4IAPA

Crystal structure of ph domain of osh3 from saccharomyces cerevisiae
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
256
structure length
256
Chain Sequence
GRYLQGYLLKKRRVDNIFEMLRIDEGLRLKIYKNTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYVDQGFKKRFFTLDFRYGTLSYYLNDHNQTCRGEIVISLSSVSANKKDKIIIIDSGMEVWVLKATTKENWQSWVDALQTCFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of osh3 reveals a conserved mode of phosphoinositide binding in oxysterol-binding proteins
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Lipid binding protein/ hydrorase
molecule keywords Oxysterol-binding protein homolog 3,Endolysin,Oxysterol-bind
total genus 76
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2012-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00959 Phage_lysozyme Phage lysozyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.530.40 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 4iapA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4iapA01
2PZ1A 4W55A 103LA 4YL8A 3NYAA 1UNRA 4OO9A 2ROVA 2QKMA 1G1VA 252LA 4W59A 3SO6A 1L0JA 2CY4A 3DXEA 4HAVB 1C6JA 1L75A 2I1JA 191LA 2ROZB 1V61A 171LA 1T8GA 2MFQA 1L31A 1L92A 1C6PA 2Z0PA 165LA 4TYZA 3V5WA 5KQ4A 4YX7C 2CAYA 233LA 1KZGA 115LA 2LKOA 230LA 4Z2MB 1L50A 1L44A 250LA 2BCJA 140LA 5EFXA 2CUUA 1L86A 3OE8A 3GYOA 1C64A 4GMXB 1DYAA 1Y19B 1LI6A 4HDQA 5KQ1A 2B6ZA 1PFJA 4A6KA 2Q9DA 167LA 225LA 3BINA 2RUKB 157LA 1QS9A 164LA 4S0WA 2V76A 2DA0A 4HAYB 234LA 261LA 1L51A 1C6BA 1L05A 2B74A 2RB0X 110LA 186LA 1G0MA 1JTNA 1L27A 262LA 1PQKA 3FA0A 2RBRA 2A4TA 1V89A 2E2XA 1KY1A 1QTVA 4H8SA 1EGXA 190LA 1QT4A 257LA 5LOPB 5D3YA 123LA 185LA 2JP2A 178LA 1D3MA 254LA 3HT9A 128LA 4XWXA 1SWYA 4P7IA 1C6DA 2D9VA 3UONA 2B75A 192LA 1B6IA 3HUAA 113LA 1PQDA 1Y5OA 5GOWB 5DHAB 1P5TA 3FEHA 240LA 4PQ0A 1L38A 4I7QA 3SB5A 3HTFA 2OTXA 3D8FA 2L78A 3A8PA 4ARLA 3JR6A 152LA 1P2LA 4W57A 2W2XC 1ZC3B 4ZRJA 3WA0A 2RBPA 2Z0OA 3C7WA 1CU2A 2EJ8A 1CV0A 1WGUA 1PQIA 1UEFA 2J59M 3RCPA 5HE0A 1KNIA 1L94A 1L12A 