4IAPA

Crystal structure of ph domain of osh3 from saccharomyces cerevisiae
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
256
structure length
256
Chain Sequence
GRYLQGYLLKKRRVDNIFEMLRIDEGLRLKIYKNTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYVDQGFKKRFFTLDFRYGTLSYYLNDHNQTCRGEIVISLSSVSANKKDKIIIIDSGMEVWVLKATTKENWQSWVDALQTCFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein/ hydrorase
molecule keywords Oxysterol-binding protein homolog 3,Endolysin,Oxysterol-bind
publication title Structure of osh3 reveals a conserved mode of phosphoinositide binding in oxysterol-binding proteins
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 76
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2012-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00959 Phage_lysozyme Phage lysozyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.530.40 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 4iapA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4iapA01
130LA 1L32A 2MFQA 1B6IA 1L18A 2LC9A 2OE4X 4EKQA 149LA 1EAZA 3GUOA 1XJTA 3P7ZA 2M38A 178LA 206LA 4H8SA 1P37A 1LPYA 1PQJA 2HUMA 1L70A 176LA 2IYBA 3PP2A 2P8VA 150LA 112LA 2YVCA 1C6DA 2D10A 2Y8FA 2EMSA 1XX0A 2COAA 2HTHB 2L1CA 5C79A 108LA 3TFMA 3OE9A 1UNQA 205LA 2OU0X 3K2RA 1C66A 3ZDTA 2L78A 1QS5A 2KCJA 1W1HA 192LA 3HUQA 1L89A 4A6FB 5HE1A 5C16A 3HH6A 1L56A 248LA 5FI0A 1PQKA 1BTKA 1D3MA 1LYHA 1G0JA 2PZ1A 1L51A 1TQZA 181LA 1C60A 1T8FA 3HU8A 256LA 1L52A 1P2RA 3PVUA 5J3TA 127LA 4ZRIA 182LA 119LA 109LA 1L04A 1RJ2A 1L99A 142LA 1L0JA 1P56A 258LA 1L21A 1FHWA 1ZC3B 1KZGA 1C6IA 1L31A 3C82A 2I5CA 1V61A 2ROZB 2A4TA 4EKRA 1L45A 1XCGA 2Y7BA 4EMOA 1C67A 1FHXA 4MT7A 1DDMA 2W2XC 1L05A 1C6QA 3IVFA 5LOPB 1NU2A 2RB2X 3DXEA 1WGQA 3DMVA 4NY0A 4EKUA 1ISNA 228LA 143LA 1D3FA 166LA 1UEFA 1KS3A 4EJ4A 229LA 4A5KA 2D11A 4DJHA 2RVBB 3C7YA 1LW9A 5L81A 1L01A 1L80A 1QSQA 1C65A 3QAKA 3ZVRA 1LI2A 5J3QA 1SX2A 2DHIA 1OY2A 5CLQB 2AEHA 1ZC4B 2DYNA 1L26A 1I6SA 1P64A 1L65A 2Q9DA 1MIXA 212LA 1QTBA 4I7KA 1L82A 1K5GB 4I7SA 241LA 1XEPA 4W54A 1T97A 3DN1A 198LA 3G3WA 1DYEA 3TO1A 2LYDA 1DBHA 2DX5A 2O7AA 2VRWB 5KCVA 4DKLA 3FADA 234LA 5JHHA 3HTDA 2J0JA 1G1WA 2E2XA 1L22A 4WSFA 1QT3A 4ZPUA 1LW3A 3GYPA 2COFA 1X86A 4GMVA 1P46A 1MK7B 1L39A 2OEAX 161LA 3SV1A 3C81A 1L29A 3SB6A 2Z0QA 1C6NA 246LA 3BINA 4CHJA 4W56A 5HE0A 2B6WA 1G1VA 211LA 2DHKA 3QBVB 1QT8A 1DYDA 1L69A 2D9ZA 1L40A 122LA 1L90A 3U8ZA 1N3HA 2LCBA 4EKSA 2DHJA 2VSZA 1SWZA 1WG7A 1EVHA 4I7PA 219LA 4YXAC 4IAPA 1GC6A 5LZMA 1CV0A 1C6HA 1L10A 2B6YA 4K5YA 1SX7A 4ARMB 111LA 1L59A 3DMXA 1L83A 5DI9B 1P36A 4LDLA 1L57A 4I7NA 2EMTA 4HDQA 1L84A 1U2BA 2R09A 4GMXB 2HUKA 173LA 3JR6A 2LZMA 3SO6A 2QKLA 2ELAA 1G0KA 129LA 145LA 2QB0B 2OTXA 3CDOA 3SN6R 1SSWA 1TLAA 1P6YA 4I7RA 2B7XA 1WJMA 3A8QA 1X11A 3RUNA 252LA 1JTMA 3HH5A 147LA 1C6EA 1CV6A 3DKEX 3NY9A 2V76A 3PVLA 4HAYB 1L50A 1QTZA 1Q67A 1D9WA 1ZSQA 1ZVRA 4ZRJA 1LYFA 213LA 3MDBC 158LA 1C68A 2LOXA 1CV5A 2F2QA 3DNAA 4PQ0A 1L08A 107LA 2RNRB 1U5GA 1QC6A 4IFSA 2B6XA 5C5BA 162LA 2OE9X 2DKPA 3KRXA 2M14A 1NTYA 3D8DA 3LZMA 3G9WA 4HHVA 1L41A 2I1KA 1CUQA 1ZM0A 1CTWA 4HAVB 4KHBB 2QKMA 1CUPA 160LA 1L38A 1LI3A 1G0QA 3TVVA 1L46A 2OTYX 138LA 3KSYA 4B6HA 240LA 1L30A 244LA 1L37A 1UPRA 2RAZX 1G0MA 4PK0A 1V5MA 4K81A 3PBLA 1UNPA 4CYEA 1T8GA 2YS3A 1V88A 236LA 4LDOA 2BCJA 2GCJA 1T8AA 2H7EA 191LA 1QTDA 2I1JA 1ZYTA 3T06A 4YL8A 1PQOA 1L67A 1CU5A 1J19A 1TJ6A 2X18A 163LA 3SB9A 4YXCA 3RZEA 243LA 3O96A 4DX8A 1L0KA 1L87A 3TCAA 1L72A 1IRSA 1M7RA 4L6EA 4Z2NA 2IFSA 186LA 4HAZB 3PVWA 3V2WA 1L49A 1OVJA 2HE7A 1G0GA 3C8RA 125LA 110LA 2B73A 3UONA 209LA 1PLSA 2LKOA 3GUJA 3HDFA 239LA 2Z0OA 3ODOA 1CU3A 2L2IA 2EC1A 3SUZA 1L63A 1LWKA 3CDVA 2RUKB 3DN2A 2FJLA 3V5WA 1L95A 4ARQA 1C69A 2K2UA 1JTNA 1L86A 1QT4A 4EKPA 2LOZA 4KVGB 3UZTA 141LA 146LA 4HAWB 2RBRA 2CY5A 3DXDA 3G3VA 201LA 5D3VA 1C6AA 103LA 171LA 3GUMA 4GBRB 1P5TA 1C64A 4W58A 1X1FA 4K2PA 1AQCA 4HATB 2D9XA 1WVHA 3C7ZA 3HK0A 4D0NB 1OMWA 1G06A 3MPXA 196LA 2RLOA 164LA 4GN1A 2VKIA 3HT7A 1RRPB 1FOEA 4F7GA 4A6KA 1CU0A 1KZ7A 4S0WA 3PZDA 1L00A 1L44A 1L79A 2RB0X 230LA 2CY4A 4A6FA 2D2QA 2CRFA 2JP2A 1U29A 1MIZB 2J59M 3KY9A 3SB8A 1CU6A 4I7QA 2G35A 4HAUB 183LA 185LA 1XJUA 169LA 1KW7A 1L02A 7LZMA 1L12A 1E5WA 1C6MA 227LA 1DDVA 3NYAA 2Y8GA 2F32A 3EMLA 3HUKA 1LWGA 4CHMA 2DX1A 6LZMA 1L16A 4EPIA 200LA 3OE8A 1GG3A 2D9WA 2NMBA 2OQBA 4HB4B 3VOQA 1WJ1A 5FI1A 2YSZA 1UPQA 1NI2A 4WJ7A 4XWXA 5J3YA 123LA 1L75A 1LGUA 5I14A 2CUUA 3FSSA 2KUPA 3G3XA 3QWMA 1XKEA 2DKQA 2MDXA 1OWZA 1DYCA 2LULA 3L64A 1L97A 4HDOA 1XODA 4K17A 1ZWNA 1Z87A 235LA 4HAXB 1PQMA 1OWYA 1OYUA 4W57A 1FAOA 1D2WA 1MAIA 3HH3A 242LA 1LLHA 4W51A 223LA 1CV1A 1FB8A 2UVMA 5DHFB 2HULA 2MKRA 2ANXA 2J0MA 4DAJA 1W1GA 1C6KA 5C5BB 3M1IB 1L93A 4I7LA 3PDSA 1C62A 1ZURA 2COCA 1CU2A 260LA 3DN8A 3GUKA 4I7JA 2DYQA 2YF0A 1G0PA 247LA 1L14A 1FGYA 2GCLA 1K28A 3HH4A 225LA 2EJ8A 2K2JA 131LA 1LYEA 3HUAA 2NZ8B 2RBOA 1L07A 4OO9A 4EJNA 1P5CA 3F0WA 215LA 2RB1X 165LA 1L43A 1OQNA 139LA 2F47A 3WA0A 167LA 1BTNA 5D27A 5KQ1A 245LA 3F9LA 4GRVA 151LA 115LA 4YX7C 4C0AA 1GC7A 5D3XA 4DBBA 4DX90 233LA 2RGNB 216LA 231LA 4A6HA 1QUOA 1L34A 1QTVA 3C8SA 3C83A 3OE0A 3ODUA 4EXMA 3F5RA 3HW2B 4HB0B 114LA 1L23A 4E97A 1V89A 3FI5A 3AU4A 4KHAA 140LA 3DN3A 1L64A 2YT0A 2YS1A 3CDRA 3NY8A 1WTHA 4ZRKA 2B70A 1L13A 1J0WA 4Z2MB 5EFXA 1FGZA 1CX7A 1D3NA 2IGCA 254LA 214LA 2RBPA 4ARMA 4WVFB 3GUPA 3HTFA 3GYOA 4W52A 1KI1B 170LA 1L09A 1QTCA 1V5UA 2B6TA 4GPTB 3NSUA 3TW1A 199LA 1NTVA 1C6PA 1C6JA 1D3JA 3P6AA 155LA 1OV5A 184LA 2UZRA 197LA 3D8FA 1L03A 3PG7A 3GUNA 1U5FA 3HT8A 3DN6A 2RAYX 4ARJA 1C6GA 174LA 3ODWA 3U7DA 1M7EA 2UZSA 1L60A 3DN0A 1L06A 1LYIA 118LA 3D8EA 3HQCA 4GZUA 2ZPYA 1I7AA 157LA 3VIAA 3SB5A 1LYGA 5HE3A 1FHOA 5DHAB 4K2OA 1L74A 220LA 1C6BA 2DA0A 148LE 3RCPA 218LA 1L94A 159LA 1CV4A 3SBBC 4IOYX 5DIFB 1OVKA 1QS9A 3SBAA 102LA 1L81A 3GULA 1V5PA 1L88A 221LA 4KAXB 2P0DA 1DYFA 3BJIA 253LA 2D9VA 232LA 1L62A 4ARLA 2AL6A 1QTHA 3WYFB 3HTGA 2D9YA 4NSWA 5DH9B 237LA 1C63A 1Y19B 1MKEA 187LA 3A98B 1L91A 1PMSA 1TXDA 1G0LA 1L71A 251LA 2OE7X 5JHGA 1PQDA 1L36A 3X23A 3QIJA 144LA 1QUDA 1WGUA 2ROVA 4LDEA 3ULCA 2RBNA 217LA 120LA 2B6ZA 1WI1A 1D2YA 2H7DA 3F8VA 1U5EA 3A8PA 126LA 1C6LA 1L68A 1QUHA 1DDWA 2ELBA 3LJUX 4DXAB 3DXCA 175LA 1MK9B 3HTBA 189LA 1NHBA 2D4QA 2N23A 5D3YA 1U5DA 4MK0A 4BBKA 3C8QA 226LA 1DYBA 2W2WA 3CIKA 4TYZA 1EGXA 1L85A 1L27A 1L48A 180LA 2Z6BA 1L42A 1L77A 1W1DA 2YT1A 1KY1A 2GS0A 137LA 1L17A 2MWNB 2P0FA 3PEGA 4TKNA 1CV3A 1P2LA 190LA 177LA 1QT6A 4HB2B 1L24A 1C6FA 3ULBA 2B72A 2GJYA 2OU8A 4F7UP 1H10A 3D4SA 1QT5A 1Y5OA 224LA 1C61A 1L55A 1L61A 1L28A 1LI6A 1JQUA 250LA 2Q13A 104LA 152LA 1X05A 262LA 2RSGA 3AU5A 4YONA 1SWYA 3HT6A 4Y94A 1QUGA 1H4RA 2B75A 1SGHA 2LG1A 1L76A 4GXBA 1DYNA 1XD4A 1BAKA 2DLWA 1L96A 1X1GA 188LA 4LZMA 2RH1A 3FEHA 1PQIA 1B55A 3KZ1A 1L53A 1QT7A 210LA 1EF1A 255LA 5HE2A 4I7MA 4EPFA 2CAYA 1L66A 2I5FA 4I7TA 1DYGA 2K00A 222LA 261LA 238LA 2NTGA 2YS5A 3OANA 4F7HA 1P7SA 2Z0PA 1SSYA 3L2XA 1DROA 4AQNA 1LB1A 3CDTA 113LA 249LA 2QARC 3SNHA 2R0DA 2Q9EA 4ARPA 5KQ4A 3HT9A 3FM8C 1CVKA 3HWLA 3ODXA 1AWEA 1U27A 2RBQA 2ADZA 5CLLB 4MY6A 1BWNA 3VW7A 1KY0A 1OVHA 3ML4A 4W55A 2YRYA 1L98A 2KGXB 5JP4A 3C7WA 257LA 1LGXA 4KHOA 1QQGA 4PJZA 1L19A 1LYDA 3CDQA 3PSCA 2XQNM 3HU9A 1DYAA 3N7CA 1MPHA 2N0YA 4W53A 259LA 1PFJA 4HB3B 5C6RA 3DMZA 4I7OA 1L20A 2CODA 1L92A 128LA 1XR0B 5D3WA 2RBSA 172LA 195LA 1L15A 2B74A 1SHCA 1QSBA 168LA 3AJ4A 2ANVA 1P6SA 1L54A 3V2YA 2OTZX 1I2HA 1K5DB 1L33A 3OE6A 1L47A 1G07A 2NTHA 3HDEA 3SYXA 5JLJB 1T6HA 4P7IA 4PNKA 3GUIA 1L35A 2O79A 1L25A 1P3NA 3CXBB 2W2XD 3C80A 2O4WA 1P3RA 1KW5A 1LGWA 1UNRA 1L58A 2DFKA 3KRWA 3DN4A 2DN6A 5LONB 5GOWB 1EPYA 2DTCA 2J0KA 1OV7A 1CX6A 1LYJA 3FA0A 4W59A 2P0HA 156LA 3SB7A 2OU9A 1C6CA 1KNIA 1L11A 1C6TA 1L73A 4ARQB
chains in the Genus database with same CATH superfamily
4QDNA 3N9AA 2MFQA 1B6IA 3G3AB 5DLAA 4EKQA 3GUOA 4HJYA 4QY9A 1P37A 1PQJA 1YAPA 4PRUA 1BQLY 1B5WA 5I53A 1B5XA 1GXXA 1YAMA 1BTKA 1TQZA 1C60A 3HU8A 4CHXA 4C5FA 3PVUA 5J3TA 4ZRIA 4TSBA 142LA 3LN2A 4CFOA 1IWUA 4WM4A 4DDCA 1ZC3B 1C6IA 1L31A 1DPXA 2ROZB 1F6RA 1L45A 2X0AA 2BQBA 2Y7BA 1GFUA 2DQEY 4MT7A 3B72A 3A92A 2Z37A 3DMVA 4GN5C 4HTNA 1HEPA 1IOCA 4EJ4A 229LA 1GF8A 132LA 3AZ5A 1HELA 1L80A 1QSQA 1HEWA 2HTXA 3QAKA 3ZVRA 5L3HA 3HFMY 9LYZA 1RE2A 4EOFA 2AEHA 1ZC4B 1YAQA 2DYNA 1BB6A 1I6SA 2KR0A 2HECA 1MIXA 4I7KA 1L82A 1LSPA 2BQMA 1OUFA 5HQ1A 1UIBA 1T97A 4LYBA 3TO1A 1W6ZA 2DX5A 2O7AA 4DKLA 2J0JA 1L22A 5B1GA 4ZPUA 1LW3A 1P46A 4QJ3B 161LA 3SB6A 2CWIA 1IC4Y 1WQRA 3QBVB 1G1VA 4YENA 2DHKA 2D9ZA 1JTTL 2LCBA 5IRSA 208LA 1SWZA 2BQDA 3P4ZA 1L10A 1HF4A 4FJRA 111LA 1P36A 3D3DA 4HDQA 173LA 1IWXA 3CT0A 5D5FA 5AMYA 3ZVQB 2K8EA 1V7TA 2QB0B 2OTXA 1SSWA 3A6CY 1WJMA 1X11A 3RUNA 1HHLA 252LA 147LA 2V76A 1ZVRA 1D9WA 1EQ4A 4ZRJA 158LA 1FN5A 1CV5A 1GEVA 1VDPA 2LZ2A 107LA 4DDAA 162LA 2DKPA 3QY4A 1NTYA 3D8DA 1FLWA 2QKMA 1CUPA 1L38A 1LI3A 1HMLA 4G4BA 4PK0A 2BQCA 1LZ1A 1WQNA 4CYEA 1FKQA 5E4PA 2H7EA 1NBZC 2I1JA 4W96A 4H1PA 2YBIA 1A4VA 1GB2A 1LSFA 3RNXA 3WW5A 4H9IA 1P2CC 1LJKA 2IFSA 2YT2A 3G3BB 110LA 1XGQC 1TCYA 209LA 3UONA 4XYYA 4TSCA 1HMKA 2Z0OA 3ODOA 5LYMA 3SUZA 1JKAA 1LWKA 3DN2A 1L95A 1LMCA 5LG4B 4W94A 2ZNXY 4GBRB 5II3A 4QGZA 1QQYA 1GBZA 4QEQA 133LA 4WOAA 1LSZA 2LHMA 4GN4A 2D2QA 3WH1A 2LZTA 2J59M 2BLYA 4I7QA 1OUJA 1UBZA 5C6JA 2YBHA 1E5WA 1C6MA 3NWAA 4CHMA 3EMLA 4DQ7A 4N1EI 4RDSA 2DX1A 1JJ1A 4EPIA 3VOQA 1LJ4A 2NMBA 5FI1A 2AUBA 1LZ8A 135LA 1NI2A 123LA 1L75A 1JKBA 2CUUA 2KUPA 1OWZA 193LA 3L64A 1IWVA 235LA 1B7LA 3NW8A 1OYUA 3WYHA 1MAIA 1LLHA 5APDA 2MKRA 3A34A 1F10A 4DAJA 1W1GA 4DD9A 2MEBA 4I7LA 1ZURA 4DYGA 5APFA 1CU2A 260LA 4I7JA 3GUKA 2DYQA 2HU3A 1GFTA 2YF0A 1L14A 2GCLA 1K28A 2KIGA 2EJ8A 1OUEA 1VDTA 1L07A 1IP5A 3WW6A 5B05A 4DX90 151LA 1GFVA 1VDSA 1ZV5L 2G4PA 231LA 4A6HA 1QTVA 3C83A 2DQFC 2EPEA 3TMWA 1L64A 3AZ4A 3CDRA 1WTHA 1EQ5A 3A93A 5EFXA 3LYZA 3HTFA 4HPIA 1LSYA 2DQGY 1YL0X 2YVBA 4NGKA 3ZEKA 1C6JA 3P6AA 4CJ2A 2UZRA 1HSXA 3HT8A 2DQIY 2RAYX 174LA 2UZSA 1GD6A 1XFPL 3DN0A 1L06A 3D8EA 157LA 4KL7A 1LYGA 1OUIA 3SB5A 1FHOA 4DWXA 1LYYA 220LA 2W1XA 3RCPA 2D91A 3SBBC 4H92A 1CV4A 1LKRA 2BQAA 4HTQA 2Z13A 4BAFA 3GULA 4OSNA 1L88A 2I25L 2P0DA 3BJIA 4KHBA 1LSAA 5KJ9A 3T36A 2AL6A 2D9YA 4NSWA 5DH9B 1I1ZA 1YKXX 1Y19B 4ETBA 1KXYA 3BKVA 2BQJA 1A2YC 1PQDA 1IORA 1L36A 4NGZA 144LA 2ROVA 5LVKA 120LA 1WI1A 1D2YA 2H7DA 3A8PA 3LJUX 1DDWA 3P64A 4DXAB 4HV1A 1FKVA 4MK0A 3C8QA 1DYBA 2DBTA 3CIKA 1EGXA 1L85A 4GCDA 1L27A 4WM2A 2Z6BA 3J6KA 1L77A 4XJBA 1B7SA 1P2LA 1REMA 4HB2B 1L24A 1MLCE 5IDDA 5F81A 4NSJA 5HNLA 2IHLA 1QT5A 224LA 5M1YA 1C61A 1L28A 1LI6A 1JQUA 3EO5A 2Q13A 152LA 262LA 3CQLA 3WPJA 2RSGA 1SWYA 3AU5A 4YONA 2B75A 3WUAA 1SGHA 2LG1A 2DLWA 3FEHA 210LA 1EF1A 1DYGA 