4IAPA

Crystal structure of ph domain of osh3 from saccharomyces cerevisiae
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
256
structure length
256
Chain Sequence
b'GRYLQGYLLKKRRVDNIFEMLRIDEGLRLKIYKNTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYVDQGFKKRFFTLDFRYGTLSYYLNDHNQTCRGEIVISLSSVSANKKDKIIIIDSGMEVWVLKATTKENWQSWVDALQTCFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oxysterol-binding protein homolog 3,Endolysin,Oxysterol-bind
molecule tags Lipid binding protein/ hydrorase
source organism Saccharomyces cerevisiae
publication title Structure of osh3 reveals a conserved mode of phosphoinositide binding in oxysterol-binding proteins
pubmed doi rcsb
total genus 76
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2012-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00959 Phage_lysozyme Phage lysozyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.530.40 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 4iapA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4iapA01
3SB8A 1L81A 229LA 2J0KA 3K2RA 1QUDA 4NSWA 142LA 1L57A 209LA 2QKLA 1TLAA 3GUIA 3HW2B 1QSBA 1L65A 171LA 1L98A 1MK9B 4ARPA 1ZSQA 173LA 2YSZA 1L23A 2AL6A 2RBNA 2OQBA 2P0DA 2VSZA 1C6DA 1CU3A 1CVKA 1C6IA 1L86A 1DYDA 3KRXA 1NU2A 3PEGA 4HAYB 3OE0A 1P2RA 1CU2A 1WI1A 177LA 1AWEA 3U8ZA 1L43A 1FHWA 2Y7BA 2B6XA 1LW9A 1OMWA 1CV0A 166LA 1L04A 2J0MA 2K2JA 1C6MA 3V2WA 2W2WA 3RCPA 3PZDA 2M14A 4I7MA 4I7RA 262LA 1L85A 2ZPYA 5JHGA 3D8DA 1L88A 1P5TA 2YS1A 2ROVA 167LA 1L82A 1OQNA 5LOPB 2QARC 1V5MA 4LZMA 1UNRA 1H10A 191LA 4I7LA 2PZ1A 3HTDA 3MPXA 4H8SA 184LA 1ZC3B 1L44A 2KGXB 2LULA 3HUKA 107LA 3V5WA 141LA 3C7YA 4A6KA 2HE7A 1K5DB 3PSCA 1Q67A 4B6HA 1NTVA 4IOYX 1L32A 161LA 1XR0B 1FHOA 3C8QA 2Q9EA 1PLSA 1L95A 1SHCA 2DHIA 1PQMA 1DYNA 4I7SA 1X05A 4HAZB 1U5DA 1G07A 3KSYA 1D3FA 1QT6A 2O4WA 5C5BA 1QTVA 1L06A 3HTFA 2LG1A 1PQKA 2B6YA 143LA 2RB0X 1MIXA 2HUMA 2YRYA 1L63A 3OE6A 1WGQA 3DMVA 1QUGA 1Y5OA 2DLWA 2YF0A 4ARQA 1ZC4B 1P56A 2RBPA 156LA 2W2XD 1G0KA 3HDEA 2M38A 242LA 1DYGA 261LA 1D3NA 164LA 3G3VA 2J0JA 3ZVRA 2DX1A 1D3JA 144LA 1UNQA 2DHKA 1OVKA 2B6ZA 2HTHB 1LI2A 172LA 1LWGA 2YS5A 1SX7A 3DN6A 1V5UA 1L64A 2I5CA 2ANVA 3KRWA 4PNKA 187LA 1QTCA 3AJ4A 3WA0A 1QUHA 4K5YA 4CYEA 4A5KA 1L48A 4HB0B 131LA 1DDWA 1G0PA 5C6RA 2DKPA 214LA 3M1IB 4HAUB 1C68A 1KS3A 245LA 1C6PA 4DBBA 2RGNB 4ZPUA 1P36A 1ZYTA 3OE8A 5DIFB 2D9XA 129LA 5I14A 1J0WA 1L68A 3ZDTA 234LA 252LA 1X11A 2K2UA 2RBQA 1PQJA 2B72A 254LA 201LA 146LA 1L49A 3L64A 1D3MA 1LYGA 1D2WA 4EJ4A 1M7RA 1L60A 2X18A 1W1GA 3PBLA 2LYDA 1C63A 1L35A 1P6YA 211LA 4I7PA 1U2BA 3ODXA 4KAXB 5D3YA 3U7DA 2QKMA 2ELAA 1V5PA 1L0KA 1L51A 213LA 3P7ZA 2LKOA 2GCLA 1T97A 1G0GA 258LA 3UONA 2RVBB 1QT5A 2L78A 1OVJA 5DI9B 199LA 5HE0A 118LA 2I1JA 2EMSA 4PJZA 244LA 2MWNB 1C60A 3HUQA 1L83A 1K5GB 1P46A 5J3TA 4HB3B 224LA 3DN3A 4HAWB 170LA 127LA 1C6HA 2VKIA 1LYIA 2RBRA 113LA 5L81A 2NMBA 122LA 222LA 3A8QA 2NTGA 2Y8FA 1L24A 3BINA 3HH3A 1JTMA 1LPYA 3NYAA 226LA 1I6SA 1P64A 3DN8A 2ADZA 3N7CA 4EXMA 206LA 2CRFA 2NZ8B 1L36A 1LI3A 1L31A 1LYEA 1XJUA 4DAJA 4I7OA 102LA 2Z6BA 103LA 2HULA 1UPQA 2DA0A 5D27A 4EPFA 2RB1X 2RLOA 2R09A 5HE1A 3T06A 4WJ7A 1DROA 1L47A 3PP2A 1L75A 130LA 1L77A 1DYFA 1L12A 1CV5A 4I7TA 4W53A 253LA 1V89A 4Z2MB 1QT3A 148LE 152LA 2RBSA 5CLLB 1DYEA 4KHBB 1C6CA 2CAYA 1KY1A 1L00A 2DX5A 4HDOA 1D2YA 216LA 1TXDA 4EKPA 176LA 1XJTA 155LA 1OV7A 1LGXA 120LA 3CDTA 3DNAA 5C16A 1TJ6A 3HT6A 3PDSA 3DMXA 4IFSA 1L01A 3VIAA 1E5WA 110LA 4D0NB 1PQOA 1LLHA 3V2YA 2K00A 4NY0A 2OE9X 3HUAA 1CTWA 1KI1B 1C69A 2JP2A 1L09A 1LGUA 126LA 4BBKA 111LA 2D9YA 1L89A 1L50A 248LA 3C8SA 2MFQA 2F47A 2Q13A 3PVLA 1BTNA 1EF1A 227LA 1MPHA 2RH1A 2B75A 3NSUA 4F7HA 3D8EA 1L84A 1GG3A 2COCA 2OE4X 2EMTA 1CUPA 1GC7A 3TW1A 1CX6A 217LA 1L15A 3CDQA 4DJHA 1L39A 5HE2A 2Z0PA 1L03A 1ZURA 223LA 1QQGA 4K2OA 1L74A 3BJIA 4P7IA 1L93A 3QWMA 5HE3A 1QTBA 1EGXA 1KZ7A 2RAYX 1XX0A 3C7WA 2R0DA 3C7ZA 4YL8A 188LA 3F0WA 3GUOA 2GCJA 1T8GA 1G06A 4I7KA 3C83A 3KZ1A 1C6AA 4PQ0A 1QT7A 3AU4A 2CODA 2D4QA 1LI6A 147LA 4KHOA 2DN6A 2MKRA 6LZMA 3HQCA 1P2LA 5D3XA 2RUKB 5GOWB 158LA 3ODUA 3GUJA 2EJ8A 1EPYA 212LA 4HAVB 4YONA 4TKNA 4Z2NA 2LOZA 1OVHA 4ZRKA 3CDVA 2Y8GA 2CUUA 5C79A 3QIJA 1L80A 1IRSA 3D4SA 3C8RA 4HDQA 1P3RA 3RUNA 1G0LA 4A6FA 1ZWNA 108LA 2OE7X 3PG7A 1DYAA 190LA 1CUQA 4C0AA 3HU8A 1WGUA 1L25A 4GXBA 1L62A 4IAPA 1T8FA 1I2HA 1V88A 1BTKA 4EKUA 1G0QA 1L07A 4HB2B 2RAZX 2V76A 2QB0B 3ULBA 4GZUA 3VOQA 3DN2A 1DYBA 200LA 4ARMB 246LA 2CY4A 1PQIA 2UZRA 4DX8A 1DDVA 196LA 4HATB 1C6NA 3GUPA 1L34A 251LA 225LA 1PMSA 1KY0A 1LW3A 1JQUA 3VW7A 1UPRA 2P0FA 3D8FA 3SN6R 2GS0A 1L76A 257LA 4HB4B 1LB1A 1L19A 1L96A 3LJUX 3O96A 5LZMA 1KW5A 233LA 1L18A 218LA 2OTZX 1QS5A 4LDLA 104LA 198LA 4S0WA 4ARQB 1QS9A 2B73A 1G1WA 3AU5A 4HAXB 3GYPA 1EVHA 1L14A 2DKQA 3FSSA 5JP4A 3DXDA 2IFSA 4CHMA 1N3HA 1XCGA 3SV1A 1LYFA 3HH4A 3FA0A 1CV6A 1L72A 3LZMA 2YT1A 1XEPA 1L21A 1L66A 1B55A 237LA 1QUOA 1L99A 5DHFB 3ODOA 1L71A 4W51A 2Q9DA 3GUMA 1L05A 2GJYA 1OWZA 3P6AA 1QTDA 1C6LA 2LZMA 4LDEA 4W57A 1L27A 230LA 3HWLA 5EFXA 3WYFB 2BCJA 2A4TA 2NTHA 1L40A 2G35A 2FJLA 4GMXB 1L70A 1QT8A 1L56A 4KHAA 4TYZA 2Z0OA 4KVGB 1L54A 178LA 236LA 1C66A 1K28A 2RB2X 4MK0A 3SB6A 123LA 1D9WA 1L61A 1L69A 2B70A 4GBRB 1OY2A 3X23A 1H4RA 1L59A 4EKRA 1MAIA 4EJNA 5J3YA 4DXAB 3HK0A 3DN1A 1WJMA 197LA 5DH9B 1QTHA 2I5FA 1SSYA 2H7EA 5JHHA 162LA 4Y94A 3OE9A 3SO6A 1LYDA 2XQNM 3SNHA 1L42A 1W1HA 4CHJA 231LA 1P3NA 238LA 3HT9A 2DHJA 183LA 1OV5A 186LA 4ARMA 3A8PA 4I7JA 1BAKA 4EKSA 4W56A 249LA 125LA 5KQ1A 1W1DA 109LA 4ZRJA 182LA 1XD4A 1L08A 1C62A 1PQDA 256LA 4I7QA 4ZRIA 1C6KA 1MIZB 1Z87A 1QTZA 5LONB 4DKLA 1CU5A 1NTYA 3CDOA 1OYUA 5D3VA 189LA 3ML4A 2OTYX 3RZEA 3C82A 1I7AA 1X86A 1X1FA 1L94A 4MT7A 4XWXA 1C6BA 3QBVB 2L2IA 3NY9A 1RRPB 3GULA 3HU9A 1L22A 1L38A 1L92A 5FI0A 1G0MA 2LC9A 3GUNA 4K17A 1C6TA 1L11A 243LA 3C80A 1SGHA 3TVVA 2D9VA 1L13A 3GUKA 4DX90 1QT4A 4LDOA 2RNRB 1L37A 3CIKA 4EMOA 2UVMA 1C64A 1U27A 2I1KA 4EPIA 195LA 4F7UP 1B6IA 1SSWA 3HT8A 2YS3A 1LYJA 3PVWA 2OU8A 2DTCA 138LA 219LA 1FGZA 150LA 1P7SA 3HH6A 255LA 1PFJA 1U5EA 3TCAA 221LA 4GMVA 4WSFA 239LA 2AEHA 1L26A 185LA 1CU6A 1G1VA 1WVHA 205LA 1FB8A 2YVCA 4I7NA 1FHXA 3DMZA 3DXCA 1TQZA 215LA 5KCVA 4OO9A 1P6SA 2D9WA 2KUPA 112LA 2DYQA 5J3QA 3KY9A 139LA 3OANA 1L58A 1L90A 1MKEA 1X1GA 1KZGA 1L52A 1EAZA 1L0JA 2H7DA 3F8VA 3SBAA 163LA 1L10A 1L46A 159LA 241LA 2ROZB 2UZSA 4W52A 1WG7A 4WVFB 1L87A 1P37A 3FADA 3L2XA 3TFMA 1DDMA 3DKEX 1L30A 1SWZA 3JR6A 3FM8C 2J59M 1C6EA 2B7XA 2O7AA 4HHVA 2F32A 5FI1A 1P5CA 4W55A 3EMLA 114LA 1V61A 3CDRA 4ARLA 1FOEA 3IVFA 181LA 1ZM0A 1C6JA 4L6EA 3HT7A 3UZTA 4A6FB 1Y19B 3ODWA 3HTBA 3SYXA 4YX7C 2LCBA 3NY8A 235LA 1L28A 1AQCA 2B6TA 2ELBA 1XKEA 4A6HA 168LA 1ZVRA 180LA 2RBOA 1DYCA 210LA 1RJ2A 1MK7B 5JLJB 7LZMA 260LA 1L33A 3A98B 1L53A 2D10A 3G3WA 3HDFA 1L02A 1L29A 2CY5A 2B74A 2YT0A 1FGYA 1C61A 5CLQB 145LA 1ISNA 1LYHA 2D2QA 2OU9A 4YXCA 1J19A 149LA 4GRVA 1U29A 3SUZA 3TO1A 4W58A 4YXAC 1UNPA 2RSGA 128LA 4AQNA 4GN1A 3G3XA 2L1CA 4MY6A 1T8AA 137LA 3HH5A 2OU0X 4GPTB 3SB9A 1C6QA 3CXBB 4ARJA 3F5RA 1OWYA 1L17A 174LA 3DN0A 1L67A 1L45A 157LA 250LA 2DYNA 3SBBC 4EKQA 3SB7A 5C5BB 1SX2A 3SB5A 4W54A 2IYBA 1LWKA 1NI2A 4K2PA 1L79A 228LA 2HUKA 2ANXA 3PVUA 175LA 1CU0A 3C81A 1GC6A 1XODA 3ULCA 1KNIA 1L91A 3DN4A 1CV4A 1KW7A 240LA 140LA 1JTNA 2W2XC 151LA 4K81A 2P0HA 1L73A 220LA 2Z0QA 2IGCA 1C6GA 3GYOA 2F2QA 1BWNA 2COFA 259LA 2OTXA 5D3WA 5KQ4A 2KCJA 192LA 1SWYA 1U5FA 2VRWB 1C6FA 1UEFA 1L41A 2N23A 1LGWA 3F9LA 3FI5A 1L55A 3HTGA 1WTHA 1M7EA 1C65A 4PK0A 1CV3A 1QC6A 2D11A 2MDXA 3DXEA 2P8VA 115LA 1CV1A 2D9ZA 1G0JA 1T6HA 2LOXA 4W59A 1FAOA 3FEHA 2OEAX 247LA 119LA 160LA 2DFKA 3G9WA 1QSQA 165LA 1L16A 3MDBC 5DHAB 1NHBA 1U5GA 1C67A 1DBHA 2B6WA 2O79A 3QAKA 2COAA 2EC1A 2N0YA 4E97A 1WJ1A 4F7GA 169LA 1L97A 2E2XA 1CX7A 1L20A 232LA
chains in the Genus database with same CATH superfamily
1LJ3A 3K2RA 209LA 3AGGG 1TLAA 171LA 1GF6A 4ARPA 2YSZA 1L23A 1CU3A 1L86A 2Z38A 4BS7A 3PEGA 1NU2A 4I8SA 4O34A 4HAYB 1CU2A 1UCOA 1WI1A 1CKCA 3LZ2A 1ZMYL 1L43A 3U8ZA 6LYTA 1CV0A 3IWRA 3V2WA 1HSXA 3PZDA 1GDWA 4I7MA 5JHGA 1UC0A 1P5TA 4WLTA 167LA 1OQNA 4QJ4B 4QEQA 1UNRA 5FSTA 2YBLA 3HTDA 4P2EA 2KGXB 2EPEA 3C7YA 2EQLA 3PSCA 1L32A 161LA 1LSZA 1RE2A 4ZFPA 4XJBA 1PLSA 1JIYA 4UWUA 1U5DA 5C5BA 1QT6A 2KIGA 3WMKA 4OWAA 1MIXA 5IDDA 4OSNA 1PZYA 2YRYA 2Q0MX 1L63A 4DDCA 1Y5OA 2DLWA 4R6CA 1ZC4B 3ZVQB 2MEHA 1G0KA 4N0JA 4HV2A 4KPMA 1LJFA 4H1PA 4QJ5B 1BQLY 4KXIA 2I5CA 1IR9A 1B2KA 2RSCA 3TXKA 1SQ2L 1C68A 1IWTA 4ZPUA 5DIFB 2D9XA 5I14A 2BQKA 234LA 252LA 1JSFA 1PQJA 254LA 3L64A 2W1LA 1D3MA 4EJ4A 1LZ1A 2X18A 3NWAA 1GF8A 1L35A 1P6YA 3ODXA 4I7PA 3U7DA 4KAXB 1IY4A 2QKMA 1B7MA 1FDLY 1F10A 1BHZA 1L0KA 3B0KA 1L51A 2LKOA 2GV0A 1G0GA 1MELL 2ZYPA 4B1AA 1AKIA 2L78A 5HE0A 4XYYA 1GE1A 1NBZC 224LA 170LA 2VKIA 4J1BA 1HMKA 2RBRA 1F0WA 1A4VA 3A96A 2NMBA 4DQJA 2NWDX 1JTMA 1DROA 226LA 2ADZA 1WQOA 2CRFA 3K3TA 1L36A 2HULA 4H92A 5APEA 4FJRA 1GFVA 4PJ2C 2R09A 5C6JA 3PP2A 2MEEA 1L12A 4W53A 5LVKA 4B49A 2K8EA 152LA 1DYEA 4KHBB 1TXDA 1ZVHL 5C16A 3DMXA 4N1EI 2BQMA 2K00A 2JP2A 4NY0A 1KI1B 4B4IA 1L50A 248LA 3C8SA 1XEKA 4TWSA 5F81A 4GLVA 1HFYA 5JENB 3NSUA 1FKVA 3WUAA 3D8EA 1CUPA 3CB7A 4XJIA 4NWEA 4WO6A 223LA 5F9XA 1QQGA 5AMYA 1IP6A 4MSTA 2YT2A 3C7WA 2R0DA 2I25L 3C7ZA 2BQBA 4YL8A 188LA 3GUOA 4R0FA 3KZ1A 1OUCA 2D4JA 6LZMA 3HQCA 1IWZA 1CJ9A 4NHPA 1E8LA 1HEWA 3RW8A 4MR1A 3CDVA 2CUUA 4XENA 1LZYA 5C79A 1L80A 3G3BB 3A58A 3HIEA 1GFGA 3D4SA 1REXA 4HDQA 1JKAA 1XGTC 1G0LA 190LA 4DYGA 1L25A 2W1YA 1L62A 4HTQA 4HB2B 2RAZX 4RDSA 3WYHA 194LA 3OK0A 4NSIA 1DDVA 1GHLA 5I4YA 1C6NA 2X0AA 1JTPL 5APCA 1DI4A 2LZTA 3SN6R 257LA 1YL0X 5LZMA 1KW5A 1L18A 218LA 1G1WA 4HAXB 3GYPA 2DKQA 3DXDA 2IFSA 1N3HA 3SV1A 3HH4A 1KIRC 1L21A 4DDAA 1B55A 1L99A 2BQJA 4W51A 3ODOA 1L05A 3WVXA 1QTDA 3W6AA 4LDEA 3HWLA 5EFXA 1LHIA 5L3IA 2BCJA 2G35A 2FJLA 1L70A 1LOZA 178LA 1CKGA 2BQFA 4OWEA 1LMNA 1L61A 1L69A 4GBRB 4CJ2A 1LZTA 2R2YA 1MAIA 3P68A 1HC0A 4DXAB 4AGAA 3LYMA 1IWYA 1GBSA 1LSYA 197LA 4J0LA 5B07A 5C6IA 3GXKA 4Y94A 1GXXA 3TXGA 1LYDA 3J6KA 1P3NA 1DI3A 183LA 1WTMA 1W1DA 1L08A 4CSQA 5DLAA 2MECA 2DQHY 1D9UA 1ALCA 1GXV2 1QTZA 1CJ8A 1GF9A 4L41A 189LA 2YBIA 4RLNA 1L94A 5HNCA 1QQYA 3QBVB 5LYZA 1XGRC 2L2IA 1GWDA 1L92A 1DI5A 1YIKA 5FI0A 3GUNA 243LA 1UUZC 4B4JA 3ATOA 3G3AB 5D5FA 2BQHA 4EMOA 4PRQA 3CIKA 1L37A 2BQGA 2UVMA 4F7UP 1LZ4A 1SSWA 2Z39A 4D9ZA 219LA 1U5EA 1OUJA 1PFJA 221LA 4WSFA 4WM2A 5LXWA 1WVHA 1BB3A 1T6VL 1FB8A 4I7NA 1GB9A 4G4BA 3TXEA 2D9WA 2D6BA 3LYTA 3KY9A 139LA 1L90A 1MKEA 1X1GA 4WO9A 1L0JA 2BQIA 2H7DA 1KIPC 163LA 2UZSA 1JWRA 1BB5A 1WG7A 1HELA 4NGLA 1P37A 3L2XA 3A93A 1WQNA 1LJ4A 1L30A 3WW5A 2Z13A 1LZCA 1JTOL 2J59M 3FM8C 4YEOA 4W55A 1WTNA 1V61A 3IVFA 1FOEA 1B7QA 4ETDA 1LTMA 