2K00A

Solution structure of the talin f3 in complex with layilin cytodomain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
GVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the interaction between the cytoplasmic domain of the hyaluronate receptor layilin and the talin F3 subdomain
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
molecule keywords Talin-1
total genus 17
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2k00A00
2VKIA 2YS5A 3F5RA 3A98B 4ZRJA 2VRWB 4Z2NA 2AL6A 2COFA 4GPTB 2GS0A 2YRYA 4K17A 5D27A 1SHCA 3P6AA 4A6FA 4WVFB 5GOWB 3A8QA 5KQ4A 2DHIA 2LULA 1RJ2A 2Y8FA 4MY6A 3ULCA 3KRWA 2Z0OA 2MWNB 4K81A 3TO1A 4DX90 1BTKA 2D9ZA 2I1KA 5CLLB 4DXAB 2RNRB 5L81A 1H10A 5LONB 5D3WA 2NMBA 1MK7B 5D3XA 3M1IB 2COAA 3SUZA 2DHJA 1I2HA 1DDWA 2YSZA 4HAWB 4KHAA 2D9XA 4KHOA 3TVVA 4HDQA 5C79A 1FHOA 2Z0PA 2CY5A 1MKEA 1BAKA 1ISNA 4P7IA 2KUPA 1E5WA 1B55A 2H7EA 4NSWA 2GCLA 3SV1A 3NSUA 3ODXA 1EF1A 2D4QA 5DH9B 2J0MA 1K5GB 1LW3A 5EFXA 4EKUA 1X1GA 2D9WA 1M7EA 1AWEA 3WYFB 2QKMA 1MK9B 1NI2A 1PFJA 2MKRA 3MDBC 1OMWA 3DXCA 1MIZB 2I1JA 3FM8C 4A6HA 1OY2A 3OANA 3UZTA 1SGHA 3A8PA 5C5BA 3LJUX 3CIKA 1U27A 5DHAB 4HB4B 1DDVA 1ZVRA 4YONA 4KAXB 2FJLA 4HAUB 2MDXA 2OQBA 3KY9A 1BTNA 3BJIA 1DROA 1GC7A 4F7UP 4Y94A 3ZDTA 1MIXA 5KCVA 3KRXA 1UPQA 2ROVA 4GZUA 2ZPYA 2V76A 1LB1A 5HE3A 1U5FA 1WJMA 5C5BB 1GC6A 2DTCA 1QC6A 1GG3A 3X23A 2R09A 5DI9B 3TFMA 5FI1A 1V5PA 4MK0A 2YVCA 2BCJA 2RGNB 1FGYA 3VIAA 5FI0A 1FOEA 2MFQA 4CHJA 1FGZA 5D3YA 2EMTA 2QKLA 2DN6A 3AU4A 3PZDA 2Y8GA 4MT7A 2CAYA 1ZC4B 4HB3B 4HHVA 4DX8A 2W2XD 2D2QA 2D9YA 1ZSQA 3PP2A 4C0AA 1NTYA 1W1GA 3SO6A 4EJNA 3SYXA 1FHWA 1X86A 3ML4A 1FB8A 2YF0A 3GYPA 1TXDA 1UNQA 1V5MA 1M7RA 2RUKB 3SNHA 2NZ8B 2R0DA 1PMSA 1DDMA 3DXEA 1U29A 2Z0QA 2Q13A 1KI1B 1V61A 1XCGA 3VOQA 1Y5OA 5J3QA 2DFKA 1X1FA 2VSZA 5KQ1A 5JLJB 3HK0A 2AEHA 4HAVB 3HW2B 2LOZA 2M38A 1P6SA 4XWXA 2DHKA 2DKQA 3F0WA 3QBVB 1I7AA 4HB0B 3V5WA 4D0NB 1RRPB 1WVHA 2DLWA 2YT0A 3O96A 1V5UA 2W2XC 2N23A 2ELBA 2JP2A 5CLQB 1AQCA 1Z87A 2D9VA 2HTHB 4KHBB 3CXBB 4CHMA 1TQZA 2HE7A 2CODA 1X11A 4Z2MB 2IFSA 1V89A 4GXBA 2L1CA 2E2XA 2EC1A 1NTVA 2GJYA 2L2IA 4A5KA 4IFSA 4WSFA 4IAPA 1ZM0A 1W1DA 4PNKA 3IVFA 1DBHA 2W2WA 2CRFA 1FHXA 2J59M 1P5TA 2Y7BA 5JP4A 2M14A 2P0HA 1OQNA 4GMXB 4HDOA 2CY4A 3D8EA 3TCAA 2K00A 2UZSA 3D8DA 4GN1A 4GMVA 4F7GA 4A6FB 2KGXB 4YL8A 1BWNA 3QIJA 4HAYB 3U8ZA 1UNRA 4WJ7A 3T06A 2H7DA 2DKPA 1TJ6A 2I5FA 5J3YA 4IOYX 2YS3A 3DXDA 1EGXA 1QQGA 2DA0A 2YS1A 4ZRKA 1X05A 1J19A 1PLSA 1XD4A 2P8VA 3ODOA 2DX1A 2D11A 2XQNM 2YT1A 3U7DA 1Q67A 1ZC3B 1XX0A 1V88A 1FAOA 4HB2B 1UPRA 4ZRIA 1WI1A 3AJ4A 3PVLA 1KZ7A 5D3VA 3FEHA 2I5CA 2ROZB 1K5DB 5HE1A 4KVGB 1XKEA 3D8FA 3N7CA 4A6KA 2RSGA 5DHFB 2G35A 3WA0A 2ADZA 4NY0A 2IYBA 2OTXA 2P0DA 3TW1A 2D10A 2ELAA 2DX5A 1MAIA 1H4RA 2X18A 3PEGA 5JHGA 1U2BA 1J0WA 4K2PA 4HAXB 4HATB 4K2OA 3PSCA 1U5EA 2LG1A 3KZ1A 5J3TA 1WGQA 1U5DA 1P3RA 2UVMA 3AU5A 4PQ0A 