1LYOA 2YS5A 1T3PA 3EXDA 3OANA 4F7HA 1P7SA 4NHPA 5I4XA 1GB8A 1SSYA 2Z14A 1LB1A 1GF5A 2R0DA 4ARPA 3HT9A 1AWEA 3HWLA 2ADZA 4MY6A 5I4WA 5LVJA 1OVHA 2H9KA 2YRYA 1L98A 5LIOA 2DQCY 1LGXA 1NMMA 1LZGA 3WULA 1LYDA 4WLYA 3M18B 1BHZA 3HU9A 1MPHA 5C6RA 4NGVA 2DQDY 3TXFA 1AT5A 1SHCA 1N4FA 2MEEA 4YEMA 1P6SA 1GF3A 2OTZX 5K7OA 1L47A 1V7SA 4WG7A 5JLJB 4PNKA 4TWSA 1WVVA 5FCPA 3CXBB 5LAFA 1UNRA 4M4OA 5DN4A 3KRWA 3DN4A 5LONB 4CSQA 2J0KA 1LKSA 1LYJA 4W59A 4G4CA 156LA 2OU9A 3LYOA 1D0MA 130LA 1L32A 2BQHA 2IFFY 1IX0A 3P7ZA 206LA 5FEKA 1D6PA 2YVCA 1ZVHL 2Y8FA 1GE4A 2EMSA 1XX0A 2COAA 2L1CA 1JPOA 5C79A 3OE9A 2HU1A 1UNQA 1C66A 2L78A 1CKHA 1IP3A 1C7PA 192LA 4Z3MA 2GUMA 3NWDA 1LZYA 3HH6A 248LA 1PQKA 1QTEA 1D3MA 1G0JA 8LYZA 1L51A 181LA 4B1AA 1YAOA 4TX7A 2FBDA 256LA 3LZTA 1SQ2L 1I56A 2MEHA 182LA 109LA 1UIHA 5HMJA 1L0JA 258LA 3HBHA 1L21A 1KZGA 3C82A 1LPIA 4EKRA 1C67A 1DDMA 4EMNA 1C6QA 3IVFA 3DXEA 1BWIA 4LYTA 4BADA 1ISNA 1D3FA 4A5KA 3A3RX 3C7YA 1LZAA 4GLAA 5L81A 1LZDA 1LSEA 1B7QA 1T77A 1L26A 1SLYA 4X3BA 1GB9A 3WL2A 212LA 1TEWA 1K5GB 1FBIX 1XEPA 4W54A 198LA 1DYEA 4RW2A 4H9HA 1DBHA 5KCVA 1LZ9A 3FADA 234LA 5JHHA 1CJ6A 1HEOA 2E2XA 1QT3A 3GYPA 1F6SA 2OEAX 2F4AA 3WU9A 1L29A 5LVHA 3WU7A 2YBLA 4W56A 5HE0A 4WM6A 1L69A 4LFPA 4DIXA 3A90A 1L90A 4EKSA 1IWWA 1GE1A 219LA 4IAPA 5LZMA 4K5YA 2B6YA 4ARMB 4WL7A 1L59A 3DMXA 1RI8B 1L57A 1U2BA 2HUBA 4GMXB 2FYCA 2HUKA 4NFVA 2Y8PA 2MEDA 3CDOA 3SN6R 1TLAA 1P6YA 2B7XA 3A8QA 1JTMA 1LZSA 4HAYB 1CV6A 3NY9A 1L50A 3WUNA 1Q67A 1GDXA 1C68A 1GF6A 2LOXA 2NWDX 1B9OA 3DNAA 5KXNA 3TXIA 4NSIA 1U5GA 2OE9X 4P2EA 3G9WA 3LZMA 1BB4A 4DQJA 1L41A 1CUQA 1LZTA 1L46A 1WVUA 1JEFA 240LA 1UPRA 4I8SA 2RAZX 4K81A 5C6LA 1GAZA 1UCOA 1GFRA 236LA 191LA 4HSIA 1NWGA 4ZIXA 1TJ6A 4LYCA 1UIGA 1J1XY 1IRSA 2VB1A 186LA 3V2WA 1QTKA 1L49A 2HE7A 1DXJA 125LA 2B73A 3TXHA 5KKJA 1LCNA 1PLSA 2LKOA 3FVCA 3GUJA 3HDFA 1GB7A 4DQ5A 1CKGA 1CU3A 2EC1A 1LMQA 1LSBA 2FJLA 4ARQA 1C69A 1QT4A 3UZTA 146LA 2MECA 1LZ5A 1YIKA 1P5TA 4K2PA 4NHSA 5KXLA 1AQCA 4HATB 1WVHA 4H94A 2RLOA 1D0LA 1CU0A 5APCA 1L44A 1L79A 4II8A 2RB0X 2CY4A 4A6FA 1J1OY 2CRFA 4I0CA 1MIZB 4NEBA 5KY1A 2G35A 1LSDA 1XJUA 1HEMA 1GFKA 5KXZA 1LOZA 227LA 1DDVA 2ZNWY 3LHMA 2F30A 3KAMA 200LA 1GG3A 2D9WA 4IATA 1NF5A 2Z2EA 3FSSA 1LGUA 5I14A 1REXA 1IWZA 3QWMA 1H6MA 2ZYPA 4OOOA 5B59A 1DYCA 1CJ8A 4XJDA 2LULA 1IC5Y 1XODA 5B07A 1PQMA 1OWYA 3W6BA 1FAOA 1D2WA 5KKIA 3CSRA 1CV1A 4C3WA 4OWEA 2ANXA 3PDSA 1G0PA 247LA 5ILCA 2K2JA 1ZVYB 131LA 3A3QA 3F0WA 3OJPA 2RB1X 5LVIA 165LA 1OQNA 139LA 1BB5A 4GRVA 4ETCA 3ATNA 1LHLA 1Z55A 1EL1A 1IY4A 1UACY 3ODUA 3C8SA 1ZYIA 1HFYA 5KXYA 114LA 3AU4A 3FI5A 4KHAA 1GB0A 2YSSC 3DN3A 2YT0A 1LJ3A 1B5VA 2Z19A 3E3DA 1TAYA 2B70A 4ZRKA 1L13A 1J0WA 4Z2MB 1D3NA 4CGEA 2IGCA 254LA 170LA 4NHIA 4GPTB 3NSUA 4OWBA 1HERA 197LA 1NKHA 3D8FA 2BQIA 1UIDA 1LHJA 1QUSA 3W6DA 3AGIA 1GDWA 1C6GA 3B0KA 1HC0A 1M7EA 1LYIA 4GZUA 1GBWA 5LYTA 5HE3A 1L74A 2DA0A 1L94A 4FDYA 5DIFB 4ET8A 1QS9A 3SBAA 1L81A 4H8ZA 5I2MA 221LA 4KAXB 2BQFA 1DYFA 4WL6A 253LA 2D9VA 2XBSA 232LA 1L62A 1QTHA 3EBAB 1GWDA 4PHIA 1MKEA 1B5UA 1TXDA 251LA 1YL1X 2BQGA 2OE7X 3TXGA 3FE0A 4L1RA 1YROA 1QUDA 4H93A 5A3ZA 3ULCA 5E9RA 4B4IA 4NG8A 1XSFA 1IP6A 3ULRA 3HTBA 5D3YA 2D4QA 2N23A 1U5DA 4BBKA 2W2WA 1L42A 1W1DA 2YT1A 1KY1A 3AGHA 2MEIA 2GS0A 2MEFA 2MWNB 2P0FA 3PEGA 3CB7A 1CV3A 4NGIA 3WVXA 2I6ZA 1Y5OA 5DL9A 3AJNA 1L55A 2BLXA 1L61A 3WXUA 104LA 3B0IA 1X05A 1ZMYL 1QUGA 4OW1A 1HEQA 4QJ4B 2MEGA 1L96A 1X1GA 188LA 4DD7A 1F0WA 2RH1A 4RLMA 1QT7A 2CAYA 1L66A 2I5FA 1BB7A 1AZFA 2ZQ4A 3W6FA 1IY3A 1JSFA 249LA 3SNHA 5KQ4A 2Q9EA 1GB3A 3FM8C 2RBQA 3AW6A 1BWNA 1KY0A 3ML4A 1CKCA 1OUGA 1KXXA 2KGXB 5JP4A 257LA 2G4QA 6LYZA 1L19A 3CDQA 3PSCA 3N7CA 4W53A 4HB3B 1PFJA 4I7OA 1L20A 1UA6Y 1L92A 1DI5A 2BPUA 1XR0B 5D3WA 195LA 4DD1A 1L15A 3A67Y 1QSBA 5LYZA 1REYA 2Z59A 1XGPC 2DQAA 1G07A 1LHMA 1GF4A 3SYXA 4AXTA 3GUIA 1L25A 1LJGA 3C80A 2O4WA 4J0LA 1P3RA 1KW5A 1LGWA 1L58A 2DFKA 2DN6A 2K49A 5GOWB 4NG1A 1OV7A 2FYDA 3SB7A 1QDTA 2F4GA 1KNIA 1QUTA 4PPOA 1L11A 4OWCA 1L73A 4NGLA 3LZ2A 1IEEA 1L18A 2LC9A 2OE4X 149LA 3K3TA 1XJTA 178LA 4H8SA 1LPYA 1LYZA 3A91A 6LYTA 176LA 2IYBA 3PP2A 4WMGA 194LA 2P8VA 112LA 5B1FA 1JKDA 3W6AA 1GF7A 4O34A 3ZDTA 2KCJA 1W1HA 2DKVA 3HUQA 5HE1A 1L56A 5FI0A 4HJZA 1LYHA 3HBEX 1P2RA 1GFAA 127LA 1L99A 1HENA 4NGYA 4LT2A 1V61A 1LMOA 2A4TA 3FI7A 1LZ4A 1XCGA 2ZILA 4B4EA 1FHXA 2W2XC 1L05A 1WGQA 228LA 1IOTA 1BWJA 1KS3A 2RVBB 1DKKA 2C8OA 4DDBA 1L01A 4NGWA 1XGUC 5J3QA 1SX2A 1XGRC 5APEA 5LAGA 2CGIA 1L65A 2BQKA 2Q9DA 4I7SA 1GXV2 241LA 4OT1A 4LYMA 3G3WA 5KXSA 4YEOA 1G1WA 4DD3A 3P65A 4D9ZA 4WSFA 4UWVA 1LJFA 4N0JA 5FELA 2COFA 1PS5A 1NQIA 1L39A 3SV1A 4WM3A 3C81A 2Z0QA 246LA 4HP0A 2Q0MX 4YM8A 2B6WA 1QT8A 122LA 2XQOA 4HJVA 2DHJA 3A58A 1WG7A 4OWHA 3P68A 1GC6A 1C6HA 4LFXA 1SX7A 2H9JA 4LDLA 2EMTA 1L84A 3HSAA 2LZMA 2D4KA 2QKLA 1B7RA 1G0KA 145LA 3HIEA 4G49A 4DC4A 1LJHA 3HH5A 1UUZC 3DKEX 4HB0B 4QJ5B 1QSWA 3B0OA 1NDGC 1ZSQA 1LYFA 213LA 1LMAA 1LZEA 4N9RA 2F2QA 1IOQA 1RFPA 5F14A 2B6XA 1JJ0A 1CTWA 4HAVB 4KHBB 1VFBC 1G0QA 2HEDA 5M4YB 2OTYX 138LA 4B6HA 244LA 1L37A 1BVKC 1G0MA 1V5MA 1T8GA 2YS3A 1V88A 4LDOA 2GCJA 2BCJA 1HFZA 1T8AA 3AZ7A 2HEEA 1QTDA 2W1MA 3T06A 1L67A 2X18A 163LA 3SB9A 4YXCA 1C46A 243LA 3EMSA 3O96A 1GBOA 2W1LA 4ZFPA 1L0KA 4GLVA 1L72A 4NWHA 1M7RA 2LYOA 4Z2NA 4HAZB 3PVWA 1EQEA 3C8RA 1G0GA 4R6CA 1DQJC 239LA 2RUKB 3V5WA 2LOZA 2K2UA 1JTNA 1KIQC 4YOPA 141LA 2RBRA 201LA 5D3VA 103LA 171LA 3GUMA 4DT3A 4W58A 4XJFA 1JJ3A 2D9XA 3HK0A 3C7ZA 3CT1A 1WQQA 4XN6A 5KXWA 3MPXA 196LA 1LHIA 164LA 3WU8A 4GN1A 1RRPB 5KXXA 1FOEA 4A6KA 2W1YA 4KPMA 3PZDA 1IP2A 1VAUA 3A8ZA 1D9UA 1LZBA 3P66A 3W3EA 3RW8A 3SB8A 185LA 169LA 5C6IA 1L12A 3DCXA 207LA 1BVXA 1D6QA 2Y8GA 4WM1A 2F32A 3HUKA 1LWGA 4IASA 4XJIA 1BB3A 1OUBA 1WJ1A 4WJ7A 5J3YA 1LTMA 3G3XA 1XKEA 2MDXA 4M6DA 1LAAA 1JWRA 1L97A 4K17A 3CSZA 4HAXB 1OUAA 4ANRA 4D6WA 1IOSA 4W51A 223LA 2HULA 1C6KA 3M1IB 1H87A 1JISA 2XBRA 3BKHA 1L93A 3B6LA 1C62A 3TMXA 2COCA 2LYZA 4H9AA 3CT5A 2NZ8B 4EJNA 5I4YA 215LA 3WVYA 2Z4DA 1IO5A 1L43A 1BTNA 4XJGA 4OOTA 245LA 3F9LA 1RJCB 5D3XA 4DBBA 233LA 2N5ZA 216LA 3WPKA 1I20A 2ZQ3A 1L34A 4EXMA 4XENA 1GE3A 5T3FA 1L23A 1V89A 5KXTA 3TMVA 4NIJA 3A96A 5FHWA 1FGZA 1CX7A 214LA 4LT3A 1HNLA 7LYZA 3GUPA 3GYOA 3GXRA 1KI1B 1QTCA 4NWEA 1V5UA 2B6TA 3M3UA 199LA 155LA 1OV5A 184LA 3PG7A 1L03A 4R0FA 3ZVQA 1IWYA 3RZ4A 2GV0A 4OWAA 1LJIA 3U7DA 4J1AA 3IJUA 1WQPA 1L60A 3WMKA 1IVMA 3RU5A 2ZPYA 4G4HA 4WLXA 1YILA 5IHGA 3AB6A 4K2OA 148LE 1BGIA 218LA 159LA 3NWFA 1OVKA 4RLNA 4HSFA 1V5PA 2A7DA 4WG1A 4J1BA 1LJEA 3TMUA 3W6EA 4Z46A 1PZYA 1C08C 4ARLA 2WARA 3HTGA 237LA 1HSWA 1C63A 1GFJA 1LZCA 4Z41A 2ZIJA 4MCKA 3A98B 1PMSA 1L71A 5JHGA 3QIJA 4LDEA 4DD0A 2RBNA 217LA 2LYMA 3F8VA 5EBHA 4WLDA 5KXMA 5HNCA 1L68A 1C6LA 2ELBA 2RSCA 1NHBA 226LA 4TYZA 2Z39A 1LMPA 180LA 2D4IA 2XJWA 137LA 4HV2A 177LA 4H91A 1C6FA 1G7JC 2CJLA 3ULBA 2GJYA 2BAAA 1LJJA 2H5ZA 3D4SA 3AZ6A 250LA 3LYMA 4ML7A 3HT6A 4Y94A 2FJUB 154LA 1L76A 1BAKA 1PQIA 1L53A 1DKJA 4EPFA 2K00A 2NTGA 2Z0PA 2NBVA 3L2XA 4H8XA 1DROA 4AQNA 4TTDA 4NGOA 3ODXA 1U27A 3TXJA 1GBYA 4G9SA 3VW7A 1VDQA 4W55A 3C7WA 4MR1A 4XJHA 4PJZA 1W08A 4L41A 3A95A 5F9UA 1FLYA 3OHMB 5LINA 2XQNM 2I26L 2N0YA 1IWTA 259LA 3DMZA 4LT1A 5D5CA 2CODA 128LA 3F6ZA 2RBSA 172LA 2B74A 3T6UA 1JIYA 3AJ4A 1WQMA 1IP4A 1I2HA 1GB6A 1L33A 4ZEEA 3OE6A 4P7IA 1XGTC 2PC2A 2W2XD 2YBJA 1O23A 1CX6A 5KXKA 5L3IA 1G7LC 3VWOA 4E3UA 1C6CA 5KXOA 1OUCA 1GFGA 1YANA 1C6TA 4HPEA 3J4GA 4ARQB 5HLLA 1LSCA 3AYQA 1EAZA 3HBDA 2M38A 3LYTA 4Z98A 2HUMA 1L70A 3SP3A 4N5RA 1B5ZA 4BS7A 150LA 4B49A 1C6DA 2D10A 1GF0A 3QNGA 2HTHB 108LA 3TFMA 205LA 2OU0X 3K2RA 5LA5A 1OUDA 1QS5A 1VATA 2RRFA 1L89A 2Z18A 4A6FB 5C16A 4GNKB 1B7PA 1UIEA 2PZ1A 1LJNA 1T8FA 1L52A 1GFHA 119LA 1GBSA 1L04A 1RJ2A 1P56A 1RCMA 1FHWA 1TBYA 1AM7A 1OP9B 2I5CA 4EMOA 1IC7Y 1IR7A 1YKYX 5LOPB 4NHQA 3GXKA 2RB2X 1NU2A 1GF9A 4DD2A 4NY0A 4EKUA 1GEZA 143LA 1JUGA 166LA 2EKSC 4TUNA 4U3XB 1UEFA 2D11A 4DJHA 1GHLA 3WUMA 2HEBA 1LW9A 1C65A 1LI2A 2DHIA 1OY2A 5CLQB 2B5ZA 4GCBA 1DI4A 1P64A 4NY5A 1MELL 5IELA 1QTBA 5A3EA 3DN1A 1LSGA 4PJ2C 2LYDA 4H9FA 1UIAA 4CFPA 2ZIKA 4RW1A 2R2YA 2VRWB 3HTDA 4MSTA 4LZTA 1AT6A 1CNSA 1X86A 4GMVA 4NGJA 1MK7B 3TXDA 2A7FA 1C6NA 2BQEA 3BINA 4CHJA 211LA 1DYDA 2BQOA 1L40A 2D6BA 2F2NA 3U8ZA 1N3HA 1XEJA 2VSZA 1EVHA 4I7PA 4YXAC 1OQMA 1JITA 1CV0A 1B7NA 3HQCA 1L83A 5DI9B 4I7NA 5I5QA 3ATOA 2R09A 4H9EA 1JSEA 3JR6A 3SO6A 2KUQA 1FDLY 4YF2A 5ILFA 5JENB 4KT3A 2ELAA 129LA 4I7RA 2XTHA 4ETDA 1NBYC 1C6EA 3PVLA 1LZRA 1QTZA 1NDMC 3TXBA 4WM5A 4ETEA 2ZWBA 3MDBC 4LGKA 4PQ0A 1L08A 2RNRB 4LT0A 1XEKA 1QC6A 4IFSA 5C5BA 3KRXA 2M14A 4HHVA 2I1KA 1ZM0A 4N1CC 160LA 3TVVA 3D9AC 3KSYA 1L30A 4NHTA 3PBLA 1UNPA 3B77A 1QDRA 1DZBX 1ZYTA 3AW7A 4YL8A 1PQOA 1CU5A 1J19A 3RZEA 1UIFA 4XADA 1CJ7A 4DX8A 3IJVA 1L87A 3TCAA 1FLUA 2EIZC 4UWNA 4WLTA 1GE2A 1GAYA 4L6EA 1GFEA 1B2KA 1YQVY 1OVJA 1VEDA 4GN3A 1UC0A 3TXEA 4B0DA 2L2IA 1L63A 3CDVA 3N9EA 1L86A 4KVGB 4EKPA 4LYOA 4HAWB 2CY5A 3DXDA 5FDJA 3G3VA 4NSGA 1C6AA 1C64A 1X1FA 1C43A 4D0NB 1OMWA 1G06A 1QSAA 4WO9A 2VKIA 3HT7A 4GOUA 1ALCA 1REZA 4H90A 1LZ6A 4S0WA 1KZ7A 1DPWA 1L00A 5DN5A 5B06A 230LA 2BQLA 1B0DA 2JP2A 1U29A 3KY9A 2ZYCA 1CU6A 4HAUB 4LYZA 183LA 1KW7A 4A7DA 1L02A 5LVGA 7LZMA 3A6BY 1LSNA 1B7MA 1LHKA 5LA8A 3NYAA 1XEIA 1C45A 6LZMA 1LYSA 1L16A 1LMNA 2OQBA 3OE8A 4HB4B 2YSZA 1UPQA 4XWXA 2DKQA 3W6CA 3AGGG 1IR9A 4HDOA 1ZWNA 1IP1A 1Z87A 5J7CA 4W57A 2FBBA 3HH3A 242LA 2ZKMX 1FB8A 2Z38A 2UVMA 5DHFB 2J0MA 5C5BB 1INUA 3DN8A 1LHHA 1MI1A 1FGYA 3HH4A 225LA 3MGWA 1JHLA 1LYEA 3HUAA 3TXKA 2RBOA 1C10A 4OO9A 1P5CA 1D0KA 1CJ9A 2F47A 3WA0A 167LA 5D27A 5KQ1A 4H9BA 4C0AA 115LA 4YX7C 1GC7A 1NHEA 5FSTA 1E8LA 2RGNB 2YDGA 1QUOA 3OE0A 3HW2B 3F5RA 1B5YA 5DM9A 4E97A 140LA 3A94A 1AKIA 1LZNA 1DI3A 2YS1A 1JTPL 3NY8A 1YKZX 4B4JA 4HTKA 2RBPA 2YBMA 4ARMA 4WVFB 5F9XA 4W52A 1L09A 1GB5A 1HFXA 4ETAA 3TW1A 1NTVA 1C6PA 1IIZA 1D3JA 1IR8A 3GUNA 1U5FA 2MEAA 3DN6A 4ARJA 4BAPA 3ODWA 4N8ZA 2YBNA 3IWRA 5I54A 118LA 1UICA 1I7AA 3VIAA 5DHAB 4QXAB 1C6BA 4J7VA 2KIEA 5HMVA 4IOYX 102LA 1IP7A 1WTNA 1JKCA 2D4JA 1CKDA 2BQNA 3WYFB 2HEFA 2EQLA 1G7IC 187LA 1L91A 1G0LA 4H8YA 3CSQA 1G7HC 5LXWA 3X23A 4AGAA 1WGUA 1WQOA 3OK0A 1LMTA 1WTMA 2B6ZA 1U5EA 4NSHA 126LA 2C8PA 1QUHA 3QE8A 1J1PY 3DXCA 175LA 1TDYA 1MK9B 4F7GA 189LA 3U12A 4GCEA 1L48A 1L17A 4TKNA 1G7MC 1LSMA 4WO6A 190LA 1QT6A 5KXPA 4ET9A 2G4NA 2B72A 2OU8A 4F7UP 1H10A 1GE0A 1H4RA 4GXBA 1DYNA 1XD4A 4LZMA 1B55A 3KZ1A 1BWHA 5HE2A 255LA 4I7MA 4GCFA 2DQJY 4I7TA 4PGJB 222LA 261LA 238LA 2DQHY 1CKFA 3CDTA 113LA 2QARC 153LA 1CVKA 2HEAA 5CLLB 1B7OA 5L9JA 1KIPC 4KHOA 1QQGA 2Z2FA 1OUHA 1GPQC 1DYAA 4UWUA 4H9CA 5KXRA 4IJ4A 4GCCA 168LA 2ANVA 1KXWA 1L54A 134LA 3V2YA 2CDSA 1K5DB 1FLQA 1QIOA 3HDEA 2NTHA 1GBXA 1T6HA 1KIRC 3RT5X 1L35A 2O79A 2Z12A 3WXTA 1P3NA 4KXIA 5F16A 1EPYA 1JTOL 2DTCA 3N9CA 3FA0A 2P0HA 1T6VL 3WPLA 5I2SA 4PRQA