1GBOA 1JJ0A 3A6CY 3P4ZA 208LA 1AQCA 2B6TA 2ELBA 168LA 2RBOA 210LA 2YT0A 5B1FA 7LYZA 1C61A 145LA 1VDQA 3WPKA 1GBZA 2A7DA 1J1OY 4GCBA 2OU9A 1GB2A 4W58A 4YXAC 128LA 4AQNA 5II3A 4MY6A 137LA 134LA 4G4HA 5E4PA 3SB9A 1C6QA 3B6LA 2Z2FA 1L67A 1G7IC 4HSIA 1IWXA 1LZ9A 4NGWA 228LA 1IC5Y 3DCXA 1GB3A 3C81A 1GC6A 1L91A 1G7MC 1GEVA 5KXYA 4DWXA 4OWBA 3AZ5A 140LA 1JTNA 151LA 4LZTA 4H8XA 1L73A 2IGCA 2COFA 1BWNA 1GD6A 4HTNA 192LA 1C6FA 1UEFA 1L41A 4HPIA 2N23A 1LGWA 3F9LA 3D3DA 3FI5A 1QC6A 1WTHA 4XWXA 5CLLB 1YANA 1G0JA 2H9KA 1T6HA 3G9WA 160LA 3MDBC 165LA 4H9IA 1DBHA 2YBMA 1L97A 1LJJA 1BVKC 1LSCA 1B7RA 5I2MA 5B05A 5KXPA 4W94A 2J0KA 1IWWA 142LA 5APFA 1MK9B 2VSZA 2BQDA 3KRXA 1DYDA 4LT3A 1P2RA 4LT2A 177LA 1JJ1A 2AUBA 2Y7BA 1LW9A 1OMWA 2K2JA 2HECA 1PS5A 2W2WA 1CJ7A 262LA 4M6DA 2DBTA 2ROVA 3WU7A 1YAOA 2G4NA 4LZMA 1H10A 2PZ1A 4H8SA 3MPXA 2LULA 3HUKA 107LA 141LA 4A6KA 1IVMA 207LA 4B6HA 4IOYX 2I6ZA 2Q9EA 1SHCA 2DHIA 5I5QA 4H93A 4HAZB 3KSYA 1Z55A 2YSSC 5ILCA 1B5ZA 5C6LA 2LG1A 2B6YA 5LG4B 3OE6A 3DMVA 2YF0A 4ARQA 3TXJA 2YDGA 1P56A 2W2XD 1NMMA 1I1ZA 242LA 3ZVRA 261LA 1D3NA 164LA 2DX1A 1D3JA 4X3BA 1OVKA 1EQ4A 2B6ZA 1NBYC 1I56A 1LI2A 2G4PA 1UIEA 3DN6A 1CKHA 1L64A 4PNKA 3AB6A 1QTCA 5L9JA 5KXSA 4A5KA 4HB0B 1G0PA 2DKPA 3P66A 245LA 2KIEA 2BQLA 1P36A 1CNSA 129LA 1J0WA 4H9FA 1TDYA 1BWHA 2CDSA 3ZDTA 5FHWA 5M1YA 2B72A 201LA 1AT5A 1L49A 1UIBA 3WULA 2H5ZA 1D2WA 4D6WA 1M7RA 1L60A 1LZRA 3PBLA 4B0DA 211LA 5KXZA 1BB6A 3J4GA 4WL6A 3P7ZA 2YBJA 5KXOA 1VAUA 258LA 1GE3A 2DQCY 1IOTA 199LA 1NDGC 118LA 2EMSA 4LT0A 3A6BY 1KXWA 1P46A 3DN3A 4DD7A 127LA 1LYIA 1LZDA 3EMSA 1YROA 3A8QA 2YBNA 1GBXA 2ZNXY 3BINA 1LPYA 3NYAA 3DN8A 206LA 2NZ8B 1LI3A 4DAJA 5KXNA 1XSFA 4BADA 1OUIA 4WJ7A 5F9UA 1L47A 1C45A 5FELA 1QT3A 1GE4A 2VB1A 4OOOA 2DX5A 216LA 2BLXA 2ZIJA 4ANRA 4EKPA 176LA 1CKFA 1OV7A 1XJTA 3RNXA 1OUFA 3CDTA 1VATA 4HSFA 4IFSA 3VIAA 1L01A 4Z98A 3TMXA 4D0NB 1PQOA 1LLHA 1C69A 1L09A 126LA 2Q13A 1EF1A 2B75A 4F7HA 1GG3A 3HSAA 1OUBA 2OE4X 1CX6A 2XBSA 1LJEA 4DJHA 1L39A 5HE2A 2Z0PA 1L03A 4K2OA 1L74A 1L93A 1G7JC 2XBRA 5F14A 1JKBA 1KZ7A 1XEJA 154LA 1GF3A 4WLXA 3F0WA 5A3ZA 3NWFA 1G06A 1C6AA 1QT7A 3AU4A 2CODA 1D0MA 2D4QA 4IATA 2DN6A 2MKRA 5GOWB 2EJ8A 5B1GA 212LA 4YONA 4W96A 4TKNA 1OVHA 1GFKA 4ZRKA 4NHQA 2Y8GA 1LJNA 3QIJA 1IRSA 3C8RA 1P3RA 3A67Y 3WXUA 1AZFA 4GXBA 4IAPA 1T8FA 3ULBA 3TXFA 2F2NA 4ARMB 246LA 5FDJA 4HJVA 196LA 2ZQ3A 1PMSA 1LW3A 3D8FA 2Z19A 153LA 1LB1A 1L96A 4OW1A 1IP4A 1QS9A 2B73A 3AU5A 3A94A 5JP4A 1XCGA 1LYFA 3HBDA 1UIFA 1CV6A 3WPJA 1CKDA 1L72A 1L66A 237LA 1LHLA 1B7PA 4WM3A 1MI1A 4TSBA 3GUMA 1UIAA 3P6AA 2LZMA 5L3HA 3FI7A 1LZAA 4XN6A 2A4TA 1D0KA 4GMXB 2Z0OA 236LA 3SB6A 123LA 1INUA 1D9WA 5LA5A 3X23A 2LYOA 4EKRA 2CWIA 4IJ4A 4H94A 1UIHA 3DN1A 2I5FA 2FYCA 2H7EA 162LA 3OE9A 3SO6A 3SNHA 1L42A 4CHJA 231LA 3A8PA 1NWGA 4I7JA 4DIXA 4W56A 5KQ1A 182LA 4LYZA 256LA 1RJCB 1BWJA 1C6KA 1LZ5A 2DKVA 2XJWA 1Z87A 4KHBA 1CU5A 3A91A 3CDOA 3CT0A 1HF4A 3ML4A 5DN5A 4GCFA 1IC7Y 1XEIA 3N9EA 1L22A 1JUGA 2LC9A 2C8PA 4K17A 1C6TA 1GF7A 3TVVA 2D9VA 3GUKA 4DX90 2RNRB 4EPIA 1B6IA 3HT8A 1IR8A 5A3EA 3PVWA 4TUNA 3WU8A 150LA 4LGKA 4OT1A 1REZA 2AEHA 5I54A 3HFMY 1G1VA 3BKVA 2BQOA 3AW7A 3DMZA 1LZSA 3DXCA 1TQZA 4OO9A 112LA 1IORA 1FLYA 3OANA 1L58A 3HBEX 1LHMA 4CGEA 3IJUA 1GBWA 1L46A 241LA 3N9CA 4W52A 1NHEA 4WVFB 1C08C 3TFMA 1DDMA 4H9AA 2DQEY 3W6FA 3WXTA 3JR6A 3SP3A 4HHVA 2B7XA 2ZKMX 1P5CA 3EMLA 4PGJB 3CDRA 4ARLA 5IHGA 235LA 1J1XY 1XKEA 4WM6A 4TX7A 2BQNA 5JLJB 3NW8A 3A98B 1L53A 1L29A 1FGYA 1C43A 5CLQB 1HERA 4YXCA 1J19A 149LA 4GRVA 3SUZA 2RSGA 2H9JA 3W6CA 1D6PA 3HH5A 4GPTB 1QDRA 4WOAA 3CXBB 4ARJA 1B5UA 4WM4A 1OWYA 2HEDA 157LA 3SBBC 4NGVA 2ZIKA 4ZIXA 5C5BB 1L79A 2DQGY 2HUKA 4QXAB 2HU3A 2LZ2A 1KNIA 1FLUA 1CV4A 1KW7A 2W2XC 2P0HA 1LZGA 3LN2A 3B72A 5D3WA 2OTXA 1SWYA 1U5FA 2VRWB 1L55A 1EQEA 4PK0A 2MDXA 115LA 1LJKA 1FAOA 2OEAX 247LA 1BGIA 4NGYA 5DHAB 1QSQA 4NGIA 1L16A 1NHBA 2O79A 3QAKA 2EC1A 4F7GA 169LA 1LZEA 2E2XA 232LA 1L81A 1QUDA 4NSWA 2ZYCA 2IFFY 1L98A 1QTEA 2PC2A 1ZSQA 1CJ6A 1NQIA 2RBNA 2P0DA 1D6QA 1C6IA 1BWIA 4NGZA 1AWEA 1FHWA 2B6XA 166LA 1L04A 4RLMA 1MLCE 3CSQA 3RCPA 1RCMA 1YQVY 1L85A 2YS1A 5LOPB 1L82A 2QARC 3TXIA 184LA 1ZC3B 1L44A 2HE7A 4LYOA 1NTVA 1FHOA 3C8QA 5EBHA 1GAYA 3F6ZA 1LMTA 1X05A 1C7PA 2O4WA 1DZBX 3HTFA 3ATNA 1WQPA 143LA 1YILA 4CFOA 2HUMA 2B5ZA 4RW1A 1QUGA 4LT1A 4DDBA 156LA 3HDEA 4KL7A 1UNQA 2HTHB 1LJGA 4H91A 3AJ4A 3WA0A 4G49A 4K5YA 4CYEA 1L48A 4LYMA 2FJUB 5C6RA 1IEEA 4HAUB 1KS3A 1C6PA 2YVBA 4DBBA 2RGNB 3OE8A 1IOSA 3WVYA 4PRUA 2Z18A 1X11A 5KXMA 2HTXA 1LYGA 3CQLA 1LSDA 1C63A 1U2BA 4GN3A 5KXRA 2ELAA 1V5PA 3TMUA 4NG8A 213LA 1GFEA 5FEKA 1VDTA 2RVBB 4U3XB 3W3EA 4GCEA 4IASA 1WQQA 3M3UA 2I1JA 5APDA 4M4OA 1B7NA 4PJZA 244LA 1L83A 4YOPA 4HAWB 2EIZC 113LA 5L81A 4N8ZA 1F6SA 4DT3A 2MEDA 2XTHA 2ZILA 1AM7A 2NTGA 1AT6A 5D5CA 1LSGA 2GUMA 1DPXA 1P64A 4YF2A 1OUEA 1L31A 135LA 4I7OA 2Z6BA 4ETCA 4AXTA 1UPQA 5D27A 4DD0A 2RLOA 2CJLA 5I53A 2W1MA 3W6BA 1LYOA 1L75A 1L77A 1JISA 1CV5A 5HMVA 1KY1A 1L00A 4HDOA 5IELA 1WQMA 5KKJA 1YKYX 1TJ6A 1IWVA 3PDSA 3V2YA 3HUAA 4BBKA 1F6RA 1L89A 3LZTA 1MPHA 4DD1A 3WU9A 4NSJA 2COCA 2EMTA 3TW1A 1HEQA 1ZVYB 1QUTA 1L15A 3CDQA 4NGKA 1B7SA 1JHLA 3BJIA 4P7IA 3QWMA 5HE3A 1H87A 1UBZA 1EGXA 1LZBA 4WG1A 1OUHA 3CT1A 1DKKA 2D4IA 1GBYA 1T8GA 4I7KA 3C83A 2W1XA 1GB0A 3A8ZA 3ULRA 5I4XA 1P2LA 2RUKB 158LA 1UIGA 8LYZA 1LSEA 1J1PY 4HAVB 4Z2NA 2LOZA 1GE0A 4WMGA 2BQCA 3TXDA 1LHHA 3RUNA 3TXBA 3RT5X 3CSZA 2OE7X 4BAFA 3EXDA 5LVHA 1DYAA 4GNKB 4C0AA 1D0LA 1WGUA 4N5RA 4EKUA 1UICA 1I2HA 1V88A 1HENA 1LJIA 1BTKA 3NWDA 1G0QA 1L07A 4LYBA 2QB0B 2BQEA 2Z59A 4GZUA 3VOQA 2XQOA 1DYBA 3DN2A 4NSHA 1WVUA 2UZRA 4DX8A 1IO5A 1FBIX 3GUPA 1C10A 1KY0A 1JQUA 3VW7A 4PHIA 2GS0A 1L76A 3QNGA 2WARA 1HFZA 3O96A 1LKSA 2OTZX 1QS5A 1XFPL 3A3RX 4LDLA 4OOTA 3B0OA 3ZVQA 3D9AC 1L14A 5LAFA 4CHMA 1G7HC 3FA0A 1OP9B 2MEAA 2Z2EA 4NHSA 1ZV5L 1QUOA 3AW6A 1L71A 2Q9DA 1LMOA 2MEFA 1HNLA 4W57A 3WYFB 4Z46A 2NTHA 1L40A 1GDXA 1B7OA 4TYZA 4KVGB 1L54A 1C66A 2RB2X 3IJVA 2B70A 2Y8PA 1L59A 4EJNA 3LYOA 1YAQA 3HK0A 1WJMA 1DKJA 1OUDA 1TCYA 5JHHA 4GCDA 1GB7A 2XQNM 4EMNA 5I4WA 2DHJA 4ARMA 1OV5A 1BAKA 249LA 109LA 4ZRJA 5LA8A 1EL1A 1B0DA 4I7QA 1UACY 5T3FA 1MIZB 1OQMA 5LONB 1NTYA 1VDSA 1QIOA 3QE8A 1X86A 1X1FA 1GB6A 1LHKA 1RRPB 1DXJA 3GULA 1LSNA 4G9SA 1G0MA 1HEOA 2F4AA 1QT4A 1BB7A 1C64A 4YEMA 1LYJA 2DTCA 1FGZA 1P7SA 255LA 3TCAA 5E9RA 4GMVA 2Z14A 4KT3A 2MEGA 2BQAA 3AZ6A 2DQFC 215LA 2D91A 2KUPA 2DYQA 5J3QA 4EOFA 4GN4A 1KZGA 1EAZA 1GB8A 3T6UA 4H9HA 4XADA 2ROZB 2CGIA 1L87A 1IC4Y 1GPQC 2HEEA 1C6EA 5FI1A 4XJDA 3TMWA 181LA 9LYZA 1TBYA 1C6JA 4L6EA 3HT7A 3SYXA 1HSWA 4YX7C 3NY8A 4ET9A 1L28A 4OWCA 4ET8A 4G4CA 4UWVA 4A6HA 4XJFA 1DYCA 1RJ2A 1MK7B 7LZMA 4RW2A 1L02A 4NIJA 4NEBA 1ISNA 3AZ7A 2D2QA 1JTTL 1IP1A 1GFJA 1U29A 3P65A 1LYZA 1UNPA 4GCCA 3WW6A 3G3XA 1I20A 2L1CA 4NGJA 3WUMA 5HLLA 1GFAA 3F5RA 1L17A 1DPWA 2MEBA 1L45A 250LA 4WLYA 2DYNA 4EKQA 3SB7A 1SX2A 3SB5A 1LWKA 1NI2A 2D4KA 1LMQA 4CFPA 4DQ7A 175LA 3ULCA 3DN4A 240LA 2FBDA 1LMCA 1LSMA 220LA 2MEIA 2Z0QA 2F2QA 5LYMA 4LYTA 3HTGA 1C65A 1CV3A 4NFVA 3DXEA 3FE0A 3T36A 119LA 4Z41A 3AJNA 1IX0A 2DFKA 4TSCA 2NBVA 1LYYA 1C67A 2FBBA 2B6WA 2N0YA 1WJ1A 1FLWA 1CX7A 1L20A 4ML7A 3SB8A 229LA 5KXXA 1L57A 5KXKA 2QKLA 3GUIA 3HW2B 1QSBA 1L65A 1IP2A 173LA 1YKXX 4PPOA 2AL6A 2OQBA 1HMLA 4ETBA 1C6DA 5LINA 1CVKA 3OE0A 4MCKA 1IOQA 4II8A 2J0MA 5HNLA 1C6MA 4QDNA 5ILFA 2M14A 1GF0A 4I0CA 1P2CC 4I7RA 5FCPA 2ZPYA 1B5XA 3D8DA 1L88A 3RU5A 1V5MA 4C5FA 191LA 4I7LA 3V5WA 2DQJY 3WL2A 1K5DB 1Q67A 1XR0B 1HEMA 2ZNWY 1L95A 1PQMA 1DYNA 4I7SA 5HMJA 1NKHA 1G07A 1D3FA 4B4EA 5LIOA 1QTVA 1L06A 2HUBA 2HEAA 1LZ8A 1PQKA 1N4FA 1KIQC 2RB0X 1KXXA 4UWNA 1WGQA 2RBPA 3AGIA 2M38A 2BPUA 1DYGA 2J0JA 3G3VA 5KXTA 1LKRA 144LA 2DHKA 3A34A 2YS5A 172LA 1LWGA 1SX7A 1V5UA 3KRWA 2ANVA 187LA 1QUHA 131LA 1DDWA 214LA 3M1IB 3U12A 4HV1A 1YKZX 1SLYA 1ZYTA 3MGWA 2A7FA 4N9RA 1L68A 5KKIA 1REMA 5KJ9A 3A92A 1LYSA 1XGQC 5KXLA 2RBQA 3KAMA 2K2UA 146LA 2K49A 1RFPA 1LSFA 2HEBA 1W1GA 2LYDA 5D3YA 1JEFA 1LMAA 3GXRA 4DD2A 2GCLA 1T97A 3UONA 2HU1A 1QT5A 4J1AA 1QSWA 1OVJA 3VWOA 5DI9B 5DL9A 2ZQ4A 4WM5A 132LA 2MWNB 1C60A 3HUQA 4NHTA 1K5GB 5J3TA 4HB3B 4DD9A 1C6HA 2ZWBA 1QDTA 122LA 222LA 2Y8FA 1L24A 3LHMA 3HH3A 3N7CA 1I6SA 1JPOA 4EXMA 3ZEKA 1LYEA 1XJUA 5DN4A 4ZEEA 102LA 103LA 1IWUA 1IY3A 2DA0A 4EPFA 2RB1X 4H9CA 5HE1A 2DQDY 1IP7A 4HP0A 3A95A 3T06A 130LA 4I7TA 1DYFA 1V89A 4Z2MB 253LA 1XGUC 148LE 2RBSA 1B5WA 1YAMA 1C6CA 2CAYA 2G4QA 3P64A 1D2YA 1YAPA 4DD3A 5IRSA 155LA 1LGXA 2I26L 5DM9A 120LA 4A7DA 3DNAA 3EBAB 3HT6A 4YM8A 4Z3MA 110LA 1E5WA 1W6ZA 2Z4DA 1CTWA 1FLQA 1LGUA 111LA 1V7TA 2D9YA 2MFQA 3PVLA 2F47A 4DQ5A 1BTNA 227LA 2RH1A 3OHMB 2F4GA 2N5ZA 1L84A 1IR7A 1GC7A 3AZ4A 6LYZA 217LA 1ZURA 4NG1A 1GB5A 4N1CC 1LHJA 1IIZA 1UIDA 1QTBA 3WPLA 1XX0A 2RAYX 4QGZA 1JKDA 5K7OA 4HJZA 1V7SA 4PQ0A 2GCJA 4TTDA 1HFXA 3B0IA 4KHOA 1LI6A 147LA 2DQIY 4LFXA 5D3XA 3CSRA 2KUQA 1YL1X 3ODUA 3GUJA 1QSAA 1EPYA 3EO5A 1QTKA 4NGOA 4NWHA 1A2YC 4H8YA 4A6FA 1JSEA 3WUNA 2LYZA 1ZWNA 4NY5A 5M4YB 108LA 5F16A 3PG7A 2RRFA 1CUQA 3HU8A 4QJ3B 1VDPA 2V76A 2CY4A 200LA 1G7LC 1PQIA 5LVIA 4HATB 1DQJC 4WLDA 1L34A 251LA 225LA 5LVGA 2P0FA 1H6MA 1UPRA 4HB4B 1QUSA 3LJUX 1L19A 4WG7A 1LMPA 3E3DA 1JKCA 4NHIA 233LA 2EKSC 104LA 198LA 4S0WA 4ARQB 1EVHA 3FSSA 1EQ5A 3LZMA 1BB4A 2YT1A 1XEPA 5DHFB 4DC4A 1FKQA 1LSBA 2GJYA 1OWZA 1W08A 4FDYA 1C6LA 1L27A 1OUAA 230LA 3AGHA 1OUGA 1QT8A 1L56A 2BLYA 4KHAA 1K28A 4MK0A 4QY9A 1OY2A 1FN5A 1H4RA 5J3YA 2IHLA 3FVCA 5DH9B 1QTHA 2LHMA 1SSYA 2Z12A 4ETAA 1TAYA 1LJHA 1GF4A 1W1HA 2YBHA 1ZYIA 3LYZA 1B7LA 238LA 2HEFA 3HT9A 5B59A 186LA 4EKSA 4YENA 125LA 1B9OA 1XD4A 4CHXA 1C62A 1PQDA 4BAPA 1GF5A 1KXYA 4ZRIA 133LA 4DKLA 1VFBC 1OYUA 1XGPC 1HHLA 5D3VA 2OTYX 3RZEA 3C82A 1I7AA 5LVJA 4MT7A 1JITA 1C6BA 1GAZA 3NY9A 193LA 4H9EA 3HU9A 1L38A 5LAGA 1L11A 3C80A 1SGHA 1L13A 5KY1A 4LDOA 3HBHA 2I1KA 1U27A 195LA 3OJPA 4H8ZA 2YS3A 2OU8A 138LA 3HH6A 3AYQA 1LZNA 1NF5A 2FYDA 239LA 1L26A 185LA 1CU6A 3QY4A 4NSGA 205LA 2YVCA 4ETEA 1T3PA 5HQ1A 1FHXA 3WH1A 1NDMC 5KCVA 2DQAA 1P6SA 3W6DA 1GFTA 5B06A 1GE2A 4H90A 1LSPA 1L52A 2Z37A 3F8VA 3SBAA 1L10A 159LA 1LSAA 3FADA 1LPIA 1WVVA 3DKEX 1JJ3A 1SWZA 2O7AA 4HTKA 2F32A 114LA 3A90A 1ZM0A 3UZTA 4A6FB 1Y19B 3ODWA 3HTBA 2LCBA 1TEWA 5J7CA 1ZVRA 2C8OA 180LA 1IOCA 5I2SA 3M18B 3N9AA 3B77A 260LA 1L33A 1GFHA 4E3UA 2D10A 4HPEA 3G3WA 3HDFA 1C46A 3CT5A 2B74A 4XJHA 2CY5A 1LAAA 4LFPA 3BKHA 1LYHA 1WQRA 4WL7A 3TO1A 1VEDA 4GN1A 1UA6Y 1REYA 2F30A 1T8AA 2OU0X 4J7VA 1HEPA 1B5YA 174LA 3DN0A 3W6EA 4LYCA 4GN5C 4H9BA 4L1RA 4W54A 2IYBA 4K2PA 1RI8B 2ANXA 3PVUA 1CU0A 1XODA 1GEZA 1T77A 1GFRA 3TXHA 1LZ6A 3A3QA 4K81A 5KXWA 4GOUA 1IP3A 2KR0A 3GYOA 1C6GA 5KQ4A 259LA 2KCJA 2LYMA 2BAAA 1M7EA 3RZ4A 2D11A 4XJGA 2P8VA 1CV1A 5LYTA 1GFUA 2D9ZA 1IP5A 2LOXA 4C3WA 4W59A 3FEHA 1BVXA 4OWHA 1LCNA 1U5GA 4GLAA 2COAA 3TMVA 4E97A 4WM1A 1B5VA 4HJYA 1O23A 2OE9X