2D4QA 2ZPYA 4W54A 1C6GA 1L43A 4F7HA 4DX8A 2K00A 1ZM0A 2YS5A 5C5BB 1L00A 2L2IA 2YS1A 3ZDTA 2CODA 3M1IB 1L13A 1L42A 1QTZA 3HT6A 1G07A 216LA 1CV6A 1C6AA 1D3JA 1L45A 2OE7X 2MDXA 2OE4X 4KHBB 1L89A 1P3NA 217LA 3DKEX 4ARQA 1FOEA 3CDOA 1B55A 131LA 1OVHA 2J0JA 3ML4A 1UNQA 1L17A 3UZTA 188LA 4PNKA 4A5KA 1XCGA 2KGXB 4DBBA 173LA 4A6HA 1QUHA 2OQBA 4EKSA 1L95A 1L52A 237LA 3VOQA 158LA 2GCJA 4C0AA 1BAKA 238LA 3DN0A 3O96A 4BBKA 118LA 1UPQA 148LE 4YXAC 3C8QA 1CU5A 1JTMA 1OYUA 2XQNM 1L76A 1C65A 3DXCA 1L73A 2L1CA 3GUIA 1NTYA 3HTGA 1L41A 5DHFB 1GG3A 1P7SA 1WVHA 2M38A 4GXBA 1L01A 2B72A 2B6YA 214LA 2CRFA 3ODOA 1L0KA 251LA 1DYGA 3DN8A 2RAZX 3QBVB 102LA 2NTGA 1QT6A 1L66A 1P2RA 1GC7A 2VSZA 146LA 3PVUA 1SSWA 3C8SA 3GUOA 2D11A 4CYEA 3FSSA 4YXCA 145LA 5D3XA 201LA 3L2XA 2R09A 5FI0A 1MIZB 3G3VA 3CIKA 4MY6A 1D9WA 2COAA 1XD4A 1T97A 3K2RA 4HB3B 3V2YA 1L81A 1V5UA 3HK0A 4IOYX 2D9YA 4B6HA 3DN4A 1X11A 2UVMA 1LYDA 1G0LA 127LA 1X1FA 122LA 4W56A 6LZMA 3GUMA 243LA 156LA 1J0WA 1V5PA 4Y94A 4AQNA 1L82A 1L88A 3KRWA 163LA 236LA 3C81A 3HH4A 1L80A 3QWMA 4EKUA 1FAOA 1L24A 1L19A 1D2YA 228LA 1G0PA 125LA 2RSGA 3SB8A 3PVLA 2G35A 2RBQA 1FHOA 4ZRIA 1L77A 1QT3A 3FI5A 1IRSA 3RZEA 2GJYA 5L81A 2D10A 2HUKA 3PSCA 218LA 2DTCA 1DYCA 239LA 1L14A 1SWZA 3HTBA 3ODUA 1DYNA 2DKPA 1M7RA 1P46A 2RBOA 1RRPB 3P7ZA 4WSFA 1NHBA 1G0KA 1WG7A 1EPYA 2EMSA 2HTHB 4WJ7A 1L87A 5JHGA 3F5RA 1ZYTA 244LA 162LA 4TKNA 5D27A 1W1DA 209LA 4NY0A 1E5WA 2LCBA 3DN2A 4W51A 4ARPA 1L47A 3SUZA 3C80A 1L53A 2M14A 2RBSA 1U5FA 3U7DA 1L33A 4PJZA 112LA 1DYFA 1CU0A 1K28A 3DMZA 151LA 1OV5A 3DN3A 1BTKA 1KI1B 5DIFB 4DXAB 3AJ4A 182LA 1CU6A 3DMVA 4NSWA 3TFMA 256LA 4LDLA 1MK7B 5C16A 1QT5A 1L57A 1FB8A 260LA 1G0QA 2VKIA 3U8ZA 4EJNA 3C7ZA 1QT8A 2QKLA 1L56A 1L09A 1LLHA 3LJUX 2N0YA 196LA 1LB1A 1LGXA 141LA 1D2WA 1RJ2A 199LA 1QUGA 2Z6BA 137LA 1ISNA 3KY9A 5FI1A 1L16A 159LA 1C6TA 7LZMA 229LA 104LA 1V88A 231LA 2P0DA 3HH3A 1OWYA 2ANXA 1AQCA 1GC6A 253LA 5C79A 1L71A 1MPHA 3SBAA 2HUMA 1L29A 170LA 2B6WA 2O7AA 2K2JA 114LA 1PQOA 3ULCA 224LA 2DLWA 2DN6A 