chains in the Genus database with same CATH topology
4QDNA 3N9AA 2MFQA 1B6IA 3G3AB 5DLAA 4EKQA 3GUOA 4HJYA 4QY9A 1P37A 1PQJA 1YAPA 4PRUA 1BQLY 1B5WA 5I53A 1B5XA 1GXXA 1YAMA 1BTKA 1TQZA 1C60A 3HU8A 4CHXA 4C5FA 3PVUA 5J3TA 4ZRIA 4TSBA 142LA 3LN2A 4CFOA 1IWUA 4WM4A 4DDCA 1ZC3B 1C6IA 1L31A 1DPXA 2ROZB 1F6RA 1L45A 2X0AA 2BQBA 2Y7BA 1GFUA 2DQEY 4MT7A 3B72A 3A92A 2Z37A 3DMVA 4GN5C 4HTNA 1HEPA 1IOCA 4EJ4A 229LA 1GF8A 132LA 3AZ5A 1HELA 1L80A 1QSQA 1HEWA 2HTXA 3QAKA 3ZVRA 5L3HA 3HFMY 9LYZA 1RE2A 4EOFA 2AEHA 1ZC4B 1YAQA 2DYNA 1BB6A 1I6SA 2HECA 1MIXA 4I7KA 1L82A 1LSPA 2BQMA 1OUFA 5HQ1A 1UIBA 1T97A 4LYBA 3TO1A 1W6ZA 2DX5A 2O7AA 4DKLA 2J0JA 1L22A 5B1GA 4ZPUA 1LW3A 1P46A 161LA 3SB6A 2CWIA 1IC4Y 1WQRA 3QBVB 1G1VA 4YENA 2DHKA 2D9ZA 1JTTL 2LCBA 208LA 1SWZA 2BQDA 3P4ZA 1L10A 1HF4A 4FJRA 111LA 1P36A 3D3DA 4HDQA 173LA 1IWXA 3CT0A 5D5FA 5AMYA 3ZVQB 1V7TA 2QB0B 2OTXA 1SSWA 3A6CY 1WJMA 1X11A 3RUNA 1HHLA 252LA 147LA 2V76A 1ZVRA 1D9WA 1EQ4A 4ZRJA 158LA 1FN5A 1CV5A 1GEVA 1VDPA 2LZ2A 107LA 4DDAA 162LA 2DKPA 3QY4A 1NTYA 3D8DA 1FLWA 2QKMA 1CUPA 1L38A 1LI3A 1HMLA 4G4BA 4PK0A 2BQCA 1LZ1A 1WQNA 4CYEA 1FKQA 5E4PA 2H7EA 1NBZC 2I1JA 4W96A 4H1PA 2YBIA 1A4VA 1GB2A 1LSFA 3RNXA 3WW5A 4H9IA 1P2CC 1LJKA 2IFSA 3G3BB 110LA 1XGQC 1TCYA 209LA 3UONA 4XYYA 4TSCA 1HMKA 2Z0OA 3ODOA 5LYMA 3SUZA 1JKAA 1LWKA 3DN2A 1L95A 1LMCA 4W94A 2ZNXY 4GBRB 5II3A 4QGZA 1QQYA 1GBZA 4QEQA 133LA 4WOAA 1LSZA 2LHMA 4GN4A 2D2QA 3WH1A 2LZTA 2J59M 2BLYA 4I7QA 1OUJA 1UBZA 5C6JA 2YBHA 1E5WA 1C6MA 4CHMA 3EMLA 4DQ7A 4N1EI 4RDSA 2DX1A 1JJ1A 4EPIA 3VOQA 1LJ4A 2NMBA 5FI1A 2AUBA 1LZ8A 135LA 1NI2A 123LA 1L75A 1JKBA 2CUUA 2KUPA 1OWZA 193LA 3L64A 1IWVA 235LA 1B7LA 1OYUA 3WYHA 1MAIA 1LLHA 5APDA 2MKRA 3A34A 1F10A 4DAJA 1W1GA 4DD9A 2MEBA 4I7LA 1ZURA 4DYGA 5APFA 1CU2A 260LA 4I7JA 3GUKA 2DYQA 2HU3A 1GFTA 2YF0A 1L14A 2GCLA 1K28A 2EJ8A 1OUEA 1VDTA 1L07A 1IP5A 3WW6A 5B05A 4DX90 151LA 1GFVA 1VDSA 1ZV5L 2G4PA 231LA 4A6HA 1QTVA 3C83A 2DQFC 2EPEA 3TMWA 1L64A 3AZ4A 3CDRA 1WTHA 1EQ5A 3A93A 5EFXA 3LYZA 3HTFA 4HPIA 1LSYA 2DQGY 1YL0X 2YVBA 4NGKA 3ZEKA 1C6JA 3P6AA 4CJ2A 2UZRA 1HSXA 3HT8A 2DQIY 2RAYX 174LA 2UZSA 1GD6A 1XFPL 3DN0A 1L06A 3D8EA 157LA 4KL7A 1LYGA 1OUIA 3SB5A 1FHOA 4DWXA 1LYYA 220LA 2W1XA 3RCPA 2D91A 3SBBC 4H92A 1CV4A 1LKRA 2BQAA 4HTQA 4BAFA 3GULA 1L88A 2I25L 2P0DA 3BJIA 1LSAA 5KJ9A 3T36A 2AL6A 2D9YA 4NSWA 5DH9B 1I1ZA 1YKXX 1Y19B 4ETBA 1KXYA 3BKVA 2BQJA 1A2YC 1PQDA 1IORA 1L36A 4NGZA 144LA 2ROVA 5LVKA 120LA 1WI1A 1D2YA 2H7DA 3A8PA 3LJUX 1DDWA 3P64A 4DXAB 4HV1A 1FKVA 4MK0A 3C8QA 1DYBA 2DBTA 3CIKA 1EGXA 1L85A 4GCDA 1L27A 4WM2A 2Z6BA 3J6KA 1L77A 4XJBA 1B7SA 1P2LA 1REMA 4HB2B 1L24A 1MLCE 5IDDA 5F81A 4NSJA 5HNLA 2IHLA 1QT5A 224LA 5M1YA 1C61A 1L28A 1LI6A 1JQUA 3EO5A 2Q13A 152LA 262LA 3CQLA 3WPJA 2RSGA 1SWYA 3AU5A 4YONA 2B75A 3WUAA 1SGHA 2LG1A 2DLWA 3FEHA 210LA 1EF1A 1DYGA 1LYOA 2YS5A 1T3PA 3EXDA 3OANA 4F7HA 1P7SA 4NHPA 5I4XA 1GB8A 1SSYA 1LB1A 1GF5A 2R0DA 4ARPA 3HT9A 1AWEA 3HWLA 2ADZA 4MY6A 5I4WA 5LVJA 1OVHA 2H9KA 2YRYA 1L98A 5LIOA 2DQCY 1LGXA 1NMMA 1LZGA 3WULA 1LYDA 4WLYA 3M18B 1BHZA 3HU9A 1MPHA 5C6RA 4NGVA 2DQDY 3TXFA 1AT5A 1SHCA 1N4FA 2MEEA 4YEMA 1P6SA 1GF3A 2OTZX 5K7OA 1L47A 1V7SA 4WG7A 5JLJB 4PNKA 4TWSA 1WVVA 5FCPA 3CXBB 5LAFA 1UNRA 4M4OA 5DN4A 3KRWA 3DN4A 5LONB 2J0KA 1LKSA 1LYJA 4W59A 4G4CA 156LA 2OU9A 3LYOA 1D0MA 130LA 1L32A 2BQHA 2IFFY 1IX0A 3P7ZA 206LA 5FEKA 1D6PA 2YVCA 1ZVHL 2Y8FA 1GE4A 2EMSA 1XX0A 2COAA 2L1CA 1JPOA 5C79A 3OE9A 2HU1A 1UNQA 1C66A 2L78A 1CKHA 1IP3A 1C7PA 192LA 4Z3MA 1LZYA 3HH6A 248LA 1PQKA 1QTEA 1D3MA 1G0JA 8LYZA 1L51A 181LA 4B1AA 1YAOA 4TX7A 2FBDA 256LA 3LZTA 1SQ2L 1I56A 2MEHA 182LA 109LA 1UIHA 5HMJA 1L0JA 258LA 3HBHA 1L21A 1KZGA 3C82A 1LPIA 4EKRA 1C67A 1DDMA 4EMNA 1C6QA 3IVFA 3DXEA 1BWIA 4LYTA 4BADA 1ISNA 1D3FA 4A5KA 3A3RX 3C7YA 1LZAA 4GLAA 5L81A 1LZDA 1LSEA 1B7QA 1L26A 1SLYA 4X3BA 1GB9A 3WL2A 212LA 1TEWA 1K5GB 1FBIX 1XEPA 4W54A 198LA 1DYEA 4RW2A 4H9HA 1DBHA 5KCVA 1LZ9A 3FADA 234LA 5JHHA 1CJ6A 1HEOA 2E2XA 1QT3A 3GYPA 1F6SA 2OEAX 2F4AA 3WU9A 1L29A 5LVHA 3WU7A 2YBLA 4W56A 5HE0A 4WM6A 1L69A 4LFPA 3A90A 1L90A 4EKSA 1IWWA 1GE1A 219LA 4IAPA 5LZMA 4K5YA 2B6YA 4ARMB 4WL7A 1L59A 3DMXA 1RI8B 1L57A 1U2BA 2HUBA 4GMXB 2FYCA 2HUKA 4NFVA 2Y8PA 2MEDA 3CDOA 3SN6R 1TLAA 1P6YA 2B7XA 3A8QA 1JTMA 1LZSA 4HAYB 1CV6A 3NY9A 1L50A 3WUNA 1Q67A 1GDXA 1C68A 1GF6A 2LOXA 2NWDX 1B9OA 3DNAA 5KXNA 3TXIA 4NSIA 1U5GA 2OE9X 4P2EA 3G9WA 3LZMA 1BB4A 4DQJA 1L41A 1CUQA 1LZTA 1L46A 1WVUA 1JEFA 240LA 1UPRA 4I8SA 2RAZX 4K81A 5C6LA 1GAZA 1UCOA 1GFRA 236LA 191LA 1NWGA 4ZIXA 1TJ6A 4LYCA 1UIGA 1J1XY 1IRSA 2VB1A 186LA 3V2WA 1QTKA 1L49A 2HE7A 1DXJA 125LA 2B73A 3TXHA 5KKJA 1LCNA 1PLSA 2LKOA 3GUJA 3HDFA 1GB7A 4DQ5A 1CKGA 1CU3A 2EC1A 1LMQA 1LSBA 2FJLA 4ARQA 1C69A 1QT4A 3UZTA 146LA 2MECA 1LZ5A 1YIKA 1P5TA 4K2PA 4NHSA 5KXLA 1AQCA 4HATB 1WVHA 4H94A 2RLOA 1D0LA 1CU0A 5APCA 1L44A 1L79A 4II8A 2RB0X 2CY4A 4A6FA 1J1OY 2CRFA 4I0CA 1MIZB 4NEBA 5KY1A 2G35A 1LSDA 1XJUA 1HEMA 1GFKA 5KXZA 1LOZA 227LA 1DDVA 2ZNWY 3LHMA 2F30A 3KAMA 200LA 1GG3A 2D9WA 4IATA 1NF5A 2Z2EA 3FSSA 1LGUA 5I14A 1REXA 1IWZA 3QWMA 1H6MA 2ZYPA 4OOOA 5B59A 1DYCA 1CJ8A 4XJDA 2LULA 1IC5Y 1XODA 5B07A 1PQMA 1OWYA 3W6BA 1FAOA 1D2WA 5KKIA 3CSRA 1CV1A 4C3WA 4OWEA 2ANXA 3PDSA 1G0PA 247LA 5ILCA 2K2JA 1ZVYB 131LA 3A3QA 3F0WA 3OJPA 2RB1X 5LVIA 165LA 1OQNA 139LA 1BB5A 4GRVA 4ETCA 3ATNA 1LHLA 1Z55A 1EL1A 1IY4A 1UACY 3ODUA 3C8SA 1HFYA 5KXYA 114LA 3AU4A 3FI5A 4KHAA 1GB0A 2YSSC 3DN3A 2YT0A 1LJ3A 1B5VA 2Z19A 3E3DA 1TAYA 2B70A 4ZRKA 1L13A 1J0WA 4Z2MB 1D3NA 4CGEA 2IGCA 254LA 170LA 4NHIA 4GPTB 3NSUA 4OWBA 1HERA 197LA 1NKHA 3D8FA 2BQIA 1UIDA 1LHJA 1QUSA 3W6DA 3AGIA 1GDWA 1C6GA 3B0KA 1HC0A 1M7EA 1LYIA 4GZUA 1GBWA 5LYTA 5HE3A 1L74A 2DA0A 1L94A 4FDYA 5DIFB 4ET8A 1QS9A 3SBAA 1L81A 4H8ZA 221LA 4KAXB 2BQFA 1DYFA 4WL6A 253LA 2D9VA 2XBSA 232LA 1L62A 1QTHA 3EBAB 1GWDA 4PHIA 1MKEA 1B5UA 1TXDA 251LA 1YL1X 2BQGA 2OE7X 3TXGA 3FE0A 1YROA 1QUDA 4H93A 5A3ZA 3ULCA 5E9RA 4B4IA 4NG8A 1XSFA 1IP6A 3ULRA 3HTBA 5D3YA 2D4QA 2N23A 1U5DA 4BBKA 2W2WA 1L42A 1W1DA 2YT1A 1KY1A 3AGHA 2MEIA 2GS0A 2MEFA 2MWNB 2P0FA 3PEGA 3CB7A 1CV3A 4NGIA 3WVXA 2I6ZA 1Y5OA 5DL9A 3AJNA 1L55A 2BLXA 1L61A 3WXUA 104LA 3B0IA 1X05A 1ZMYL 1QUGA 4OW1A 1HEQA 2MEGA 1L96A 1X1GA 188LA 4DD7A 1F0WA 2RH1A 4RLMA 1QT7A 2CAYA 1L66A 2I5FA 1BB7A 1AZFA 2ZQ4A 3W6FA 1IY3A 1JSFA 249LA 3SNHA 5KQ4A 2Q9EA 1GB3A 3FM8C 2RBQA 3AW6A 1BWNA 1KY0A 3ML4A 1CKCA 1OUGA 1KXXA 2KGXB 5JP4A 257LA 2G4QA 6LYZA 1L19A 3CDQA 3PSCA 3N7CA 4W53A 4HB3B 1PFJA 4I7OA 1L20A 1UA6Y 1L92A 1DI5A 2BPUA 1XR0B 5D3WA 195LA 4DD1A 1L15A 3A67Y 1QSBA 5LYZA 1REYA 1XGPC 2DQAA 1G07A 1LHMA 1GF4A 3SYXA 4AXTA 3GUIA 1L25A 1LJGA 3C80A 2O4WA 4J0LA 1P3RA 1KW5A 1LGWA 1L58A 2DFKA 2DN6A 5GOWB 4NG1A 1OV7A 2FYDA 3SB7A 1QDTA 2F4GA 1KNIA 1QUTA 4PPOA 1L11A 4OWCA 1L73A 4NGLA 3LZ2A 1IEEA 1L18A 2LC9A 2OE4X 149LA 3K3TA 1XJTA 178LA 4H8SA 1LPYA 1LYZA 3A91A 6LYTA 176LA 2IYBA 3PP2A 4WMGA 194LA 2P8VA 112LA 5B1FA 1JKDA 3W6AA 1GF7A 4O34A 3ZDTA 2KCJA 1W1HA 2DKVA 3HUQA 5HE1A 1L56A 5FI0A 4HJZA 1LYHA 3HBEX 1P2RA 1GFAA 127LA 1L99A 1HENA 4NGYA 4LT2A 1V61A 1LMOA 2A4TA 3FI7A 1LZ4A 1XCGA 2ZILA 4B4EA 1FHXA 2W2XC 1L05A 1WGQA 228LA 1IOTA 1BWJA 1KS3A 2RVBB 1DKKA 2C8OA 4DDBA 1L01A 4NGWA 1XGUC 5J3QA 1SX2A 1XGRC 5APEA 5LAGA 2CGIA 1L65A 2BQKA 2Q9DA 4I7SA 1GXV2 241LA 4LYMA 3G3WA 5KXSA 4YEOA 1G1WA 4DD3A 3P65A 4D9ZA 4WSFA 4UWVA 1LJFA 4N0JA 5FELA 2COFA 1PS5A 1NQIA 1L39A 3SV1A 4WM3A 3C81A 2Z0QA 246LA 4HP0A 2Q0MX 4YM8A 2B6WA 1QT8A 122LA 2XQOA 4HJVA 2DHJA 1WG7A 4OWHA 3P68A 1GC6A 1C6HA 4LFXA 1SX7A 2H9JA 4LDLA 2EMTA 1L84A 2LZMA 2D4KA 2QKLA 1B7RA 1G0KA 145LA 4G49A 4DC4A 1LJHA 3HH5A 1UUZC 3DKEX 4HB0B 1QSWA 3B0OA 1NDGC 1ZSQA 1LYFA 213LA 1LMAA 1LZEA 4N9RA 2F2QA 1IOQA 1RFPA 5F14A 2B6XA 1JJ0A 1CTWA 4HAVB 4KHBB 1VFBC 1G0QA 2HEDA 2OTYX 138LA 4B6HA 244LA 1L37A 1BVKC 1G0MA 1V5MA 1T8GA 2YS3A 1V88A 4LDOA 2GCJA 2BCJA 1HFZA 1T8AA 3AZ7A 2HEEA 1QTDA 2W1MA 3T06A 1L67A 2X18A 163LA 3SB9A 4YXCA 1C46A 243LA 3EMSA 3O96A 1GBOA 2W1LA 4ZFPA 1L0KA 4GLVA 1L72A 4NWHA 1M7RA 2LYOA 4Z2NA 4HAZB 3PVWA 1EQEA 3C8RA 1G0GA 4R6CA 1DQJC 239LA 2RUKB 3V5WA 2LOZA 2K2UA 1JTNA 1KIQC 4YOPA 141LA 2RBRA 201LA 5D3VA 103LA 171LA 3GUMA 4DT3A 4W58A 4XJFA 1JJ3A 2D9XA 3HK0A 3C7ZA 3CT1A 1WQQA 4XN6A 5KXWA 3MPXA 196LA 1LHIA 164LA 3WU8A 4GN1A 1RRPB 5KXXA 1FOEA 4A6KA 2W1YA 4KPMA 3PZDA 1IP2A 1VAUA 3A8ZA 1D9UA 1LZBA 3P66A 3W3EA 3RW8A 3SB8A 185LA 169LA 5C6IA 1L12A 207LA 1BVXA 1D6QA 2Y8GA 4WM1A 2F32A 3HUKA 1LWGA 4IASA 4XJIA 1BB3A 1OUBA 1WJ1A 4WJ7A 5J3YA 1LTMA 3G3XA 1XKEA 2MDXA 4M6DA 1LAAA 1JWRA 1L97A 4K17A 3CSZA 4HAXB 1OUAA 4ANRA 1IOSA 4W51A 223LA 2HULA 1C6KA 3M1IB 1H87A 1JISA 2XBRA 3BKHA 1L93A 3B6LA 1C62A 3TMXA 2COCA 2LYZA 4H9AA 3CT5A 2NZ8B 4EJNA 5I4YA 215LA 3WVYA 1IO5A 1L43A 1BTNA 4XJGA 4OOTA 245LA 3F9LA 1RJCB 5D3XA 4DBBA 233LA 2N5ZA 216LA 3WPKA 1I20A 2ZQ3A 1L34A 4EXMA 4XENA 1GE3A 5T3FA 1L23A 1V89A 5KXTA 3TMVA 4NIJA 3A96A 5FHWA 1FGZA 1CX7A 214LA 4LT3A 1HNLA 7LYZA 3GUPA 3GYOA 3GXRA 1KI1B 1QTCA 4NWEA 1V5UA 2B6TA 3M3UA 199LA 155LA 1OV5A 184LA 3PG7A 1L03A 4R0FA 3ZVQA 1IWYA 3RZ4A 2GV0A 4OWAA 1LJIA 3U7DA 4J1AA 3IJUA 1WQPA 1L60A 3WMKA 1IVMA 3RU5A 2ZPYA 4G4HA 4WLXA 1YILA 5IHGA 3AB6A 4K2OA 148LE 1BGIA 218LA 159LA 1OVKA 4RLNA 4HSFA 1V5PA 2A7DA 4WG1A 4J1BA 1LJEA 3TMUA 3W6EA 4Z46A 1PZYA 1C08C 4ARLA 2WARA 3HTGA 237LA 1HSWA 1C63A 1GFJA 1LZCA 4Z41A 2ZIJA 4MCKA 3A98B 1PMSA 1L71A 5JHGA 3QIJA 4LDEA 4DD0A 2RBNA 217LA 2LYMA 3F8VA 5EBHA 4WLDA 5KXMA 5HNCA 1L68A 1C6LA 2ELBA 2RSCA 1NHBA 226LA 4TYZA 2Z39A 1LMPA 180LA 2D4IA 2XJWA 137LA 4HV2A 177LA 4H91A 1C6FA 1G7JC 2CJLA 3ULBA 2GJYA 2BAAA 1LJJA 2H5ZA 3D4SA 3AZ6A 250LA 3LYMA 4ML7A 3HT6A 4Y94A 154LA 1L76A 1BAKA 1PQIA 1L53A 1DKJA 4EPFA 2K00A 2NTGA 2Z0PA 3L2XA 4H8XA 1DROA 4AQNA 4TTDA 4NGOA 3ODXA 1U27A 3TXJA 1GBYA 4G9SA 3VW7A 1VDQA 4W55A 3C7WA 4MR1A 4XJHA 4PJZA 1W08A 4L41A 3A95A 5F9UA 1FLYA 5LINA 2XQNM 2I26L 2N0YA 1IWTA 259LA 3DMZA 4LT1A 5D5CA 2CODA 128LA 3F6ZA 2RBSA 172LA 2B74A 3T6UA 1JIYA 3AJ4A 1WQMA 1IP4A 1I2HA 1GB6A 1L33A 4ZEEA 3OE6A 4P7IA 1XGTC 2PC2A 2W2XD 2YBJA 1O23A 1CX6A 5KXKA 5L3IA 1G7LC 3VWOA 4E3UA 1C6CA 5KXOA 1OUCA 1GFGA 1YANA 1C6TA 4HPEA 3J4GA 4ARQB 5HLLA 1LSCA 3AYQA 1EAZA 3HBDA 2M38A 3LYTA 4Z98A 2HUMA 1L70A 3SP3A 4N5RA 1B5ZA 4BS7A 150LA 4B49A 1C6DA 2D10A 1GF0A 3QNGA 2HTHB 108LA 3TFMA 205LA 2OU0X 3K2RA 5LA5A 1OUDA 1QS5A 1VATA 1L89A 2Z18A 4A6FB 5C16A 1B7PA 1UIEA 2PZ1A 1LJNA 1T8FA 1L52A 1GFHA 119LA 1GBSA 1L04A 1RJ2A 1P56A 1RCMA 1FHWA 1TBYA 1AM7A 1OP9B 2I5CA 4EMOA 1IC7Y 1IR7A 1YKYX 5LOPB 4NHQA 3GXKA 2RB2X 1NU2A 1GF9A 4DD2A 4NY0A 4EKUA 1GEZA 143LA 1JUGA 166LA 2EKSC 4TUNA 4U3XB 1UEFA 2D11A 4DJHA 1GHLA 3WUMA 2HEBA 1LW9A 1C65A 1LI2A 2DHIA 1OY2A 5CLQB 2B5ZA 4GCBA 1DI4A 1P64A 