MAI A;  1WGU A;  2MKR A;  4GMV A;  1FHX A;  4TKN A;  2GCJ A;  4KHB B;  3GYP A;  1X1G A;  4HAT B;  1TJ6 A;  1U2B A;  3KY9 A;  4DX8 A;  4HB0 B;  1V89 A;  4HB3 B;  4IOY X;  3PP2 A;  1OY2 A;  2X18 A;  4Z2M B;  2D9Z A;  2IYB A;  4HDO A;  1DDW A;  2COF A;  5DHA B;  1FOE A;  3F0W A;  2M38 A;  4IAP A;  1UNQ A;  4HB4 B;  5JHG A;  4A6F B;  5C5B A;  1X11 A;  5C16 A;  2UVM A;  2D9W A;  4EJN A;  5KQ1 A;  4HAY B;  3ZVR A;  5FI1 A;  1U5D A;  3GYO A;  2YS1 A;  3O96 A;  5L81 A;  4EKU A;  1BTN A;  1V88 A;  1PLS A;  2D4Q A;  2KCJ A;  3QWM A;  3TCA A;  1W1G A;  2KGX B;  1Y19 B;  2RNR B;  1OQN A;  1X05 A;  4DXA B;  2W2X D;  2R0D A;  2GS0 A;  2LYD A;  2COD A;  2EJ8 A;  1TQZ A;  5GOW B;  5DIF B;  4CHJ A;  2Q13 A;  5C5B B;  1NI2 A;  1X86 A;  2YRY A;  2D2Q A;  1WJ1 A;  5KCV A;  3P7Z A;  1PFJ A;  4HAV B;  1DRO A;  2P0D A;  3CXB B;  4TYZ A;  2Y7B A;  2N0Y A;  1IRS A;  4GXB A;  4Z2N A;  3PVW A;  1WVH A;  2BCJ A;  3D8E A;  3F5R A;  1BTK A;  3NSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...