172LA 2HE7A 4ARJA 1Q67A 143LA 1L99A 223LA 2Z0QA 1T8FA 1EAZA 1P37A 3HT7A 1W1GA 4CHMA 1WJ1A 1L69A 197LA 4HDOA 1L22A 1FHWA 2OU8A 2OTYX 3CDVA 4K2OA 2RB1X 1QTHA 1QTCA 3TW1A 1D3FA 4EKQA 215LA 1MAIA 1L18A 1WTHA 198LA 1NU2A 3HDEA 1LYEA 3SN6R 1V5MA 1G06A 2D9WA 2Q13A 4WVFB 3HU9A 2GS0A 1CV5A 3PP2A 1L65A 255LA 227LA 3PG7A 1C67A 1CU3A 2COFA 1L49A 3D8EA 1L34A 169LA 4K2PA 212LA 1C6CA 1C69A 1H4RA 2LOXA 3A8QA 3GUPA 5HE2A 3CDTA 1LYGA 1DDVA 5HE1A 181LA 3CDRA 109LA 1C62A 2AEHA 1NTVA 1QTBA 2W2WA 4I7NA 3HDFA 2IYBA 1N3HA 150LA 3TO1A 2B6XA 1L04A 1UPRA 3SNHA 4GN1A 1PQJA 3OE6A 3BJIA 2MWNB 1T6HA 245LA 1CV3A 1L68A 1DYDA 2K2UA 2FJLA 4KAXB 2NTHA 1QUDA 206LA 3F8VA 2COCA 1C6KA 2OE9X 4I7LA 5D3WA 168LA 1TLAA 1G0JA 1WI1A 3NY8A 3TVVA 126LA 3ODXA 1L85A 1DBHA 4MT7A 1C6QA 3KZ1A 4HAUB 1ZC4B 2W2XD 4EMOA 2O4WA 219LA 1MK9B 1U2BA 2YT1A 2YT0A 1L93A 2MKRA 1L30A 2RB2X 166LA 247LA 3ULBA 2F32A 259LA 4F7GA 1LI2A 1OWZA 1ZWNA 2ADZA 2DX1A 1L83A 5CLLB 4YONA 3PEGA 1C6HA 2Y7BA 184LA 1P64A 4LDEA 1AWEA 1L11A 177LA 2ELAA 2OTZX 161LA 1C6NA 1PQMA 1XODA 2DYQA 2H7EA 2NMBA 2R0DA 180LA 2P0FA 4KHAA 2O79A 149LA 3F0WA 1P56A 3HUQA 1SGHA 2D9XA 2ELBA 2F47A 1X05A 1SHCA 3QIJA 4KVGB 129LA 3V2WA 1OQNA 1TXDA 183LA 1P5CA 3AU5A 3VIAA 2OU9A 1CX7A 3F9LA 1L39A 1L25A 2P8VA 3C83A 1L10A 1L03A 1L54A 2OEAX 2OU0X 3NY9A 4I7JA 4I7TA 3D8DA 195LA 1L84A 1WJMA 2RNRB 2D9ZA 4HAZB 1L28A 200LA 2B70A 4DJHA 3FM8C 3OANA 1EVHA 4IAPA 4K5YA 1DYBA 1L58A 2B7XA 211LA 1L61A 1U27A 1XKEA 3DMXA 3C82A 1CUPA 4A6FB 1QTDA 3PVWA 1L15A 1OV7A 1TQZA 1SX7A 1L70A 2EMTA 4ARMB 1X1GA 2Q9EA 1L37A 3HW2B 1TJ6A 3PZDA 1Z87A 175LA 1L20A 2YSZA 1CV4A 4EPIA 1C61A 1C63A 4E97A 1L63A 1LW3A 1L35A 1LYJA 210LA 1OVJA 3HH6A 1BWNA 1L97A 1X86A 120LA 5D3VA 4EXMA 2YRYA 2RGNB 1C68A 1XX0A 5LONB 1L21A 1SSYA 1L62A 4HATB 5CLQB 1KW5A 2B73A 4GBRB 4ARMA 1P6SA 1UNPA 174LA 1XEPA 3N7CA 4A6FA 4W52A 1L07A 3SBBC 119LA 1MKEA 4KHOA 3DXDA 249LA 2I5FA 1I7AA 5JP4A 1LGUA 2CY5A 1L91A 138LA 1G0GA 1L55A 1L02A 1L90A 1LW9A 3MPXA 1QT7A 139LA 3TCAA 111LA 160LA 5JLJB 1L59A 1QUOA 3C7YA 