1WGUA 2LOXA 3ZVRA 1Y19B 3HQCA 1UNPA 3P7ZA 4TKNA 4CYEA 2LYDA 4F7HA 1U5GA 3G9WA 3PG7A 5C16A 2K2UA 2UZRA 1IRSA 2RLOA 1UEFA 5JHHA 1N3HA 4BBKA 4L6EA 2GCJA 2N0YA 1MPHA 5HE2A 2COCA 1NU2A 3ODWA 4EMOA 4B6HA 4H8SA 1KZGA 2P0FA 4DBBA 2K2JA 2J0JA 1XODA 3QWMA 2EMSA 3MPXA 1XR0B 2RVBB 1EAZA 5C6RA 5LOPB 1EVHA 3RCPA 5HE0A 2DYQA 2J0KA 5DIFB 1WJ1A 3ULBA 2KCJA 4TYZA 4HAZB 3GYOA 1WG7A 3PVUA 1DYNA 1W1HA 3KSYA 2EJ8A 2LKOA 3FSSA 3BINA 2DYNA 2PZ1A 3PVWA
chains in the Genus database with same CATH superfamily
2VKIA 2YS5A 3F5RA 3A98B 4ZRJA 2VRWB 4Z2NA 2AL6A 2COFA 4GPTB 2GS0A 2YRYA 4K17A 5D27A 2Z4DA 1SHCA 3OHMB 3P6AA 4A6FA 4WVFB 5GOWB 3A8QA 5KQ4A 2DHIA 2LULA 1RJ2A 2Y8FA 4MY6A 3ULCA 3KRWA 2Z0OA 2MWNB 4K81A 3TO1A 4DX90 1BTKA 4QJ4B 2D9ZA 2RRFA 1ZYIA 2I1KA 5CLLB 4DXAB 2RNRB 4D6WA 5L81A 1H10A 5LONB 5D3WA 2NMBA 1MK7B 5D3XA 3M1IB 2COAA 3SUZA 2DHJA 1I2HA 1DDWA 2YSZA 4HAWB 4KHAA 2D9XA 3U12A 4KHOA 3TVVA 4HDQA 5C79A 1FHOA 2Z0PA 2CY5A 4QJ5B 1MKEA 1BAKA 5I2MA 2FJUB 1ISNA 4P7IA 2KUPA 1E5WA 1B55A 2H7EA 4NSWA 2GCLA 3SV1A 3NSUA 3ODXA 3NWDA 1EF1A 2D4QA 5DH9B 2J0MA 1K5GB 1LW3A 5EFXA 4EKUA 1X1GA 2D9WA 1M7EA 1AWEA 3WYFB 2QKMA 1MK9B 1NI2A 1PFJA 2KIEA 2KUQA 2MKRA 3MDBC 1OMWA 3DXCA 1MIZB 2I1JA 3FM8C 4A6HA 1OY2A 3OANA 3UZTA 3A8PA 1SGHA 4OT1A 5C5BA 2K49A 3LJUX 3CIKA 1U27A 5DHAB 4HB4B 1DDVA 1ZVRA 4YONA 4KAXB 2FJLA 4HAUB 2MDXA 2OQBA 5IRSA 3KY9A 1BTNA 3BJIA 1DROA 1GC7A 4F7UP 4Y94A 3ZDTA 1MIXA 5KCVA 3KRXA 1UPQA 2ROVA 4GZUA 2ZPYA 2V76A 1LB1A 4OSNA 2KR0A 5HE3A 1U5FA 1WJMA 5C5BB 1GC6A 2DTCA 1QC6A 3FVCA 1GG3A 3X23A 2R09A 5DI9B 3TFMA 2ZKMX 3B77A 5FI1A 1V5PA 4MK0A 2YVCA 2BCJA 2RGNB 1FGYA 3VIAA 5FI0A 1FOEA 2MFQA 4CHJA 1FGZA 5D3YA 2EMTA 2QKLA 3NWAA 2DN6A 3AU4A 3PZDA 2Y8GA 4MT7A 2CAYA 1ZC4B 4HB3B 4HHVA 5M4YB 4DX8A 2W2XD 2D2QA 2D9YA 1ZSQA 4KHBA 3PP2A 4C0AA 1NTYA 1W1GA 3SO6A 4EJNA 3SYXA 1FHWA 1X86A 3ML4A 1FB8A 2YF0A 2R2YA 2Z14A 4QXAB 3GYPA 1TXDA 1UNQA 1V5MA 1M7RA 2RUKB 3SNHA 2NZ8B 2R0DA 1PMSA 1DDMA 3DXEA 1U29A 2Z0QA 2Q13A 1KI1B 1V61A 1XCGA 1MI1A 3VOQA 1Y5OA 5J3QA 2DFKA 1X1FA 2VSZA 5KQ1A 5JLJB 3HK0A 2AEHA 4HAVB 3HW2B 2LOZA 2M38A 1P6SA 4XWXA 2DHKA 2DKQA 3F0WA 3QBVB 1I7AA 4HB0B 3V5WA 4D0NB 1RRPB 1WVHA 2DLWA 2YT0A 3O96A 4GOUA 1V5UA 2YT2A 2W2XC 4GNKB 2N23A 2ELBA 2JP2A 5CLQB 1AQCA 1Z87A 2D9VA 2HTHB 2K8EA 4KHBB 3CXBB 4CHMA 1TQZA 2HE7A 2CODA 1X11A 3DCXA 2NBVA 4Z2MB 2IFSA 1V89A 4GXBA 2L1CA 2E2XA 2EC1A 1NTVA 2GJYA 2L2IA 4A5KA 4IFSA 4WSFA 4IAPA 4L1RA 1ZM0A 1W1DA 4PNKA 3HSAA 2KIGA 3IVFA 1DBHA 2W2WA 2CRFA 1FHXA 2J59M 1P5TA 2Y7BA 5JP4A 2M14A 2P0HA 1OQNA 4GMXB 4HDOA 2CY4A 3D8EA 3TCAA 2K00A 2UZSA 3D8DA 4GN1A 4GMVA 4HSIA 4F7GA 4A6FB 2KGXB 4YL8A 1BWNA 3QIJA 4HAYB 3U8ZA 1UNRA 4WJ7A 3T06A 2H7DA 2DKPA 1TJ6A 2I5FA 5J3YA 4IOYX 2YS3A 3DXDA 1EGXA 1QQGA 5LG4B 2Z59A 2DA0A 2YS1A 3NW8A 4ZRKA 1X05A 1J19A 1PLSA 1XD4A 2P8VA 3ODOA 2DX1A 2D11A 2XQNM 2YT1A 3U7DA 1Q67A 1ZC3B 1XX0A 1V88A 1FAOA 4HB2B 1UPRA 4ZRIA 1WI1A 3AJ4A 3PVLA 