chains in the Genus database with same CATH topology
1LJ3A 3K2RA 209LA 3AGGG 1TLAA 171LA 1GF6A 4ARPA 2YSZA 1L23A 1CU3A 1L86A 2Z38A 4BS7A 3PEGA 1NU2A 4I8SA 4O34A 4HAYB 1CU2A 1UCOA 1WI1A 1CKCA 3LZ2A 1ZMYL 1L43A 3U8ZA 6LYTA 1CV0A 3IWRA 3V2WA 1HSXA 3PZDA 1GDWA 4I7MA 5JHGA 1UC0A 1P5TA 4WLTA 167LA 1OQNA 4QEQA 1UNRA 5FSTA 2YBLA 3HTDA 4P2EA 2KGXB 2EPEA 3C7YA 2EQLA 3PSCA 1L32A 161LA 1LSZA 1RE2A 4ZFPA 4XJBA 1PLSA 1JIYA 4UWUA 1U5DA 5C5BA 1QT6A 3WMKA 4OWAA 1MIXA 5IDDA 1PZYA 2YRYA 2Q0MX 1L63A 4DDCA 1Y5OA 2DLWA 4R6CA 1ZC4B 3ZVQB 2MEHA 1G0KA 4N0JA 4HV2A 4KPMA 1LJFA 4H1PA 1BQLY 4KXIA 2I5CA 1IR9A 1B2KA 2RSCA 3TXKA 1SQ2L 1C68A 1IWTA 4ZPUA 5DIFB 2D9XA 5I14A 2BQKA 234LA 252LA 1JSFA 1PQJA 254LA 3L64A 2W1LA 1D3MA 4EJ4A 1LZ1A 2X18A 1GF8A 1L35A 1P6YA 3ODXA 4I7PA 3U7DA 4KAXB 1IY4A 2QKMA 1B7MA 1FDLY 1F10A 1BHZA 1L0KA 3B0KA 1L51A 2LKOA 2GV0A 1G0GA 1MELL 2ZYPA 4B1AA 1AKIA 2L78A 5HE0A 4XYYA 1GE1A 1NBZC 224LA 170LA 2VKIA 4J1BA 1HMKA 2RBRA 1F0WA 1A4VA 3A96A 2NMBA 4DQJA 2NWDX 1JTMA 1DROA 226LA 2ADZA 1WQOA 2CRFA 3K3TA 1L36A 2HULA 4H92A 5APEA 4FJRA 1GFVA 4PJ2C 2R09A 5C6JA 3PP2A 2MEEA 1L12A 4W53A 5LVKA 4B49A 152LA 1DYEA 4KHBB 1TXDA 1ZVHL 5C16A 3DMXA 4N1EI 2BQMA 2K00A 2JP2A 4NY0A 1KI1B 4B4IA 1L50A 248LA 3C8SA 1XEKA 4TWSA 5F81A 4GLVA 1HFYA 5JENB 3NSUA 1FKVA 3WUAA 3D8EA 1CUPA 3CB7A 4XJIA 4NWEA 4WO6A 223LA 5F9XA 1QQGA 5AMYA 1IP6A 4MSTA 3C7WA 2R0DA 2I25L 3C7ZA 2BQBA 4YL8A 188LA 3GUOA 4R0FA 3KZ1A 1OUCA 2D4JA 6LZMA 3HQCA 1IWZA 1CJ9A 4NHPA 1E8LA 1HEWA 3RW8A 4MR1A 3CDVA 2CUUA 4XENA 1LZYA 5C79A 1L80A 3G3BB 1GFGA 3D4SA 1REXA 4HDQA 1JKAA 1XGTC 1G0LA 190LA 4DYGA 1L25A 2W1YA 1L62A 4HTQA 4HB2B 2RAZX 4RDSA 3WYHA 194LA 3OK0A 4NSIA 1DDVA 1GHLA 5I4YA 1C6NA 2X0AA 1JTPL 5APCA 1DI4A 2LZTA 3SN6R 257LA 1YL0X 5LZMA 1KW5A 1L18A 218LA 1G1WA 4HAXB 3GYPA 2DKQA 3DXDA 2IFSA 1N3HA 3SV1A 3HH4A 1KIRC 1L21A 4DDAA 1B55A 1L99A 2BQJA 4W51A 3ODOA 1L05A 3WVXA 1QTDA 3W6AA 4LDEA 3HWLA 5EFXA 1LHIA 5L3IA 2BCJA 2G35A 2FJLA 1L70A 1LOZA 178LA 1CKGA 2BQFA 4OWEA 1LMNA 1L61A 1L69A 4GBRB 4CJ2A 1LZTA 1MAIA 3P68A 1HC0A 4DXAB 4AGAA 3LYMA 1IWYA 1GBSA 1LSYA 197LA 4J0LA 5B07A 5C6IA 3GXKA 4Y94A 1GXXA 3TXGA 1LYDA 3J6KA 1P3NA 1DI3A 183LA 1WTMA 1W1DA 1L08A 5DLAA 2MECA 2DQHY 1D9UA 1ALCA 1GXV2 1QTZA 1CJ8A 1GF9A 4L41A 189LA 2YBIA 4RLNA 1L94A 5HNCA 1QQYA 3QBVB 5LYZA 1XGRC 2L2IA 1GWDA 1L92A 1DI5A 1YIKA 5FI0A 3GUNA 243LA 1UUZC 4B4JA 3ATOA 3G3AB 5D5FA 2BQHA 4EMOA 4PRQA 3CIKA 1L37A 2BQGA 2UVMA 4F7UP 1LZ4A 1SSWA 2Z39A 4D9ZA 219LA 1U5EA 1OUJA 1PFJA 221LA 4WSFA 4WM2A 5LXWA 1WVHA 1BB3A 1T6VL 1FB8A 4I7NA 1GB9A 4G4BA 3TXEA 2D9WA 2D6BA 3LYTA 3KY9A 139LA 1L90A 1MKEA 1X1GA 4WO9A 1L0JA 2BQIA 2H7DA 1KIPC 163LA 2UZSA 1JWRA 1BB5A 1WG7A 1HELA 4NGLA 1P37A 3L2XA 3A93A 1WQNA 1LJ4A 1L30A 3WW5A 1LZCA 1JTOL 2J59M 3FM8C 4YEOA 4W55A 1WTNA 1V61A 3IVFA 1FOEA 1B7QA 4ETDA 1LTMA 1GBOA 1JJ0A 3A6CY 3P4ZA 208LA 1AQCA 2B6TA 2ELBA 168LA 2RBOA 210LA 2YT0A 5B1FA 7LYZA 1C61A 145LA 1VDQA 3WPKA 1GBZA 2A7DA 1J1OY 4GCBA 2OU9A 1GB2A 4W58A 4YXAC 128LA 4AQNA 5II3A 4MY6A 137LA 134LA 4G4HA 5E4PA 3SB9A 1C6QA 3B6LA 2Z2FA 1L67A 1G7IC 1IWXA 1LZ9A 4NGWA 228LA 1IC5Y 1GB3A 3C81A 1GC6A 1L91A 1G7MC 1GEVA 5KXYA 4DWXA 4OWBA 3AZ5A 140LA 1JTNA 151LA 4LZTA 4H8XA 1L73A 2IGCA 2COFA 1BWNA 1GD6A 4HTNA 192LA 1C6FA 1UEFA 1L41A 4HPIA 2N23A 1LGWA 3F9LA 3D3DA 3FI5A 1QC6A 1WTHA 4XWXA 5CLLB 1YANA 1G0JA 2H9KA 1T6HA 3G9WA 160LA 3MDBC 165LA 4H9IA 1DBHA 2YBMA 1L97A 1LJJA 1BVKC 1LSCA 1B7RA 5B05A 5KXPA 4W94A 2J0KA 1IWWA 142LA 5APFA 1MK9B 2VSZA 2BQDA 3KRXA 1DYDA 4LT3A 1P2RA 4LT2A 177LA 1JJ1A 2AUBA 2Y7BA 1LW9A 1OMWA 2K2JA 2HECA 1PS5A 2W2WA 1CJ7A 262LA 4M6DA 2DBTA 2ROVA 3WU7A 1YAOA 2G4NA 4LZMA 1H10A 2PZ1A 4H8SA 3MPXA 2LULA 3HUKA 107LA 141LA 4A6KA 1IVMA 207LA 4B6HA 4IOYX 2I6ZA 2Q9EA 1SHCA 2DHIA 5I5QA 4H93A 4HAZB 3KSYA 1Z55A 2YSSC 5ILCA 1B5ZA 5C6LA 2LG1A 2B6YA 3OE6A 3DMVA 2YF0A 4ARQA 3TXJA 2YDGA 1P56A 2W2XD 1NMMA 1I1ZA 242LA 3ZVRA 261LA 1D3NA 164LA 2DX1A 1D3JA 4X3BA 1OVKA 1EQ4A 2B6ZA 1NBYC 1I56A 1LI2A 2G4PA 1UIEA 3DN6A 1CKHA 1L64A 4PNKA 3AB6A 1QTCA 5L9JA 5KXSA 4A5KA 4HB0B 1G0PA 2DKPA 3P66A 245LA 2BQLA 1P36A 1CNSA 129LA 1J0WA 4H9FA 1TDYA 1BWHA 2CDSA 3ZDTA 5FHWA 5M1YA 2B72A 201LA 1AT5A 1L49A 1UIBA 3WULA 2H5ZA 1D2WA 1M7RA 1L60A 1LZRA 3PBLA 4B0DA 211LA 5KXZA 1BB6A 3J4GA 4WL6A 3P7ZA 2YBJA 5KXOA 1VAUA 258LA 1GE3A 2DQCY 1IOTA 199LA 1NDGC 118LA 2EMSA 4LT0A 3A6BY 1KXWA 1P46A 3DN3A 4DD7A 127LA 1LYIA 1LZDA 3EMSA 1YROA 3A8QA 2YBNA 1GBXA 2ZNXY 3BINA 1LPYA 3NYAA 3DN8A 206LA 2NZ8B 1LI3A 4DAJA 5KXNA 1XSFA 4BADA 1OUIA 4WJ7A 5F9UA 1L47A 1C45A 5FELA 1QT3A 1GE4A 2VB1A 4OOOA 2DX5A 216LA 2BLXA 2ZIJA 4ANRA 4EKPA 176LA 1CKFA 1OV7A 1XJTA 3RNXA 1OUFA 3CDTA 1VATA 4HSFA 4IFSA 3VIAA 1L01A 4Z98A 3TMXA 4D0NB 1PQOA 1LLHA 1C69A 1L09A 126LA 2Q13A 1EF1A 2B75A 4F7HA 1GG3A 1OUBA 2OE4X 1CX6A 2XBSA 1LJEA 4DJHA 1L39A 5HE2A 2Z0PA 1L03A 4K2OA 1L74A 1L93A 1G7JC 2XBRA 5F14A 1JKBA 1KZ7A 1XEJA 154LA 1GF3A 4WLXA 3F0WA 5A3ZA 1G06A 1C6AA 1QT7A 3AU4A 2CODA 1D0MA 2D4QA 4IATA 2DN6A 2MKRA 5GOWB 2EJ8A 5B1GA 212LA 4YONA 4W96A 4TKNA 1OVHA 1GFKA 4ZRKA 4NHQA 2Y8GA 1LJNA 3QIJA 1IRSA 3C8RA 1P3RA 3A67Y 3WXUA 1AZFA 4GXBA 4IAPA 1T8FA 3ULBA 3TXFA 2F2NA 4ARMB 246LA 5FDJA 4HJVA 196LA 2ZQ3A 1PMSA 1LW3A 3D8FA 2Z19A 153LA 1LB1A 1L96A 4OW1A 1IP4A 1QS9A 2B73A 3AU5A 3A94A 5JP4A 1XCGA 1LYFA 3HBDA 1UIFA 1CV6A 3WPJA 1CKDA 1L72A 1L66A 237LA 1LHLA 1B7PA 4WM3A 4TSBA 3GUMA 1UIAA 3P6AA 2LZMA 5L3HA 3FI7A 1LZAA 4XN6A 2A4TA 1D0KA 4GMXB 2Z0OA 236LA 3SB6A 123LA 1INUA 1D9WA 5LA5A 3X23A 2LYOA 4EKRA 2CWIA 4IJ4A 4H94A 1UIHA 3DN1A 2I5FA 2FYCA 2H7EA 162LA 3OE9A 3SO6A 3SNHA 1L42A 4CHJA 231LA 3A8PA 1NWGA 4I7JA 4W56A 5KQ1A 182LA 4LYZA 256LA 1RJCB 1BWJA 1C6KA 1LZ5A 2DKVA 2XJWA 1Z87A 1CU5A 3A91A 3CDOA 3CT0A 1HF4A 3ML4A 5DN5A 4GCFA 1IC7Y 1XEIA 3N9EA 1L22A 1JUGA 2LC9A 2C8PA 4K17A 1C6TA 1GF7A 3TVVA 2D9VA 3GUKA 4DX90 2RNRB 4EPIA 1B6IA 3HT8A 1IR8A 5A3EA 3PVWA 4TUNA 3WU8A 150LA 4LGKA 1REZA 2AEHA 5I54A 3HFMY 1G1VA 3BKVA 2BQOA 3AW7A 3DMZA 1LZSA 3DXCA 1TQZA 4OO9A 112LA 1IORA 1FLYA 3OANA 1L58A 3HBEX 1LHMA 4CGEA 3IJUA 1GBWA 1L46A 241LA 3N9CA 4W52A 1NHEA 4WVFB 1C08C 3TFMA 1DDMA 4H9AA 2DQEY 3W6FA 3WXTA 3JR6A 3SP3A 4HHVA 2B7XA 1P5CA 3EMLA 4PGJB 3CDRA 4ARLA 5IHGA 235LA 1J1XY 1XKEA 4WM6A 4TX7A 2BQNA 5JLJB 3A98B 1L53A 1L29A 1FGYA 1C43A 5CLQB 1HERA 4YXCA 1J19A 149LA 4GRVA 3SUZA 2RSGA 2H9JA 3W6CA 1D6PA 3HH5A 4GPTB 1QDRA 4WOAA 3CXBB 4ARJA 1B5UA 4WM4A 1OWYA 2HEDA 157LA 3SBBC 4NGVA 2ZIKA 4ZIXA 5C5BB 1L79A 2DQGY 2HUKA 2HU3A 2LZ2A 1KNIA 1FLUA 1CV4A 1KW7A 2W2XC 2P0HA 1LZGA 3LN2A 3B72A 5D3WA 2OTXA 1SWYA 1U5FA 2VRWB 1L55A 1EQEA 4PK0A 2MDXA 115LA 1LJKA 1FAOA 2OEAX 247LA 1BGIA 4NGYA 5DHAB 1QSQA 4NGIA 1L16A 1NHBA 2O79A 3QAKA 2EC1A 4F7GA 169LA 1LZEA 2E2XA 232LA 1L81A 1QUDA 4NSWA 2ZYCA 2IFFY 1L98A 1QTEA 2PC2A 1ZSQA 1CJ6A 1NQIA 2RBNA 2P0DA 1D6QA 1C6IA 1BWIA 4NGZA 1AWEA 1FHWA 2B6XA 166LA 1L04A 4RLMA 1MLCE 3CSQA 3RCPA 1RCMA 1YQVY 1L85A 2YS1A 5LOPB 1L82A 2QARC 3TXIA 184LA 1ZC3B 1L44A 2HE7A 4LYOA 1NTVA 1FHOA 3C8QA 5EBHA 1GAYA 3F6ZA 1LMTA 1X05A 1C7PA 2O4WA 1DZBX 3HTFA 3ATNA 1WQPA 143LA 1YILA 4CFOA 2HUMA 2B5ZA 4RW1A 1QUGA 4LT1A 4DDBA 156LA 3HDEA 4KL7A 1UNQA 2HTHB 1LJGA 4H91A 3AJ4A 3WA0A 4G49A 4K5YA 4CYEA 1L48A 4LYMA 5C6RA 1IEEA 4HAUB 1KS3A 1C6PA 2YVBA 4DBBA 2RGNB 3OE8A 1IOSA 3WVYA 4PRUA 2Z18A 1X11A 5KXMA 2HTXA 1LYGA 3CQLA 1LSDA 1C63A 1U2BA 4GN3A 5KXRA 2ELAA 1V5PA 3TMUA 4NG8A 213LA 1GFEA 5FEKA 1VDTA 2RVBB 4U3XB 3W3EA 4GCEA 4IASA 1WQQA 3M3UA 2I1JA 5APDA 4M4OA 1B7NA 4PJZA 244LA 1L83A 4YOPA 4HAWB 2EIZC 113LA 5L81A 4N8ZA 1F6SA 4DT3A 2MEDA 2XTHA 2ZILA 1AM7A 2NTGA 1AT6A 5D5CA 1LSGA 1DPXA 1P64A 4YF2A 1OUEA 1L31A 135LA 4I7OA 2Z6BA 4ETCA 4AXTA 1UPQA 5D27A 4DD0A 2RLOA 2CJLA 5I53A 2W1MA 3W6BA 1LYOA 1L75A 1L77A 1JISA 1CV5A 5HMVA 1KY1A 1L00A 4HDOA 5IELA 1WQMA 5KKJA 1YKYX 1TJ6A 1IWVA 3PDSA 3V2YA 3HUAA 4BBKA 1F6RA 1L89A 3LZTA 1MPHA 4DD1A 3WU9A 4NSJA 2COCA 2EMTA 3TW1A 1HEQA 1ZVYB 1QUTA 1L15A 3CDQA 4NGKA 1B7SA 1JHLA 3BJIA 4P7IA 3QWMA 5HE3A 1H87A 1UBZA 1EGXA 1LZBA 4WG1A 1OUHA 3CT1A 1DKKA 2D4IA 1GBYA 1T8GA 4I7KA 3C83A 2W1XA 1GB0A 3A8ZA 3ULRA 5I4XA 1P2LA 2RUKB 158LA 1UIGA 8LYZA 1LSEA 1J1PY 4HAVB 4Z2NA 2LOZA 1GE0A 4WMGA 2BQCA 3TXDA 1LHHA 3RUNA 3TXBA 3RT5X 3CSZA 2OE7X 4BAFA 3EXDA 5LVHA 1DYAA 4C0AA 1D0LA 1WGUA 4N5RA 4EKUA 1UICA 1I2HA 1V88A 1HENA 1LJIA 1BTKA 1G0QA 1L07A 4LYBA 2QB0B 2BQEA 4GZUA 3VOQA 2XQOA 1DYBA 3DN2A 4NSHA 1WVUA 2UZRA 4DX8A 1IO5A 1FBIX 3GUPA 1C10A 1KY0A 1JQUA 3VW7A 4PHIA 2GS0A 1L76A 3QNGA 2WARA 1HFZA 3O96A 1LKSA 2OTZX 1QS5A 1XFPL 3A3RX 4LDLA 4OOTA 3B0OA 3ZVQA 3D9AC 1L14A 5LAFA 4CHMA 1G7HC 3FA0A 1OP9B 2MEAA 2Z2EA 4NHSA 1ZV5L 1QUOA 3AW6A 1L71A 2Q9DA 1LMOA 2MEFA 1HNLA 4W57A 3WYFB 4Z46A 2NTHA 1L40A 1GDXA 1B7OA 4TYZA 4KVGB 1L54A 1C66A 2RB2X 3IJVA 2B70A 2Y8PA 1L59A 4EJNA 3LYOA 1YAQA 3HK0A 1WJMA 1DKJA 1OUDA 1TCYA 5JHHA 4GCDA 1GB7A 2XQNM 4EMNA 5I4WA 2DHJA 4ARMA 1OV5A 1BAKA 249LA 109LA 4ZRJA 5LA8A 1EL1A 1B0DA 4I7QA 1UACY 5T3FA 1MIZB 1OQMA 5LONB 1NTYA 1VDSA 1QIOA 3QE8A 1X86A 1X1FA 1GB6A 1LHKA 1RRPB 1DXJA 3GULA 1LSNA 4G9SA 1G0MA 1HEOA 2F4AA 1QT4A 1BB7A 1C64A 4YEMA 1LYJA 2DTCA 1FGZA 1P7SA 255LA 3TCAA 5E9RA 4GMVA 4KT3A 2MEGA 2BQAA 3AZ6A 2DQFC 215LA 2D91A 2KUPA 2DYQA 5J3QA 4EOFA 4GN4A 1KZGA 1EAZA 1GB8A 3T6UA 4H9HA 4XADA 2ROZB 2CGIA 1L87A 1IC4Y 1GPQC 2HEEA 1C6EA 5FI1A 4XJDA 3TMWA 181LA 9LYZA 1TBYA 1C6JA 4L6EA 3HT7A 3SYXA 1HSWA 4YX7C 3NY8A 4ET9A 1L28A 4OWCA 4ET8A 4G4CA 4UWVA 4A6HA 4XJFA 1DYCA 1RJ2A 1MK7B 7LZMA 4RW2A 1L02A 4NIJA 4NEBA 1ISNA 3AZ7A 2D2QA 1JTTL 1IP1A 1GFJA 1U29A 3P65A 1LYZA 1UNPA 4GCCA 3WW6A 3G3XA 1I20A 2L1CA 4NGJA 3WUMA 5HLLA 1GFAA 3F5RA 1L17A 1DPWA 2MEBA 1L45A 250LA 4WLYA 2DYNA 4EKQA 3SB7A 1SX2A 3SB5A 1LWKA 1NI2A 2D4KA 1LMQA 4CFPA 4DQ7A 175LA 3ULCA 3DN4A 240LA 2FBDA 1LMCA 1LSMA 220LA 2MEIA 2Z0QA 2F2QA 5LYMA 4LYTA 3HTGA 1C65A 1CV3A 4NFVA 3DXEA 3FE0A 3T36A 119LA 4Z41A 3AJNA 1IX0A 2DFKA 4TSCA 1LYYA 1C67A 2FBBA 2B6WA 2N0YA 1WJ1A 1FLWA 1CX7A 1L20A 4ML7A 3SB8A 229LA 5KXXA 1L57A 5KXKA 2QKLA 3GUIA 3HW2B 1QSBA 1L65A 1IP2A 173LA 1YKXX 4PPOA 2AL6A 2OQBA 1HMLA 4ETBA 1C6DA 5LINA 1CVKA 3OE0A 4MCKA 1IOQA 4II8A 2J0MA 5HNLA 1C6MA 4QDNA 5ILFA 2M14A 1GF0A 4I0CA 1P2CC 4I7RA 5FCPA 2ZPYA 1B5XA 3D8DA 1L88A 3RU5A 1V5MA 4C5FA 191LA 4I7LA 3V5WA 2DQJY 3WL2A 1K5DB 1Q67A 1XR0B 1HEMA 2ZNWY 1L95A 1PQMA 1DYNA 4I7SA 5HMJA 1NKHA 1G07A 1D3FA 4B4EA 5LIOA 1QTVA 1L06A 2HUBA 2HEAA 1LZ8A 1PQKA 1N4FA 1KIQC 2RB0X 1KXXA 4UWNA 1WGQA 2RBPA 3AGIA 2M38A 2BPUA 1DYGA 2J0JA 3G3VA 5KXTA 1LKRA 144LA 2DHKA 3A34A 2YS5A 172LA 1LWGA 1SX7A 1V5UA 3KRWA 2ANVA 187LA 1QUHA 131LA 1DDWA 214LA 3M1IB 4HV1A 1YKZX 1SLYA 1ZYTA 3MGWA 2A7FA 4N9RA 1L68A 5KKIA 1REMA 5KJ9A 3A92A 1LYSA 1XGQC 5KXLA 2RBQA 3KAMA 2K2UA 146LA 1RFPA 1LSFA 2HEBA 1W1GA 2LYDA 5D3YA 