1L36A 3L64A 1K5DB 2DKQA 3T06A 4HHVA 147LA 1J19A 1SX2A 2DHKA 2KCJA 4HB4B 4ARQB 1U5GA 4IFSA 4D0NB 1DDMA 1WGQA 1D3NA 5J3TA 1PLSA 1L67A 1CVKA 5HE3A 1ZVRA 3HTDA 1LWGA 2DFKA 4L6EA 2LG1A 3RUNA 1L32A 5C5BA 1G1WA 1L74A 1OY2A 3A98B 1L72A 2LOZA 4CHJA 2N23A 3EMLA 221LA 4DKLA 3GUKA 4DX90 3NSUA 1FGYA 226LA 2RBNA 4HB0B 3D4SA 3X23A 155LA 2RH1A 1CX6A 5DI9B 1JQUA 4Z2NA 1XR0B 5JHHA 3HQCA 2QARC 1CTWA 1FHXA 3KSYA 2I5CA 1LYFA 3MDBC 3DN6A 2LYDA 3GUNA 1FGZA 3HWLA 1BTNA 3OE0A 4LZMA 1L48A 3SB7A 4HB2B 3HH5A 1L23A 2LC9A 3KRXA 4GRVA 3G3WA 2KUPA 1DROA 1U5EA 4F7UP 1ZURA 1DDWA 2H7DA 3HU8A 4EKRA 4GZUA 1C66A 2DYNA 1L96A 1XJUA 2D2QA 4EJ4A 220LA 5I14A 4W53A 3GYPA 1L40A 1T8AA 2J0KA 1QQGA 2DHIA 235LA 2F2QA 2DHJA 1LYHA 3G9WA 4EPFA 2X18A 1LPYA 1L08A 3FADA 3AU4A 1KS3A 3HUKA 4I7RA 1LGWA 1H10A 205LA 242LA 2ANVA 130LA 3QAKA 187LA 1MIXA 2UZSA 1PMSA 4DAJA 3SB9A 4I7PA 3VW7A 246LA 2YVCA 5J3QA 1DYEA 1QSQA 1C6IA 144LA 1L60A 1W1HA 2Y8GA 4I7SA 2QB0B 4GMVA 3IVFA 2J0MA 1CUQA 3DN1A 2LULA 4MK0A 2I1KA 3GUJA 3HT8A 1P6YA 2RVBB 1EF1A 2IFSA 3G3XA 1L64A 1KZ7A 5DH9B 1CV1A 4HAWB 189LA 4ZPUA 1OMWA 1M7EA 1C6MA 1XJTA 4PK0A 4ZRKA 108LA 2UZRA 2EC1A 2VRWB 1I6SA 3CDQA 1QS5A 1C6LA 4HAXB 2DX5A 1C60A 4LDOA 142LA 3CXBB 1L46A 3SYXA 1L06A 1QC6A 2YS3A 4W58A 1P3RA 3WYFB 1OVKA 1L98A 4I7MA 3ODWA 3GULA 3C8RA 4K81A 2HULA 2P0HA 4I7KA 5C6RA 1KY0A 2RAYX 2RLOA 2Y8FA 1L26A 3P6AA 1QSBA 3PBLA 232LA 4GPTB 1C6EA 176LA 4I7OA 3SV1A 1ZSQA 1KW7A 4EKPA 248LA 1P36A 2GCLA 3OE9A 1C6FA 2IGCA 1LYIA 5J3YA 1I2HA 3ZVRA 3PDSA 1L79A 3SB6A 1U29A 2YF0A 2AL6A 2NZ8B 107LA 1NI2A 241LA 3DNAA 1LI3A 2B6TA 1LWKA 5LZMA 1K5GB 213LA 3LZMA 4K17A 2LZMA 5KCVA 222LA 258LA 1U5DA
chains in the Genus database with same CATH superfamily
1HMKA 1YILA 4W55A 103LA 3NYAA 1UNRA 1LSAA 2ROVA 3EMSA 252LA 1L0JA 4IJ4A 3P68A 1VDSA 1HELA 4ETCA 3V5WA 4YX7C 1KZGA 1LZEA 230LA 4WG7A 1LYOA 5LAGA 2CUUA 4GN4A 2X0AA 1KIRC 1GFUA 1Y19B 1LI6A 4HDQA 1LMPA 4A6KA 4YF2A 1F6SA 3AZ6A 1QS9A 4S0WA 2V76A 1L51A 262LA 1V89A 2E2XA 1EGXA 1QT4A 3W6CA 4IASA 5LOPB 4GCBA 2JP2A 1XGTC 4N5RA 