4NY5A 1MELL 5IELA 1QTBA 5A3EA 3DN1A 1LSGA 4PJ2C 2LYDA 4H9FA 1UIAA 4CFPA 2ZIKA 4RW1A 2VRWB 3HTDA 4MSTA 4LZTA 1AT6A 1CNSA 1X86A 4GMVA 4NGJA 1MK7B 3TXDA 2A7FA 1C6NA 2BQEA 3BINA 4CHJA 211LA 1DYDA 2BQOA 1L40A 2D6BA 2F2NA 3U8ZA 1N3HA 1XEJA 2VSZA 1EVHA 4I7PA 4YXAC 1OQMA 1JITA 1CV0A 1B7NA 3HQCA 1L83A 5DI9B 4I7NA 5I5QA 3ATOA 2R09A 4H9EA 1JSEA 3JR6A 3SO6A 1FDLY 4YF2A 5ILFA 5JENB 4KT3A 2ELAA 129LA 4I7RA 2XTHA 4ETDA 1NBYC 1C6EA 3PVLA 1LZRA 1QTZA 1NDMC 3TXBA 4WM5A 4ETEA 2ZWBA 3MDBC 4LGKA 4PQ0A 1L08A 2RNRB 4LT0A 1XEKA 1QC6A 4IFSA 5C5BA 3KRXA 2M14A 4HHVA 2I1KA 1ZM0A 4N1CC 160LA 3TVVA 3D9AC 3KSYA 1L30A 4NHTA 3PBLA 1UNPA 1QDRA 1DZBX 1ZYTA 3AW7A 4YL8A 1PQOA 1CU5A 1J19A 3RZEA 1UIFA 4XADA 1CJ7A 4DX8A 3IJVA 1L87A 3TCAA 1FLUA 2EIZC 4UWNA 4WLTA 1GE2A 1GAYA 4L6EA 1GFEA 1B2KA 1YQVY 1OVJA 1VEDA 4GN3A 1UC0A 3TXEA 4B0DA 2L2IA 1L63A 3CDVA 3N9EA 1L86A 4KVGB 4EKPA 4LYOA 4HAWB 2CY5A 3DXDA 5FDJA 3G3VA 4NSGA 1C6AA 1C64A 1X1FA 1C43A 4D0NB 1OMWA 1G06A 1QSAA 4WO9A 2VKIA 3HT7A 1ALCA 1REZA 4H90A 1LZ6A 4S0WA 1KZ7A 1DPWA 1L00A 5DN5A 5B06A 230LA 2BQLA 1B0DA 2JP2A 1U29A 3KY9A 2ZYCA 1CU6A 4HAUB 4LYZA 183LA 1KW7A 4A7DA 1L02A 5LVGA 7LZMA 3A6BY 1LSNA 1B7MA 1LHKA 5LA8A 3NYAA 1XEIA 1C45A 6LZMA 1LYSA 1L16A 1LMNA 2OQBA 3OE8A 4HB4B 2YSZA 1UPQA 4XWXA 2DKQA 3W6CA 3AGGG 1IR9A 4HDOA 1ZWNA 1IP1A 1Z87A 5J7CA 4W57A 2FBBA 3HH3A 242LA 1FB8A 2Z38A 2UVMA 5DHFB 2J0MA 5C5BB 1INUA 3DN8A 1LHHA 1FGYA 3HH4A 225LA 3MGWA 1JHLA 1LYEA 3HUAA 3TXKA 2RBOA 1C10A 4OO9A 1P5CA 1D0KA 1CJ9A 2F47A 3WA0A 167LA 5D27A 5KQ1A 4H9BA 4C0AA 115LA 4YX7C 1GC7A 1NHEA 5FSTA 1E8LA 2RGNB 2YDGA 1QUOA 3OE0A 3HW2B 3F5RA 1B5YA 5DM9A 4E97A 140LA 3A94A 1AKIA 1LZNA 1DI3A 2YS1A 1JTPL 3NY8A 1YKZX 4B4JA 4HTKA 2RBPA 2YBMA 4ARMA 4WVFB 5F9XA 4W52A 1L09A 1GB5A 1HFXA 4ETAA 3TW1A 1NTVA 1C6PA 1IIZA 1D3JA 1IR8A 3GUNA 1U5FA 2MEAA 3DN6A 4ARJA 4BAPA 3ODWA 4N8ZA 2YBNA 3IWRA 5I54A 118LA 1UICA 1I7AA 3VIAA 5DHAB 1C6BA 4J7VA 5HMVA 4IOYX 102LA 1IP7A 1WTNA 1JKCA 2D4JA 1CKDA 2BQNA 3WYFB 2HEFA 2EQLA 1G7IC 187LA 1L91A 1G0LA 4H8YA 3CSQA 1G7HC 5LXWA 3X23A 4AGAA 1WGUA 1WQOA 3OK0A 1LMTA 1WTMA 2B6ZA 1U5EA 4NSHA 126LA 2C8PA 1QUHA 3QE8A 1J1PY 3DXCA 175LA 1TDYA 1MK9B 4F7GA 189LA 4GCEA 1L48A 1L17A 4TKNA 1G7MC 1LSMA 4WO6A 190LA 1QT6A 5KXPA 4ET9A 2G4NA 2B72A 2OU8A 4F7UP 1H10A 1GE0A 1H4RA 4GXBA 1DYNA 1XD4A 4LZMA 1B55A 3KZ1A 1BWHA 5HE2A 255LA 4I7MA 4GCFA 2DQJY 4I7TA 4PGJB 222LA 261LA 238LA 2DQHY 1CKFA 3CDTA 113LA 2QARC 153LA 1CVKA 2HEAA 5CLLB 1B7OA 5L9JA 1KIPC 4KHOA 1QQGA 2Z2FA 1OUHA 1GPQC 1DYAA 4UWUA 4H9CA 5KXRA 4IJ4A 4GCCA 168LA 2ANVA 1KXWA 1L54A 134LA 3V2YA 2CDSA 1K5DB 1FLQA 1QIOA 3HDEA 2NTHA 1GBXA 1T6HA 1KIRC 3RT5X 1L35A 2O79A 2Z12A 3WXTA 1P3NA 4KXIA 5F16A 1EPYA 1JTOL 2DTCA 3N9CA 3FA0A 2P0HA 1T6VL 3WPLA 4PRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 130L A;  1L32 A;  2MFQ A;  1B6I A;  1L18 A;  2LC9 A;  2OE4 X;  4EKQ A;  149L A;  1EAZ A;  3GUO A;  1XJT A;  3P7Z A;  2M38 A;  178L A;  206L A;  4H8S A;  1P37 A;  1LPY A;  1PQJ A;  2HUM A;  1L70 A;  176L A;  2IYB A;  3PP2 A;  2P8V A;  150L A;  112L A;  2YVC A;  1C6D A;  2D10 A;  2Y8F A;  2EMS A;  1XX0 A;  2COA A;  2HTH B;  2L1C A;  5C79 A;  108L A;  3TFM A;  3OE9 A;  1UNQ A;  205L A;  2OU0 X;  3K2R A;  1C66 A;  3ZDT A;  2L78 A;  1QS5 A;  2KCJ A;  1W1H A;  192L A;  3HUQ A;  1L89 A;  4A6F B;  5HE1 A;  5C16 A;  3HH6 A;  1L56 A;  248L A;  5FI0 A;  1PQK A;  1BTK A;  1D3M A;  1LYH A;  1G0J A;  2PZ1 A;  1L51 A;  1TQZ A;  181L A;  1C60 A;  1T8F A;  3HU8 A;  256L A;  1L52 A;  1P2R A;  3PVU A;  5J3T A;  127L A;  4ZRI A;  182L A;  119L A;  109L A;  1L04 A;  1RJ2 A;  1L99 A;  142L A;  1L0J A;  1P56 A;  258L A;  1L21 A;  1FHW A;  1ZC3 B;  1KZG A;  1C6I A;  1L31 A;  3C82 A;  2I5C A;  1V61 A;  2ROZ B;  2A4T A;  4EKR A;  1L45 A;  1XCG A;  2Y7B A;  4EMO A;  1C67 A;  1FHX A;  4MT7 A;  1DDM A;  2W2X C;  1L05 A;  1C6Q A;  3IVF A;  5LOP B;  1NU2 A;  2RB2 X;  3DXE A;  1WGQ A;  3DMV A;  4NY0 A;  4EKU A;  1ISN A;  228L A;  143L A;  1D3F A;  166L A;  1UEF A;  1KS3 A;  4EJ4 A;  229L A;  4A5K A;  2D11 A;  4DJH A;  2RVB B;  3C7Y A;  1LW9 A;  5L81 A;  1L01 A;  1L80 A;  1QSQ A;  1C65 A;  3QAK A;  3ZVR A;  1LI2 A;  5J3Q A;  1SX2 A;  2DHI A;  1OY2 A;  5CLQ B;  2AEH A;  1ZC4 B;  2DYN A;  1L26 A;  1I6S A;  1P64 A;  1L65 A;  2Q9D A;  1MIX A;  212L A;  1QTB A;  4I7K A;  1L82 A;  1K5G B;  4I7S A;  241L A;  1XEP A;  4W54 A;  1T97 A;  3DN1 A;  198L A;  3G3W A;  1DYE A;  3TO1 A;  2LYD A;  1DBH A;  2DX5 A;  2O7A A;  2VRW B;  5KCV A;  4DKL A;  3FAD A;  234L A;  5JHH A;  3HTD A;  2J0J A;  1G1W A;  2E2X A;  1L22 A;  4WSF A;  1QT3 A;  4ZPU A;  1LW3 A;  3GYP A;  2COF A;  1X86 A;  4GMV A;  1P46 A;  1MK7 B;  1L39 A;  2OEA X;  161L A;  3SV1 A;  3C81 A;  1L29 A;  3SB6 A;  2Z0Q A;  1C6N A;  246L A;  3BIN A;  4CHJ A;  4W56 A;  5HE0 A;  2B6W A;  1G1V A;  211L A;  2DHK A;  3QBV B;  1QT8 A;  1DYD A;  1L69 A;  2D9Z A;  1L40 A;  122L A;  1L90 A;  3U8Z A;  1N3H A;  2LCB A;  4EKS A;  2DHJ A;  2VSZ A;  1SWZ A;  1WG7 A;  1EVH A;  4I7P A;  219L A;  4YXA C;  4IAP A;  1GC6 A;  5LZM A;  1CV0 A;  1C6H A;  1L10 A;  2B6Y A;  4K5Y A;  1SX7 A;  4ARM B;  111L A;  1L59 A;  3DMX A;  1L83 A;  5DI9 B;  1P36 A;  4LDL A;  1L57 A;  4I7N A;  2EMT A;  4HDQ A;  1L84 A;  1U2B A;  2R09 A;  4GMX B;  2HUK A;  173L A;  3JR6 A;  2LZM A;  3SO6 A;  2QKL A;  2ELA A;  1G0K A;  129L A;  145L A;  2QB0 B;  2OTX A;  3CDO A;  3SN6 R;  1SSW A;  1TLA A;  1P6Y A;  4I7R A;  2B7X A;  1WJM A;  3A8Q A;  1X11 A;  3RUN A;  252L A;  1JTM A;  3HH5 A;  147L A;  1C6E A;  1CV6 A;  3DKE X;  3NY9 A;  2V76 A;  3PVL A;  4HAY B;  1L50 A;  1QTZ A;  1Q67 A;  1D9W A;  1ZSQ A;  1ZVR A;  4ZRJ A;  1LYF A;  213L A;  3MDB C;  158L A;  1C68 A;  2LOX A;  1CV5 A;  2F2Q A;  3DNA A;  4PQ0 A;  1L08 A;  107L A;  2RNR B;  1U5G A;  1QC6 A;  4IFS A;  2B6X A;  5C5B A;  162L A;  2OE9 X;  2DKP A;  3KRX A;  2M14 A;  1NTY A;  3D8D A;  3LZM A;  3G9W A;  4HHV A;  1L41 A;  2I1K A;  1CUQ A;  1ZM0 A;  1CTW A;  4HAV B;  4KHB B;  2QKM A;  1CUP A;  160L A;  1L38 A;  1LI3 A;  1G0Q A;  3TVV A;  1L46 A;  2OTY X;  138L A;  3KSY A;  4B6H A;  240L A;  1L30 A;  244L A;  1L37 A;  1UPR A;  2RAZ X;  1G0M A;  4PK0 A;  1V5M A;  4K81 A;  3PBL A;  1UNP A;  4CYE A;  1T8G A;  2YS3 A;  1V88 A;  236L A;  4LDO A;  2BCJ A;  2GCJ A;  1T8A A;  2H7E A;  191L A;  1QTD A;  2I1J A;  1ZYT A;  3T06 A;  4YL8 A;  1PQO A;  1L67 A;  1CU5 A;  1J19 A;  1TJ6 A;  2X18 A;  163L A;  3SB9 A;  4YXC A;  3RZE A;  243L A;  3O96 A;  4DX8 A;  1L0K A;  1L87 A;  3TCA A;  1L72 A;  1IRS A;  1M7R A;  4L6E A;  4Z2N A;  2IFS A;  186L A;  4HAZ B;  3PVW A;  3V2W A;  1L49 A;  1OVJ A;  2HE7 A;  1G0G A;  3C8R A;  125L A;  110L A;  2B73 A;  3UON A;  209L A;  1PLS A;  2LKO A;  3GUJ A;  3HDF A;  239L A;  2Z0O A;  3ODO A;  1CU3 A;  2L2I A;  2EC1 A;  3SUZ A;  1L63 A;  1LWK A;  3CDV A;  2RUK B;  3DN2 A;  2FJL A;  3V5W A;  1L95 A;  4ARQ A;  1C69 A;  2K2U A;  1JTN A;  1L86 A;  1QT4 A;  4EKP A;  2LOZ A;  4KVG B;  3UZT A;  141L A;  146L A;  4HAW B;  2RBR A;  2CY5 A;  3DXD A;  3G3V A;  201L A;  5D3V A;  1C6A A;  103L A;  171L A;  3GUM A;  4GBR B;  1P5T A;  1C64 A;  4W58 A;  1X1F A;  4K2P A;  1AQC A;  4HAT B;  2D9X A;  1WVH A;  3C7Z A;  3HK0 A;  4D0N B;  1OMW A;  1G06 A;  3MPX A;  196L A;  2RLO A;  164L A;  4GN1 A;  2VKI A;  3HT7 A;  1RRP B;  1FOE A;  4F7G A;  4A6K A;  1CU0 A;  1KZ7 A;  4S0W A;  3PZD A;  1L00 A;  1L44 A;  1L79 A;  2RB0 X;  230L A;  2CY4 A;  4A6F A;  2D2Q A;  2CRF A;  2JP2 A;  1U29 A;  1MIZ B;  2J59 M;  3KY9 A;  3SB8 A;  1CU6 A;  4I7Q A;  2G35 A;  4HAU B;  183L A;  185L A;  1XJU A;  169L A;  1KW7 A;  1L02 A;  7LZM A;  1L12 A;  1E5W A;  1C6M A;  227L A;  1DDV A;  3NYA A;  2Y8G A;  2F32 A;  3EML A;  3HUK A;  1LWG A;  4CHM A;  2DX1 A;  6LZM A;  1L16 A;  4EPI A;  200L A;  3OE8 A;  1GG3 A;  2D9W A;  2NMB A;  2OQB A;  4HB4 B;  3VOQ A;  1WJ1 A;  5FI1 A;  2YSZ A;  1UPQ A;  1NI2 A;  4WJ7 A;  4XWX A;  5J3Y A;  123L A;  1L75 A;  1LGU A;  5I14 A;  2CUU A;  3FSS A;  2KUP A;  3G3X A;  3QWM A;  1XKE A;  2DKQ A;  2MDX A;  1OWZ A;  1DYC A;  2LUL A;  3L64 A;  1L97 A;  4HDO A;  1XOD A;  4K17 A;  1ZWN A;  1Z87 A;  235L A;  4HAX B;  1PQM A;  1OWY A;  1OYU A;  4W57 A;  1FAO A;  1D2W A;  1MAI A;  3HH3 A;  242L A;  1LLH A;  4W51 A;  223L A;  1CV1 A;  1FB8 A;  2UVM A;  5DHF B;  2HUL A;  2MKR A;  2ANX A;  2J0M A;  4DAJ A;  1W1G A;  1C6K A;  5C5B B;  3M1I B;  1L93 A;  4I7L A;  3PDS A;  1C62 A;  1ZUR A;  2COC A;  1CU2 A;  260L A;  3DN8 A;  3GUK A;  4I7J A;  2DYQ A;  2YF0 A;  1G0P A;  247L A;  1L14 A;  1FGY A;  2GCL A;  1K28 A;  3HH4 A;  225L A;  2EJ8 A;  2K2J A;  131L A;  1LYE A;  3HUA A;  2NZ8 B;  2RBO A;  1L07 A;  4OO9 A;  4EJN A;  1P5C A;  3F0W A;  215L A;  2RB1 X;  165L A;  1L43 A;  1OQN A;  139L A;  2F47 A;  3WA0 A;  167L A;  1BTN A;  5D27 A;  5KQ1 A;  245L A;  3F9L A;  4GRV A;  151L A;  115L A;  4YX7 C;  4C0A A;  1GC7 A;  5D3X A;  4DBB A;  4DX9 0;  233L A;  2RGN B;  216L A;  231L A;  4A6H A;  1QUO A;  1L34 A;  1QTV A;  3C8S A;  3C83 A;  3OE0 A;  3ODU A;  4EXM A;  3F5R A;  3HW2 B;  4HB0 B;  114L A;  1L23 A;  4E97 A;  1V89 A;  3FI5 A;  3AU4 A;  4KHA A;  140L A;  3DN3 A;  1L64 A;  2YT0 A;  2YS1 A;  3CDR A;  3NY8 A;  1WTH A;  4ZRK A;  2B70 A;  1L13 A;  1J0W A;  4Z2M B;  5EFX A;  1FGZ A;  1CX7 A;  1D3N A;  2IGC A;  254L A;  214L A;  2RBP A;  4ARM A;  4WVF B;  3GUP A;  3HTF A;  3GYO A;  4W52 A;  1KI1 B;  170L A;  1L09 A;  1QTC A;  1V5U A;  2B6T A;  4GPT B;  3NSU A;  3TW1 A;  199L A;  1NTV A;  1C6P A;  1C6J A;  1D3J A;  3P6A A;  155L A;  1OV5 A;  184L A;  2UZR A;  197L A;  3D8F A;  1L03 A;  3PG7 A;  3GUN A;  1U5F A;  3HT8 A;  3DN6 A;  2RAY X;  4ARJ A;  1C6G A;  174L A;  3ODW A;  3U7D A;  1M7E A;  2UZS A;  1L60 A;  3DN0 A;  1L06 A;  1LYI A;  118L A;  3D8E A;  3HQC A;  4GZU A;  2ZPY A;  1I7A A;  157L A;  3VIA A;  3SB5 A;  1LYG A;  5HE3 A;  1FHO A;  5DHA B;  4K2O A;  1L74 A;  220L A;  1C6B A;  2DA0 A;  148L E;  3RCP A;  218L A;  1L94 A;  159L A;  1CV4 A;  3SBB C;  4IOY X;  5DIF B;  1OVK A;  1QS9 A;  3SBA A;  102L A;  1L81 A;  3GUL A;  1V5P A;  1L88 A;  221L A;  4KAX B;  2P0D A;  1DYF A;  3BJI A;  253L A;  2D9V A;  232L A;  1L62 A;  4ARL A;  2AL6 A;  1QTH A;  3WYF B;  3HTG A;  2D9Y A;  4NSW A;  5DH9 B;  237L A;  1C63 A;  1Y19 B;  1MKE A;  187L A;  3A98 B;  1L91 A;  1PMS A;  1TXD A;  1G0L A;  1L71 A;  251L A;  2OE7 X;  5JHG A;  1PQD A;  1L36 A;  3X23 A;  3QIJ A;  144L A;  1QUD A;  1WGU A;  2ROV A;  4LDE A;  3ULC A;  2RBN A;  217L A;  120L A;  2B6Z A;  1WI1 A;  1D2Y A;  2H7D A;  3F8V A;  1U5E A;  3A8P A;  126L A;  1C6L A;  1L68 A;  1QUH A;  1DDW A;  2ELB A;  3LJU X;  4DXA B;  3DXC A;  175L A;  1MK9 B;  3HTB A;  189L A;  1NHB A;  2D4Q A;  2N23 A;  5D3Y A;  