1JEFA 1LMAA 3GXRA 4DD2A 2GCLA 1T97A 3UONA 2HU1A 1QT5A 4J1AA 1QSWA 1OVJA 3VWOA 5DI9B 5DL9A 2ZQ4A 4WM5A 132LA 2MWNB 1C60A 3HUQA 4NHTA 1K5GB 5J3TA 4HB3B 4DD9A 1C6HA 2ZWBA 1QDTA 122LA 222LA 2Y8FA 1L24A 3LHMA 3HH3A 3N7CA 1I6SA 1JPOA 4EXMA 3ZEKA 1LYEA 1XJUA 5DN4A 4ZEEA 102LA 103LA 1IWUA 1IY3A 2DA0A 4EPFA 2RB1X 4H9CA 5HE1A 2DQDY 1IP7A 4HP0A 3A95A 3T06A 130LA 4I7TA 1DYFA 1V89A 4Z2MB 253LA 1XGUC 148LE 2RBSA 1B5WA 1YAMA 1C6CA 2CAYA 2G4QA 3P64A 1D2YA 1YAPA 4DD3A 155LA 1LGXA 2I26L 5DM9A 120LA 4A7DA 3DNAA 3EBAB 3HT6A 4YM8A 4Z3MA 110LA 1E5WA 1W6ZA 1CTWA 1FLQA 1LGUA 111LA 1V7TA 2D9YA 2MFQA 3PVLA 2F47A 4DQ5A 1BTNA 227LA 2RH1A 2F4GA 2N5ZA 1L84A 1IR7A 1GC7A 3AZ4A 6LYZA 217LA 1ZURA 4NG1A 1GB5A 4N1CC 1LHJA 1IIZA 1UIDA 1QTBA 3WPLA 1XX0A 2RAYX 4QGZA 1JKDA 5K7OA 4HJZA 1V7SA 4PQ0A 2GCJA 4TTDA 1HFXA 3B0IA 4KHOA 1LI6A 147LA 2DQIY 4LFXA 5D3XA 3CSRA 1YL1X 3ODUA 3GUJA 1QSAA 1EPYA 3EO5A 1QTKA 4NGOA 4NWHA 1A2YC 4H8YA 4A6FA 1JSEA 3WUNA 2LYZA 1ZWNA 4NY5A 108LA 5F16A 3PG7A 1CUQA 3HU8A 1VDPA 2V76A 2CY4A 200LA 1G7LC 1PQIA 5LVIA 4HATB 1DQJC 4WLDA 1L34A 251LA 225LA 5LVGA 2P0FA 1H6MA 1UPRA 4HB4B 1QUSA 3LJUX 1L19A 4WG7A 1LMPA 3E3DA 1JKCA 4NHIA 233LA 2EKSC 104LA 198LA 4S0WA 4ARQB 1EVHA 3FSSA 1EQ5A 3LZMA 1BB4A 2YT1A 1XEPA 5DHFB 4DC4A 1FKQA 1LSBA 2GJYA 1OWZA 1W08A 4FDYA 1C6LA 1L27A 1OUAA 230LA 3AGHA 1OUGA 1QT8A 1L56A 2BLYA 4KHAA 1K28A 4MK0A 4QY9A 1OY2A 1FN5A 1H4RA 5J3YA 2IHLA 5DH9B 1QTHA 2LHMA 1SSYA 2Z12A 4ETAA 1TAYA 1LJHA 1GF4A 1W1HA 2YBHA 3LYZA 1B7LA 238LA 2HEFA 3HT9A 5B59A 186LA 4EKSA 4YENA 125LA 1B9OA 1XD4A 4CHXA 1C62A 1PQDA 4BAPA 1GF5A 1KXYA 4ZRIA 133LA 4DKLA 1VFBC 1OYUA 1XGPC 1HHLA 5D3VA 2OTYX 3RZEA 3C82A 1I7AA 5LVJA 4MT7A 1JITA 1C6BA 1GAZA 3NY9A 193LA 4H9EA 3HU9A 1L38A 5LAGA 1L11A 3C80A 1SGHA 1L13A 5KY1A 4LDOA 3HBHA 2I1KA 1U27A 195LA 3OJPA 4H8ZA 2YS3A 2OU8A 138LA 3HH6A 3AYQA 1LZNA 1NF5A 2FYDA 239LA 1L26A 185LA 1CU6A 3QY4A 4NSGA 205LA 2YVCA 4ETEA 1T3PA 5HQ1A 1FHXA 3WH1A 1NDMC 5KCVA 2DQAA 1P6SA 3W6DA 1GFTA 5B06A 1GE2A 4H90A 1LSPA 1L52A 2Z37A 3F8VA 3SBAA 1L10A 159LA 1LSAA 3FADA 1LPIA 1WVVA 3DKEX 1JJ3A 1SWZA 2O7AA 4HTKA 2F32A 114LA 3A90A 1ZM0A 3UZTA 4A6FB 1Y19B 3ODWA 3HTBA 2LCBA 1TEWA 5J7CA 1ZVRA 2C8OA 180LA 1IOCA 3M18B 3N9AA 260LA 1L33A 1GFHA 4E3UA 2D10A 4HPEA 3G3WA 3HDFA 1C46A 3CT5A 2B74A 4XJHA 2CY5A 1LAAA 4LFPA 3BKHA 1LYHA 1WQRA 4WL7A 3TO1A 1VEDA 4GN1A 1UA6Y 1REYA 2F30A 1T8AA 2OU0X 4J7VA 1HEPA 1B5YA 174LA 3DN0A 3W6EA 4LYCA 4GN5C 4H9BA 4W54A 2IYBA 4K2PA 1RI8B 2ANXA 3PVUA 1CU0A 1XODA 1GEZA 1GFRA 3TXHA 1LZ6A 3A3QA 4K81A 5KXWA 1IP3A 3GYOA 1C6GA 5KQ4A 259LA 2KCJA 2LYMA 2BAAA 1M7EA 3RZ4A 2D11A 4XJGA 2P8VA 1CV1A 5LYTA 1GFUA 2D9ZA 1IP5A 2LOXA 4C3WA 4W59A 3FEHA 1BVXA 4OWHA 1LCNA 1U5GA 4GLAA 2COAA 3TMVA 4E97A 4WM1A 1B5VA 4HJYA 1O23A 2OE9X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SB8 A;  1L81 A;  229L A;  2J0K A;  3K2R A;  1QUD A;  4NSW A;  142L A;  1L57 A;  209L A;  2QKL A;  1TLA A;  3GUI A;  3HW2 B;  1QSB A;  1L65 A;  171L A;  1L98 A;  1MK9 B;  4ARP A;  1ZSQ A;  173L A;  2YSZ A;  1L23 A;  2AL6 A;  2RBN A;  2OQB A;  2P0D A;  2VSZ A;  1C6D A;  1CU3 A;  1CVK A;  1C6I A;  1L86 A;  1DYD A;  3KRX A;  1NU2 A;  3PEG A;  4HAY B;  3OE0 A;  1P2R A;  1CU2 A;  1WI1 A;  177L A;  1AWE A;  3U8Z A;  1L43 A;  1FHW A;  2Y7B A;  2B6X A;  1LW9 A;  1OMW A;  1CV0 A;  166L A;  1L04 A;  2J0M A;  2K2J A;  1C6M A;  3V2W A;  2W2W A;  3RCP A;  3PZD A;  2M14 A;  4I7M A;  4I7R A;  262L A;  1L85 A;  2ZPY A;  5JHG A;  3D8D A;  1L88 A;  1P5T A;  2YS1 A;  2ROV A;  167L A;  1L82 A;  1OQN A;  5LOP B;  2QAR C;  1V5M A;  4LZM A;  1UNR A;  1H10 A;  191L A;  4I7L A;  2PZ1 A;  3HTD A;  3MPX A;  4H8S A;  184L A;  1ZC3 B;  1L44 A;  2KGX B;  2LUL A;  3HUK A;  107L A;  3V5W A;  141L A;  3C7Y A;  4A6K A;  2HE7 A;  1K5D B;  3PSC A;  1Q67 A;  4B6H A;  1NTV A;  4IOY X;  1L32 A;  161L A;  1XR0 B;  1FHO A;  3C8Q A;  2Q9E A;  1PLS A;  1L95 A;  1SHC A;  2DHI A;  1PQM A;  1DYN A;  4I7S A;  1X05 A;  4HAZ B;  1U5D A;  1G07 A;  3KSY A;  1D3F A;  1QT6 A;  2O4W A;  5C5B A;  1QTV A;  1L06 A;  3HTF A;  2LG1 A;  1PQK A;  2B6Y A;  143L A;  2RB0 X;  1MIX A;  2HUM A;  2YRY A;  1L63 A;  3OE6 A;  1WGQ A;  3DMV A;  1QUG A;  1Y5O A;  2DLW A;  2YF0 A;  4ARQ A;  1ZC4 B;  1P56 A;  2RBP A;  156L A;  2W2X D;  1G0K A;  3HDE A;  2M38 A;  242L A;  1DYG A;  261L A;  1D3N A;  164L A;  3G3V A;  2J0J A;  3ZVR A;  2DX1 A;  1D3J A;  144L A;  1UNQ A;  2DHK A;  1OVK A;  2B6Z A;  2HTH B;  1LI2 A;  172L A;  1LWG A;  2YS5 A;  1SX7 A;  3DN6 A;  1V5U A;  1L64 A;  2I5C A;  2ANV A;  3KRW A;  4PNK A;  187L A;  1QTC A;  3AJ4 A;  3WA0 A;  1QUH A;  4K5Y A;  4CYE A;  4A5K A;  1L48 A;  4HB0 B;  131L A;  1DDW A;  1G0P A;  5C6R A;  2DKP A;  214L A;  3M1I B;  4HAU B;  1C68 A;  1KS3 A;  245L A;  1C6P A;  4DBB A;  2RGN B;  4ZPU A;  1P36 A;  1ZYT A;  3OE8 A;  5DIF B;  2D9X A;  129L A;  5I14 A;  1J0W A;  1L68 A;  3ZDT A;  234L A;  252L A;  1X11 A;  2K2U A;  2RBQ A;  1PQJ A;  2B72 A;  254L A;  201L A;  146L A;  1L49 A;  3L64 A;  1D3M A;  1LYG A;  1D2W A;  4EJ4 A;  1M7R A;  1L60 A;  2X18 A;  1W1G A;  3PBL A;  2LYD A;  1C63 A;  1L35 A;  1P6Y A;  211L A;  4I7P A;  1U2B A;  3ODX A;  4KAX B;  5D3Y A;  3U7D A;  2QKM A;  2ELA A;  1V5P A;  1L0K A;  1L51 A;  213L A;  3P7Z A;  2LKO A;  2GCL A;  1T97 A;  1G0G A;  258L A;  3UON A;  2RVB B;  1QT5 A;  2L78 A;  1OVJ A;  5DI9 B;  199L A;  5HE0 A;  118L A;  2I1J A;  2EMS A;  4PJZ A;  244L A;  2MWN B;  1C60 A;  3HUQ A;  1L83 A;  1K5G B;  1P46 A;  5J3T A;  4HB3 B;  224L A;  3DN3 A;  4HAW B;  170L A;  127L A;  1C6H A;  2VKI A;  1LYI A;  2RBR A;  113L A;  5L81 A;  2NMB A;  122L A;  222L A;  3A8Q A;  2NTG A;  2Y8F A;  1L24 A;  3BIN A;  3HH3 A;  1JTM A;  1LPY A;  3NYA A;  226L A;  1I6S A;  1P64 A;  3DN8 A;  2ADZ A;  3N7C A;  4EXM A;  206L A;  2CRF A;  2NZ8 B;  1L36 A;  1LI3 A;  1L31 A;  1LYE A;  1XJU A;  4DAJ A;  4I7O A;  102L A;  2Z6B A;  103L A;  2HUL A;  1UPQ A;  2DA0 A;  5D27 A;  4EPF A;  2RB1 X;  2RLO A;  2R09 A;  5HE1 A;  3T06 A;  4WJ7 A;  1DRO A;  1L47 A;  3PP2 A;  1L75 A;  130L A;  1L77 A;  1DYF A;  1L12 A;  1CV5 A;  4I7T A;  4W53 A;  253L A;  1V89 A;  4Z2M B;  1QT3 A;  148L E;  152L A;  2RBS A;  5CLL B;  1DYE A;  4KHB B;  1C6C A;  2CAY A;  1KY1 A;  1L00 A;  2DX5 A;  4HDO A;  1D2Y A;  216L A;  1TXD A;  4EKP A;  176L A;  1XJT A;  155L A;  1OV7 A;  1LGX A;  120L A;  3CDT A;  3DNA A;  5C16 A;  1TJ6 A;  3HT6 A;  3PDS A;  3DMX A;  4IFS A;  1L01 A;  3VIA A;  1E5W A;  110L A;  4D0N B;  1PQO A;  1LLH A;  3V2Y A;  2K00 A;  4NY0 A;  2OE9 X;  3HUA A;  1CTW A;  1KI1 B;  1C69 A;  2JP2 A;  1L09 A;  1LGU A;  126L A;  4BBK A;  111L A;  2D9Y A;  1L89 A;  1L50 A;  248L A;  3C8S A;  2MFQ A;  2F47 A;  2Q13 A;  3PVL A;  1BTN A;  1EF1 A;  227L A;  1MPH A;  2RH1 A;  2B75 A;  3NSU A;  4F7H A;  3D8E A;  1L84 A;  1GG3 A;  2COC A;  2OE4 X;  2EMT A;  1CUP A;  1GC7 A;  3TW1 A;  1CX6 A;  217L A;  1L15 A;  3CDQ A;  4DJH A;  1L39 A;  5HE2 A;  2Z0P A;  1L03 A;  1ZUR A;  223L A;  1QQG A;  4K2O A;  1L74 A;  3BJI A;  4P7I A;  1L93 A;  3QWM A;  5HE3 A;  1QTB A;  1EGX A;  1KZ7 A;  2RAY X;  1XX0 A;  3C7W A;  2R0D A;  3C7Z A;  4YL8 A;  188L A;  3F0W A;  3GUO A;  2GCJ A;  1T8G A;  1G06 A;  4I7K A;  3C83 A;  3KZ1 A;  1C6A A;  4PQ0 A;  1QT7 A;  3AU4 A;  2COD A;  2D4Q A;  1LI6 A;  147L A;  4KHO A;  2DN6 A;  2MKR A;  6LZM A;  3HQC A;  1P2L A;  5D3X A;  2RUK B;  5GOW B;  158L A;  3ODU A;  3GUJ A;  2EJ8 A;  1EPY A;  212L A;  4HAV B;  4YON A;  4TKN A;  4Z2N A;  2LOZ A;  1OVH A;  4ZRK A;  3CDV A;  2Y8G A;  2CUU A;  5C79 A;  3QIJ A;  1L80 A;  1IRS A;  3D4S A;  3C8R A;  4HDQ A;  1P3R A;  3RUN A;  1G0L A;  4A6F A;  1ZWN A;  108L A;  2OE7 X;  3PG7 A;  1DYA A;  190L A;  1CUQ A;  4C0A A;  3HU8 A;  1WGU A;  1L25 A;  4GXB A;  1L62 A;  4IAP A;  1T8F A;  1I2H A;  1V88 A;  1BTK A;  4EKU A;  1G0Q A;  1L07 A;  4HB2 B;  2RAZ X;  2V76 A;  2QB0 B;  3ULB A;  4GZU A;  3VOQ A;  3DN2 A;  1DYB A;  200L A;  4ARM B;  246L A;  2CY4 A;  1PQI A;  2UZR A;  4DX8 A;  1DDV A;  196L A;  4HAT B;  1C6N A;  3GUP A;  1L34 A;  251L A;  225L A;  1PMS A;  1KY0 A;  1LW3 A;  1JQU A;  3VW7 A;  1UPR A;  2P0F A;  3D8F A;  3SN6 R;  2GS0 A;  1L76 A;  257L A;  4HB4 B;  1LB1 A;  1L19 A;  1L96 A;  3LJU X;  3O96 A;  5LZM A;  1KW5 A;  233L A;  1L18 A;  218L A;  2OTZ X;  1QS5 A;  4LDL A;  104L A;  198L A;  4S0W A;  4ARQ B;  1QS9 A;  2B73 A;  1G1W A;  3AU5 A;  4HAX B;  3GYP A;  1EVH A;  1L14 A;  2DKQ A;  3FSS A;  5JP4 A;  3DXD A;  2IFS A;  4CHM A;  1N3H A;  1XCG A;  3SV1 A;  1LYF A;  3HH4 A;  3FA0 A;  1CV6 A;  1L72 A;  3LZM A;  2YT1 A;  1XEP A;  1L21 A;  1L66 A;  1B55 A;  237L A;  1QUO A;  1L99 A;  5DHF B;  3ODO A;  1L71 A;  4W51 A;  2Q9D A;  3GUM A;  1L05 A;  2GJY A;  1OWZ A;  3P6A A;  1QTD A;  1C6L A;  2LZM A;  4LDE A;  4W57 A;  1L27 A;  230L A;  3HWL A;  5EFX A;  3WYF B;  2BCJ A;  2A4T A;  2NTH A;  1L40 A;  2G35 A;  2FJL A;  4GMX B;  1L70 A;  1QT8 A;  1L56 A;  4KHA A;  4TYZ A;  2Z0O A;  4KVG B;  1L54 A;  178L A;  236L A;  1C66 A;  1K28 A;  2RB2 X;  4MK0 A;  3SB6 A;  123L A;  1D9W A;  1L61 A;  1L69 A;  2B70 A;  4GBR B;  1OY2 A;  3X23 A;  1H4R A;  1L59 A;  4EKR A;  1MAI A;  4EJN A;  5J3Y A;  4DXA B;  3HK0 A;  3DN1 A;  1WJM A;  197L A;  5DH9 B;  1QTH A;  2I5F A;  1SSY A;  2H7E A;  5JHH A;  162L A;  4Y94 A;  3OE9 A;  3SO6 A;  1LYD A;  2XQN M;  3SNH A;  1L42 A;  1W1H A;  4CHJ A;  231L A;  1P3N A;  238L A;  3HT9 A;  2DHJ A;  183L A;  1OV5 A;  186L A;  4ARM A;  3A8P A;  4I7J A;  1BAK A;  4EKS A;  4W56 A;  249L A;  125L A;  5KQ1 A;  1W1D A;  109L A;  4ZRJ A;  182L A;  1XD4 A;  1L08 A;  1C62 A;  1PQD A;  256L A;  4I7Q A;  4ZRI A;  1C6K A;  1MIZ B;  1Z87 A;  1QTZ A;  5LON B;  4DKL A;  1CU5 A;  1NTY A;  3CDO A;  1OYU A;  5D3V A;  189L A;  3ML4 A;  2OTY X;  3RZE A;  3C82 A;  1I7A A;  1X86 A;  1X1F A;  1L94 A;  4MT7 A;  4XWX A;  1C6B A;  3QBV B;  2L2I A;  3NY9 A;  1RRP B;  3GUL A;  3HU9 A;  1L22 A;  1L38 A;  1L92 A;  5FI0 A;  1G0M A;  2LC9 A;  3GUN A;  4K17 A;  1C6T A;  1L11 A;  243L A;  3C80 A;  1SGH A;  3TVV A;  2D9V A;  1L13 A;  3GUK A;  4DX9 0;  1QT4 A;  4LDO A;  2RNR B;  1L37 A;  3CIK A;  4EMO A;  2UVM A;  1C64 A;  1U27 A;  2I1K A;  4EPI A;  195L A;  4F7U P;  1B6I A;  1SSW A;  3HT8 A;  2YS3 A;  1LYJ A;  3PVW A;  2OU8 A;  2DTC A;  138L A;  219L A;  1FGZ A;  150L A;  1P7S A;  3HH6 A;  255L A;  1PFJ A;  1U5E A;  3TCA A;  221L A;  4GMV A;  4WSF A;  239L A;  2AEH A;  1L26 A;  185L A;  1CU6 A;  1G1V A;  1WVH A;  205L A;  1FB8 A;  2YVC A;  4I7N A;  1FHX A;  3DMZ A;  3DXC A;  1TQZ A;  215L A;  5KCV A;  4OO9 A;  1P6S A;  2D9W A;  2KUP A;  112L A;  2DYQ A;  5J3Q A;  3KY9 A;  139L A;  3OAN A;  1L58 A;  1L90 A;  1MKE A;  1X1G A;  1KZG A;  1L52 A;  1EAZ A;  1L0J A;  2H7D