1KZ7A 5D3VA 3FEHA 2I5CA 2ROZB 2GUMA 1K5DB 5HE1A 4KVGB 1XKEA 3D8FA 3N7CA 4A6KA 2RSGA 5DHFB 2G35A 3WA0A 2ADZA 4NY0A 2IYBA 2OTXA 2P0DA 3TW1A 2D10A 2ELAA 2DX5A 1MAIA 1H4RA 2X18A 3PEGA 5JHGA 1U2BA 1J0WA 4QJ3B 4K2PA 4HAXB 4HATB 4K2OA 3PSCA 1U5EA 2LG1A 3KZ1A 5J3TA 1WGQA 1U5DA 1P3RA 2UVMA 3AU5A 3NWFA 4PQ0A 1WGUA 2LOXA 3ZVRA 1Y19B 3HQCA 1UNPA 3P7ZA 4TKNA 4CYEA 2LYDA 4DIXA 4F7HA 1U5GA 3G9WA 3PG7A 5C16A 2K2UA 2UZRA 1IRSA 2RLOA 1UEFA 5JHHA 1N3HA 4BBKA 4L6EA 2GCJA 2N0YA 1MPHA 5HE2A 2COCA 1NU2A 4CSQA 3ODWA 4EMOA 4B6HA 5I2SA 4H8SA 1KZGA 2P0FA 4DBBA 2K2JA 2J0JA 1XODA 3QWMA 1T77A 2EMSA 3MPXA 1XR0B 2RVBB 1EAZA 5C6RA 5LOPB 1EVHA 3RCPA 5HE0A 2DYQA 2J0KA 5DIFB 1WJ1A 3ULBA 2KCJA 4TYZA 4HAZB 3GYOA 1WG7A 3PVUA 3HIEA 1DYNA 2PZ1A 1W1HA 3KSYA 2EJ8A 2LKOA 3FSSA 3BINA 2DYNA 2Z13A 3A58A 3PVWA
chains in the Genus database with same CATH topology
2VKIA 2YS5A 3F5RA 3A98B 4ZRJA 2VRWB 4Z2NA 2AL6A 2COFA 4GPTB 2GS0A 2YRYA 4K17A 5D27A 1SHCA 3P6AA 4A6FA 4WVFB 5GOWB 3A8QA 5KQ4A 2DHIA 2LULA 1RJ2A 2Y8FA 4MY6A 3ULCA 3KRWA 2Z0OA 2MWNB 4K81A 3TO1A 4DX90 1BTKA 2D9ZA 2I1KA 5CLLB 4DXAB 2RNRB 5L81A 1H10A 5LONB 5D3WA 2NMBA 1MK7B 5D3XA 3M1IB 2COAA 3SUZA 2DHJA 1I2HA 1DDWA 2YSZA 4HAWB 4KHAA 2D9XA 4KHOA 3TVVA 4HDQA 5C79A 1FHOA 2Z0PA 2CY5A 1MKEA 1BAKA 1ISNA 4P7IA 2KUPA 1E5WA 1B55A 2H7EA 4NSWA 2GCLA 3SV1A 3NSUA 3ODXA 1EF1A 2D4QA 5DH9B 2J0MA 1K5GB 1LW3A 5EFXA 4EKUA 1X1GA 2D9WA 1M7EA 1AWEA 3WYFB 2QKMA 1MK9B 1NI2A 1PFJA 2MKRA 3MDBC 1OMWA 3DXCA 1MIZB 2I1JA 3FM8C 4A6HA 1OY2A 3OANA 3UZTA 1SGHA 3A8PA 5C5BA 3LJUX 3CIKA 1U27A 5DHAB 4HB4B 1DDVA 1ZVRA 4YONA 4KAXB 2FJLA 4HAUB 2MDXA 2OQBA 3KY9A 1BTNA 3BJIA 1DROA 1GC7A 4F7UP 4Y94A 3ZDTA 1MIXA 5KCVA 3KRXA 1UPQA 2ROVA 4GZUA 2ZPYA 2V76A 1LB1A 5HE3A 1U5FA 1WJMA 5C5BB 1GC6A 2DTCA 1QC6A 1GG3A 3X23A 2R09A 5DI9B 3TFMA 5FI1A 1V5PA 4MK0A 2YVCA 2BCJA 2RGNB 1FGYA 3VIAA 5FI0A 1FOEA 2MFQA 4CHJA 1FGZA 5D3YA 2EMTA 2QKLA 2DN6A 3AU4A 3PZDA 2Y8GA 4MT7A 2CAYA 1ZC4B 4HB3B 4HHVA 4DX8A 2W2XD 2D2QA 2D9YA 1ZSQA 3PP2A 4C0AA 1NTYA 1W1GA 3SO6A 4EJNA 3SYXA 1FHWA 1X86A 3ML4A 1FB8A 2YF0A 3GYPA 1TXDA 1UNQA 1V5MA 1M7RA 2RUKB 3SNHA 2NZ8B 2R0DA 1PMSA 1DDMA 3DXEA 1U29A 2Z0QA 2Q13A 1KI1B 1V61A 1XCGA 3VOQA 1Y5OA 5J3QA 2DFKA 1X1FA 2VSZA 5KQ1A 5JLJB 3HK0A 2AEHA 4HAVB 3HW2B 2LOZA 2M38A 1P6SA 4XWXA 2DHKA 2DKQA 3F0WA 3QBVB 1I7AA 4HB0B 3V5WA 4D0NB 1RRPB 1WVHA 2DLWA 2YT0A 3O96A 1V5UA 2W2XC 2N23A 2ELBA 2JP2A 5CLQB 1AQCA 1Z87A 2D9VA 2HTHB 4KHBB 3CXBB 4CHMA 1TQZA 2HE7A 2CODA 1X11A 4Z2MB 2IFSA 1V89A 4GXBA 2L1CA 2E2XA 2EC1A 1NTVA 2GJYA 2L2IA 4A5KA 4IFSA 4WSFA 4IAPA 1ZM0A 1W1DA 4PNKA 3IVFA 1DBHA 2W2WA 2CRFA 1FHXA 2J59M 1P5TA 2Y7BA 5JP4A 2M14A 2P0HA 1OQNA 4GMXB 4HDOA 2CY4A 3D8EA 3TCAA 2K00A 2UZSA 3D8DA 4GN1A 4GMVA 4F7GA 4A6FB 2KGXB 4YL8A 1BWNA 3QIJA 4HAYB 3U8ZA 1UNRA 4WJ7A 3T06A 2H7DA 2DKPA 1TJ6A 2I5FA 5J3YA 4IOYX 2YS3A 3DXDA 1EGXA 1QQGA 2DA0A 2YS1A 4ZRKA 1X05A 1J19A 1PLSA 1XD4A 2P8VA 3ODOA 