1U5D A;  4MK0 A;  4BBK A;  3C8Q A;  226L A;  1DYB A;  2W2W A;  3CIK A;  4TYZ A;  1EGX A;  1L85 A;  1L27 A;  1L48 A;  180L A;  2Z6B A;  1L42 A;  1L77 A;  1W1D A;  2YT1 A;  1KY1 A;  2GS0 A;  137L A;  1L17 A;  2MWN B;  2P0F A;  3PEG A;  4TKN A;  1CV3 A;  1P2L A;  190L A;  177L A;  1QT6 A;  4HB2 B;  1L24 A;  1C6F A;  3ULB A;  2B72 A;  2GJY A;  2OU8 A;  4F7U P;  1H10 A;  3D4S A;  1QT5 A;  1Y5O A;  224L A;  1C61 A;  1L55 A;  1L61 A;  1L28 A;  1LI6 A;  1JQU A;  250L A;  2Q13 A;  104L A;  152L A;  1X05 A;  262L A;  2RSG A;  3AU5 A;  4YON A;  1SWY A;  3HT6 A;  4Y94 A;  1QUG A;  1H4R A;  2B75 A;  1SGH A;  2LG1 A;  1L76 A;  4GXB A;  1DYN A;  1XD4 A;  1BAK A;  2DLW A;  1L96 A;  1X1G A;  188L A;  4LZM A;  2RH1 A;  3FEH A;  1PQI A;  1B55 A;  3KZ1 A;  1L53 A;  1QT7 A;  210L A;  1EF1 A;  255L A;  5HE2 A;  4I7M A;  4EPF A;  2CAY A;  1L66 A;  2I5F A;  4I7T A;  1DYG A;  2K00 A;  222L A;  261L A;  238L A;  2NTG A;  2YS5 A;  3OAN A;  4F7H A;  1P7S A;  2Z0P A;  1SSY A;  3L2X A;  1DRO A;  4AQN A;  1LB1 A;  3CDT A;  113L A;  249L A;  2QAR C;  3SNH A;  2R0D A;  2Q9E A;  4ARP A;  5KQ4 A;  3HT9 A;  3FM8 C;  1CVK A;  3HWL A;  3ODX A;  1AWE A;  1U27 A;  2RBQ A;  2ADZ A;  5CLL B;  4MY6 A;  1BWN A;  3VW7 A;  1KY0 A;  1OVH A;  3ML4 A;  4W55 A;  2YRY A;  1L98 A;  2KGX B;  5JP4 A;  3C7W A;  257L A;  1LGX A;  4KHO A;  1QQG A;  4PJZ A;  1L19 A;  1LYD A;  3CDQ A;  3PSC A;  2XQN M;  3HU9 A;  1DYA A;  3N7C A;  1MPH A;  2N0Y A;  4W53 A;  259L A;  1PFJ A;  4HB3 B;  5C6R A;  3DMZ A;  4I7O A;  1L20 A;  2COD A;  1L92 A;  128L A;  1XR0 B;  5D3W A;  2RBS A;  172L A;  195L A;  1L15 A;  2B74 A;  1SHC A;  1QSB A;  168L A;  3AJ4 A;  2ANV A;  1P6S A;  1L54 A;  3V2Y A;  2OTZ X;  1I2H A;  1K5D B;  1L33 A;  3OE6 A;  1L47 A;  1G07 A;  2NTH A;  3HDE A;  3SYX A;  5JLJ B;  1T6H A;  4P7I A;  4PNK A;  3GUI A;  1L35 A;  2O79 A;  1L25 A;  1P3N A;  3CXB B;  2W2X D;  3C80 A;  2O4W A;  1P3R A;  1KW5 A;  1LGW A;  1UNR A;  1L58 A;  2DFK A;  3KRW A;  3DN4 A;  2DN6 A;  5LON B;  5GOW B;  1EPY A;  2DTC A;  2J0K A;  1OV7 A;  1CX6 A;  1LYJ A;  3FA0 A;  4W59 A;  2P0H A;  156L A;  3SB7 A;  2OU9 A;  1C6C A;  1KNI A;  1L11 A;  1C6T A;  1L73 A;  4ARQ B; 
#chains in the Genus database with same CATH topology
 4QDN A;  3N9A A;  2MFQ A;  1B6I A;  3G3A B;  5DLA A;  4EKQ A;  3GUO A;  4HJY A;  4QY9 A;  1P37 A;  1PQJ A;  1YAP A;  4PRU A;  1BQL Y;  1B5W A;  5I53 A;  1B5X A;  1GXX A;  1YAM A;  1BTK A;  1TQZ A;  1C60 A;  3HU8 A;  4CHX A;  4C5F A;  3PVU A;  5J3T A;  4ZRI A;  4TSB A;  142L A;  3LN2 A;  4CFO A;  1IWU A;  4WM4 A;  4DDC A;  1ZC3 B;  1C6I A;  1L31 A;  1DPX A;  2ROZ B;  1F6R A;  1L45 A;  2X0A A;  2BQB A;  2Y7B A;  1GFU A;  2DQE Y;  4MT7 A;  3B72 A;  3A92 A;  2Z37 A;  3DMV A;  4GN5 C;  4HTN A;  1HEP A;  1IOC A;  4EJ4 A;  229L A;  1GF8 A;  132L A;  3AZ5 A;  1HEL A;  1L80 A;  1QSQ A;  1HEW A;  2HTX A;  3QAK A;  3ZVR A;  5L3H A;  3HFM Y;  9LYZ A;  1RE2 A;  4EOF A;  2AEH A;  1ZC4 B;  1YAQ A;  2DYN A;  1BB6 A;  1I6S A;  2KR0 A;  2HEC A;  1MIX A;  4I7K A;  1L82 A;  1LSP A;  2BQM A;  1OUF A;  5HQ1 A;  1UIB A;  1T97 A;  4LYB A;  3TO1 A;  1W6Z A;  2DX5 A;  2O7A A;  4DKL A;  2J0J A;  1L22 A;  5B1G A;  4ZPU A;  1LW3 A;  1P46 A;  4QJ3 B;  161L A;  3SB6 A;  2CWI A;  1IC4 Y;  1WQR A;  3QBV B;  1G1V A;  4YEN A;  2DHK A;  2D9Z A;  1JTT L;  2LCB A;  5IRS A;  208L A;  1SWZ A;  2BQD A;  3P4Z A;  1L10 A;  1HF4 A;  4FJR A;  111L A;  1P36 A;  3D3D A;  4HDQ A;  173L A;  1IWX A;  3CT0 A;  5D5F A;  5AMY A;  3ZVQ B;  2K8E A;  1V7T A;  2QB0 B;  2OTX A;  1SSW A;  3A6C Y;  1WJM A;  1X11 A;  3RUN A;  1HHL A;  252L A;  147L A;  2V76 A;  1ZVR A;  1D9W A;  1EQ4 A;  4ZRJ A;  158L A;  1FN5 A;  1CV5 A;  1GEV A;  1VDP A;  2LZ2 A;  107L A;  4DDA A;  162L A;  2DKP A;  3QY4 A;  1NTY A;  3D8D A;  1FLW A;  2QKM A;  1CUP A;  1L38 A;  1LI3 A;  1HML A;  4G4B A;  4PK0 A;  2BQC A;  1LZ1 A;  1WQN A;  4CYE A;  1FKQ A;  5E4P A;  2H7E A;  1NBZ C;  2I1J A;  4W96 A;  4H1P A;  2YBI A;  1A4V A;  1GB2 A;  1LSF A;  3RNX A;  3WW5 A;  4H9I A;  1P2C C;  1LJK A;  2IFS A;  2YT2 A;  3G3B B;  110L A;  1XGQ C;  1TCY A;  209L A;  3UON A;  4XYY A;  4TSC A;  1HMK A;  2Z0O A;  3ODO A;  5LYM A;  3SUZ A;  1JKA A;  1LWK A;  3DN2 A;  1L95 A;  1LMC A;  5LG4 B;  4W94 A;  2ZNX Y;  4GBR B;  5II3 A;  4QGZ A;  1QQY A;  1GBZ A;  4QEQ A;  133L A;  4WOA A;  1LSZ A;  2LHM A;  4GN4 A;  2D2Q A;  3WH1 A;  2LZT A;  2J59 M;  2BLY A;  4I7Q A;  1OUJ A;  1UBZ A;  5C6J A;  2YBH A;  1E5W A;  1C6M A;  3NWA A;  4CHM A;  3EML A;  4DQ7 A;  4N1E I;  4RDS A;  2DX1 A;  1JJ1 A;  4EPI A;  3VOQ A;  1LJ4 A;  2NMB A;  5FI1 A;  2AUB A;  1LZ8 A;  135L A;  1NI2 A;  123L A;  1L75 A;  1JKB A;  2CUU A;  2KUP A;  1OWZ A;  193L A;  3L64 A;  1IWV A;  235L A;  1B7L A;  3NW8 A;  1OYU A;  3WYH A;  1MAI A;  1LLH A;  5APD A;  2MKR A;  3A34 A;  1F10 A;  4DAJ A;  1W1G A;  4DD9 A;  2MEB A;  4I7L A;  1ZUR A;  4DYG A;  5APF A;  1CU2 A;  260L A;  4I7J A;  3GUK A;  2DYQ A;  2HU3 A;  1GFT A;  2YF0 A;  1L14 A;  2GCL A;  1K28 A;  2KIG A;  2EJ8 A;  1OUE A;  1VDT A;  1L07 A;  1IP5 A;  3WW6 A;  5B05 A;  4DX9 0;  151L A;  1GFV A;  1VDS A;  1ZV5 L;  2G4P A;  231L A;  4A6H A;  1QTV A;  3C83 A;  2DQF C;  2EPE A;  3TMW A;  1L64 A;  3AZ4 A;  3CDR A;  1WTH A;  1EQ5 A;  3A93 A;  5EFX A;  3LYZ A;  3HTF A;  4HPI A;  1LSY A;  2DQG Y;  1YL0 X;  2YVB A;  4NGK A;  3ZEK A;  1C6J A;  3P6A A;  4CJ2 A;  2UZR A;  1HSX A;  3HT8 A;  2DQI Y;  2RAY X;  174L A;  2UZS A;  1GD6 A;  1XFP L;  3DN0 A;  1L06 A;  3D8E A;  157L A;  4KL7 A;  1LYG A;  1OUI A;  3SB5 A;  1FHO A;  4DWX A;  1LYY A;  220L A;  2W1X A;  3RCP A;  2D91 A;  3SBB C;  4H92 A;  1CV4 A;  1LKR A;  2BQA A;  4HTQ A;  2Z13 A;  4BAF A;  3GUL A;  4OSN A;  1L88 A;  2I25 L;  2P0D A;  3BJI A;  4KHB A;  1LSA A;  5KJ9 A;  3T36 A;  2AL6 A;  2D9Y A;  4NSW A;  5DH9 B;  1I1Z A;  1YKX X;  1Y19 B;  4ETB A;  1KXY A;  3BKV A;  2BQJ A;  1A2Y C;  1PQD A;  1IOR A;  1L36 A;  4NGZ A;  144L A;  2ROV A;  5LVK A;  120L A;  1WI1 A;  1D2Y A;  2H7D A;  3A8P A;  3LJU X;  1DDW A;  3P64 A;  4DXA B;  4HV1 A;  1FKV A;  4MK0 A;  3C8Q A;  1DYB A;  2DBT A;  3CIK A;  1EGX A;  1L85 A;  4GCD A;  1L27 A;  4WM2 A;  2Z6B A;  3J6K A;  1L77 A;  4XJB A;  1B7S A;  1P2L A;  1REM A;  4HB2 B;  1L24 A;  1MLC E;  5IDD A;  5F81 A;  4NSJ A;  5HNL A;  2IHL A;  1QT5 A;  224L A;  5M1Y A;  1C61 A;  1L28 A;  1LI6 A;  1JQU A;  3EO5 A;  2Q13 A;  152L A;  262L A;  3CQL A;  3WPJ A;  2RSG A;  1SWY A;  3AU5 A;  4YON A;  2B75 A;  3WUA A;  1SGH A;  2LG1 A;  2DLW A;  3FEH A;  210L A;  1EF1 A;  1DYG A;  1LYO A;  2YS5 A;  1T3P A;  3EXD A;  3OAN A;  4F7H A;  1P7S A;  4NHP A;  5I4X A;  1GB8 A;  1SSY A;  2Z14 A;  1LB1 A;  1GF5 A;  2R0D A;  4ARP A;  3HT9 A;  1AWE A;  3HWL A;  2ADZ A;  4MY6 A;  5I4W A;  5LVJ A;  1OVH A;  2H9K A;  2YRY A;  1L98 A;  5LIO A;  2DQC Y;  1LGX A;  1NMM A;  1LZG A;  3WUL A;  1LYD A;  4WLY A;  3M18 B;  1BHZ A;  3HU9 A;  1MPH A;  5C6R A;  4NGV A;  2DQD Y;  3TXF A;  1AT5 A;  1SHC A;  1N4F A;  2MEE A;  4YEM A;  1P6S A;  1GF3 A;  2OTZ X;  5K7O A;  1L47 A;  1V7S A;  4WG7 A;  5JLJ B;  4PNK A;  4TWS A;  1WVV A;  5FCP A;  3CXB B;  5LAF A;  1UNR A;  4M4O A;  5DN4 A;  3KRW A;  3DN4 A;  5LON B;  4CSQ A;  2J0K A;  1LKS A;  1LYJ A;  4W59 A;  4G4C A;  156L A;  2OU9 A;  3LYO A;  1D0M A;  130L A;  1L32 A;  2BQH A;  2IFF Y;  1IX0 A;  3P7Z A;  206L A;  5FEK A;  1D6P A;  2YVC A;  1ZVH L;  2Y8F A;  1GE4 A;  2EMS A;  1XX0 A;  2COA A;  2L1C A;  1JPO A;  5C79 A;  3OE9 A;  2HU1 A;  1UNQ A;  1C66 A;  2L78 A;  1CKH A;  1IP3 A;  1C7P A;  192L A;  4Z3M A;  2GUM A;  3NWD A;  1LZY A;  3HH6 A;  248L A;  1PQK A;  1QTE A;  1D3M A;  1G0J A;  8LYZ A;  1L51 A;  181L A;  4B1A A;  1YAO A;  4TX7 A;  2FBD A;  256L A;  3LZT A;  1SQ2 L;  1I56 A;  2MEH A;  182L A;  109L A;  1UIH A;  5HMJ A;  1L0J A;  258L A;  3HBH A;  1L21 A;  1KZG A;  3C82 A;  1LPI A;  4EKR A;  1C67 A;  1DDM A;  4EMN A;  1C6Q A;  3IVF A;  3DXE A;  1BWI A;  4LYT A;  4BAD A;  1ISN A;  1D3F A;  4A5K A;  3A3R X;  3C7Y A;  1LZA A;  4GLA A;  5L81 A;  1LZD A;  1LSE A;  1B7Q A;  1T77 A;  1L26 A;  1SLY A;  4X3B A;  1GB9 A;  3WL2 A;  212L A;  1TEW A;  1K5G B;  1FBI X;  1XEP A;  4W54 A;  198L A;  1DYE A;  4RW2 A;  4H9H A;  1DBH A;  5KCV A;  1LZ9 A;  3FAD A;  234L A;  5JHH A;  1CJ6 A;  1HEO A;  2E2X A;  1QT3 A;  3GYP A;  1F6S A;  2OEA X;  2F4A A;  3WU9 A;  1L29 A;  5LVH A;  3WU7 A;  2YBL A;  4W56 A;  5HE0 A;  4WM6 A;  1L69 A;  4LFP A;  4DIX A;  3A90 A;  1L90 A;  4EKS A;  1IWW A;  1GE1 A;  219L A;  4IAP A;  5LZM A;  4K5Y A;  2B6Y A;  4ARM B;  4WL7 A;  1L59 A;  3DMX A;  1RI8 B;  1L57 A;  1U2B A;  2HUB A;  4GMX B;  2FYC A;  2HUK A;  4NFV A;  2Y8P A;  2MED A;  3CDO A;  3SN6 R;  1TLA A;  1P6Y A;  2B7X A;  3A8Q A;  1JTM A;  1LZS A;  4HAY B;  1CV6 A;  3NY9 A;  1L50 A;  3WUN A;  1Q67 A;  1GDX A;  1C68 A;  1GF6 A;  2LOX A;  2NWD X;  1B9O A;  3DNA A;  5KXN A;  3TXI A;  4NSI A;  1U5G A;  2OE9 X;  4P2E A;  3G9W A;  3LZM A;  1BB4 A;  4DQJ A;  1L41 A;  1CUQ A;  1LZT A;  1L46 A;  1WVU A;  1JEF A;  240L A;  1UPR A;  4I8S A;  2RAZ X;  4K81 A;  5C6L A;  1GAZ A;  1UCO A;  1GFR A;  236L A;  191L A;  4HSI A;  1NWG A;  4ZIX A;  1TJ6 A;  4LYC A;  1UIG A;  1J1X Y;  1IRS A;  2VB1 A;  186L A;  3V2W A;  1QTK A;  1L49 A;  2HE7 A;  1DXJ A;  125L A;  2B73 A;  3TXH A;  5KKJ A;  1LCN A;  1PLS A;  2LKO A;  3FVC A;  3GUJ A;  3HDF A;  1GB7 A;  4DQ5 A;  1CKG A;  1CU3 A;  2EC1 A;  1LMQ A;  1LSB A;  2FJL A;  4ARQ A;  1C69 A;  1QT4 A;  3UZT A;  146L A;  2MEC A;  1LZ5 A;  1YIK A;  1P5T A;  4K2P A;  4NHS A;  5KXL A;  1AQC A;  4HAT B;  1WVH A;  4H94 A;  2RLO A;  1D0L A;  1CU0 A;  5APC A;  1L44 A;  1L79 A;  4II8 A;  2RB0 X;  2CY4 A;  4A6F A;  1J1O Y;  2CRF A;  4I0C A;  1MIZ B;  4NEB A;  5KY1 A;  2G35 A;  1LSD A;  1XJU A;  1HEM A;  1GFK A;  5KXZ A;  1LOZ A;  227L A;  1DDV A;  2ZNW Y;  3LHM A;  2F30 A;  3KAM A;  200L A;  1GG3 A;  2D9W A;  4IAT A;  1NF5 A;  2Z2E A;  3FSS A;  1LGU A;  5I14 A;  1REX A;  1IWZ A;  3QWM A;  1H6M A;  2ZYP A;  4OOO A;  5B59 A;  1DYC A;  1CJ8 A;  4XJD A;  2LUL A;  1IC5 Y;  1XOD A;  5B07 A;  1PQM A;  1OWY A;  3W6B A;  1FAO A;  1D2W A;  5KKI A;  3CSR A;  1CV1 A;  4C3W A;  4OWE A;  2ANX A;  3PDS A;  1G0P A;  247L A;  5ILC A;  2K2J A;  1ZVY B;  131L A;  3A3Q A;  3F0W A;  3OJP A;  2RB1 X;  5LVI A;  165L A;  1OQN A;  139L A;  1BB5 A;  4GRV A;  4ETC A;  3ATN A;  1LHL A;  1Z55 A;  1EL1 A;  1IY4 A;  1UAC Y;  3ODU A;  3C8S A;  1ZYI A;  1HFY A;  5KXY A;  114L A;  3AU4 A;  3FI5 A;  4KHA A;  1GB0 A;  2YSS C;  3DN3 A;  2YT0 A;  1LJ3 A;  1B5V A;  2Z19 A;  3E3D A;  1TAY A;  2B70 A;  4ZRK A;  1L13 A;  1J0W A;  4Z2M B;  1D3N A;  4CGE A;  2IGC A;  254L A;  170L A;  4NHI A;  4GPT B;  3NSU A;  