A;  3F8V A;  3SBA A;  163L A;  1L10 A;  1L46 A;  159L A;  241L A;  2ROZ B;  2UZS A;  4W52 A;  1WG7 A;  4WVF B;  1L87 A;  1P37 A;  3FAD A;  3L2X A;  3TFM A;  1DDM A;  3DKE X;  1L30 A;  1SWZ A;  3JR6 A;  3FM8 C;  2J59 M;  1C6E A;  2B7X A;  2O7A A;  4HHV A;  2F32 A;  5FI1 A;  1P5C A;  4W55 A;  3EML A;  114L A;  1V61 A;  3CDR A;  4ARL A;  1FOE A;  3IVF A;  181L A;  1ZM0 A;  1C6J A;  4L6E A;  3HT7 A;  3UZT A;  4A6F B;  1Y19 B;  3ODW A;  3HTB A;  3SYX A;  4YX7 C;  2LCB A;  3NY8 A;  235L A;  1L28 A;  1AQC A;  2B6T A;  2ELB A;  1XKE A;  4A6H A;  168L A;  1ZVR A;  180L A;  2RBO A;  1DYC A;  210L A;  1RJ2 A;  1MK7 B;  5JLJ B;  7LZM A;  260L A;  1L33 A;  3A98 B;  1L53 A;  2D10 A;  3G3W A;  3HDF A;  1L02 A;  1L29 A;  2CY5 A;  2B74 A;  2YT0 A;  1FGY A;  1C61 A;  5CLQ B;  145L A;  1ISN A;  1LYH A;  2D2Q A;  2OU9 A;  4YXC A;  1J19 A;  149L A;  4GRV A;  1U29 A;  3SUZ A;  3TO1 A;  4W58 A;  4YXA C;  1UNP A;  2RSG A;  128L A;  4AQN A;  4GN1 A;  3G3X A;  2L1C A;  4MY6 A;  1T8A A;  137L A;  3HH5 A;  2OU0 X;  4GPT B;  3SB9 A;  1C6Q A;  3CXB B;  4ARJ A;  3F5R A;  1OWY A;  1L17 A;  174L A;  3DN0 A;  1L67 A;  1L45 A;  157L A;  250L A;  2DYN A;  3SBB C;  4EKQ A;  3SB7 A;  5C5B B;  1SX2 A;  3SB5 A;  4W54 A;  2IYB A;  1LWK A;  1NI2 A;  4K2P A;  1L79 A;  228L A;  2HUK A;  2ANX A;  3PVU A;  175L A;  1CU0 A;  3C81 A;  1GC6 A;  1XOD A;  3ULC A;  1KNI A;  1L91 A;  3DN4 A;  1CV4 A;  1KW7 A;  240L A;  140L A;  1JTN A;  2W2X C;  151L A;  4K81 A;  2P0H A;  1L73 A;  220L A;  2Z0Q A;  2IGC A;  1C6G A;  3GYO A;  2F2Q A;  1BWN A;  2COF A;  259L A;  2OTX A;  5D3W A;  5KQ4 A;  2KCJ A;  192L A;  1SWY A;  1U5F A;  2VRW B;  1C6F A;  1UEF A;  1L41 A;  2N23 A;  1LGW A;  3F9L A;  3FI5 A;  1L55 A;  3HTG A;  1WTH A;  1M7E A;  1C65 A;  4PK0 A;  1CV3 A;  1QC6 A;  2D11 A;  2MDX A;  3DXE A;  2P8V A;  115L A;  1CV1 A;  2D9Z A;  1G0J A;  1T6H A;  2LOX A;  4W59 A;  1FAO A;  3FEH A;  2OEA X;  247L A;  119L A;  160L A;  2DFK A;  3G9W A;  1QSQ A;  165L A;  1L16 A;  3MDB C;  5DHA B;  1NHB A;  1U5G A;  1C67 A;  1DBH A;  2B6W A;  2O79 A;  3QAK A;  2COA A;  2EC1 A;  2N0Y A;  4E97 A;  1WJ1 A;  4F7G A;  169L A;  1L97 A;  2E2X A;  1CX7 A;  1L20 A;  232L A; 
#chains in the Genus database with same CATH topology
 1LJ3 A;  3K2R A;  209L A;  3AGG G;  1TLA A;  171L A;  1GF6 A;  4ARP A;  2YSZ A;  1L23 A;  1CU3 A;  1L86 A;  2Z38 A;  4BS7 A;  3PEG A;  1NU2 A;  4I8S A;  4O34 A;  4HAY B;  1CU2 A;  1UCO A;  1WI1 A;  1CKC A;  3LZ2 A;  1ZMY L;  1L43 A;  3U8Z A;  6LYT A;  1CV0 A;  3IWR A;  3V2W A;  1HSX A;  3PZD A;  1GDW A;  4I7M A;  5JHG A;  1UC0 A;  1P5T A;  4WLT A;  167L A;  1OQN A;  4QJ4 B;  4QEQ A;  1UNR A;  5FST A;  2YBL A;  3HTD A;  4P2E A;  2KGX B;  2EPE A;  3C7Y A;  2EQL A;  3PSC A;  1L32 A;  161L A;  1LSZ A;  1RE2 A;  4ZFP A;  4XJB A;  1PLS A;  1JIY A;  4UWU A;  1U5D A;  5C5B A;  1QT6 A;  2KIG A;  3WMK A;  4OWA A;  1MIX A;  5IDD A;  4OSN A;  1PZY A;  2YRY A;  2Q0M X;  1L63 A;  4DDC A;  1Y5O A;  2DLW A;  4R6C A;  1ZC4 B;  3ZVQ B;  2MEH A;  1G0K A;  4N0J A;  4HV2 A;  4KPM A;  1LJF A;  4H1P A;  4QJ5 B;  1BQL Y;  4KXI A;  2I5C A;  1IR9 A;  1B2K A;  2RSC A;  3TXK A;  1SQ2 L;  1C68 A;  1IWT A;  4ZPU A;  5DIF B;  2D9X A;  5I14 A;  2BQK A;  234L A;  252L A;  1JSF A;  1PQJ A;  254L A;  3L64 A;  2W1L A;  1D3M A;  4EJ4 A;  1LZ1 A;  2X18 A;  3NWA A;  1GF8 A;  1L35 A;  1P6Y A;  3ODX A;  4I7P A;  3U7D A;  4KAX B;  1IY4 A;  2QKM A;  1B7M A;  1FDL Y;  1F10 A;  1BHZ A;  1L0K A;  3B0K A;  1L51 A;  2LKO A;  2GV0 A;  1G0G A;  1MEL L;  2ZYP A;  4B1A A;  1AKI A;  2L78 A;  5HE0 A;  4XYY A;  1GE1 A;  1NBZ C;  224L A;  170L A;  2VKI A;  4J1B A;  1HMK A;  2RBR A;  1F0W A;  1A4V A;  3A96 A;  2NMB A;  4DQJ A;  2NWD X;  1JTM A;  1DRO A;  226L A;  2ADZ A;  1WQO A;  2CRF A;  3K3T A;  1L36 A;  2HUL A;  4H92 A;  5APE A;  4FJR A;  1GFV A;  4PJ2 C;  2R09 A;  5C6J A;  3PP2 A;  2MEE A;  1L12 A;  4W53 A;  5LVK A;  4B49 A;  2K8E A;  152L A;  1DYE A;  4KHB B;  1TXD A;  1ZVH L;  5C16 A;  3DMX A;  4N1E I;  2BQM A;  2K00 A;  2JP2 A;  4NY0 A;  1KI1 B;  4B4I A;  1L50 A;  248L A;  3C8S A;  1XEK A;  4TWS A;  5F81 A;  4GLV A;  1HFY A;  5JEN B;  3NSU A;  1FKV A;  3WUA A;  3D8E A;  1CUP A;  3CB7 A;  4XJI A;  4NWE A;  4WO6 A;  223L A;  5F9X A;  1QQG A;  5AMY A;  1IP6 A;  4MST A;  2YT2 A;  3C7W A;  2R0D A;  2I25 L;  3C7Z A;  2BQB A;  4YL8 A;  188L A;  3GUO A;  4R0F A;  3KZ1 A;  1OUC A;  2D4J A;  6LZM A;  3HQC A;  1IWZ A;  1CJ9 A;  4NHP A;  1E8L A;  1HEW A;  3RW8 A;  4MR1 A;  3CDV A;  2CUU A;  4XEN A;  1LZY A;  5C79 A;  1L80 A;  3G3B B;  3A58 A;  3HIE A;  1GFG A;  3D4S A;  1REX A;  4HDQ A;  1JKA A;  1XGT C;  1G0L A;  190L A;  4DYG A;  1L25 A;  2W1Y A;  1L62 A;  4HTQ A;  4HB2 B;  2RAZ X;  4RDS A;  3WYH A;  194L A;  3OK0 A;  4NSI A;  1DDV A;  1GHL A;  5I4Y A;  1C6N A;  2X0A A;  1JTP L;  5APC A;  1DI4 A;  2LZT A;  3SN6 R;  257L A;  1YL0 X;  5LZM A;  1KW5 A;  1L18 A;  218L A;  1G1W A;  4HAX B;  3GYP A;  2DKQ A;  3DXD A;  2IFS A;  1N3H A;  3SV1 A;  3HH4 A;  1KIR C;  1L21 A;  4DDA A;  1B55 A;  1L99 A;  2BQJ A;  4W51 A;  3ODO A;  1L05 A;  3WVX A;  1QTD A;  3W6A A;  4LDE A;  3HWL A;  5EFX A;  1LHI A;  5L3I A;  2BCJ A;  2G35 A;  2FJL A;  1L70 A;  1LOZ A;  178L A;  1CKG A;  2BQF A;  4OWE A;  1LMN A;  1L61 A;  1L69 A;  4GBR B;  4CJ2 A;  1LZT A;  2R2Y A;  1MAI A;  3P68 A;  1HC0 A;  4DXA B;  4AGA A;  3LYM A;  1IWY A;  1GBS A;  1LSY A;  197L A;  4J0L A;  5B07 A;  5C6I A;  3GXK A;  4Y94 A;  1GXX A;  3TXG A;  1LYD A;  3J6K A;  1P3N A;  1DI3 A;  183L A;  1WTM A;  1W1D A;  1L08 A;  4CSQ A;  5DLA A;  2MEC A;  2DQH Y;  1D9U A;  1ALC A;  1GXV 2;  1QTZ A;  1CJ8 A;  1GF9 A;  4L41 A;  189L A;  2YBI A;  4RLN A;  1L94 A;  5HNC A;  1QQY A;  3QBV B;  5LYZ A;  1XGR C;  2L2I A;  1GWD A;  1L92 A;  1DI5 A;  1YIK A;  5FI0 A;  3GUN A;  243L A;  1UUZ C;  4B4J A;  3ATO A;  3G3A B;  5D5F A;  2BQH A;  4EMO A;  4PRQ A;  3CIK A;  1L37 A;  2BQG A;  2UVM A;  4F7U P;  1LZ4 A;  1SSW A;  2Z39 A;  4D9Z A;  219L A;  1U5E A;  1OUJ A;  1PFJ A;  221L A;  4WSF A;  4WM2 A;  5LXW A;  1WVH A;  1BB3 A;  1T6V L;  1FB8 A;  4I7N A;  1GB9 A;  4G4B A;  3TXE A;  2D9W A;  2D6B A;  3LYT A;  3KY9 A;  139L A;  1L90 A;  1MKE A;  1X1G A;  4WO9 A;  1L0J A;  2BQI A;  2H7D A;  1KIP C;  163L A;  2UZS A;  1JWR A;  1BB5 A;  1WG7 A;  1HEL A;  4NGL A;  1P37 A;  3L2X A;  3A93 A;  1WQN A;  1LJ4 A;  1L30 A;  3WW5 A;  2Z13 A;  1LZC A;  1JTO L;  2J59 M;  3FM8 C;  4YEO A;  4W55 A;  1WTN A;  1V61 A;  3IVF A;  1FOE A;  1B7Q A;  4ETD A;  1LTM A;  1GBO A;  1JJ0 A;  3A6C Y;  3P4Z A;  208L A;  1AQC A;  2B6T A;  2ELB A;  168L A;  2RBO A;  210L A;  2YT0 A;  5B1F A;  7LYZ A;  1C61 A;  145L A;  1VDQ A;  3WPK A;  1GBZ A;  2A7D A;  1J1O Y;  4GCB A;  2OU9 A;  1GB2 A;  4W58 A;  4YXA C;  128L A;  4AQN A;  5II3 A;  4MY6 A;  137L A;  134L A;  4G4H A;  5E4P A;  3SB9 A;  1C6Q A;  3B6L A;  2Z2F A;  1L67 A;  1G7I C;  4HSI A;  1IWX A;  1LZ9 A;  4NGW A;  228L A;  1IC5 Y;  3DCX A;  1GB3 A;  3C81 A;  1GC6 A;  1L91 A;  1G7M C;  1GEV A;  5KXY A;  4DWX A;  4OWB A;  3AZ5 A;  140L A;  1JTN A;  151L A;  4LZT A;  4H8X A;  1L73 A;  2IGC A;  2COF A;  1BWN A;  1GD6 A;  4HTN A;  192L A;  1C6F A;  1UEF A;  1L41 A;  4HPI A;  2N23 A;  1LGW A;  3F9L A;  3D3D A;  3FI5 A;  1QC6 A;  1WTH A;  4XWX A;  5CLL B;  1YAN A;  1G0J A;  2H9K A;  1T6H A;  3G9W A;  160L A;  3MDB C;  165L A;  4H9I A;  1DBH A;  2YBM A;  1L97 A;  1LJJ A;  1BVK C;  1LSC A;  1B7R A;  5I2M A;  5B05 A;  5KXP A;  4W94 A;  2J0K A;  1IWW A;  142L A;  5APF A;  1MK9 B;  2VSZ A;  2BQD A;  3KRX A;  1DYD A;  4LT3 A;  1P2R A;  4LT2 A;  177L A;  1JJ1 A;  2AUB A;  2Y7B A;  1LW9 A;  1OMW A;  2K2J A;  2HEC A;  1PS5 A;  2W2W A;  1CJ7 A;  262L A;  4M6D A;  2DBT A;  2ROV A;  3WU7 A;  1YAO A;  2G4N A;  4LZM A;  1H10 A;  2PZ1 A;  4H8S A;  3MPX A;  2LUL A;  3HUK A;  107L A;  141L A;  4A6K A;  1IVM A;  207L A;  4B6H A;  4IOY X;  2I6Z A;  2Q9E A;  1SHC A;  2DHI A;  5I5Q A;  4H93 A;  4HAZ B;  3KSY A;  1Z55 A;  2YSS C;  5ILC A;  1B5Z A;  5C6L A;  2LG1 A;  2B6Y A;  5LG4 B;  3OE6 A;  3DMV A;  2YF0 A;  4ARQ A;  3TXJ A;  2YDG A;  1P56 A;  2W2X D;  1NMM A;  1I1Z A;  242L A;  3ZVR A;  261L A;  1D3N A;  164L A;  2DX1 A;  1D3J A;  4X3B A;  1OVK A;  1EQ4 A;  2B6Z A;  1NBY C;  1I56 A;  1LI2 A;  2G4P A;  1UIE A;  3DN6 A;  1CKH A;  1L64 A;  4PNK A;  3AB6 A;  1QTC A;  5L9J A;  5KXS A;  4A5K A;  4HB0 B;  1G0P A;  2DKP A;  3P66 A;  245L A;  2KIE A;  2BQL A;  1P36 A;  1CNS A;  129L A;  1J0W A;  4H9F A;  1TDY A;  1BWH A;  2CDS A;  3ZDT A;  5FHW A;  5M1Y A;  2B72 A;  201L A;  1AT5 A;  1L49 A;  1UIB A;  3WUL A;  2H5Z A;  1D2W A;  4D6W A;  1M7R A;  1L60 A;  1LZR A;  3PBL A;  4B0D A;  211L A;  5KXZ A;  1BB6 A;  3J4G A;  4WL6 A;  3P7Z A;  2YBJ A;  5KXO A;  1VAU A;  258L A;  1GE3 A;  2DQC Y;  1IOT A;  199L A;  1NDG C;  118L A;  2EMS A;  4LT0 A;  3A6B Y;  1KXW A;  1P46 A;  3DN3 A;  4DD7 A;  127L A;  1LYI A;  1LZD A;  3EMS A;  1YRO A;  3A8Q A;  2YBN A;  1GBX A;  2ZNX Y;  3BIN A;  1LPY A;  3NYA A;  3DN8 A;  206L A;  2NZ8 B;  1LI3 A;  4DAJ A;  5KXN A;  1XSF A;  4BAD A;  1OUI A;  4WJ7 A;  5F9U A;  1L47 A;  1C45 A;  5FEL A;  1QT3 A;  1GE4 A;  2VB1 A;  4OOO A;  2DX5 A;  216L A;  2BLX A;  2ZIJ A;  4ANR A;  4EKP A;  176L A;  1CKF A;  1OV7 A;  1XJT A;  3RNX A;  1OUF A;  3CDT A;  1VAT A;  4HSF A;  4IFS A;  3VIA A;  1L01 A;  4Z98 A;  3TMX A;  4D0N B;  1PQO A;  1LLH A;  1C69 A;  1L09 A;  126L A;  2Q13 A;  1EF1 A;  2B75 A;  4F7H A;  1GG3 A;  3HSA A;  1OUB A;  2OE4 X;  1CX6 A;  2XBS A;  1LJE A;  4DJH A;  1L39 A;  5HE2 A;  2Z0P A;  1L03 A;  4K2O A;  1L74 A;  1L93 A;  1G7J C;  2XBR A;  5F14 A;  1JKB A;  1KZ7 A;  1XEJ A;  154L A;  1GF3 A;  4WLX A;  3F0W A;  5A3Z A;  3NWF A;  1G06 A;  1C6A A;  1QT7 A;  3AU4 A;  2COD A;  1D0M A;  2D4Q A;  4IAT A;  2DN6 A;  2MKR A;  5GOW B;  2EJ8 A;  5B1G A;  212L A;  4YON A;  4W96 A;  4TKN A;  1OVH A;  1GFK A;  4ZRK A;  4NHQ A;  2Y8G A;  1LJN A;  3QIJ A;  1IRS A;  3C8R A;  1P3R A;  3A67 Y;  3WXU A;  1AZF A;  4GXB A;  4IAP A;  1T8F A;  3ULB A;  3TXF A;  2F2N A;  4ARM B;  246L A;  5FDJ A;  4HJV A;  196L A;  2ZQ3 A;  1PMS A;  1LW3 A;  3D8F A;  2Z19 A;  153L A;  1LB1 A;  1L96 A;  4OW1 A;  1IP4 A;  1QS9 A;  2B73 A;  3AU5 A;  3A94 A;  5JP4 A;  1XCG A;  1LYF A;  3HBD A;  1UIF A;  1CV6 A;  3WPJ A;  1CKD A;  1L72 A;  1L66 A;  237L A;  1LHL A;  1B7P A;  4WM3 A;  1MI1 A;  4TSB A;  3GUM A;  1UIA A;  3P6A A;  2LZM A;  5L3H A;  3FI7 A;  1LZA A;  4XN6 A;  2A4T A;  1D0K A;  4GMX B;  2Z0O A;  236L A;  3SB6 A;  123L A;  1INU A;  1D9W A;  5LA5 A;  3X23 A;  2LYO A;  4EKR A;  2CWI A;  4IJ4 A;  4H94 A;  1UIH A;  3DN1 A;  2I5F A;  2FYC A;  2H7E A;  162L A;  3OE9 A;  3SO6 A;  3SNH