2DX1A 2D11A 2XQNM 2YT1A 3U7DA 1Q67A 1ZC3B 1XX0A 1V88A 1FAOA 4HB2B 1UPRA 4ZRIA 1WI1A 3AJ4A 3PVLA 1KZ7A 5D3VA 3FEHA 2I5CA 2ROZB 1K5DB 5HE1A 4KVGB 1XKEA 3D8FA 3N7CA 4A6KA 2RSGA 5DHFB 2G35A 3WA0A 2ADZA 4NY0A 2IYBA 2OTXA 2P0DA 3TW1A 2D10A 2ELAA 2DX5A 1MAIA 1H4RA 2X18A 3PEGA 5JHGA 1U2BA 1J0WA 4K2PA 4HAXB 4HATB 4K2OA 3PSCA 1U5EA 2LG1A 3KZ1A 5J3TA 1WGQA 1U5DA 1P3RA 2UVMA 3AU5A 4PQ0A 1WGUA 2LOXA 3ZVRA 1Y19B 3HQCA 1UNPA 3P7ZA 4TKNA 4CYEA 2LYDA 4F7HA 1U5GA 3G9WA 3PG7A 5C16A 2K2UA 2UZRA 1IRSA 2RLOA 1UEFA 5JHHA 1N3HA 4BBKA 4L6EA 2GCJA 2N0YA 1MPHA 5HE2A 2COCA 1NU2A 3ODWA 4EMOA 4B6HA 4H8SA 1KZGA 2P0FA 4DBBA 2K2JA 2J0JA 1XODA 3QWMA 2EMSA 3MPXA 1XR0B 2RVBB 1EAZA 5C6RA 5LOPB 1EVHA 3RCPA 5HE0A 2DYQA 2J0KA 5DIFB 1WJ1A 3ULBA 2KCJA 4TYZA 4HAZB 3GYOA 1WG7A 3PVUA 1DYNA 1W1HA 3KSYA 2EJ8A 2LKOA 3FSSA 3BINA 2DYNA 2PZ1A 3PVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VKI A;  2YS5 A;  3F5R A;  3A98 B;  4ZRJ A;  2VRW B;  4Z2N A;  2AL6 A;  2COF A;  4GPT B;  2GS0 A;  2YRY A;  4K17 A;  5D27 A;  1SHC A;  3P6A A;  4A6F A;  4WVF B;  5GOW B;  3A8Q A;  5KQ4 A;  2DHI A;  2LUL A;  1RJ2 A;  2Y8F A;  4MY6 A;  3ULC A;  3KRW A;  2Z0O A;  2MWN B;  4K81 A;  3TO1 A;  4DX9 0;  1BTK A;  2D9Z A;  2I1K A;  5CLL B;  4DXA B;  2RNR B;  5L81 A;  1H10 A;  5LON B;  5D3W A;  2NMB A;  1MK7 B;  5D3X A;  3M1I B;  2COA A;  3SUZ A;  2DHJ A;  1I2H A;  1DDW A;  2YSZ A;  4HAW B;  4KHA A;  2D9X A;  4KHO A;  3TVV A;  4HDQ A;  5C79 A;  1FHO A;  2Z0P A;  2CY5 A;  1MKE A;  1BAK A;  1ISN A;  4P7I A;  2KUP A;  1E5W A;  1B55 A;  2H7E A;  4NSW A;  2GCL A;  3SV1 A;  3NSU A;  3ODX A;  1EF1 A;  2D4Q A;  5DH9 B;  2J0M A;  1K5G B;  1LW3 A;  5EFX A;  4EKU A;  1X1G A;  2D9W A;  1M7E A;  1AWE A;  3WYF B;  2QKM A;  1MK9 B;  1NI2 A;  1PFJ A;  2MKR A;  3MDB C;  1OMW A;  3DXC A;  1MIZ B;  2I1J A;  3FM8 C;  4A6H A;  1OY2 A;  3OAN A;  3UZT A;  1SGH A;  3A8P A;  5C5B A;  3LJU X;  3CIK A;  1U27 A;  5DHA B;  4HB4 B;  1DDV A;  1ZVR A;  4YON A;  4KAX B;  2FJL A;  4HAU B;  2MDX A;  2OQB A;  3KY9 A;  1BTN A;  3BJI A;  1DRO A;  1GC7 A;  4F7U P;  4Y94 A;  3ZDT A;  1MIX A;  5KCV A;  3KRX A;  1UPQ A;  2ROV A;  4GZU A;  2ZPY A;  2V76 A;  1LB1 A;  5HE3 A;  1U5F A;  1WJM A;  5C5B B;  1GC6 A;  2DTC A;  1QC6 A;  1GG3 A;  3X23 A;  2R09 A;  5DI9 B;  3TFM A;  5FI1 A;  1V5P A;  4MK0 A;  2YVC A;  2BCJ A;  2RGN B;  1FGY A;  3VIA A;  5FI0 A;  1FOE A;  2MFQ A;  4CHJ A;  1FGZ A;  5D3Y A;  2EMT A;  2QKL A;  2DN6 A;  3AU4 A;  3PZD A;  2Y8G A;  4MT7 A;  2CAY A;  1ZC4 B;  4HB3 B;  4HHV A;  4DX8 A;  2W2X D;  2D2Q A;  2D9Y A;  1ZSQ A;  3PP2 A;  4C0A A;  1NTY A;  1W1G A;  3SO6 A;  4EJN A;  3SYX A;  1FHW A;  1X86 A;  3ML4 A;  1FB8 A;  2YF0 A;  3GYP A;  1TXD A;  1UNQ A;  1V5M A;  1M7R A;  2RUK B;  3SNH A;  2NZ8 B;  2R0D A;  1PMS A;  1DDM A;  3DXE A;  1U29 A;  2Z0Q A;  2Q13 A;  1KI1 B;  1V61 A;  1XCG A;  3VOQ A;  1Y5O A;  5J3Q A;  2DFK A;  