4OWB A;  1HER A;  197L A;  1NKH A;  3D8F A;  2BQI A;  1UID A;  1LHJ A;  1QUS A;  3W6D A;  3AGI A;  1GDW A;  1C6G A;  3B0K A;  1HC0 A;  1M7E A;  1LYI A;  4GZU A;  1GBW A;  5LYT A;  5HE3 A;  1L74 A;  2DA0 A;  1L94 A;  4FDY A;  5DIF B;  4ET8 A;  1QS9 A;  3SBA A;  1L81 A;  4H8Z A;  5I2M A;  221L A;  4KAX B;  2BQF A;  1DYF A;  4WL6 A;  253L A;  2D9V A;  2XBS A;  232L A;  1L62 A;  1QTH A;  3EBA B;  1GWD A;  4PHI A;  1MKE A;  1B5U A;  1TXD A;  251L A;  1YL1 X;  2BQG A;  2OE7 X;  3TXG A;  3FE0 A;  4L1R A;  1YRO A;  1QUD A;  4H93 A;  5A3Z A;  3ULC A;  5E9R A;  4B4I A;  4NG8 A;  1XSF A;  1IP6 A;  3ULR A;  3HTB A;  5D3Y A;  2D4Q A;  2N23 A;  1U5D A;  4BBK A;  2W2W A;  1L42 A;  1W1D A;  2YT1 A;  1KY1 A;  3AGH A;  2MEI A;  2GS0 A;  2MEF A;  2MWN B;  2P0F A;  3PEG A;  3CB7 A;  1CV3 A;  4NGI A;  3WVX A;  2I6Z A;  1Y5O A;  5DL9 A;  3AJN A;  1L55 A;  2BLX A;  1L61 A;  3WXU A;  104L A;  3B0I A;  1X05 A;  1ZMY L;  1QUG A;  4OW1 A;  1HEQ A;  4QJ4 B;  2MEG A;  1L96 A;  1X1G A;  188L A;  4DD7 A;  1F0W A;  2RH1 A;  4RLM A;  1QT7 A;  2CAY A;  1L66 A;  2I5F A;  1BB7 A;  1AZF A;  2ZQ4 A;  3W6F A;  1IY3 A;  1JSF A;  249L A;  3SNH A;  5KQ4 A;  2Q9E A;  1GB3 A;  3FM8 C;  2RBQ A;  3AW6 A;  1BWN A;  1KY0 A;  3ML4 A;  1CKC A;  1OUG A;  1KXX A;  2KGX B;  5JP4 A;  257L A;  2G4Q A;  6LYZ A;  1L19 A;  3CDQ A;  3PSC A;  3N7C A;  4W53 A;  4HB3 B;  1PFJ A;  4I7O A;  1L20 A;  1UA6 Y;  1L92 A;  1DI5 A;  2BPU A;  1XR0 B;  5D3W A;  195L A;  4DD1 A;  1L15 A;  3A67 Y;  1QSB A;  5LYZ A;  1REY A;  2Z59 A;  1XGP C;  2DQA A;  1G07 A;  1LHM A;  1GF4 A;  3SYX A;  4AXT A;  3GUI A;  1L25 A;  1LJG A;  3C80 A;  2O4W A;  4J0L A;  1P3R A;  1KW5 A;  1LGW A;  1L58 A;  2DFK A;  2DN6 A;  2K49 A;  5GOW B;  4NG1 A;  1OV7 A;  2FYD A;  3SB7 A;  1QDT A;  2F4G A;  1KNI A;  1QUT A;  4PPO A;  1L11 A;  4OWC A;  1L73 A;  4NGL A;  3LZ2 A;  1IEE A;  1L18 A;  2LC9 A;  2OE4 X;  149L A;  3K3T A;  1XJT A;  178L A;  4H8S A;  1LPY A;  1LYZ A;  3A91 A;  6LYT A;  176L A;  2IYB A;  3PP2 A;  4WMG A;  194L A;  2P8V A;  112L A;  5B1F A;  1JKD A;  3W6A A;  1GF7 A;  4O34 A;  3ZDT A;  2KCJ A;  1W1H A;  2DKV A;  3HUQ A;  5HE1 A;  1L56 A;  5FI0 A;  4HJZ A;  1LYH A;  3HBE X;  1P2R A;  1GFA A;  127L A;  1L99 A;  1HEN A;  4NGY A;  4LT2 A;  1V61 A;  1LMO A;  2A4T A;  3FI7 A;  1LZ4 A;  1XCG A;  2ZIL A;  4B4E A;  1FHX A;  2W2X C;  1L05 A;  1WGQ A;  228L A;  1IOT A;  1BWJ A;  1KS3 A;  2RVB B;  1DKK A;  2C8O A;  4DDB A;  1L01 A;  4NGW A;  1XGU C;  5J3Q A;  1SX2 A;  1XGR C;  5APE A;  5LAG A;  2CGI A;  1L65 A;  2BQK A;  2Q9D A;  4I7S A;  1GXV 2;  241L A;  4OT1 A;  4LYM A;  3G3W A;  5KXS A;  4YEO A;  1G1W A;  4DD3 A;  3P65 A;  4D9Z A;  4WSF A;  4UWV A;  1LJF A;  4N0J A;  5FEL A;  2COF A;  1PS5 A;  1NQI A;  1L39 A;  3SV1 A;  4WM3 A;  3C81 A;  2Z0Q A;  246L A;  4HP0 A;  2Q0M X;  4YM8 A;  2B6W A;  1QT8 A;  122L A;  2XQO A;  4HJV A;  2DHJ A;  3A58 A;  1WG7 A;  4OWH A;  3P68 A;  1GC6 A;  1C6H A;  4LFX A;  1SX7 A;  2H9J A;  4LDL A;  2EMT A;  1L84 A;  3HSA A;  2LZM A;  2D4K A;  2QKL A;  1B7R A;  1G0K A;  145L A;  3HIE A;  4G49 A;  4DC4 A;  1LJH A;  3HH5 A;  1UUZ C;  3DKE X;  4HB0 B;  4QJ5 B;  1QSW A;  3B0O A;  1NDG C;  1ZSQ A;  1LYF A;  213L A;  1LMA A;  1LZE A;  4N9R A;  2F2Q A;  1IOQ A;  1RFP A;  5F14 A;  2B6X A;  1JJ0 A;  1CTW A;  4HAV B;  4KHB B;  1VFB C;  1G0Q A;  2HED A;  5M4Y B;  2OTY X;  138L A;  4B6H A;  244L A;  1L37 A;  1BVK C;  1G0M A;  1V5M A;  1T8G A;  2YS3 A;  1V88 A;  4LDO A;  2GCJ A;  2BCJ A;  1HFZ A;  1T8A A;  3AZ7 A;  2HEE A;  1QTD A;  2W1M A;  3T06 A;  1L67 A;  2X18 A;  163L A;  3SB9 A;  4YXC A;  1C46 A;  243L A;  3EMS A;  3O96 A;  1GBO A;  2W1L A;  4ZFP A;  1L0K A;  4GLV A;  1L72 A;  4NWH A;  1M7R A;  2LYO A;  4Z2N A;  4HAZ B;  3PVW A;  1EQE A;  3C8R A;  1G0G A;  4R6C A;  1DQJ C;  239L A;  2RUK B;  3V5W A;  2LOZ A;  2K2U A;  1JTN A;  1KIQ C;  4YOP A;  141L A;  2RBR A;  201L A;  5D3V A;  103L A;  171L A;  3GUM A;  4DT3 A;  4W58 A;  4XJF A;  1JJ3 A;  2D9X A;  3HK0 A;  3C7Z A;  3CT1 A;  1WQQ A;  4XN6 A;  5KXW A;  3MPX A;  196L A;  1LHI A;  164L A;  3WU8 A;  4GN1 A;  1RRP B;  5KXX A;  1FOE A;  4A6K A;  2W1Y A;  4KPM A;  3PZD A;  1IP2 A;  1VAU A;  3A8Z A;  1D9U A;  1LZB A;  3P66 A;  3W3E A;  3RW8 A;  3SB8 A;  185L A;  169L A;  5C6I A;  1L12 A;  3DCX A;  207L A;  1BVX A;  1D6Q A;  2Y8G A;  4WM1 A;  2F32 A;  3HUK A;  1LWG A;  4IAS A;  4XJI A;  1BB3 A;  1OUB A;  1WJ1 A;  4WJ7 A;  5J3Y A;  1LTM A;  3G3X A;  1XKE A;  2MDX A;  4M6D A;  1LAA A;  1JWR A;  1L97 A;  4K17 A;  3CSZ A;  4HAX B;  1OUA A;  4ANR A;  4D6W A;  1IOS A;  4W51 A;  223L A;  2HUL A;  1C6K A;  3M1I B;  1H87 A;  1JIS A;  2XBR A;  3BKH A;  1L93 A;  3B6L A;  1C62 A;  3TMX A;  2COC A;  2LYZ A;  4H9A A;  3CT5 A;  2NZ8 B;  4EJN A;  5I4Y A;  215L A;  3WVY A;  2Z4D A;  1IO5 A;  1L43 A;  1BTN A;  4XJG A;  4OOT A;  245L A;  3F9L A;  1RJC B;  5D3X A;  4DBB A;  233L A;  2N5Z A;  216L A;  3WPK A;  1I20 A;  2ZQ3 A;  1L34 A;  4EXM A;  4XEN A;  1GE3 A;  5T3F A;  1L23 A;  1V89 A;  5KXT A;  3TMV A;  4NIJ A;  3A96 A;  5FHW A;  1FGZ A;  1CX7 A;  214L A;  4LT3 A;  1HNL A;  7LYZ A;  3GUP A;  3GYO A;  3GXR A;  1KI1 B;  1QTC A;  4NWE A;  1V5U A;  2B6T A;  3M3U A;  199L A;  155L A;  1OV5 A;  184L A;  3PG7 A;  1L03 A;  4R0F A;  3ZVQ A;  1IWY A;  3RZ4 A;  2GV0 A;  4OWA A;  1LJI A;  3U7D A;  4J1A A;  3IJU A;  1WQP A;  1L60 A;  3WMK A;  1IVM A;  3RU5 A;  2ZPY A;  4G4H A;  4WLX A;  1YIL A;  5IHG A;  3AB6 A;  4K2O A;  148L E;  1BGI A;  218L A;  159L A;  3NWF A;  1OVK A;  4RLN A;  4HSF A;  1V5P A;  2A7D A;  4WG1 A;  4J1B A;  1LJE A;  3TMU A;  3W6E A;  4Z46 A;  1PZY A;  1C08 C;  4ARL A;  2WAR A;  3HTG A;  237L A;  1HSW A;  1C63 A;  1GFJ A;  1LZC A;  4Z41 A;  2ZIJ A;  4MCK A;  3A98 B;  1PMS A;  1L71 A;  5JHG A;  3QIJ A;  4LDE A;  4DD0 A;  2RBN A;  217L A;  2LYM A;  3F8V A;  5EBH A;  4WLD A;  5KXM A;  5HNC A;  1L68 A;  1C6L A;  2ELB A;  2RSC A;  1NHB A;  226L A;  4TYZ A;  2Z39 A;  1LMP A;  180L A;  2D4I A;  2XJW A;  137L A;  4HV2 A;  177L A;  4H91 A;  1C6F A;  1G7J C;  2CJL A;  3ULB A;  2GJY A;  2BAA A;  1LJJ A;  2H5Z A;  3D4S A;  3AZ6 A;  250L A;  3LYM A;  4ML7 A;  3HT6 A;  4Y94 A;  2FJU B;  154L A;  1L76 A;  1BAK A;  1PQI A;  1L53 A;  1DKJ A;  4EPF A;  2K00 A;  2NTG A;  2Z0P A;  2NBV A;  3L2X A;  4H8X A;  1DRO A;  4AQN A;  4TTD A;  4NGO A;  3ODX A;  1U27 A;  3TXJ A;  1GBY A;  4G9S A;  3VW7 A;  1VDQ A;  4W55 A;  3C7W A;  4MR1 A;  4XJH A;  4PJZ A;  1W08 A;  4L41 A;  3A95 A;  5F9U A;  1FLY A;  3OHM B;  5LIN A;  2XQN M;  2I26 L;  2N0Y A;  1IWT A;  259L A;  3DMZ A;  4LT1 A;  5D5C A;  2COD A;  128L A;  3F6Z A;  2RBS A;  172L A;  2B74 A;  3T6U A;  1JIY A;  3AJ4 A;  1WQM A;  1IP4 A;  1I2H A;  1GB6 A;  1L33 A;  4ZEE A;  3OE6 A;  4P7I A;  1XGT C;  2PC2 A;  2W2X D;  2YBJ A;  1O23 A;  1CX6 A;  5KXK A;  5L3I A;  1G7L C;  3VWO A;  4E3U A;  1C6C A;  5KXO A;  1OUC A;  1GFG A;  1YAN A;  1C6T A;  4HPE A;  3J4G A;  4ARQ B;  5HLL A;  1LSC A;  3AYQ A;  1EAZ A;  3HBD A;  2M38 A;  3LYT A;  4Z98 A;  2HUM A;  1L70 A;  3SP3 A;  4N5R A;  1B5Z A;  4BS7 A;  150L A;  4B49 A;  1C6D A;  2D10 A;  1GF0 A;  3QNG A;  2HTH B;  108L A;  3TFM A;  205L A;  2OU0 X;  3K2R A;  5LA5 A;  1OUD A;  1QS5 A;  1VAT A;  2RRF A;  1L89 A;  2Z18 A;  4A6F B;  5C16 A;  4GNK B;  1B7P A;  1UIE A;  2PZ1 A;  1LJN A;  1T8F A;  1L52 A;  1GFH A;  119L A;  1GBS A;  1L04 A;  1RJ2 A;  1P56 A;  1RCM A;  1FHW A;  1TBY A;  1AM7 A;  1OP9 B;  2I5C A;  4EMO A;  1IC7 Y;  1IR7 A;  1YKY X;  5LOP B;  4NHQ A;  3GXK A;  2RB2 X;  1NU2 A;  1GF9 A;  4DD2 A;  4NY0 A;  4EKU A;  1GEZ A;  143L A;  1JUG A;  166L A;  2EKS C;  4TUN A;  4U3X B;  1UEF A;  2D11 A;  4DJH A;  1GHL A;  3WUM A;  2HEB A;  1LW9 A;  1C65 A;  1LI2 A;  2DHI A;  1OY2 A;  5CLQ B;  2B5Z A;  4GCB A;  1DI4 A;  1P64 A;  4NY5 A;  1MEL L;  5IEL A;  1QTB A;  5A3E A;  3DN1 A;  1LSG A;  4PJ2 C;  2LYD A;  4H9F A;  1UIA A;  4CFP A;  2ZIK A;  4RW1 A;  2R2Y A;  2VRW B;  3HTD A;  4MST A;  4LZT A;  1AT6 A;  1CNS A;  1X86 A;  4GMV A;  4NGJ A;  1MK7 B;  3TXD A;  2A7F A;  1C6N A;  2BQE A;  3BIN A;  4CHJ A;  211L A;  1DYD A;  2BQO A;  1L40 A;  2D6B A;  2F2N A;  3U8Z A;  1N3H A;  1XEJ A;  2VSZ A;  1EVH A;  4I7P A;  4YXA C;  1OQM A;  1JIT A;  1CV0 A;  1B7N A;  3HQC A;  1L83 A;  5DI9 B;  4I7N A;  5I5Q A;  3ATO A;  2R09 A;  4H9E A;  1JSE A;  3JR6 A;  3SO6 A;  2KUQ A;  1FDL Y;  4YF2 A;  5ILF A;  5JEN B;  4KT3 A;  2ELA A;  129L A;  4I7R A;  2XTH A;  4ETD A;  1NBY C;  1C6E A;  3PVL A;  1LZR A;  1QTZ A;  1NDM C;  3TXB A;  4WM5 A;  4ETE A;  2ZWB A;  3MDB C;  4LGK A;  4PQ0 A;  1L08 A;  2RNR B;  4LT0 A;  1XEK A;  1QC6 A;  4IFS A;  5C5B A;  3KRX A;  2M14 A;  4HHV A;  2I1K A;  1ZM0 A;  4N1C C;  160L A;  3TVV A;  3D9A C;  3KSY A;  1L30 A;  4NHT A;  3PBL A;  1UNP A;  3B77 A;  1QDR A;  1DZB X;  1ZYT A;  3AW7 A;  4YL8 A;  1PQO A;  1CU5 A;  1J19 A;  3RZE A;  1UIF A;  4XAD A;  1CJ7 A;  4DX8 A;  3IJV A;  1L87 A;  3TCA A;  1FLU A;  2EIZ C;  4UWN A;  4WLT A;  1GE2 A;  1GAY A;  4L6E A;  1GFE A;  1B2K A;  1YQV Y;  1OVJ A;  1VED A;  4GN3 A;  1UC0 A;  3TXE A;  4B0D A;  2L2I A;  1L63 A;  3CDV A;  3N9E A;  1L86 A;  4KVG B;  4EKP A;  4LYO A;  4HAW B;  2CY5 A;  3DXD A;  5FDJ A;  3G3V A;  4NSG A;  1C6A A;  1C64 A;  1X1F A;  1C43 A;  4D0N B;  1OMW A;  1G06 A;  1QSA A;  4WO9 A;  2VKI A;  3HT7 A;  4GOU A;  1ALC A;  1REZ A;  4H90 A;  1LZ6 A;  4S0W A;  1KZ7 A;  1DPW A;  1L00 A;  5DN5 A;  5B06 A;  230L A;  2BQL A;  1B0D A;  2JP2 A;  1U29 A;  3KY9 A;  2ZYC A;  1CU6 A;  4HAU B;  4LYZ A;  183L A;  1KW7 A;  4A7D A;  1L02 A;  5LVG A;  7LZM A;  3A6B Y;  1LSN A;  1B7M A;  1LHK A;  5LA8 A;  3NYA A;  1XEI A;  1C45 A;  6LZM A;  1LYS A;  1L16 A;  1LMN A;  2OQB A;  3OE8 A;  4HB4 B;  2YSZ A;  1UPQ A;  4XWX A;  2DKQ A;  3W6C A;  3AGG G;  1IR9 A;  4HDO A;  1ZWN A;  1IP1 A;  1Z87 A;  5J7C A;  4W57 A;  2FBB A;  3HH3 A;  242L A;  2ZKM X;  1FB8 A;  2Z38 A;  2UVM A;  5DHF B;  2J0M A;  5C5B B;  1INU A;  3DN8 A;  1LHH A;  1MI1 A;  1FGY A;  3HH4 A;  225L A;  3MGW A;  1JHL A;  1LYE A;  3HUA A;  3TXK A;  2RBO A;  1C10 A;  4OO9 A;  1P5C A;  1D0K A;  1CJ9 A;  2F47 A;  3WA0 A;  167L A;  5D27 A;  5KQ1 A;  4H9B A;  4C0A A;  115L A;  4YX7 C;  1GC7 A;  1NHE A;  5FST A;  1E8L A;  2RGN B;  2YDG A;  1QUO A;  3OE0 A;  3HW2 B;  3F5R A;  1B5Y A;  5DM9 A;  4E97 A;  140L A;  3A94 A;  1AKI A;  1LZN A;  1DI3 A;  2YS1 A;  1JTP L;  3NY8 A;  1YKZ X;  4B4J A;  4HTK A;  2RBP A;  2YBM A;  4ARM A;  4WVF B;  5F9X A;  4W52 A;  1L09 A;  1GB5 A;  1HFX A;  4ETA A;  3TW1 A;  1NTV A;  1C6P A;  1IIZ A;  1D3J A;  1IR8 A;  3GUN A;  1U5F A;  2MEA A;  3DN6 A;  4ARJ A;  4BAP A;  3ODW A;  4N8Z A;  2YBN A;  3IWR A;  5I54 A;  118L A;  1UIC A;  1I7A A;  3VIA A;  5DHA B;  4QXA B;  1C6B A;  4J7V A;  2KIE A;  5HMV A;  4IOY X;  102L A;  1IP7 A;  1WTN A;  1JKC A;  2D4J A;  1CKD A;  2BQN A;  3WYF B;  2HEF A;  2EQL A;  1G7I C;  187L A;  1L91 A;  1G0L A;  4H8Y A;  3CSQ A;  1G7H C;  5LXW A;  3X23 A;  4AGA A;  1WGU A;  1WQO A;  3OK0 A;  1LMT A;  1WTM A;  2B6Z A;  1U5E A;  4NSH A;  126L A;  2C8P A;  1QUH A;  3QE8 A;  1J1P Y;  3DXC A;  175L A;  1TDY A;  1MK9 B;  4F7G A;  189L A;  3U12 A;  4GCE A;  1L48 A;  1L17 A;  4TKN A;  1G7M C;  1LSM A;  4WO6 A;  190L A;  1QT6 A;  5KXP A;  4ET9 A;  2G4N A;  2B72 A;  2OU8 A;  4F7U P;  1H10 A;  1GE0 A;  1H4R A;  4GXB A;  1DYN A;  1XD4 A;  4LZM A;  1B55 A;  3KZ1 A;  1BWH A;  5HE2 A;  255L A;  4I7M A;  4GCF A;  2DQJ Y;  4I7T A;  4PGJ B;  222L A;  261L A;  238L A;  2DQH Y;  1CKF A;  3CDT A;  113L A;  2QAR C;  153L A;  1CVK A;  2HEA A;  5CLL B;  1B7O A;  5L9J A;  1KIP C;  4KHO A;  1QQG A;  2Z2F A;  1OUH A;  1GPQ C;  1DYA A;  4UWU A;  4H9C A;  5KXR A;  4IJ4 A;  4GCC A;  168L A;  2ANV A;  1KXW A;  1L54 A;  134L A;  3V2Y A;  2CDS A;  1K5D B;  1FLQ A;  1QIO A;  3HDE A;  2NTH A;  1GBX A;  1T6H A;  1KIR C;  3RT5 X;  1L35 A;  2O79 A;  2Z12 A;  3WXT A;  1P3N A;  4KXI A;  5F16 A;  1EPY A;  1JTO L;  2DTC A;  3N9C A;  3FA0 A;  2P0H A;  1T6V L;  3WPL A;  5I2S A;  4PRQ A; 