A;  1L42 A;  4CHJ A;  231L A;  3A8P A;  1NWG A;  4I7J A;  4DIX A;  4W56 A;  5KQ1 A;  182L A;  4LYZ A;  256L A;  1RJC B;  1BWJ A;  1C6K A;  1LZ5 A;  2DKV A;  2XJW A;  1Z87 A;  4KHB A;  1CU5 A;  3A91 A;  3CDO A;  3CT0 A;  1HF4 A;  3ML4 A;  5DN5 A;  4GCF A;  1IC7 Y;  1XEI A;  3N9E A;  1L22 A;  1JUG A;  2LC9 A;  2C8P A;  4K17 A;  1C6T A;  1GF7 A;  3TVV A;  2D9V A;  3GUK A;  4DX9 0;  2RNR B;  4EPI A;  1B6I A;  3HT8 A;  1IR8 A;  5A3E A;  3PVW A;  4TUN A;  3WU8 A;  150L A;  4LGK A;  4OT1 A;  1REZ A;  2AEH A;  5I54 A;  3HFM Y;  1G1V A;  3BKV A;  2BQO A;  3AW7 A;  3DMZ A;  1LZS A;  3DXC A;  1TQZ A;  4OO9 A;  112L A;  1IOR A;  1FLY A;  3OAN A;  1L58 A;  3HBE X;  1LHM A;  4CGE A;  3IJU A;  1GBW A;  1L46 A;  241L A;  3N9C A;  4W52 A;  1NHE A;  4WVF B;  1C08 C;  3TFM A;  1DDM A;  4H9A A;  2DQE Y;  3W6F A;  3WXT A;  3JR6 A;  3SP3 A;  4HHV A;  2B7X A;  2ZKM X;  1P5C A;  3EML A;  4PGJ B;  3CDR A;  4ARL A;  5IHG A;  235L A;  1J1X Y;  1XKE A;  4WM6 A;  4TX7 A;  2BQN A;  5JLJ B;  3NW8 A;  3A98 B;  1L53 A;  1L29 A;  1FGY A;  1C43 A;  5CLQ B;  1HER A;  4YXC A;  1J19 A;  149L A;  4GRV A;  3SUZ A;  2RSG A;  2H9J A;  3W6C A;  1D6P A;  3HH5 A;  4GPT B;  1QDR A;  4WOA A;  3CXB B;  4ARJ A;  1B5U A;  4WM4 A;  1OWY A;  2HED A;  157L A;  3SBB C;  4NGV A;  2ZIK A;  4ZIX A;  5C5B B;  1L79 A;  2DQG Y;  2HUK A;  4QXA B;  2HU3 A;  2LZ2 A;  1KNI A;  1FLU A;  1CV4 A;  1KW7 A;  2W2X C;  2P0H A;  1LZG A;  3LN2 A;  3B72 A;  5D3W A;  2OTX A;  1SWY A;  1U5F A;  2VRW B;  1L55 A;  1EQE A;  4PK0 A;  2MDX A;  115L A;  1LJK A;  1FAO A;  2OEA X;  247L A;  1BGI A;  4NGY A;  5DHA B;  1QSQ A;  4NGI A;  1L16 A;  1NHB A;  2O79 A;  3QAK A;  2EC1 A;  4F7G A;  169L A;  1LZE A;  2E2X A;  232L A;  1L81 A;  1QUD A;  4NSW A;  2ZYC A;  2IFF Y;  1L98 A;  1QTE A;  2PC2 A;  1ZSQ A;  1CJ6 A;  1NQI A;  2RBN A;  2P0D A;  1D6Q A;  1C6I A;  1BWI A;  4NGZ A;  1AWE A;  1FHW A;  2B6X A;  166L A;  1L04 A;  4RLM A;  1MLC E;  3CSQ A;  3RCP A;  1RCM A;  1YQV Y;  1L85 A;  2YS1 A;  5LOP B;  1L82 A;  2QAR C;  3TXI A;  184L A;  1ZC3 B;  1L44 A;  2HE7 A;  4LYO A;  1NTV A;  1FHO A;  3C8Q A;  5EBH A;  1GAY A;  3F6Z A;  1LMT A;  1X05 A;  1C7P A;  2O4W A;  1DZB X;  3HTF A;  3ATN A;  1WQP A;  143L A;  1YIL A;  4CFO A;  2HUM A;  2B5Z A;  4RW1 A;  1QUG A;  4LT1 A;  4DDB A;  156L A;  3HDE A;  4KL7 A;  1UNQ A;  2HTH B;  1LJG A;  4H91 A;  3AJ4 A;  3WA0 A;  4G49 A;  4K5Y A;  4CYE A;  1L48 A;  4LYM A;  2FJU B;  5C6R A;  1IEE A;  4HAU B;  1KS3 A;  1C6P A;  2YVB A;  4DBB A;  2RGN B;  3OE8 A;  1IOS A;  3WVY A;  4PRU A;  2Z18 A;  1X11 A;  5KXM A;  2HTX A;  1LYG A;  3CQL A;  1LSD A;  1C63 A;  1U2B A;  4GN3 A;  5KXR A;  2ELA A;  1V5P A;  3TMU A;  4NG8 A;  213L A;  1GFE A;  5FEK A;  1VDT A;  2RVB B;  4U3X B;  3W3E A;  4GCE A;  4IAS A;  1WQQ A;  3M3U A;  2I1J A;  5APD A;  4M4O A;  1B7N A;  4PJZ A;  244L A;  1L83 A;  4YOP A;  4HAW B;  2EIZ C;  113L A;  5L81 A;  4N8Z A;  1F6S A;  4DT3 A;  2MED A;  2XTH A;  2ZIL A;  1AM7 A;  2NTG A;  1AT6 A;  5D5C A;  1LSG A;  2GUM A;  1DPX A;  1P64 A;  4YF2 A;  1OUE A;  1L31 A;  135L A;  4I7O A;  2Z6B A;  4ETC A;  4AXT A;  1UPQ A;  5D27 A;  4DD0 A;  2RLO A;  2CJL A;  5I53 A;  2W1M A;  3W6B A;  1LYO A;  1L75 A;  1L77 A;  1JIS A;  1CV5 A;  5HMV A;  1KY1 A;  1L00 A;  4HDO A;  5IEL A;  1WQM A;  5KKJ A;  1YKY X;  1TJ6 A;  1IWV A;  3PDS A;  3V2Y A;  3HUA A;  4BBK A;  1F6R A;  1L89 A;  3LZT A;  1MPH A;  4DD1 A;  3WU9 A;  4NSJ A;  2COC A;  2EMT A;  3TW1 A;  1HEQ A;  1ZVY B;  1QUT A;  1L15 A;  3CDQ A;  4NGK A;  1B7S A;  1JHL A;  3BJI A;  4P7I A;  3QWM A;  5HE3 A;  1H87 A;  1UBZ A;  1EGX A;  1LZB A;  4WG1 A;  1OUH A;  3CT1 A;  1DKK A;  2D4I A;  1GBY A;  1T8G A;  4I7K A;  3C83 A;  2W1X A;  1GB0 A;  3A8Z A;  3ULR A;  5I4X A;  1P2L A;  2RUK B;  158L A;  1UIG A;  8LYZ A;  1LSE A;  1J1P Y;  4HAV B;  4Z2N A;  2LOZ A;  1GE0 A;  4WMG A;  2BQC A;  3TXD A;  1LHH A;  3RUN A;  3TXB A;  3RT5 X;  3CSZ A;  2OE7 X;  4BAF A;  3EXD A;  5LVH A;  1DYA A;  4GNK B;  4C0A A;  1D0L A;  1WGU A;  4N5R A;  4EKU A;  1UIC A;  1I2H A;  1V88 A;  1HEN A;  1LJI A;  1BTK A;  3NWD A;  1G0Q A;  1L07 A;  4LYB A;  2QB0 B;  2BQE A;  2Z59 A;  4GZU A;  3VOQ A;  2XQO A;  1DYB A;  3DN2 A;  4NSH A;  1WVU A;  2UZR A;  4DX8 A;  1IO5 A;  1FBI X;  3GUP A;  1C10 A;  1KY0 A;  1JQU A;  3VW7 A;  4PHI A;  2GS0 A;  1L76 A;  3QNG A;  2WAR A;  1HFZ A;  3O96 A;  1LKS A;  2OTZ X;  1QS5 A;  1XFP L;  3A3R X;  4LDL A;  4OOT A;  3B0O A;  3ZVQ A;  3D9A C;  1L14 A;  5LAF A;  4CHM A;  1G7H C;  3FA0 A;  1OP9 B;  2MEA A;  2Z2E A;  4NHS A;  1ZV5 L;  1QUO A;  3AW6 A;  1L71 A;  2Q9D A;  1LMO A;  2MEF A;  1HNL A;  4W57 A;  3WYF B;  4Z46 A;  2NTH A;  1L40 A;  1GDX A;  1B7O A;  4TYZ A;  4KVG B;  1L54 A;  1C66 A;  2RB2 X;  3IJV A;  2B70 A;  2Y8P A;  1L59 A;  4EJN A;  3LYO A;  1YAQ A;  3HK0 A;  1WJM A;  1DKJ A;  1OUD A;  1TCY A;  5JHH A;  4GCD A;  1GB7 A;  2XQN M;  4EMN A;  5I4W A;  2DHJ A;  4ARM A;  1OV5 A;  1BAK A;  249L A;  109L A;  4ZRJ A;  5LA8 A;  1EL1 A;  1B0D A;  4I7Q A;  1UAC Y;  5T3F A;  1MIZ B;  1OQM A;  5LON B;  1NTY A;  1VDS A;  1QIO A;  3QE8 A;  1X86 A;  1X1F A;  1GB6 A;  1LHK A;  1RRP B;  1DXJ A;  3GUL A;  1LSN A;  4G9S A;  1G0M A;  1HEO A;  2F4A A;  1QT4 A;  1BB7 A;  1C64 A;  4YEM A;  1LYJ A;  2DTC A;  1FGZ A;  1P7S A;  255L A;  3TCA A;  5E9R A;  4GMV A;  2Z14 A;  4KT3 A;  2MEG A;  2BQA A;  3AZ6 A;  2DQF C;  215L A;  2D91 A;  2KUP A;  2DYQ A;  5J3Q A;  4EOF A;  4GN4 A;  1KZG A;  1EAZ A;  1GB8 A;  3T6U A;  4H9H A;  4XAD A;  2ROZ B;  2CGI A;  1L87 A;  1IC4 Y;  1GPQ C;  2HEE A;  1C6E A;  5FI1 A;  4XJD A;  3TMW A;  181L A;  9LYZ A;  1TBY A;  1C6J A;  4L6E A;  3HT7 A;  3SYX A;  1HSW A;  4YX7 C;  3NY8 A;  4ET9 A;  1L28 A;  4OWC A;  4ET8 A;  4G4C A;  4UWV A;  4A6H A;  4XJF A;  1DYC A;  1RJ2 A;  1MK7 B;  7LZM A;  4RW2 A;  1L02 A;  4NIJ A;  4NEB A;  1ISN A;  3AZ7 A;  2D2Q A;  1JTT L;  1IP1 A;  1GFJ A;  1U29 A;  3P65 A;  1LYZ A;  1UNP A;  4GCC A;  3WW6 A;  3G3X A;  1I20 A;  2L1C A;  4NGJ A;  3WUM A;  5HLL A;  1GFA A;  3F5R A;  1L17 A;  1DPW A;  2MEB A;  1L45 A;  250L A;  4WLY A;  2DYN A;  4EKQ A;  3SB7 A;  1SX2 A;  3SB5 A;  1LWK A;  1NI2 A;  2D4K A;  1LMQ A;  4CFP A;  4DQ7 A;  175L A;  3ULC A;  3DN4 A;  240L A;  2FBD A;  1LMC A;  1LSM A;  220L A;  2MEI A;  2Z0Q A;  2F2Q A;  5LYM A;  4LYT A;  3HTG A;  1C65 A;  1CV3 A;  4NFV A;  3DXE A;  3FE0 A;  3T36 A;  119L A;  4Z41 A;  3AJN A;  1IX0 A;  2DFK A;  4TSC A;  2NBV A;  1LYY A;  1C67 A;  2FBB A;  2B6W A;  2N0Y A;  1WJ1 A;  1FLW A;  1CX7 A;  1L20 A;  4ML7 A;  3SB8 A;  229L A;  5KXX A;  1L57 A;  5KXK A;  2QKL A;  3GUI A;  3HW2 B;  1QSB A;  1L65 A;  1IP2 A;  173L A;  1YKX X;  4PPO A;  2AL6 A;  2OQB A;  1HML A;  4ETB A;  1C6D A;  5LIN A;  1CVK A;  3OE0 A;  4MCK A;  1IOQ A;  4II8 A;  2J0M A;  5HNL A;  1C6M A;  4QDN A;  5ILF A;  2M14 A;  1GF0 A;  4I0C A;  1P2C C;  4I7R A;  5FCP A;  2ZPY A;  1B5X A;  3D8D A;  1L88 A;  3RU5 A;  1V5M A;  4C5F A;  191L A;  4I7L A;  3V5W A;  2DQJ Y;  3WL2 A;  1K5D B;  1Q67 A;  1XR0 B;  1HEM A;  2ZNW Y;  1L95 A;  1PQM A;  1DYN A;  4I7S A;  5HMJ A;  1NKH A;  1G07 A;  1D3F A;  4B4E A;  5LIO A;  1QTV A;  1L06 A;  2HUB A;  2HEA A;  1LZ8 A;  1PQK A;  1N4F A;  1KIQ C;  2RB0 X;  1KXX A;  4UWN A;  1WGQ A;  2RBP A;  3AGI A;  2M38 A;  2BPU A;  1DYG A;  2J0J A;  3G3V A;  5KXT A;  1LKR A;  144L A;  2DHK A;  3A34 A;  2YS5 A;  172L A;  1LWG A;  1SX7 A;  1V5U A;  3KRW A;  2ANV A;  187L A;  1QUH A;  131L A;  1DDW A;  214L A;  3M1I B;  3U12 A;  4HV1 A;  1YKZ X;  1SLY A;  1ZYT A;  3MGW A;  2A7F A;  4N9R A;  1L68 A;  5KKI A;  1REM A;  5KJ9 A;  3A92 A;  1LYS A;  1XGQ C;  5KXL A;  2RBQ A;  3KAM A;  2K2U A;  146L A;  2K49 A;  1RFP A;  1LSF A;  2HEB A;  1W1G A;  2LYD A;  5D3Y A;  1JEF A;  1LMA A;  3GXR A;  4DD2 A;  2GCL A;  1T97 A;  3UON A;  2HU1 A;  1QT5 A;  4J1A A;  1QSW A;  1OVJ A;  3VWO A;  5DI9 B;  5DL9 A;  2ZQ4 A;  4WM5 A;  132L A;  2MWN B;  1C60 A;  3HUQ A;  4NHT A;  1K5G B;  5J3T A;  4HB3 B;  4DD9 A;  1C6H A;  2ZWB A;  1QDT A;  122L A;  222L A;  2Y8F A;  1L24 A;  3LHM A;  3HH3 A;  3N7C A;  1I6S A;  1JPO A;  4EXM A;  3ZEK A;  1LYE A;  1XJU A;  5DN4 A;  4ZEE A;  102L A;  103L A;  1IWU A;  1IY3 A;  2DA0 A;  4EPF A;  2RB1 X;  4H9C A;  5HE1 A;  2DQD Y;  1IP7 A;  4HP0 A;  3A95 A;  3T06 A;  130L A;  4I7T A;  1DYF A;  1V89 A;  4Z2M B;  253L A;  1XGU C;  148L E;  2RBS A;  1B5W A;  1YAM A;  1C6C A;  2CAY A;  2G4Q A;  3P64 A;  1D2Y A;  1YAP A;  4DD3 A;  5IRS A;  155L A;  1LGX A;  2I26 L;  5DM9 A;  120L A;  4A7D A;  3DNA A;  3EBA B;  3HT6 A;  4YM8 A;  4Z3M A;  110L A;  1E5W A;  1W6Z A;  2Z4D A;  1CTW A;  1FLQ A;  1LGU A;  111L A;  1V7T A;  2D9Y A;  2MFQ A;  3PVL A;  2F47 A;  4DQ5 A;  1BTN A;  227L A;  2RH1 A;  3OHM B;  2F4G A;  2N5Z A;  1L84 A;  1IR7 A;  1GC7 A;  3AZ4 A;  6LYZ A;  217L A;  1ZUR A;  4NG1 A;  1GB5 A;  4N1C C;  1LHJ A;  1IIZ A;  1UID A;  1QTB A;  3WPL A;  1XX0 A;  2RAY X;  4QGZ A;  1JKD A;  5K7O A;  4HJZ A;  1V7S A;  4PQ0 A;  2GCJ A;  4TTD A;  1HFX A;  3B0I A;  4KHO A;  1LI6 A;  147L A;  2DQI Y;  4LFX A;  5D3X A;  3CSR A;  2KUQ A;  1YL1 X;  3ODU A;  3GUJ A;  1QSA A;  1EPY A;  3EO5 A;  1QTK A;  4NGO A;  4NWH A;  1A2Y C;  4H8Y A;  4A6F A;  1JSE A;  3WUN A;  2LYZ A;  1ZWN A;  4NY5 A;  5M4Y B;  108L A;  5F16 A;  3PG7 A;  2RRF A;  1CUQ A;  3HU8 A;  4QJ3 B;  1VDP A;  2V76 A;  2CY4 A;  200L A;  1G7L C;  1PQI A;  5LVI A;  4HAT B;  1DQJ C;  4WLD A;  1L34 A;  251L A;  225L A;  5LVG A;  2P0F A;  1H6M A;  1UPR A;  4HB4 B;  1QUS A;  3LJU X;  1L19 A;  4WG7 A;  1LMP A;  3E3D A;  1JKC A;  4NHI A;  233L A;  2EKS C;  104L A;  198L A;  4S0W A;  4ARQ B;  1EVH A;  3FSS A;  1EQ5 A;  3LZM A;  1BB4 A;  2YT1 A;  1XEP A;  5DHF B;  4DC4 A;  1FKQ A;  1LSB A;  2GJY A;  1OWZ A;  1W08 A;  4FDY A;  1C6L A;  1L27 A;  1OUA A;  230L A;  3AGH A;  1OUG A;  1QT8 A;  1L56 A;  2BLY A;  4KHA A;  1K28 A;  4MK0 A;  4QY9 A;  1OY2 A;  1FN5 A;  1H4R A;  5J3Y A;  2IHL A;  3FVC A;  5DH9 B;  1QTH A;  2LHM A;  1SSY A;  2Z12 A;  4ETA A;  1TAY A;  1LJH A;  1GF4 A;  1W1H A;  2YBH A;  1ZYI A;  3LYZ A;  1B7L A;  238L A;  2HEF A;  3HT9 A;  5B59 A;  186L A;  4EKS A;  4YEN A;  125L A;  1B9O A;  1XD4 A;  4CHX A;  1C62 A;  1PQD A;  4BAP A;  1GF5 A;  1KXY A;  4ZRI A;  133L A;  4DKL A;  1VFB C;  1OYU A;  1XGP C;  1HHL A;  5D3V A;  2OTY X;  3RZE A;  3C82 A;  1I7A A;  5LVJ A;  4MT7 A;  1JIT A;  1C6B A;  1GAZ A;  3NY9 A;  193L A;  4H9E A;  3HU9 A;  1L38 A;  5LAG A;  1L11 A;  3C80 A;  1SGH A;  1L13 A;  5KY1 A;  4LDO A;  3HBH A;  2I1K A;  1U27 A;  195L A;  3OJP A;  4H8Z A;  2YS3 A;  2OU8 A;  138L A;  3HH6 A;  3AYQ A;  1LZN A;  1NF5 A;  2FYD A;  239L A;  1L26 A;  185L A;  1CU6 A;  3QY4 A;  4NSG A;  205L A;  2YVC A;  4ETE A;  1T3P A;  5HQ1 A;  1FHX A;  3WH1 A;  1NDM C;  5KCV A;  2DQA A;  1P6S A;  3W6D A;  1GFT A;  5B06 A;  1GE2 A;  4H90 A;  1LSP A;  1L52 A;  2Z37 A;  3F8V A;  3SBA A;  1L10 A;  159L A;  1LSA A;  3FAD A;  1LPI A;  1WVV A;  3DKE X;  1JJ3 A;  1SWZ A;  2O7A A;  4HTK A;  2F32 A;  114L A;  3A90 A;  1ZM0 A;  3UZT A;  4A6F B;  1Y19 B;  3ODW A;  3HTB A;  2LCB A;  1TEW A;  5J7C A;  1ZVR A;  2C8O A;  180L A;  1IOC A;  5I2S A;  3M18 B;  3N9A A;  3B77 A;  260L A;  1L33 A;  1GFH A;  4E3U A;  2D10 A;  4HPE A;  3G3W A;  3HDF A;  1C46 A;  3CT5 A;  2B74 A;  4XJH A;  2CY5 A;  1LAA A;  4LFP A;  3BKH A;  1LYH A;  1WQR A;  4WL7 A;  3TO1 A;  1VED A;  4GN1 A;  1UA6 Y;  1REY A;  2F30 A;  1T8A A;  2OU0 X;  4J7V A;  1HEP A;  1B5Y A;  174L A;  3DN0 A;  3W6E A;  4LYC A;  4GN5 C;  4H9B A;  4L1R A;  4W54 A;  2IYB A;  4K2P A;  1RI8 B;  2ANX A;  3PVU A;  1CU0 A;  1XOD A;  1GEZ A;  1T77 A;  1GFR A;  3TXH A;  1LZ6 A;  3A3Q A;  4K81 A;  5KXW A;  4GOU A;  1IP3 A;  2KR0 A;  3GYO A;  1C6G A;  5KQ4 A;  259L A;  2KCJ A;  2LYM A;  2BAA A;  1M7E A;  3RZ4 A;  2D11 A;  4XJG A;  2P8V A;  1CV1 A;  5LYT A;  1GFU A;  2D9Z A;  1IP5 A;  2LOX A;  4C3W A;  4W59 A;  3FEH A;  1BVX A;  4OWH A;  1LCN A;  1U5G A;  4GLA A;  2COA A;  3TMV A;  4E97 A;  4WM1 A;  1B5V A;  4HJY A;  1O23 A;  2OE9 X; 