1X1F A;  2VSZ A;  5KQ1 A;  5JLJ B;  3HK0 A;  2AEH A;  4HAV B;  3HW2 B;  2LOZ A;  2M38 A;  1P6S A;  4XWX A;  2DHK A;  2DKQ A;  3F0W A;  3QBV B;  1I7A A;  4HB0 B;  3V5W A;  4D0N B;  1RRP B;  1WVH A;  2DLW A;  2YT0 A;  3O96 A;  1V5U A;  2W2X C;  2N23 A;  2ELB A;  2JP2 A;  5CLQ B;  1AQC A;  1Z87 A;  2D9V A;  2HTH B;  4KHB B;  3CXB B;  4CHM A;  1TQZ A;  2HE7 A;  2COD A;  1X11 A;  4Z2M B;  2IFS A;  1V89 A;  4GXB A;  2L1C A;  2E2X A;  2EC1 A;  1NTV A;  2GJY A;  2L2I A;  4A5K A;  4IFS A;  4WSF A;  4IAP A;  1ZM0 A;  1W1D A;  4PNK A;  3IVF A;  1DBH A;  2W2W A;  2CRF A;  1FHX A;  2J59 M;  1P5T A;  2Y7B A;  5JP4 A;  2M14 A;  2P0H A;  1OQN A;  4GMX B;  4HDO A;  2CY4 A;  3D8E A;  3TCA A;  2K00 A;  2UZS A;  3D8D A;  4GN1 A;  4GMV A;  4F7G A;  4A6F B;  2KGX B;  4YL8 A;  1BWN A;  3QIJ A;  4HAY B;  3U8Z A;  1UNR A;  4WJ7 A;  3T06 A;  2H7D A;  2DKP A;  1TJ6 A;  2I5F A;  5J3Y A;  4IOY X;  2YS3 A;  3DXD A;  1EGX A;  1QQG A;  2DA0 A;  2YS1 A;  4ZRK A;  1X05 A;  1J19 A;  1PLS A;  1XD4 A;  2P8V A;  3ODO A;  2DX1 A;  2D11 A;  2XQN M;  2YT1 A;  3U7D A;  1Q67 A;  1ZC3 B;  1XX0 A;  1V88 A;  1FAO A;  4HB2 B;  1UPR A;  4ZRI A;  1WI1 A;  3AJ4 A;  3PVL A;  1KZ7 A;  5D3V A;  3FEH A;  2I5C A;  2ROZ B;  1K5D B;  5HE1 A;  4KVG B;  1XKE A;  3D8F A;  3N7C A;  4A6K A;  2RSG A;  5DHF B;  2G35 A;  3WA0 A;  2ADZ A;  4NY0 A;  2IYB A;  2OTX A;  2P0D A;  3TW1 A;  2D10 A;  2ELA A;  2DX5 A;  1MAI A;  1H4R A;  2X18 A;  3PEG A;  5JHG A;  1U2B A;  1J0W A;  4K2P A;  4HAX B;  4HAT B;  4K2O A;  3PSC A;  1U5E A;  2LG1 A;  3KZ1 A;  5J3T A;  1WGQ A;  1U5D A;  1P3R A;  2UVM A;  3AU5 A;  4PQ0 A;  1WGU A;  2LOX A;  3ZVR A;  1Y19 B;  3HQC A;  1UNP A;  3P7Z A;  4TKN A;  4CYE A;  2LYD A;  4F7H A;  1U5G A;  3G9W A;  3PG7 A;  5C16 A;  2K2U A;  2UZR A;  1IRS A;  2RLO A;  1UEF A;  5JHH A;  1N3H A;  4BBK A;  4L6E A;  2GCJ A;  2N0Y A;  1MPH A;  5HE2 A;  2COC A;  1NU2 A;  3ODW A;  4EMO A;  4B6H A;  4H8S A;  1KZG A;  2P0F A;  4DBB A;  2K2J A;  2J0J A;  1XOD A;  3QWM A;  2EMS A;  3MPX A;  1XR0 B;  2RVB B;  1EAZ A;  5C6R A;  5LOP B;  1EVH A;  3RCP A;  5HE0 A;  2DYQ A;  2J0K A;  5DIF B;  1WJ1 A;  3ULB A;  2KCJ A;  4TYZ A;  4HAZ B;  3GYO A;  1WG7 A;  3PVU A;  1DYN A;  1W1H A;  3KSY A;  2EJ8 A;  2LKO A;  3FSS A;  3BIN A;  2DYN A;  2PZ1 A;  3PVW A; 
#chains in the Genus database with same CATH topology
 2VKI A;  2YS5 A;  3F5R A;  3A98 B;  4ZRJ A;  2VRW B;  4Z2N A;  2AL6 A;  2COF A;  4GPT B;  2GS0 A;  2YRY A;  4K17 A;  5D27 A;  2Z4D A;  1SHC A;  3OHM B;  3P6A A;  4A6F A;  4WVF B;  5GOW B;  3A8Q A;  5KQ4 A;  2DHI A;  2LUL A;  1RJ2 A;  2Y8F A;  4MY6 A;  3ULC A;  3KRW A;  2Z0O A;  2MWN B;  4K81 A;  3TO1 A;  4DX9 0;  1BTK A;  4QJ4 B;  2D9Z A;  2RRF A;  1ZYI A;  2I1K A;  5CLL B;  4DXA B;  2RNR B;  4D6W A;  5L81 A;  1H10 A;  5LON B;  5D3W A;  2NMB A;  1MK7 B;  5D3X A;  3M1I B;  2COA A;  3SUZ A;  2DHJ A;  