#chains in the Genus database with same CATH homology
 4QDN A;  3N9A A;  2MFQ A;  1B6I A;  3G3A B;  5DLA A;  4EKQ A;  3GUO A;  4HJY A;  4QY9 A;  1P37 A;  1PQJ A;  1YAP A;  4PRU A;  1BQL Y;  1B5W A;  5I53 A;  1B5X A;  1GXX A;  1YAM A;  1BTK A;  1TQZ A;  1C60 A;  3HU8 A;  4CHX A;  4C5F A;  3PVU A;  5J3T A;  4ZRI A;  4TSB A;  142L A;  3LN2 A;  4CFO A;  1IWU A;  4WM4 A;  4DDC A;  1ZC3 B;  1C6I A;  1L31 A;  1DPX A;  2ROZ B;  1F6R A;  1L45 A;  2X0A A;  2BQB A;  2Y7B A;  1GFU A;  2DQE Y;  4MT7 A;  3B72 A;  3A92 A;  2Z37 A;  3DMV A;  4GN5 C;  4HTN A;  1HEP A;  1IOC A;  4EJ4 A;  229L A;  1GF8 A;  132L A;  3AZ5 A;  1HEL A;  1L80 A;  1QSQ A;  1HEW A;  2HTX A;  3QAK A;  3ZVR A;  5L3H A;  3HFM Y;  9LYZ A;  1RE2 A;  4EOF A;  2AEH A;  1ZC4 B;  1YAQ A;  2DYN A;  1BB6 A;  1I6S A;  2HEC A;  1MIX A;  4I7K A;  1L82 A;  1LSP A;  2BQM A;  1OUF A;  5HQ1 A;  1UIB A;  1T97 A;  4LYB A;  3TO1 A;  1W6Z A;  2DX5 A;  2O7A A;  4DKL A;  2J0J A;  1L22 A;  5B1G A;  4ZPU A;  1LW3 A;  1P46 A;  161L A;  3SB6 A;  2CWI A;  1IC4 Y;  1WQR A;  3QBV B;  1G1V A;  4YEN A;  2DHK A;  2D9Z A;  1JTT L;  2LCB A;  208L A;  1SWZ A;  2BQD A;  3P4Z A;  1L10 A;  1HF4 A;  4FJR A;  111L A;  1P36 A;  3D3D A;  4HDQ A;  173L A;  1IWX A;  3CT0 A;  5D5F A;  5AMY A;  3ZVQ B;  1V7T A;  2QB0 B;  2OTX A;  1SSW A;  3A6C Y;  1WJM A;  1X11 A;  3RUN A;  1HHL A;  252L A;  147L A;  2V76 A;  1ZVR A;  1D9W A;  1EQ4 A;  4ZRJ A;  158L A;  1FN5 A;  1CV5 A;  1GEV A;  1VDP A;  2LZ2 A;  107L A;  4DDA A;  162L A;  2DKP A;  3QY4 A;  1NTY A;  3D8D A;  1FLW A;  2QKM A;  1CUP A;  1L38 A;  1LI3 A;  1HML A;  4G4B A;  4PK0 A;  2BQC A;  1LZ1 A;  1WQN A;  4CYE A;  1FKQ A;  5E4P A;  2H7E A;  1NBZ C;  2I1J A;  4W96 A;  4H1P A;  2YBI A;  1A4V A;  1GB2 A;  1LSF A;  3RNX A;  3WW5 A;  4H9I A;  1P2C C;  1LJK A;  2IFS A;  3G3B B;  110L A;  1XGQ C;  1TCY A;  209L A;  3UON A;  4XYY A;  4TSC A;  1HMK A;  2Z0O A;  3ODO A;  5LYM A;  3SUZ A;  1JKA A;  1LWK A;  3DN2 A;  1L95 A;  1LMC A;  4W94 A;  2ZNX Y;  4GBR B;  5II3 A;  4QGZ A;  1QQY A;  1GBZ A;  4QEQ A;  133L A;  4WOA A;  1LSZ A;  2LHM A;  4GN4 A;  2D2Q A;  3WH1 A;  2LZT A;  2J59 M;  2BLY A;  4I7Q A;  1OUJ A;  1UBZ A;  5C6J A;  2YBH A;  1E5W A;  1C6M A;  4CHM A;  3EML A;  4DQ7 A;  4N1E I;  4RDS A;  2DX1 A;  1JJ1 A;  4EPI A;  3VOQ A;  1LJ4 A;  2NMB A;  5FI1 A;  2AUB A;  1LZ8 A;  135L A;  1NI2 A;  123L A;  1L75 A;  1JKB A;  2CUU A;  2KUP A;  1OWZ A;  193L A;  3L64 A;  1IWV A;  235L A;  1B7L A;  1OYU A;  3WYH A;  1MAI A;  1LLH A;  5APD A;  2MKR A;  3A34 A;  1F10 A;  4DAJ A;  1W1G A;  4DD9 A;  2MEB A;  4I7L A;  1ZUR A;  4DYG A;  5APF A;  1CU2 A;  260L A;  4I7J A;  3GUK A;  2DYQ A;  2HU3 A;  1GFT A;  2YF0 A;  1L14 A;  2GCL A;  1K28 A;  2EJ8 A;  1OUE A;  1VDT A;  1L07 A;  1IP5 A;  3WW6 A;  5B05 A;  4DX9 0;  151L A;  1GFV A;  1VDS A;  1ZV5 L;  2G4P A;  231L A;  4A6H A;  1QTV A;  3C83 A;  2DQF C;  2EPE A;  3TMW A;  1L64 A;  3AZ4 A;  3CDR A;  1WTH A;  1EQ5 A;  3A93 A;  5EFX A;  3LYZ A;  3HTF A;  4HPI A;  1LSY A;  2DQG Y;  1YL0 X;  2YVB A;  4NGK A;  3ZEK A;  1C6J A;  3P6A A;  4CJ2 A;  2UZR A;  1HSX A;  3HT8 A;  2DQI Y;  2RAY X;  174L A;  2UZS A;  1GD6 A;  1XFP L;  3DN0 A;  1L06 A;  3D8E A;  157L A;  4KL7 A;  1LYG A;  1OUI A;  3SB5 A;  1FHO A;  4DWX A;  1LYY A;  220L A;  2W1X A;  3RCP A;  2D91 A;  3SBB C;  4H92 A;  1CV4 A;  1LKR A;  2BQA A;  4HTQ A;  4BAF A;  3GUL A;  1L88 A;  2I25 L;  2P0D A;  3BJI A;  1LSA A;  5KJ9 A;  3T36 A;  2AL6 A;  2D9Y A;  4NSW A;  5DH9 B;  1I1Z A;  1YKX X;  1Y19 B;  4ETB A;  1KXY A;  3BKV A;  2BQJ A;  1A2Y C;  1PQD A;  1IOR A;  1L36 A;  4NGZ A;  144L A;  2ROV A;  5LVK A;  120L A;  1WI1 A;  1D2Y A;  2H7D A;  3A8P A;  3LJU X;  1DDW A;  3P64 A;  4DXA B;  4HV1 A;  1FKV A;  4MK0 A;  3C8Q A;  1DYB A;  2DBT A;  3CIK A;  1EGX A;  1L85 A;  4GCD A;  1L27 A;  4WM2 A;  2Z6B A;  3J6K A;  1L77 A;  4XJB A;  1B7S A;  1P2L A;  1REM A;  4HB2 B;  1L24 A;  1MLC E;  5IDD A;  5F81 A;  4NSJ A;  5HNL A;  2IHL A;  1QT5 A;  224L A;  5M1Y A;  1C61 A;  1L28 A;  1LI6 A;  1JQU A;  3EO5 A;  2Q13 A;  152L A;  262L A;  3CQL A;  3WPJ A;  2RSG A;  1SWY A;  3AU5 A;  4YON A;  2B75 A;  3WUA A;  1SGH A;  2LG1 A;  2DLW A;  3FEH A;  210L A;  1EF1 A;  1DYG A;  1LYO A;  2YS5 A;  1T3P A;  3EXD A;  3OAN A;  4F7H A;  1P7S A;  4NHP A;  5I4X A;  1GB8 A;  1SSY A;  1LB1 A;  1GF5 A;  2R0D A;  4ARP A;  3HT9 A;  1AWE A;  3HWL A;  2ADZ A;  4MY6 A;  5I4W A;  5LVJ A;  1OVH A;  2H9K A;  2YRY A;  1L98 A;  5LIO A;  2DQC Y;  1LGX A;  1NMM A;  1LZG A;  3WUL A;  1LYD A;  4WLY A;  3M18 B;  1BHZ A;  3HU9 A;  1MPH A;  5C6R A;  4NGV A;  2DQD Y;  3TXF A;  1AT5 A;  1SHC A;  1N4F A;  2MEE A;  4YEM A;  1P6S A;  1GF3 A;  2OTZ X;  5K7O A;  1L47 A;  1V7S A;  4WG7 A;  5JLJ B;  4PNK A;  4TWS A;  1WVV A;  5FCP A;  3CXB B;  5LAF A;  1UNR A;  4M4O A;  5DN4 A;  3KRW A;  3DN4 A;  5LON B;  2J0K A;  1LKS A;  1LYJ A;  4W59 A;  4G4C A;  156L A;  2OU9 A;  3LYO A;  1D0M A;  130L A;  1L32 A;  2BQH A;  2IFF Y;  1IX0 A;  3P7Z A;  206L A;  5FEK A;  1D6P A;  2YVC A;  1ZVH L;  2Y8F A;  1GE4 A;  2EMS A;  1XX0 A;  2COA A;  2L1C A;  1JPO A;  5C79 A;  3OE9 A;  2HU1 A;  1UNQ A;  1C66 A;  2L78 A;  1CKH A;  1IP3 A;  1C7P A;  192L A;  4Z3M A;  1LZY A;  3HH6 A;  248L A;  1PQK A;  1QTE A;  1D3M A;  1G0J A;  8LYZ A;  1L51 A;  181L A;  4B1A A;  1YAO A;  4TX7 A;  2FBD A;  256L A;  3LZT A;  1SQ2 L;  1I56 A;  2MEH A;  182L A;  109L A;  1UIH A;  5HMJ A;  1L0J A;  258L A;  3HBH A;  1L21 A;  1KZG A;  3C82 A;  1LPI A;  4EKR A;  1C67 A;  1DDM A;  4EMN A;  1C6Q A;  3IVF A;  3DXE A;  1BWI A;  4LYT A;  4BAD A;  1ISN A;  1D3F A;  4A5K A;  3A3R X;  3C7Y A;  1LZA A;  4GLA A;  5L81 A;  1LZD A;  1LSE A;  1B7Q A;  1L26 A;  1SLY A;  4X3B A;  1GB9 A;  3WL2 A;  212L A;  1TEW A;  1K5G B;  1FBI X;  1XEP A;  4W54 A;  198L A;  1DYE A;  4RW2 A;  4H9H A;  1DBH A;  5KCV A;  1LZ9 A;  3FAD A;  234L A;  5JHH A;  1CJ6 A;  1HEO A;  2E2X A;  1QT3 A;  3GYP A;  1F6S A;  2OEA X;  2F4A A;  3WU9 A;  1L29 A;  5LVH A;  3WU7 A;  2YBL A;  4W56 A;  5HE0 A;  4WM6 A;  1L69 A;  4LFP A;  3A90 A;  1L90 A;  4EKS A;  1IWW A;  1GE1 A;  219L A;  4IAP A;  5LZM A;  4K5Y A;  2B6Y A;  4ARM B;  4WL7 A;  1L59 A;  3DMX A;  1RI8 B;  1L57 A;  1U2B A;  2HUB A;  4GMX B;  2FYC A;  2HUK A;  4NFV A;  2Y8P A;  2MED A;  3CDO A;  3SN6 R;  1TLA A;  1P6Y A;  2B7X A;  3A8Q A;  1JTM A;  1LZS A;  4HAY B;  1CV6 A;  3NY9 A;  1L50 A;  3WUN A;  1Q67 A;  1GDX A;  1C68 A;  1GF6 A;  2LOX A;  2NWD X;  1B9O A;  3DNA A;  5KXN A;  3TXI A;  4NSI A;  1U5G A;  2OE9 X;  4P2E A;  3G9W A;  3LZM A;  1BB4 A;  4DQJ A;  1L41 A;  1CUQ A;  1LZT A;  1L46 A;  1WVU A;  1JEF A;  240L A;  1UPR A;  4I8S A;  2RAZ X;  4K81 A;  5C6L A;  1GAZ A;  1UCO A;  1GFR A;  236L A;  191L A;  1NWG A;  4ZIX A;  1TJ6 A;  4LYC A;  1UIG A;  1J1X Y;  1IRS A;  2VB1 A;  186L A;  3V2W A;  1QTK A;  1L49 A;  2HE7 A;  1DXJ A;  125L A;  2B73 A;  3TXH A;  5KKJ A;  1LCN A;  1PLS A;  2LKO A;  3GUJ A;  3HDF A;  1GB7 A;  4DQ5 A;  1CKG A;  1CU3 A;  2EC1 A;  1LMQ A;  1LSB A;  2FJL A;  4ARQ A;  1C69 A;  1QT4 A;  3UZT A;  146L A;  2MEC A;  1LZ5 A;  1YIK A;  1P5T A;  4K2P A;  4NHS A;  5KXL A;  1AQC A;  4HAT B;  1WVH A;  4H94 A;  2RLO A;  1D0L A;  1CU0 A;  5APC A;  1L44 A;  1L79 A;  4II8 A;  2RB0 X;  2CY4 A;  4A6F A;  1J1O Y;  2CRF A;  4I0C A;  1MIZ B;  4NEB A;  5KY1 A;  2G35 A;  1LSD A;  1XJU A;  1HEM A;  1GFK A;  5KXZ A;  1LOZ A;  227L A;  1DDV A;  2ZNW Y;  3LHM A;  2F30 A;  3KAM A;  200L A;  1GG3 A;  2D9W A;  4IAT A;  1NF5 A;  2Z2E A;  3FSS A;  1LGU A;  5I14 A;  1REX A;  1IWZ A;  3QWM A;  1H6M A;  2ZYP A;  4OOO A;  5B59 A;  1DYC A;  1CJ8 A;  4XJD A;  2LUL A;  1IC5 Y;  1XOD A;  5B07 A;  1PQM A;  1OWY A;  3W6B A;  1FAO A;  1D2W A;  5KKI A;  3CSR A;  1CV1 A;  4C3W A;  4OWE A;  2ANX A;  3PDS A;  1G0P A;  247L A;  5ILC A;  2K2J A;  1ZVY B;  131L A;  3A3Q A;  3F0W A;  3OJP A;  2RB1 X;  5LVI A;  165L A;  1OQN A;  139L A;  1BB5 A;  4GRV A;  4ETC A;  3ATN A;  1LHL A;  1Z55 A;  1EL1 A;  1IY4 A;  1UAC Y;  3ODU A;  3C8S A;  1HFY A;  5KXY A;  114L A;  3AU4 A;  3FI5 A;  4KHA A;  1GB0 A;  2YSS C;  3DN3 A;  2YT0 A;  1LJ3 A;  1B5V A;  2Z19 A;  3E3D A;  1TAY A;  2B70 A;  4ZRK A;  1L13 A;  1J0W A;  4Z2M B;  1D3N A;  4CGE A;  2IGC A;  254L A;  170L A;  4NHI A;  4GPT B;  3NSU A;  4OWB A;  1HER A;  197L A;  1NKH A;  3D8F A;  2BQI A;  1UID A;  1LHJ A;  1QUS A;  3W6D A;  3AGI A;  1GDW A;  1C6G A;  3B0K A;  1HC0 A;  1M7E A;  1LYI A;  4GZU A;  1GBW A;  5LYT A;  5HE3 A;  1L74 A;  2DA0 A;  1L94 A;  4FDY A;  5DIF B;  4ET8 A;  1QS9 A;  3SBA A;  1L81 A;  4H8Z A;  221L A;  4KAX B;  2BQF A;  1DYF A;  4WL6 A;  253L A;  2D9V A;  2XBS A;  232L A;  1L62 A;  1QTH A;  3EBA B;  1GWD A;  4PHI A;  1MKE A;  1B5U A;  1TXD A;  251L A;  1YL1 X;  2BQG A;  2OE7 X;  3TXG A;  3FE0 A;  1YRO A;  1QUD A;  4H93 A;  5A3Z A;  3ULC A;  5E9R A;  4B4I A;  4NG8 A;  1XSF A;  1IP6 A;  3ULR A;  3HTB A;  5D3Y A;  2D4Q A;  2N23 A;  1U5D A;  4BBK A;  2W2W A;  1L42 A;  1W1D A;  2YT1 A;  1KY1 A;  3AGH A;  2MEI A;  2GS0 A;  2MEF A;  2MWN B;  2P0F A;  3PEG A;  3CB7 A;  1CV3 A;  4NGI A;  3WVX A;  2I6Z A;  1Y5O A;  5DL9 A;  3AJN A;  1L55 A;  2BLX A;  1L61 A;  3WXU A;  104L A;  3B0I A;  1X05 A;  1ZMY L;  1QUG A;  4OW1 A;  1HEQ A;  2MEG A;  1L96 A;  1X1G A;  188L A;  4DD7 A;  1F0W A;  2RH1 A;  4RLM A;  1QT7 A;  2CAY A;  1L66 A;  2I5F A;  1BB7 A;  1AZF