#chains in the Genus database with same CATH homology
 1LJ3 A;  3K2R A;  209L A;  3AGG G;  1TLA A;  171L A;  1GF6 A;  4ARP A;  2YSZ A;  1L23 A;  1CU3 A;  1L86 A;  2Z38 A;  4BS7 A;  3PEG A;  1NU2 A;  4I8S A;  4O34 A;  4HAY B;  1CU2 A;  1UCO A;  1WI1 A;  1CKC A;  3LZ2 A;  1ZMY L;  1L43 A;  3U8Z A;  6LYT A;  1CV0 A;  3IWR A;  3V2W A;  1HSX A;  3PZD A;  1GDW A;  4I7M A;  5JHG A;  1UC0 A;  1P5T A;  4WLT A;  167L A;  1OQN A;  4QEQ A;  1UNR A;  5FST A;  2YBL A;  3HTD A;  4P2E A;  2KGX B;  2EPE A;  3C7Y A;  2EQL A;  3PSC A;  1L32 A;  161L A;  1LSZ A;  1RE2 A;  4ZFP A;  4XJB A;  1PLS A;  1JIY A;  4UWU A;  1U5D A;  5C5B A;  1QT6 A;  3WMK A;  4OWA A;  1MIX A;  5IDD A;  1PZY A;  2YRY A;  2Q0M X;  1L63 A;  4DDC A;  1Y5O A;  2DLW A;  4R6C A;  1ZC4 B;  3ZVQ B;  2MEH A;  1G0K A;  4N0J A;  4HV2 A;  4KPM A;  1LJF A;  4H1P A;  1BQL Y;  4KXI A;  2I5C A;  1IR9 A;  1B2K A;  2RSC A;  3TXK A;  1SQ2 L;  1C68 A;  1IWT A;  4ZPU A;  5DIF B;  2D9X A;  5I14 A;  2BQK A;  234L A;  252L A;  1JSF A;  1PQJ A;  254L A;  3L64 A;  2W1L A;  1D3M A;  4EJ4 A;  1LZ1 A;  2X18 A;  1GF8 A;  1L35 A;  1P6Y A;  3ODX A;  4I7P A;  3U7D A;  4KAX B;  1IY4 A;  2QKM A;  1B7M A;  1FDL Y;  1F10 A;  1BHZ A;  1L0K A;  3B0K A;  1L51 A;  2LKO A;  2GV0 A;  1G0G A;  1MEL L;  2ZYP A;  4B1A A;  1AKI A;  2L78 A;  5HE0 A;  4XYY A;  1GE1 A;  1NBZ C;  224L A;  170L A;  2VKI A;  4J1B A;  1HMK A;  2RBR A;  1F0W A;  1A4V A;  3A96 A;  2NMB A;  4DQJ A;  2NWD X;  1JTM A;  1DRO A;  226L A;  2ADZ A;  1WQO A;  2CRF A;  3K3T A;  1L36 A;  2HUL A;  4H92 A;  5APE A;  4FJR A;  1GFV A;  4PJ2 C;  2R09 A;  5C6J A;  3PP2 A;  2MEE A;  1L12 A;  4W53 A;  5LVK A;  4B49 A;  152L A;  1DYE A;  4KHB B;  1TXD A;  1ZVH L;  5C16 A;  3DMX A;  4N1E I;  2BQM A;  2K00 A;  2JP2 A;  4NY0 A;  1KI1 B;  4B4I A;  1L50 A;  248L A;  3C8S A;  1XEK A;  4TWS A;  5F81 A;  4GLV A;  1HFY A;  5JEN B;  3NSU A;  1FKV A;  3WUA A;  3D8E A;  1CUP A;  3CB7 A;  4XJI A;  4NWE A;  4WO6 A;  223L A;  5F9X A;  1QQG A;  5AMY A;  1IP6 A;  4MST A;  3C7W A;  2R0D A;  2I25 L;  3C7Z A;  2BQB A;  4YL8 A;  188L A;  3GUO A;  4R0F A;  3KZ1 A;  1OUC A;  2D4J A;  6LZM A;  3HQC A;  1IWZ A;  1CJ9 A;  4NHP A;  1E8L A;  1HEW A;  3RW8 A;  4MR1 A;  3CDV A;  2CUU A;  4XEN A;  1LZY A;  5C79 A;  1L80 A;  3G3B B;  1GFG A;  3D4S A;  1REX A;  4HDQ A;  1JKA A;  1XGT C;  1G0L A;  190L A;  4DYG A;  1L25 A;  2W1Y A;  1L62 A;  4HTQ A;  4HB2 B;  2RAZ X;  4RDS A;  3WYH A;  194L A;  3OK0 A;  4NSI A;  1DDV A;  1GHL A;  5I4Y A;  1C6N A;  2X0A A;  1JTP L;  5APC A;  1DI4 A;  2LZT A;  3SN6 R;  257L A;  1YL0 X;  5LZM A;  1KW5 A;  1L18 A;  218L A;  1G1W A;  4HAX B;  3GYP A;  2DKQ A;  3DXD A;  2IFS A;  1N3H A;  3SV1 A;  3HH4 A;  1KIR C;  1L21 A;  4DDA A;  1B55 A;  1L99 A;  2BQJ A;  4W51 A;  3ODO A;  1L05 A;  3WVX A;  1QTD A;  3W6A A;  4LDE A;  3HWL A;  5EFX A;  1LHI A;  5L3I A;  2BCJ A;  2G35 A;  2FJL A;  1L70 A;  1LOZ A;  178L A;  1CKG A;  2BQF A;  4OWE A;  1LMN A;  1L61 A;  1L69 A;  4GBR B;  4CJ2 A;  1LZT A;  1MAI A;  3P68 A;  1HC0 A;  4DXA B;  4AGA A;  3LYM A;  1IWY A;  1GBS A;  1LSY A;  197L A;  4J0L A;  5B07 A;  5C6I A;  3GXK A;  4Y94 A;  1GXX A;  3TXG A;  1LYD A;  3J6K A;  1P3N A;  1DI3 A;  183L A;  1WTM A;  1W1D A;  1L08 A;  5DLA A;  2MEC A;  2DQH Y;  1D9U A;  1ALC A;  1GXV 2;  1QTZ A;  1CJ8 A;  1GF9 A;  4L41 A;  189L A;  2YBI A;  4RLN A;  1L94 A;  5HNC A;  1QQY A;  3QBV B;  5LYZ A;  1XGR C;  2L2I A;  1GWD A;  1L92 A;  1DI5 A;  1YIK A;  5FI0 A;  3GUN A;  243L A;  1UUZ C;  4B4J A;  3ATO A;  3G3A B;  5D5F A;  2BQH A;  4EMO A;  4PRQ A;  3CIK A;  1L37 A;  2BQG A;  2UVM A;  4F7U P;  1LZ4 A;  1SSW A;  2Z39 A;  4D9Z A;  219L A;  1U5E A;  1OUJ A;  1PFJ A;  221L A;  4WSF A;  4WM2 A;  5LXW A;  1WVH A;  1BB3 A;  1T6V L;  1FB8 A;  4I7N A;  1GB9 A;  4G4B A;  3TXE A;  2D9W A;  2D6B A;  3LYT A;  3KY9 A;  139L A;  1L90 A;  1MKE A;  1X1G A;  4WO9 A;  1L0J A;  2BQI A;  2H7D A;  1KIP C;  163L A;  2UZS A;  1JWR A;  1BB5 A;  1WG7 A;  1HEL A;  4NGL A;  1P37 A;  3L2X A;  3A93 A;  1WQN A;  1LJ4 A;  1L30 A;  3WW5 A;  1LZC A;  1JTO L;  2J59 M;  3FM8 C;  4YEO A;  4W55 A;  1WTN A;  1V61 A;  3IVF A;  1FOE A;  1B7Q A;  4ETD A;  1LTM A;  1GBO A;  1JJ0 A;  3A6C Y;  3P4Z A;  208L A;  1AQC A;  2B6T A;  2ELB A;  168L A;  2RBO A;  210L A;  2YT0 A;  5B1F A;  7LYZ A;  1C61 A;  145L A;  1VDQ A;  3WPK A;  1GBZ A;  2A7D A;  1J1O Y;  4GCB A;  2OU9 A;  1GB2 A;  4W58 A;  4YXA C;  128L A;  4AQN A;  5II3 A;  4MY6 A;  137L A;  134L A;  4G4H A;  5E4P A;  3SB9 A;  1C6Q A;  3B6L A;  2Z2F A;  1L67 A;  1G7I C;  1IWX A;  1LZ9 A;  4NGW A;  228L A;  1IC5 Y;  1GB3 A;  3C81 A;  1GC6 A;  1L91 A;  1G7M C;  1GEV A;  5KXY A;  4DWX A;  4OWB A;  3AZ5 A;  140L A;  1JTN A;  151L A;  4LZT A;  4H8X A;  1L73 A;  2IGC A;  2COF A;  1BWN A;  1GD6 A;  4HTN A;  192L A;  1C6F A;  1UEF A;  1L41 A;  4HPI A;  2N23 A;  1LGW A;  3F9L A;  3D3D A;  3FI5 A;  1QC6 A;  1WTH A;  4XWX A;  5CLL B;  1YAN A;  1G0J A;  2H9K A;  1T6H A;  3G9W A;  160L A;  3MDB C;  165L A;  4H9I A;  1DBH A;  2YBM A;  1L97 A;  1LJJ A;  1BVK C;  1LSC A;  1B7R A;  5B05 A;  5KXP A;  4W94 A;  2J0K A;  1IWW A;  142L A;  5APF A;  1MK9 B;  2VSZ A;  2BQD A;  3KRX A;  1DYD A;  4LT3 A;  1P2R A;  4LT2 A;  177L A;  1JJ1 A;  2AUB A;  2Y7B A;  1LW9 A;  1OMW A;  2K2J A;  2HEC A;  1PS5 A;  2W2W A;  1CJ7 A;  262L A;  4M6D A;  2DBT A;  2ROV A;  3WU7 A;  1YAO A;  2G4N A;  4LZM A;  1H10 A;  2PZ1 A;  4H8S A;  3MPX A;  2LUL A;  3HUK A;  107L A;  141L A;  4A6K A;  1IVM A;  207L A;  4B6H A;  4IOY X;  2I6Z A;  2Q9E A;  1SHC A;  2DHI A;  5I5Q A;  4H93 A;  4HAZ B;  3KSY A;  1Z55 A;  2YSS C;  5ILC A;  1B5Z A;  5C6L A;  2LG1 A;  2B6Y A;  3OE6 A;  3DMV A;  2YF0 A;  4ARQ A;  3TXJ A;  2YDG A;  1P56 A;  2W2X D;  1NMM A;  1I1Z A;  242L A;  3ZVR A;  261L A;  1D3N A;  164L A;  2DX1 A;  1D3J A;  4X3B A;  1OVK A;  1EQ4 A;  2B6Z A;  1NBY C;  1I56 A;  1LI2 A;  2G4P A;  1UIE A;  3DN6 A;  1CKH A;  1L64 A;  4PNK A;  3AB6 A;  1QTC A;  5L9J A;  5KXS A;  4A5K A;  4HB0 B;  1G0P A;  2DKP A;  3P66 A;  245L A;  2BQL A;  1P36 A;  1CNS A;  129L A;  1J0W A;  4H9F A;  1TDY A;  1BWH A;  2CDS A;  3ZDT A;  5FHW A;  5M1Y A;  2B72 A;  201L A;  1AT5 A;  1L49 A;  1UIB A;  3WUL A;  2H5Z A;  1D2W A;  1M7R A;  1L60 A;  1LZR A;  3PBL A;  4B0D A;  211L A;  5KXZ A;  1BB6 A;  3J4G A;  4WL6 A;  3P7Z A;  2YBJ A;  5KXO A;  1VAU A;  258L A;  1GE3 A;  2DQC Y;  1IOT A;  199L A;  1NDG C;  118L A;  2EMS A;  4LT0 A;  3A6B Y;  1KXW A;  1P46 A;  3DN3 A;  4DD7 A;  127L A;  1LYI A;  1LZD A;  3EMS A;  1YRO A;  3A8Q A;  2YBN A;  1GBX A;  2ZNX Y;  3BIN A;  1LPY A;  3NYA A;  3DN8 A;  206L A;  2NZ8 B;  1LI3 A;  4DAJ A;  5KXN A;  1XSF A;  4BAD A;  1OUI A;  4WJ7 A;  5F9U A;  1L47 A;  1C45 A;  5FEL A;  1QT3 A;  1GE4 A;  2VB1 A;  4OOO A;  2DX5 A;  216L A;  2BLX A;  2ZIJ A;  4ANR A;  4EKP A;  176L A;  1CKF A;  1OV7 A;  1XJT A;  3RNX A;  1OUF A;  3CDT A;  1VAT A;  4HSF A;  4IFS A;  3VIA A;  1L01 A;  4Z98 A;  3TMX A;  4D0N B;  1PQO A;  1LLH A;  1C69 A;  1L09 A;  126L A;  2Q13 A;  1EF1 A;  2B75 A;  4F7H A;  1GG3 A;  1OUB A;  2OE4 X;  1CX6 A;  2XBS A;  1LJE A;  4DJH A;  1L39 A;  5HE2 A;  2Z0P A;  1L03 A;  4K2O A;  1L74 A;  1L93 A;  1G7J C;  2XBR A;  5F14 A;  1JKB A;  1KZ7 A;  1XEJ A;  154L A;  1GF3 A;  4WLX A;  3F0W A;  5A3Z A;  1G06 A;  1C6A A;  1QT7 A;  3AU4 A;  2COD A;  1D0M A;  2D4Q A;  4IAT A;  2DN6 A;  2MKR A;  5GOW B;  2EJ8 A;  5B1G A;  212L A;  4YON A;  4W96 A;  4TKN A;  1OVH A;  1GFK A;  4ZRK A;  4NHQ A;  2Y8G A;  1LJN A;  3QIJ A;  1IRS A;  3C8R A;  1P3R A;  3A67 Y;  3WXU A;  1AZF A;  4GXB A;  4IAP A;  1T8F A;  3ULB A;  3TXF A;  2F2N A;  4ARM B;  246L A;  5FDJ A;  4HJV A;  196L A;  2ZQ3 A;  1PMS A;  1LW3 A;  3D8F A;  2Z19 A;  153L A;  1LB1 A;  1L96 A;  4OW1 A;  1IP4 A;  1QS9 A;  2B73 A;  3AU5 A;  3A94 A;  5JP4 A;  1XCG A;  1LYF A;  3HBD A;  1UIF A;  1CV6 A;  3WPJ A;  1CKD A;  1L72 A;  1L66 A;  237L A;  1LHL A;  1B7P A;  4WM3 A;  4TSB A;  3GUM A;  1UIA A;  3P6A A;  2LZM A;  5L3H A;  3FI7 A;  1LZA A;  4XN6 A;  2A4T A;  1D0K A;  4GMX B;  2Z0O A;  236L A;  3SB6 A;  123L A;  1INU A;  1D9W A;  5LA5 A;  3X23 A;  2LYO A;  4EKR A;  2CWI A;  4IJ4 A;  4H94 A;  1UIH A;  3DN1 A;  2I5F A;  2FYC A;  2H7E A;  162L A;  3OE9 A;  3SO6 A;  3SNH A;  1L42 A;  4CHJ A;  231L A;  3A8P A;  1NWG A;  4I7J A;  4W56 A;  5KQ1 A;  182L A;  4LYZ A;  256L A;  1RJC B;  1BWJ A;  1C6K A;  1LZ5 A;  2DKV A;  2XJW A;  1Z87 A;  1CU5 A;  3A91 A;  3CDO A;  3CT0 A;  1HF4 A;  3ML4 A;  5DN5 A;  4GCF A;  1IC7 Y;  1XEI A;  3N9E A;  1L22 A;  1JUG A;  2LC9 A;  2C8P A;  4K17 A;  1C6T A;  1GF7 A;  3TVV A;  2D9V A;  3GUK A;  4DX9 0;  2RNR B;  4EPI A;  1B6I A;  3HT8 A;  1IR8 A;  5A3E A;  3PVW A;  4TUN A;  3WU8 A;  150L A;  4LGK A;  1REZ A;  2AEH A;  5I54 A;  3HFM Y;  1G1V A;  3BKV A;  2BQO A;  3AW7 A;  3DMZ A;  1LZS A;  3DXC A;  1TQZ A;  4OO9 A;  112L A;  1IOR A;  1FLY A;  3OAN A;  1L58 A;  3HBE X;  1LHM A;  4CGE A;  3IJU A;  1GBW A;  1L46 A;  241L A;  3N9C A;  4W52 A;  1NHE A;  4WVF B;  1C08 C;  3TFM A;  1DDM A;  4H9A A;  2DQE Y;  3W6F A;  3WXT A;  3JR6 A;  3SP3 A;  4HHV A;  2B7X A;  1P5C A;  3EML A;  4PGJ B;  3CDR A;  4ARL A;  5IHG A;  235L A;  1J1X Y;  1XKE A;  4WM6 A;  4TX7 A;  2BQN A;  5JLJ B;  3A98 B;  1L53 A;  1L29 A;  1FGY A;  1C43 A;  5CLQ B;  1HER A;  4YXC A;  1J19 A;  149L A;  4GRV A;  3SUZ A;  2RSG