1I2H A;  1DDW A;  2YSZ A;  4HAW B;  4KHA A;  2D9X A;  3U12 A;  4KHO A;  3TVV A;  4HDQ A;  5C79 A;  1FHO A;  2Z0P A;  2CY5 A;  4QJ5 B;  1MKE A;  1BAK A;  5I2M A;  2FJU B;  1ISN A;  4P7I A;  2KUP A;  1E5W A;  1B55 A;  2H7E A;  4NSW A;  2GCL A;  3SV1 A;  3NSU A;  3ODX A;  3NWD A;  1EF1 A;  2D4Q A;  5DH9 B;  2J0M A;  1K5G B;  1LW3 A;  5EFX A;  4EKU A;  1X1G A;  2D9W A;  1M7E A;  1AWE A;  3WYF B;  2QKM A;  1MK9 B;  1NI2 A;  1PFJ A;  2KIE A;  2KUQ A;  2MKR A;  3MDB C;  1OMW A;  3DXC A;  1MIZ B;  2I1J A;  3FM8 C;  4A6H A;  1OY2 A;  3OAN A;  3UZT A;  3A8P A;  1SGH A;  4OT1 A;  5C5B A;  2K49 A;  3LJU X;  3CIK A;  1U27 A;  5DHA B;  4HB4 B;  1DDV A;  1ZVR A;  4YON A;  4KAX B;  2FJL A;  4HAU B;  2MDX A;  2OQB A;  5IRS A;  3KY9 A;  1BTN A;  3BJI A;  1DRO A;  1GC7 A;  4F7U P;  4Y94 A;  3ZDT A;  1MIX A;  5KCV A;  3KRX A;  1UPQ A;  2ROV A;  4GZU A;  2ZPY A;  2V76 A;  1LB1 A;  4OSN A;  2KR0 A;  5HE3 A;  1U5F A;  1WJM A;  5C5B B;  1GC6 A;  2DTC A;  1QC6 A;  3FVC A;  1GG3 A;  3X23 A;  2R09 A;  5DI9 B;  3TFM A;  2ZKM X;  3B77 A;  5FI1 A;  1V5P A;  4MK0 A;  2YVC A;  2BCJ A;  2RGN B;  1FGY A;  3VIA A;  5FI0 A;  1FOE A;  2MFQ A;  4CHJ A;  1FGZ A;  5D3Y A;  2EMT A;  2QKL A;  3NWA A;  2DN6 A;  3AU4 A;  3PZD A;  2Y8G A;  4MT7 A;  2CAY A;  1ZC4 B;  4HB3 B;  4HHV A;  5M4Y B;  4DX8 A;  2W2X D;  2D2Q A;  2D9Y A;  1ZSQ A;  4KHB A;  3PP2 A;  4C0A A;  1NTY A;  1W1G A;  3SO6 A;  4EJN A;  3SYX A;  1FHW A;  1X86 A;  3ML4 A;  1FB8 A;  2YF0 A;  2R2Y A;  2Z14 A;  4QXA B;  3GYP A;  1TXD A;  1UNQ A;  1V5M A;  1M7R A;  2RUK B;  3SNH A;  2NZ8 B;  2R0D A;  1PMS A;  1DDM A;  3DXE A;  1U29 A;  2Z0Q A;  2Q13 A;  1KI1 B;  1V61 A;  1XCG A;  1MI1 A;  3VOQ A;  1Y5O A;  5J3Q A;  2DFK A;  1X1F A;  2VSZ A;  5KQ1 A;  5JLJ B;  3HK0 A;  2AEH A;  4HAV B;  3HW2 B;  2LOZ A;  2M38 A;  1P6S A;  4XWX A;  2DHK A;  2DKQ A;  3F0W A;  3QBV B;  1I7A A;  4HB0 B;  3V5W A;  4D0N B;  1RRP B;  1WVH A;  2DLW A;  2YT0 A;  3O96 A;  4GOU A;  1V5U A;  2YT2 A;  2W2X C;  4GNK B;  2N23 A;  2ELB A;  2JP2 A;  5CLQ B;  1AQC A;  1Z87 A;  2D9V A;  2HTH B;  2K8E A;  4KHB B;  3CXB B;  4CHM A;  1TQZ A;  2HE7 A;  2COD A;  1X11 A;  3DCX A;  2NBV A;  4Z2M B;  2IFS A;  1V89 A;  4GXB A;  2L1C A;  2E2X A;  2EC1 A;  1NTV A;  2GJY A;  2L2I A;  4A5K A;  4IFS A;  4WSF A;  4IAP A;  4L1R A;  1ZM0 A;  1W1D A;  4PNK A;  3HSA A;  2KIG A;  3IVF A;  1DBH A;  2W2W A;  2CRF A;  1FHX A;  2J59 M;  1P5T A;  2Y7B A;  5JP4 A;  2M14 A;  2P0H A;  1OQN A;  4GMX B;  4HDO A;  2CY4 A;  3D8E A;  3TCA A;  2K00 A;  2UZS A;  3D8D A;  4GN1 A;  4GMV A;  4HSI A;  4F7G A;  4A6F B;  2KGX B;  4YL8 A;  1BWN A;  3QIJ A;  4HAY B;  3U8Z A;  1UNR A;  4WJ7 A;  3T06 A;  2H7D A;  2DKP A;  1TJ6 A;  2I5F A;  5J3Y A;  4IOY X;  2YS3 A;  3DXD A;  1EGX A;  1QQG A;  5LG4 B;  2Z59 A;  2DA0 A;  2YS1 A;  3NW8 A;  4ZRK A;  1X05 A;  1J19 A;  1PLS A;  1XD4 A;  2P8V A;  3ODO