A;  2ZQ4 A;  3W6F A;  1IY3 A;  1JSF A;  249L A;  3SNH A;  5KQ4 A;  2Q9E A;  1GB3 A;  3FM8 C;  2RBQ A;  3AW6 A;  1BWN A;  1KY0 A;  3ML4 A;  1CKC A;  1OUG A;  1KXX A;  2KGX B;  5JP4 A;  257L A;  2G4Q A;  6LYZ A;  1L19 A;  3CDQ A;  3PSC A;  3N7C A;  4W53 A;  4HB3 B;  1PFJ A;  4I7O A;  1L20 A;  1UA6 Y;  1L92 A;  1DI5 A;  2BPU A;  1XR0 B;  5D3W A;  195L A;  4DD1 A;  1L15 A;  3A67 Y;  1QSB A;  5LYZ A;  1REY A;  1XGP C;  2DQA A;  1G07 A;  1LHM A;  1GF4 A;  3SYX A;  4AXT A;  3GUI A;  1L25 A;  1LJG A;  3C80 A;  2O4W A;  4J0L A;  1P3R A;  1KW5 A;  1LGW A;  1L58 A;  2DFK A;  2DN6 A;  5GOW B;  4NG1 A;  1OV7 A;  2FYD A;  3SB7 A;  1QDT A;  2F4G A;  1KNI A;  1QUT A;  4PPO A;  1L11 A;  4OWC A;  1L73 A;  4NGL A;  3LZ2 A;  1IEE A;  1L18 A;  2LC9 A;  2OE4 X;  149L A;  3K3T A;  1XJT A;  178L A;  4H8S A;  1LPY A;  1LYZ A;  3A91 A;  6LYT A;  176L A;  2IYB A;  3PP2 A;  4WMG A;  194L A;  2P8V A;  112L A;  5B1F A;  1JKD A;  3W6A A;  1GF7 A;  4O34 A;  3ZDT A;  2KCJ A;  1W1H A;  2DKV A;  3HUQ A;  5HE1 A;  1L56 A;  5FI0 A;  4HJZ A;  1LYH A;  3HBE X;  1P2R A;  1GFA A;  127L A;  1L99 A;  1HEN A;  4NGY A;  4LT2 A;  1V61 A;  1LMO A;  2A4T A;  3FI7 A;  1LZ4 A;  1XCG A;  2ZIL A;  4B4E A;  1FHX A;  2W2X C;  1L05 A;  1WGQ A;  228L A;  1IOT A;  1BWJ A;  1KS3 A;  2RVB B;  1DKK A;  2C8O A;  4DDB A;  1L01 A;  4NGW A;  1XGU C;  5J3Q A;  1SX2 A;  1XGR C;  5APE A;  5LAG A;  2CGI A;  1L65 A;  2BQK A;  2Q9D A;  4I7S A;  1GXV 2;  241L A;  4LYM A;  3G3W A;  5KXS A;  4YEO A;  1G1W A;  4DD3 A;  3P65 A;  4D9Z A;  4WSF A;  4UWV A;  1LJF A;  4N0J A;  5FEL A;  2COF A;  1PS5 A;  1NQI A;  1L39 A;  3SV1 A;  4WM3 A;  3C81 A;  2Z0Q A;  246L A;  4HP0 A;  2Q0M X;  4YM8 A;  2B6W A;  1QT8 A;  122L A;  2XQO A;  4HJV A;  2DHJ A;  1WG7 A;  4OWH A;  3P68 A;  1GC6 A;  1C6H A;  4LFX A;  1SX7 A;  2H9J A;  4LDL A;  2EMT A;  1L84 A;  2LZM A;  2D4K A;  2QKL A;  1B7R A;  1G0K A;  145L A;  4G49 A;  4DC4 A;  1LJH A;  3HH5 A;  1UUZ C;  3DKE X;  4HB0 B;  1QSW A;  3B0O A;  1NDG C;  1ZSQ A;  1LYF A;  213L A;  1LMA A;  1LZE A;  4N9R A;  2F2Q A;  1IOQ A;  1RFP A;  5F14 A;  2B6X A;  1JJ0 A;  1CTW A;  4HAV B;  4KHB B;  1VFB C;  1G0Q A;  2HED A;  2OTY X;  138L A;  4B6H A;  244L A;  1L37 A;  1BVK C;  1G0M A;  1V5M A;  1T8G A;  2YS3 A;  1V88 A;  4LDO A;  2GCJ A;  2BCJ A;  1HFZ A;  1T8A A;  3AZ7 A;  2HEE A;  1QTD A;  2W1M A;  3T06 A;  1L67 A;  2X18 A;  163L A;  3SB9 A;  4YXC A;  1C46 A;  243L A;  3EMS A;  3O96 A;  1GBO A;  2W1L A;  4ZFP A;  1L0K A;  4GLV A;  1L72 A;  4NWH A;  1M7R A;  2LYO A;  4Z2N A;  4HAZ B;  3PVW A;  1EQE A;  3C8R A;  1G0G A;  4R6C A;  1DQJ C;  239L A;  2RUK B;  3V5W A;  2LOZ A;  2K2U A;  1JTN A;  1KIQ C;  4YOP A;  141L A;  2RBR A;  201L A;  5D3V A;  103L A;  171L A;  3GUM A;  4DT3 A;  4W58 A;  4XJF A;  1JJ3 A;  2D9X A;  3HK0 A;  3C7Z A;  3CT1 A;  1WQQ A;  4XN6 A;  5KXW A;  3MPX A;  196L A;  1LHI A;  164L A;  3WU8 A;  4GN1 A;  1RRP B;  5KXX A;  1FOE A;  4A6K A;  2W1Y A;  4KPM A;  3PZD A;  1IP2 A;  1VAU A;  3A8Z A;  1D9U A;  1LZB A;  3P66 A;  3W3E A;  3RW8 A;  3SB8 A;  185L A;  169L A;  5C6I A;  1L12 A;  207L A;  1BVX A;  1D6Q A;  2Y8G A;  4WM1 A;  2F32 A;  3HUK A;  1LWG A;  4IAS A;  4XJI A;  1BB3 A;  1OUB A;  1WJ1 A;  4WJ7 A;  5J3Y A;  1LTM A;  3G3X A;  1XKE A;  2MDX A;  4M6D A;  1LAA A;  1JWR A;  1L97 A;  4K17 A;  3CSZ A;  4HAX B;  1OUA A;  4ANR A;  1IOS A;  4W51 A;  223L A;  2HUL A;  1C6K A;  3M1I B;  1H87 A;  1JIS A;  2XBR A;  3BKH A;  1L93 A;  3B6L A;  1C62 A;  3TMX A;  2COC A;  2LYZ A;  4H9A A;  3CT5 A;  2NZ8 B;  4EJN A;  5I4Y A;  215L A;  3WVY A;  1IO5 A;  1L43 A;  1BTN A;  4XJG A;  4OOT A;  245L A;  3F9L A;  1RJC B;  5D3X A;  4DBB A;  233L A;  2N5Z A;  216L A;  3WPK A;  1I20 A;  2ZQ3 A;  1L34 A;  4EXM A;  4XEN A;  1GE3 A;  5T3F A;  1L23 A;  1V89 A;  5KXT A;  3TMV A;  4NIJ A;  3A96 A;  5FHW A;  1FGZ A;  1CX7 A;  214L A;  4LT3 A;  1HNL A;  7LYZ A;  3GUP A;  3GYO A;  3GXR A;  1KI1 B;  1QTC A;  4NWE A;  1V5U A;  2B6T A;  3M3U A;  199L A;  155L A;  1OV5 A;  184L A;  3PG7 A;  1L03 A;  4R0F A;  3ZVQ A;  1IWY A;  3RZ4 A;  2GV0 A;  4OWA A;  1LJI A;  3U7D A;  4J1A A;  3IJU A;  1WQP A;  1L60 A;  3WMK A;  1IVM A;  3RU5 A;  2ZPY A;  4G4H A;  4WLX A;  1YIL A;  5IHG A;  3AB6 A;  4K2O A;  148L E;  1BGI A;  218L A;  159L A;  1OVK A;  4RLN A;  4HSF A;  1V5P A;  2A7D A;  4WG1 A;  4J1B A;  1LJE A;  3TMU A;  3W6E A;  4Z46 A;  1PZY A;  1C08 C;  4ARL A;  2WAR A;  3HTG A;  237L A;  1HSW A;  1C63 A;  1GFJ A;  1LZC A;  4Z41 A;  2ZIJ A;  4MCK A;  3A98 B;  1PMS A;  1L71 A;  5JHG A;  3QIJ A;  4LDE A;  4DD0 A;  2RBN A;  217L A;  2LYM A;  3F8V A;  5EBH A;  4WLD A;  5KXM A;  5HNC A;  1L68 A;  1C6L A;  2ELB A;  2RSC A;  1NHB A;  226L A;  4TYZ A;  2Z39 A;  1LMP A;  180L A;  2D4I A;  2XJW A;  137L A;  4HV2 A;  177L A;  4H91 A;  1C6F A;  1G7J C;  2CJL A;  3ULB A;  2GJY A;  2BAA A;  1LJJ A;  2H5Z A;  3D4S A;  3AZ6 A;  250L A;  3LYM A;  4ML7 A;  3HT6 A;  4Y94 A;  154L A;  1L76 A;  1BAK A;  1PQI A;  1L53 A;  1DKJ A;  4EPF A;  2K00 A;  2NTG A;  2Z0P A;  3L2X A;  4H8X A;  1DRO A;  4AQN A;  4TTD A;  4NGO A;  3ODX A;  1U27 A;  3TXJ A;  1GBY A;  4G9S A;  3VW7 A;  1VDQ A;  4W55 A;  3C7W A;  4MR1 A;  4XJH A;  4PJZ A;  1W08 A;  4L41 A;  3A95 A;  5F9U A;  1FLY A;  5LIN A;  2XQN M;  2I26 L;  2N0Y A;  1IWT A;  259L A;  3DMZ A;  4LT1 A;  5D5C A;  2COD A;  128L A;  3F6Z A;  2RBS A;  172L A;  2B74 A;  3T6U A;  1JIY A;  3AJ4 A;  1WQM A;  1IP4 A;  1I2H A;  1GB6 A;  1L33 A;  4ZEE A;  3OE6 A;  4P7I A;  1XGT C;  2PC2 A;  2W2X D;  2YBJ A;  1O23 A;  1CX6 A;  5KXK A;  5L3I A;  1G7L C;  3VWO A;  4E3U A;  1C6C A;  5KXO A;  1OUC A;  1GFG A;  1YAN A;  1C6T A;  4HPE A;  3J4G A;  4ARQ B;  5HLL A;  1LSC A;  3AYQ A;  1EAZ A;  3HBD A;  2M38 A;  3LYT A;  4Z98 A;  2HUM A;  1L70 A;  3SP3 A;  4N5R A;  1B5Z A;  4BS7 A;  150L A;  4B49 A;  1C6D A;  2D10 A;  1GF0 A;  3QNG A;  2HTH B;  108L A;  3TFM A;  205L A;  2OU0 X;  3K2R A;  5LA5 A;  1OUD A;  1QS5 A;  1VAT A;  1L89 A;  2Z18 A;  4A6F B;  5C16 A;  1B7P A;  1UIE A;  2PZ1 A;  1LJN A;  1T8F A;  1L52 A;  1GFH A;  119L A;  1GBS A;  1L04 A;  1RJ2 A;  1P56 A;  1RCM A;  1FHW A;  1TBY A;  1AM7 A;  1OP9 B;  2I5C A;  4EMO A;  1IC7 Y;  1IR7 A;  1YKY X;  5LOP B;  4NHQ A;  3GXK A;  2RB2 X;  1NU2 A;  1GF9 A;  4DD2 A;  4NY0 A;  4EKU A;  1GEZ A;  143L A;  1JUG A;  166L A;  2EKS C;  4TUN A;  4U3X B;  1UEF A;  2D11 A;  4DJH A;  1GHL A;  3WUM A;  2HEB A;  1LW9 A;  1C65 A;  1LI2 A;  2DHI A;  1OY2 A;  5CLQ B;  2B5Z A;  4GCB A;  1DI4 A;  1P64 A;  4NY5 A;  1MEL L;  5IEL A;  1QTB A;  5A3E A;  3DN1 A;  1LSG A;  4PJ2 C;  2LYD A;  4H9F A;  1UIA A;  4CFP A;  2ZIK A;  4RW1 A;  2VRW B;  3HTD A;  4MST A;  4LZT A;  1AT6 A;  1CNS A;  1X86 A;  4GMV A;  4NGJ A;  1MK7 B;  3TXD A;  2A7F A;  1C6N A;  2BQE A;  3BIN A;  4CHJ A;  211L A;  1DYD A;  2BQO A;  1L40 A;  2D6B A;  2F2N A;  3U8Z A;  1N3H A;  1XEJ A;  2VSZ A;  1EVH A;  4I7P A;  4YXA C;  1OQM A;  1JIT A;  1CV0 A;  1B7N A;  3HQC A;  1L83 A;  5DI9 B;  4I7N A;  5I5Q A;  3ATO A;  2R09 A;  4H9E A;  1JSE A;  3JR6 A;  3SO6 A;  1FDL Y;  4YF2 A;  5ILF A;  5JEN B;  4KT3 A;  2ELA A;  129L A;  4I7R A;  2XTH A;  4ETD A;  1NBY C;  1C6E A;  3PVL A;  1LZR A;  1QTZ A;  1NDM C;  3TXB A;  4WM5 A;  4ETE A;  2ZWB A;  3MDB C;  4LGK A;  4PQ0 A;  1L08 A;  2RNR B;  4LT0 A;  1XEK A;  1QC6 A;  4IFS A;  5C5B A;  3KRX A;  2M14 A;  4HHV A;  2I1K A;  1ZM0 A;  4N1C C;  160L A;  3TVV A;  3D9A C;  3KSY A;  1L30 A;  4NHT A;  3PBL A;  1UNP A;  1QDR A;  1DZB X;  1ZYT A;  3AW7 A;  4YL8 A;  1PQO A;  1CU5 A;  1J19 A;  3RZE A;  1UIF A;  4XAD A;  1CJ7 A;  4DX8 A;  3IJV A;  1L87 A;  3TCA A;  1FLU A;  2EIZ C;  4UWN A;  4WLT A;  1GE2 A;  1GAY A;  4L6E A;  1GFE A;  1B2K A;  1YQV Y;  1OVJ A;  1VED A;  4GN3 A;  1UC0 A;  3TXE A;  4B0D A;  2L2I A;  1L63 A;  3CDV A;  3N9E A;  1L86 A;  4KVG B;  4EKP A;  4LYO A;  4HAW B;  2CY5 A;  3DXD A;  5FDJ A;  3G3V A;  4NSG A;  1C6A A;  1C64 A;  1X1F A;  1C43 A;  4D0N B;  1OMW A;  1G06 A;  1QSA A;  4WO9 A;  2VKI A;  3HT7 A;  1ALC A;  1REZ A;  4H90 A;  1LZ6 A;  4S0W A;  1KZ7 A;  1DPW A;  1L00 A;  5DN5 A;  5B06 A;  230L A;  2BQL A;  1B0D A;  2JP2 A;  1U29 A;  3KY9 A;  2ZYC A;  1CU6 A;  4HAU B;  4LYZ A;  183L A;  1KW7 A;  4A7D A;  1L02 A;  5LVG A;  7LZM A;  3A6B Y;  1LSN A;  1B7M A;  1LHK A;  5LA8 A;  3NYA A;  1XEI A;  1C45 A;  6LZM A;  1LYS A;  1L16 A;  1LMN A;  2OQB A;  3OE8 A;  4HB4 B;  2YSZ A;  1UPQ A;  4XWX A;  2DKQ A;  3W6C A;  3AGG G;  1IR9 A;  4HDO A;  1ZWN A;  1IP1 A;  1Z87 A;  5J7C A;  4W57 A;  2FBB A;  3HH3 A;  242L A;  1FB8 A;  2Z38 A;  2UVM A;  5DHF B;  2J0M A;  5C5B B;  1INU A;  3DN8 A;  1LHH A;  1FGY A;  3HH4 A;  225L A;  3MGW A;  1JHL A;  1LYE A;  3HUA A;  3TXK A;  2RBO A;  1C10 A;  4OO9 A;  1P5C A;  1D0K A;  1CJ9 A;  2F47 A;  3WA0 A;  167L A;  5D27 A;  5KQ1 A;  4H9B A;  4C0A A;  115L A;  4YX7 C;  1GC7 A;  1NHE A;  5FST A;  1E8L A;  2RGN B;  2YDG A;  1QUO A;  3OE0 A;  3HW2 B;  3F5R A;  1B5Y A;  5DM9 A;  4E97 A;  140L A;  3A94 A;  1AKI A;  1LZN A;  1DI3 A;  2YS1 A;  1JTP L;  3NY8 A;  1YKZ X;  4B4J A;  4HTK A;  2RBP A;  2YBM A;  4ARM A;  4WVF B;  5F9X A;  4W52 A;  1L09 A;  1GB5 A;  1HFX A;  4ETA A;  3TW1 A;  1NTV A;  1C6P A;  1IIZ A;  1D3J A;  1IR8 A;  3GUN A;  1U5F A;  2MEA A;  3DN6 A;  4ARJ A;  4BAP A;  3ODW A;  4N8Z A;  2YBN A;  3IWR A;  5I54 A;  118L A;  1UIC A;  1I7A A;  3VIA A;  5DHA B;  1C6B A;  4J7V A;  5HMV A;  4IOY X;  102L A;  1IP7 A;  1WTN A;  1JKC A;  2D4J A;  1CKD A;  2BQN A;  3WYF B;  2HEF A;  2EQL A;  1G7I C;  187L A;  1L91 A;  1G0L A;  4H8Y A;  3CSQ A;  1G7H C;  5LXW A;  3X23 A;  4AGA A;  1WGU A;  1WQO A;  3OK0 A;  1LMT A;  1WTM A;  2B6Z A;  1U5E A;  4NSH A;  126L A;  2C8P A;  1QUH A;  3QE8 A;  1J1P Y;  3DXC A;  175L A;  1TDY A;  1MK9 B;  4F7G A;  189L A;  4GCE A;  1L48 A;  1L17 A;  4TKN A;  1G7M C;  1LSM A;  4WO6 A;  190L A;  1QT6 A;  5KXP A;  4ET9 A;  2G4N A;  2B72 A;  2OU8 A;  4F7U P;  1H10 A;  1GE0 A;  1H4R A;  4GXB A;  1DYN A;  1XD4 A;  4LZM A;  1B55 A;  3KZ1 A;  1BWH A;  5HE2 A;  255L A;  4I7M A;  4GCF A;  2DQJ Y;  4I7T A;  4PGJ B;  222L A;  261L A;  238L A;  2DQH Y;  1CKF A;  3CDT A;  113L A;  2QAR C;  153L A;  1CVK A;  2HEA A;  5CLL B;  1B7O A;  5L9J A;  1KIP C;  4KHO A;  1QQG A;  2Z2F A;  1OUH A;  1GPQ C;  1DYA A;  4UWU A;  4H9C A;  5KXR A;  4IJ4 A;  4GCC A;  168L A;  2ANV A;  1KXW A;  1L54 A;  134L A;  3V2Y A;  2CDS A;  1K5D B;  1FLQ A;  1QIO A;  3HDE A;  2NTH A;  1GBX A;  1T6H A;  1KIR C;  3RT5 X;  1L35 A;  2O79 A;  2Z12 A;  3WXT A;  1P3N A;  4KXI A;  5F16 A;  1EPY A;  1JTO L;  2DTC A;  3N9C A;  3FA0 A;  2P0H A;  1T6V L;  3WPL A;  4PRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...