A;  2H9J A;  3W6C A;  1D6P A;  3HH5 A;  4GPT B;  1QDR A;  4WOA A;  3CXB B;  4ARJ A;  1B5U A;  4WM4 A;  1OWY A;  2HED A;  157L A;  3SBB C;  4NGV A;  2ZIK A;  4ZIX A;  5C5B B;  1L79 A;  2DQG Y;  2HUK A;  2HU3 A;  2LZ2 A;  1KNI A;  1FLU A;  1CV4 A;  1KW7 A;  2W2X C;  2P0H A;  1LZG A;  3LN2 A;  3B72 A;  5D3W A;  2OTX A;  1SWY A;  1U5F A;  2VRW B;  1L55 A;  1EQE A;  4PK0 A;  2MDX A;  115L A;  1LJK A;  1FAO A;  2OEA X;  247L A;  1BGI A;  4NGY A;  5DHA B;  1QSQ A;  4NGI A;  1L16 A;  1NHB A;  2O79 A;  3QAK A;  2EC1 A;  4F7G A;  169L A;  1LZE A;  2E2X A;  232L A;  1L81 A;  1QUD A;  4NSW A;  2ZYC A;  2IFF Y;  1L98 A;  1QTE A;  2PC2 A;  1ZSQ A;  1CJ6 A;  1NQI A;  2RBN A;  2P0D A;  1D6Q A;  1C6I A;  1BWI A;  4NGZ A;  1AWE A;  1FHW A;  2B6X A;  166L A;  1L04 A;  4RLM A;  1MLC E;  3CSQ A;  3RCP A;  1RCM A;  1YQV Y;  1L85 A;  2YS1 A;  5LOP B;  1L82 A;  2QAR C;  3TXI A;  184L A;  1ZC3 B;  1L44 A;  2HE7 A;  4LYO A;  1NTV A;  1FHO A;  3C8Q A;  5EBH A;  1GAY A;  3F6Z A;  1LMT A;  1X05 A;  1C7P A;  2O4W A;  1DZB X;  3HTF A;  3ATN A;  1WQP A;  143L A;  1YIL A;  4CFO A;  2HUM A;  2B5Z A;  4RW1 A;  1QUG A;  4LT1 A;  4DDB A;  156L A;  3HDE A;  4KL7 A;  1UNQ A;  2HTH B;  1LJG A;  4H91 A;  3AJ4 A;  3WA0 A;  4G49 A;  4K5Y A;  4CYE A;  1L48 A;  4LYM A;  5C6R A;  1IEE A;  4HAU B;  1KS3 A;  1C6P A;  2YVB A;  4DBB A;  2RGN B;  3OE8 A;  1IOS A;  3WVY A;  4PRU A;  2Z18 A;  1X11 A;  5KXM A;  2HTX A;  1LYG A;  3CQL A;  1LSD A;  1C63 A;  1U2B A;  4GN3 A;  5KXR A;  2ELA A;  1V5P A;  3TMU A;  4NG8 A;  213L A;  1GFE A;  5FEK A;  1VDT A;  2RVB B;  4U3X B;  3W3E A;  4GCE A;  4IAS A;  1WQQ A;  3M3U A;  2I1J A;  5APD A;  4M4O A;  1B7N A;  4PJZ A;  244L A;  1L83 A;  4YOP A;  4HAW B;  2EIZ C;  113L A;  5L81 A;  4N8Z A;  1F6S A;  4DT3 A;  2MED A;  2XTH A;  2ZIL A;  1AM7 A;  2NTG A;  1AT6 A;  5D5C A;  1LSG A;  1DPX A;  1P64 A;  4YF2 A;  1OUE A;  1L31 A;  135L A;  4I7O A;  2Z6B A;  4ETC A;  4AXT A;  1UPQ A;  5D27 A;  4DD0 A;  2RLO A;  2CJL A;  5I53 A;  2W1M A;  3W6B A;  1LYO A;  1L75 A;  1L77 A;  1JIS A;  1CV5 A;  5HMV A;  1KY1 A;  1L00 A;  4HDO A;  5IEL A;  1WQM A;  5KKJ A;  1YKY X;  1TJ6 A;  1IWV A;  3PDS A;  3V2Y A;  3HUA A;  4BBK A;  1F6R A;  1L89 A;  3LZT A;  1MPH A;  4DD1 A;  3WU9 A;  4NSJ A;  2COC A;  2EMT A;  3TW1 A;  1HEQ A;  1ZVY B;  1QUT A;  1L15 A;  3CDQ A;  4NGK A;  1B7S A;  1JHL A;  3BJI A;  4P7I A;  3QWM A;  5HE3 A;  1H87 A;  1UBZ A;  1EGX A;  1LZB A;  4WG1 A;  1OUH A;  3CT1 A;  1DKK A;  2D4I A;  1GBY A;  1T8G A;  4I7K A;  3C83 A;  2W1X A;  1GB0 A;  3A8Z A;  3ULR A;  5I4X A;  1P2L A;  2RUK B;  158L A;  1UIG A;  8LYZ A;  1LSE A;  1J1P Y;  4HAV B;  4Z2N A;  2LOZ A;  1GE0 A;  4WMG A;  2BQC A;  3TXD A;  1LHH A;  3RUN A;  3TXB A;  3RT5 X;  3CSZ A;  2OE7 X;  4BAF A;  3EXD A;  5LVH A;  1DYA A;  4C0A A;  1D0L A;  1WGU A;  4N5R A;  4EKU A;  1UIC A;  1I2H A;  1V88 A;  1HEN A;  1LJI A;  1BTK A;  1G0Q A;  1L07 A;  4LYB A;  2QB0 B;  2BQE A;  4GZU A;  3VOQ A;  2XQO A;  1DYB A;  3DN2 A;  4NSH A;  1WVU A;  2UZR A;  4DX8 A;  1IO5 A;  1FBI X;  3GUP A;  1C10 A;  1KY0 A;  1JQU A;  3VW7 A;  4PHI A;  2GS0 A;  1L76 A;  3QNG A;  2WAR A;  1HFZ A;  3O96 A;  1LKS A;  2OTZ X;  1QS5 A;  1XFP L;  3A3R X;  4LDL A;  4OOT A;  3B0O A;  3ZVQ A;  3D9A C;  1L14 A;  5LAF A;  4CHM A;  1G7H C;  3FA0 A;  1OP9 B;  2MEA A;  2Z2E A;  4NHS A;  1ZV5 L;  1QUO A;  3AW6 A;  1L71 A;  2Q9D A;  1LMO A;  2MEF A;  1HNL A;  4W57 A;  3WYF B;  4Z46 A;  2NTH A;  1L40 A;  1GDX A;  1B7O A;  4TYZ A;  4KVG B;  1L54 A;  1C66 A;  2RB2 X;  3IJV A;  2B70 A;  2Y8P A;  1L59 A;  4EJN A;  3LYO A;  1YAQ A;  3HK0 A;  1WJM A;  1DKJ A;  1OUD A;  1TCY A;  5JHH A;  4GCD A;  1GB7 A;  2XQN M;  4EMN A;  5I4W A;  2DHJ A;  4ARM A;  1OV5 A;  1BAK A;  249L A;  109L A;  4ZRJ A;  5LA8 A;  1EL1 A;  1B0D A;  4I7Q A;  1UAC Y;  5T3F A;  1MIZ B;  1OQM A;  5LON B;  1NTY A;  1VDS A;  1QIO A;  3QE8 A;  1X86 A;  1X1F A;  1GB6 A;  1LHK A;  1RRP B;  1DXJ A;  3GUL A;  1LSN A;  4G9S A;  1G0M A;  1HEO A;  2F4A A;  1QT4 A;  1BB7 A;  1C64 A;  4YEM A;  1LYJ A;  2DTC A;  1FGZ A;  1P7S A;  255L A;  3TCA A;  5E9R A;  4GMV A;  4KT3 A;  2MEG A;  2BQA A;  3AZ6 A;  2DQF C;  215L A;  2D91 A;  2KUP A;  2DYQ A;  5J3Q A;  4EOF A;  4GN4 A;  1KZG A;  1EAZ A;  1GB8 A;  3T6U A;  4H9H A;  4XAD A;  2ROZ B;  2CGI A;  1L87 A;  1IC4 Y;  1GPQ C;  2HEE A;  1C6E A;  5FI1 A;  4XJD A;  3TMW A;  181L A;  9LYZ A;  1TBY A;  1C6J A;  4L6E A;  3HT7 A;  3SYX A;  1HSW A;  4YX7 C;  3NY8 A;  4ET9 A;  1L28 A;  4OWC A;  4ET8 A;  4G4C A;  4UWV A;  4A6H A;  4XJF A;  1DYC A;  1RJ2 A;  1MK7 B;  7LZM A;  4RW2 A;  1L02 A;  4NIJ A;  4NEB A;  1ISN A;  3AZ7 A;  2D2Q A;  1JTT L;  1IP1 A;  1GFJ A;  1U29 A;  3P65 A;  1LYZ A;  1UNP A;  4GCC A;  3WW6 A;  3G3X A;  1I20 A;  2L1C A;  4NGJ A;  3WUM A;  5HLL A;  1GFA A;  3F5R A;  1L17 A;  1DPW A;  2MEB A;  1L45 A;  250L A;  4WLY A;  2DYN A;  4EKQ A;  3SB7 A;  1SX2 A;  3SB5 A;  1LWK A;  1NI2 A;  2D4K A;  1LMQ A;  4CFP A;  4DQ7 A;  175L A;  3ULC A;  3DN4 A;  240L A;  2FBD A;  1LMC A;  1LSM A;  220L A;  2MEI A;  2Z0Q A;  2F2Q A;  5LYM A;  4LYT A;  3HTG A;  1C65 A;  1CV3 A;  4NFV A;  3DXE A;  3FE0 A;  3T36 A;  119L A;  4Z41 A;  3AJN A;  1IX0 A;  2DFK A;  4TSC A;  1LYY A;  1C67 A;  2FBB A;  2B6W A;  2N0Y A;  1WJ1 A;  1FLW A;  1CX7 A;  1L20 A;  4ML7 A;  3SB8 A;  229L A;  5KXX A;  1L57 A;  5KXK A;  2QKL A;  3GUI A;  3HW2 B;  1QSB A;  1L65 A;  1IP2 A;  173L A;  1YKX X;  4PPO A;  2AL6 A;  2OQB A;  1HML A;  4ETB A;  1C6D A;  5LIN A;  1CVK A;  3OE0 A;  4MCK A;  1IOQ A;  4II8 A;  2J0M A;  5HNL A;  1C6M A;  4QDN A;  5ILF A;  2M14 A;  1GF0 A;  4I0C A;  1P2C C;  4I7R A;  5FCP A;  2ZPY A;  1B5X A;  3D8D A;  1L88 A;  3RU5 A;  1V5M A;  4C5F A;  191L A;  4I7L A;  3V5W A;  2DQJ Y;  3WL2 A;  1K5D B;  1Q67 A;  1XR0 B;  1HEM A;  2ZNW Y;  1L95 A;  1PQM A;  1DYN A;  4I7S A;  5HMJ A;  1NKH A;  1G07 A;  1D3F A;  4B4E A;  5LIO A;  1QTV A;  1L06 A;  2HUB A;  2HEA A;  1LZ8 A;  1PQK A;  1N4F A;  1KIQ C;  2RB0 X;  1KXX A;  4UWN A;  1WGQ A;  2RBP A;  3AGI A;  2M38 A;  2BPU A;  1DYG A;  2J0J A;  3G3V A;  5KXT A;  1LKR A;  144L A;  2DHK A;  3A34 A;  2YS5 A;  172L A;  1LWG A;  1SX7 A;  1V5U A;  3KRW A;  2ANV A;  187L A;  1QUH A;  131L A;  1DDW A;  214L A;  3M1I B;  4HV1 A;  1YKZ X;  1SLY A;  1ZYT A;  3MGW A;  2A7F A;  4N9R A;  1L68 A;  5KKI A;  1REM A;  5KJ9 A;  3A92 A;  1LYS A;  1XGQ C;  5KXL A;  2RBQ A;  3KAM A;  2K2U A;  146L A;  1RFP A;  1LSF A;  2HEB A;  1W1G A;  2LYD A;  5D3Y A;  1JEF A;  1LMA A;  3GXR A;  4DD2 A;  2GCL A;  1T97 A;  3UON A;  2HU1 A;  1QT5 A;  4J1A A;  1QSW A;  1OVJ A;  3VWO A;  5DI9 B;  5DL9 A;  2ZQ4 A;  4WM5 A;  132L A;  2MWN B;  1C60 A;  3HUQ A;  4NHT A;  1K5G B;  5J3T A;  4HB3 B;  4DD9 A;  1C6H A;  2ZWB A;  1QDT A;  122L A;  222L A;  2Y8F A;  1L24 A;  3LHM A;  3HH3 A;  3N7C A;  1I6S A;  1JPO A;  4EXM A;  3ZEK A;  1LYE A;  1XJU A;  5DN4 A;  4ZEE A;  102L A;  103L A;  1IWU A;  1IY3 A;  2DA0 A;  4EPF A;  2RB1 X;  4H9C A;  5HE1 A;  2DQD Y;  1IP7 A;  4HP0 A;  3A95 A;  3T06 A;  130L A;  4I7T A;  1DYF A;  1V89 A;  4Z2M B;  253L A;  1XGU C;  148L E;  2RBS A;  1B5W A;  1YAM A;  1C6C A;  2CAY A;  2G4Q A;  3P64 A;  1D2Y A;  1YAP A;  4DD3 A;  155L A;  1LGX A;  2I26 L;  5DM9 A;  120L A;  4A7D A;  3DNA A;  3EBA B;  3HT6 A;  4YM8 A;  4Z3M A;  110L A;  1E5W A;  1W6Z A;  1CTW A;  1FLQ A;  1LGU A;  111L A;  1V7T A;  2D9Y A;  2MFQ A;  3PVL A;  2F47 A;  4DQ5 A;  1BTN A;  227L A;  2RH1 A;  2F4G A;  2N5Z A;  1L84 A;  1IR7 A;  1GC7 A;  3AZ4 A;  6LYZ A;  217L A;  1ZUR A;  4NG1 A;  1GB5 A;  4N1C C;  1LHJ A;  1IIZ A;  1UID A;  1QTB A;  3WPL A;  1XX0 A;  2RAY X;  4QGZ A;  1JKD A;  5K7O A;  4HJZ A;  1V7S A;  4PQ0 A;  2GCJ A;  4TTD A;  1HFX A;  3B0I A;  4KHO A;  1LI6 A;  147L A;  2DQI Y;  4LFX A;  5D3X A;  3CSR A;  1YL1 X;  3ODU A;  3GUJ A;  1QSA A;  1EPY A;  3EO5 A;  1QTK A;  4NGO A;  4NWH A;  1A2Y C;  4H8Y A;  4A6F A;  1JSE A;  3WUN A;  2LYZ A;  1ZWN A;  4NY5 A;  108L A;  5F16 A;  3PG7 A;  1CUQ A;  3HU8 A;  1VDP A;  2V76 A;  2CY4 A;  200L A;  1G7L C;  1PQI A;  5LVI A;  4HAT B;  1DQJ C;  4WLD A;  1L34 A;  251L A;  225L A;  5LVG A;  2P0F A;  1H6M A;  1UPR A;  4HB4 B;  1QUS A;  3LJU X;  1L19 A;  4WG7 A;  1LMP A;  3E3D A;  1JKC A;  4NHI A;  233L A;  2EKS C;  104L A;  198L A;  4S0W A;  4ARQ B;  1EVH A;  3FSS A;  1EQ5 A;  3LZM A;  1BB4 A;  2YT1 A;  1XEP A;  5DHF B;  4DC4 A;  1FKQ A;  1LSB A;  2GJY A;  1OWZ A;  1W08 A;  4FDY A;  1C6L A;  1L27 A;  1OUA A;  230L A;  3AGH A;  1OUG A;  1QT8 A;  1L56 A;  2BLY A;  4KHA A;  1K28 A;  4MK0 A;  4QY9 A;  1OY2 A;  1FN5 A;  1H4R A;  5J3Y A;  2IHL A;  5DH9 B;  1QTH A;  2LHM A;  1SSY A;  2Z12 A;  4ETA A;  1TAY A;  1LJH A;  1GF4 A;  1W1H A;  2YBH A;  3LYZ A;  1B7L A;  238L A;  2HEF A;  3HT9 A;  5B59 A;  186L A;  4EKS A;  4YEN A;  125L A;  1B9O A;  1XD4 A;  4CHX A;  1C62 A;  1PQD A;  4BAP A;  1GF5 A;  1KXY A;  4ZRI A;  133L A;  4DKL A;  1VFB C;  1OYU A;  1XGP C;  1HHL A;  5D3V A;  2OTY X;  3RZE A;  3C82 A;  1I7A A;  5LVJ A;  4MT7 A;  1JIT A;  1C6B A;  1GAZ A;  3NY9 A;  193L A;  4H9E A;  3HU9 A;  1L38 A;  5LAG A;  1L11 A;  3C80 A;  1SGH A;  1L13 A;  5KY1 A;  4LDO A;  3HBH A;  2I1K A;  1U27 A;  195L A;  3OJP A;  4H8Z A;  2YS3 A;  2OU8 A;  138L A;  3HH6 A;  3AYQ A;  1LZN A;  1NF5 A;  2FYD A;  239L A;  1L26 A;  185L A;  1CU6 A;  3QY4 A;  4NSG A;  205L A;  2YVC A;  4ETE A;  1T3P A;  5HQ1 A;  1FHX A;  3WH1 A;  1NDM C;  5KCV A;  2DQA A;  1P6S A;  3W6D A;  1GFT A;  5B06 A;  1GE2 A;  4H90 A;  1LSP A;  1L52 A;  2Z37 A;  3F8V A;  3SBA A;  1L10 A;  159L A;  1LSA A;  3FAD A;  1LPI A;  1WVV A;  3DKE X;  1JJ3 A;  1SWZ A;  2O7A A;  4HTK A;  2F32 A;  114L A;  3A90 A;  1ZM0 A;  3UZT A;  4A6F B;  1Y19 B;  3ODW A;  3HTB A;  2LCB A;  1TEW A;  5J7C A;  1ZVR A;  2C8O A;  180L A;  1IOC A;  3M18 B;  3N9A A;  260L A;  1L33 A;  1GFH A;  4E3U A;  2D10 A;  4HPE A;  3G3W A;  3HDF A;  1C46 A;  3CT5 A;  2B74 A;  4XJH A;  2CY5 A;  1LAA A;  4LFP A;  3BKH A;  1LYH A;  1WQR A;  4WL7 A;  3TO1 A;  1VED A;  4GN1 A;  1UA6 Y;  1REY A;  2F30 A;  1T8A A;  2OU0 X;  4J7V A;  1HEP A;  1B5Y A;  174L A;  3DN0 A;  3W6E A;  4LYC A;  4GN5 C;  4H9B A;  4W54 A;  2IYB A;  4K2P A;  1RI8 B;  2ANX A;  3PVU A;  1CU0 A;  1XOD A;  1GEZ A;  1GFR A;  3TXH A;  1LZ6 A;  3A3Q A;  4K81 A;  5KXW A;  1IP3 A;  3GYO A;  1C6G A;  5KQ4 A;  259L A;  2KCJ A;  2LYM A;  2BAA A;  1M7E A;  3RZ4 A;  2D11 A;  4XJG A;  2P8V A;  1CV1 A;  5LYT A;  1GFU A;  2D9Z A;  1IP5 A;  2LOX A;  4C3W A;  4W59 A;  3FEH A;  1BVX A;  4OWH A;  1LCN A;  1U5G A;  4GLA A;  2COA A;  3TMV A;  4E97 A;  4WM1 A;  1B5V A;  4HJY A;  1O23 A;  2OE9 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...