A;  2DX1 A;  2D11 A;  2XQN M;  2YT1 A;  3U7D A;  1Q67 A;  1ZC3 B;  1XX0 A;  1V88 A;  1FAO A;  4HB2 B;  1UPR A;  4ZRI A;  1WI1 A;  3AJ4 A;  3PVL A;  1KZ7 A;  5D3V A;  3FEH A;  2I5C A;  2ROZ B;  2GUM A;  1K5D B;  5HE1 A;  4KVG B;  1XKE A;  3D8F A;  3N7C A;  4A6K A;  2RSG A;  5DHF B;  2G35 A;  3WA0 A;  2ADZ A;  4NY0 A;  2IYB A;  2OTX A;  2P0D A;  3TW1 A;  2D10 A;  2ELA A;  2DX5 A;  1MAI A;  1H4R A;  2X18 A;  3PEG A;  5JHG A;  1U2B A;  1J0W A;  4QJ3 B;  4K2P A;  4HAX B;  4HAT B;  4K2O A;  3PSC A;  1U5E A;  2LG1 A;  3KZ1 A;  5J3T A;  1WGQ A;  1U5D A;  1P3R A;  2UVM A;  3AU5 A;  3NWF A;  4PQ0 A;  1WGU A;  2LOX A;  3ZVR A;  1Y19 B;  3HQC A;  1UNP A;  3P7Z A;  4TKN A;  4CYE A;  2LYD A;  4DIX A;  4F7H A;  1U5G A;  3G9W A;  3PG7 A;  5C16 A;  2K2U A;  2UZR A;  1IRS A;  2RLO A;  1UEF A;  5JHH A;  1N3H A;  4BBK A;  4L6E A;  2GCJ A;  2N0Y A;  1MPH A;  5HE2 A;  2COC A;  1NU2 A;  4CSQ A;  3ODW A;  4EMO A;  4B6H A;  5I2S A;  4H8S A;  1KZG A;  2P0F A;  4DBB A;  2K2J A;  2J0J A;  1XOD A;  3QWM A;  1T77 A;  2EMS A;  3MPX A;  1XR0 B;  2RVB B;  1EAZ A;  5C6R A;  5LOP B;  1EVH A;  3RCP A;  5HE0 A;  2DYQ A;  2J0K A;  5DIF B;  1WJ1 A;  3ULB A;  2KCJ A;  4TYZ A;  4HAZ B;  3GYO A;  1WG7 A;  3PVU A;  3HIE A;  1DYN A;  2PZ1 A;  1W1H A;  3KSY A;  2EJ8 A;  2LKO A;  3FSS A;  3BIN A;  2DYN A;  2Z13 A;  3A58 A;  3PVW A; 
#chains in the Genus database with same CATH homology
 2VKI A;  2YS5 A;  3F5R A;  3A98 B;  4ZRJ A;  2VRW B;  4Z2N A;  2AL6 A;  2COF A;  4GPT B;  2GS0 A;  2YRY A;  4K17 A;  5D27 A;  1SHC A;  3P6A A;  4A6F A;  4WVF B;  5GOW B;  3A8Q A;  5KQ4 A;  2DHI A;  2LUL A;  1RJ2 A;  2Y8F A;  4MY6 A;  3ULC A;  3KRW A;  2Z0O A;  2MWN B;  4K81 A;  3TO1 A;  4DX9 0;  1BTK A;  2D9Z A;  2I1K A;  5CLL B;  4DXA B;  2RNR B;  5L81 A;  1H10 A;  5LON B;  5D3W A;  2NMB A;  1MK7 B;  5D3X A;  3M1I B;  2COA A;  3SUZ A;  2DHJ A;  1I2H A;  1DDW A;  2YSZ A;  4HAW B;  4KHA A;  2D9X A;  4KHO A;  3TVV A;  4HDQ A;  5C79 A;  1FHO A;  2Z0P A;  2CY5 A;  1MKE A;  1BAK A;  1ISN A;  4P7I A;  2KUP A;  1E5W A;  1B55 A;  2H7E A;  4NSW A;  2GCL A;  3SV1 A;  3NSU A;  3ODX A;  1EF1 A;  2D4Q A;  5DH9 B;  2J0M A;  1K5G B;  1LW3 A;  5EFX A;  4EKU A;  1X1G A;  2D9W A;  1M7E A;  1AWE A;  3WYF B;  2QKM A;  1MK9 B;  1NI2 A;  1PFJ A;  2MKR A;  3MDB C;  1OMW A;  3DXC A;  1MIZ B;  2I1J A;  3FM8 C;  4A6H A;  1OY2 A;  3OAN A;  3UZT A;  1SGH A;  3A8P A;  5C5B A;  3LJU X;  3CIK A;  1U27 A;  5DHA B;  4HB4 B;  1DDV A;  1ZVR A;  4YON A;  4KAX B;  2FJL A;  4HAU B;  2MDX A;  2OQB A;  3KY9 A;  1BTN A;  3BJI A;  1DRO A;  1GC7 A;  4F7U P;  4Y94 A;  3ZDT A;  1MIX A;  5KCV A;  3KRX A;  1UPQ A;  2ROV A;  4GZU A;  2ZPY A;  2V76 A;  1LB1 A;  5HE3 A;  1U5F A;  1WJM A;  5C5B B;  1GC6 A;  2DTC A;  1QC6 A;  1GG3 A;  3X23 A;  2R09 A;  5DI9 B;  3TFM A;  5FI1 A;  1V5P A;  4MK0 A;  2YVC A;  2BCJ A;  2RGN B;  1FGY A;  3VIA A;  5FI0 A;  1FOE A;  2MFQ A;  4CHJ A;  1FGZ A;  5D3Y A;  2EMT A;  2QKL A;  2DN6 A;  3AU4 A;  3PZD A;  2Y8G A;  4MT7 A;  2CAY A;  1ZC4 B;  4HB3 B;  4HHV A;  4DX8 A;  2W2X D;  2D2Q A;  2D9Y A;  1ZSQ A;  3PP2 A;  4C0A A;  1NTY A;  1W1G A;  3SO6 A;  4EJN A;  3SYX A;  1FHW A;  1X86 A;  3ML4 A;  1FB8 A;  2YF0 A;  3GYP A;  1TXD A;  1UNQ A;  1V5M A;  1M7R A;  2RUK B;  3SNH A;  2NZ8 B;  2R0D A;  1PMS A;  1DDM A;  3DXE A;  1U29 A;  2Z0Q A;  2Q13 A;  1KI1 B;  1V61 A;  1XCG A;  3VOQ A;  1Y5O A;  5J3Q A;  2DFK A;  1X1F A;  2VSZ A;  5KQ1 A;  5JLJ B;  3HK0 A;  2AEH A;  4HAV B;  3HW2 B;  2LOZ A;  2M38 A;  1P6S A;  4XWX A;  2DHK A;  2DKQ A;  3F0W A;  3QBV B;  1I7A A;  4HB0 B;  3V5W A;  4D0N B;  1RRP B;  1WVH A;  2DLW A;  2YT0 A;  3O96 A;  1V5U A;  2W2X C;  2N23 A;  2ELB A;  2JP2 A;  5CLQ B;  1AQC A;  1Z87 A;  2D9V A;  2HTH B;  4KHB B;  3CXB B;  4CHM A;  1TQZ A;  2HE7 A;  2COD A;  1X11 A;  4Z2M B;  2IFS A;  1V89 A;  4GXB A;  2L1C A;  2E2X A;  2EC1 A;  1NTV A;  2GJY A;  2L2I A;  4A5K A;  4IFS A;  4WSF A;  4IAP A;  1ZM0 A;  1W1D A;  4PNK A;  3IVF A;  1DBH A;  2W2W A;  2CRF A;  1FHX A;  2J59 M;  1P5T A;  2Y7B A;  5JP4 A;  2M14 A;  2P0H A;  1OQN A;  4GMX B;  4HDO A;  2CY4 A;  3D8E A;  3TCA A;  2K00 A;  2UZS A;  3D8D A;  4GN1 A;  4GMV A;  4F7G A;  4A6F B;  2KGX B;  4YL8 A;  1BWN A;  3QIJ A;  4HAY B;  3U8Z A;  1UNR A;  4WJ7 A;  3T06 A;  2H7D A;  2DKP A;  1TJ6 A;  2I5F A;  5J3Y A;  4IOY X;  2YS3 A;  3DXD A;  1EGX A;  1QQG A;  2DA0 A;  2YS1 A;  4ZRK A;  1X05 A;  1J19 A;  1PLS A;  1XD4 A;  2P8V A;  3ODO A;  2DX1 A;  2D11 A;  2XQN M;  2YT1 A;  3U7D A;  1Q67 A;  1ZC3 B;  1XX0 A;  1V88 A;  1FAO A;  4HB2 B;  1UPR A;  4ZRI A;  1WI1 A;  3AJ4 A;  3PVL A;  1KZ7 A;  5D3V A;  3FEH A;  2I5C A;  2ROZ B;  1K5D B;  5HE1 A;  4KVG B;  1XKE A;  3D8F A;  3N7C A;  4A6K A;  2RSG A;  5DHF B;  2G35 A;  3WA0 A;  2ADZ A;  4NY0 A;  2IYB A;  2OTX A;  2P0D A;  3TW1 A;  2D10 A;  2ELA A;  2DX5 A;  1MAI A;  1H4R A;  2X18 A;  3PEG A;  5JHG A;  1U2B A;  1J0W A;  4K2P A;  4HAX B;  4HAT B;  4K2O A;  3PSC A;  1U5E A;  2LG1 A;  3KZ1 A;  5J3T A;  1WGQ A;  1U5D A;  1P3R A;  2UVM A;  3AU5 A;  4PQ0 A;  1WGU A;  2LOX A;  3ZVR A;  1Y19 B;  3HQC A;  1UNP A;  3P7Z A;  4TKN A;  4CYE A;  2LYD A;  4F7H A;  1U5G A;  3G9W A;  3PG7 A;  5C16 A;  2K2U A;  2UZR A;  1IRS A;  2RLO A;  1UEF A;  5JHH A;  1N3H A;  4BBK A;  4L6E A;  2GCJ A;  2N0Y A;  1MPH A;  5HE2 A;  2COC A;  1NU2 A;  3ODW A;  4EMO A;  4B6H A;  4H8S A;  1KZG A;  2P0F A;  4DBB A;  2K2J A;  2J0J A;  1XOD A;  3QWM A;  2EMS A;  3MPX A;  1XR0 B;  2RVB B;  1EAZ A;  5C6R A;  5LOP B;  1EVH A;  3RCP A;  5HE0 A;  2DYQ A;  2J0K A;  5DIF B;  1WJ1 A;  3ULB A;  2KCJ A;  4TYZ A;  4HAZ B;  3GYO A;  1WG7 A;  3PVU A;  1DYN A;  1W1H A;  3KSY A;  2EJ8 A;  2LKO A;  3FSS A;  3BIN A;  2DYN A;  2PZ1 A;  3PVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...