4BS7A 3HT9A 4XWXA 1GB2A 2B75A 4M4OA 1B6IA 1JEFA 1Y5OA 5GOWB 4NGKA 1P5TA 3FEHA 240LA 4OWAA 4I7QA 2ZQ4A 1RE2A 1G7JC 2OTXA 3D8FA 3A8PA 1NWGA 1JUGA 2W2XC 1CV0A 3RCPA 1UEFA 1L12A 2D4QA 2ZPYA 1C6GA 2YS5A 1LJHA 1OUIA 1L00A 5KXZA 5C5BB 1QTZA 1UIBA 3HT6A 4NHSA 5F9XA 1D3JA 2OE7X 217LA 4XENA 2J0JA 1GAZA 1OVHA 1REZA 1DZBX 1XFPL 4PNKA 3CT5A 1XCGA 2XQOA 1WQRA 1L95A 237LA 3W6DA 1BAKA 2XBSA 5F16A 4BBKA 3O96A 3T6UA 1CU5A 1GFRA 1OYUA 4DQ7A 2XQNM 2GV0A 1NTYA 1P7SA 4WL7A 2CRFA 3ODOA 2I26L 2DQCY 1JKAA 3LYZA 1LSEA 1NQIA 5FI0A 1MIZB 3G3VA 4MY6A 3K2RA 1GFGA 3CSQA 1V5UA 3HK0A 1X1FA 1OUHA 4H92A 1IC5Y 3W3EA 1FDLY 4NGVA 1J0WA 4Y94A 1V5PA 163LA 4EKUA 1L80A 3QWMA 1VFBC 2RBQA 4MSTA 1IRSA 4U3XB 2D10A 1B0DA 3PSCA 1DYCA 2FBDA 1L14A 1SWZA 3HTBA 3ODUA 1P46A 2EMSA 2DQJY 5HNLA 5JHGA 5KXOA 1IWWA 1FKQA 1GFAA 1ZYTA 4YOPA 162LA 4NY0A 1L47A 4NGZA 1L53A 5L9JA 2RBSA 1U5FA 1K28A 1CU0A 3DMZA 4ET9A 4DXAB 1CU6A 3DMVA 5FELA 1MK7B 1PZYA 5C16A 1FB8A 4Z41A 1J1XY 4EJNA 1LB1A 1BB7A 1LGXA 141LA 1D2WA 1QUSA 2Z6BA 5B07A 3DCXA 5KXPA 1TAYA 3HH3A 1OWYA 5C79A 4Z98A 1MPHA 3AGHA 2B6WA 2KUQA 1ZVYB 223LA 1D0KA 4LYTA 1JPOA 4HDOA 1FHWA 2OU8A 2YBHA 4K2OA 2DQGY 5IDDA 1GF7A 1HC0A 1JJ3A 1QUTA 215LA 2Z39A 3EBAB 2Z14A 1L18A 1WTHA 1NU2A 1V5MA 4WVFB 1LYEA 3SN6R 2CWIA 3P64A 1HFYA 1OUEA 3D8EA 1A2YC 3AGGG 3A8QA 5F81A 2ZQ3A 1DDVA 4WM4A 4PRUA 5LYTA 2LZTA 1YKXX 1NTVA 1IEEA 1QTBA 1GXV2 2LYZA 4HJVA 2W2WA 1N3HA 3TO1A 2B6XA 1JTTL 1L04A 5I53A 1CV3A 2NTHA 206LA 4B4JA 1IWYA 2OE9X 1GB8A 1G0JA 126LA 4LFPA 3ODXA 3CT0A 5HMVA 1IY4A 1DBHA 1ZC4B 1XEJA 4NHIA 1U2BA 1L93A 3ULBA 1LI2A 4H9AA 1L83A 1CJ8A 1C10A 1C6HA 3A93A 1LSCA 2R2YA 2BQGA 2OTZX 161LA 1XODA 3LZ2A 2P0FA 1GE1A 4KHAA 3F0WA 1P56A 2F47A 3CT1A 1LTMA 1OQNA 4H1PA 2OU9A 3ZVQB 2P8VA 3RZ4A 1GPQC 1L10A 3NY9A 4I7TA 195LA 1LJ3A 5HMJA 3CQLA 1W08A 1HEQA 5IRSA 4ANRA 1HEMA 3C82A 3W6AA 3B0OA 1IOTA 1B7LA 4MR1A 2K8EA 2Q9EA 1L37A 1TJ6A 1L20A 4J1AA 1CV4A 5DLAA 1IY3A 1FN5A 5I2MA 4NEBA 4NG8A 210LA 1J1PY 1OVJA 1X86A 5D3VA 4B1AA 3IWRA 1XX0A 5LONB 1L62A 2Z18A 1UNPA 4L1RA 5I2SA 1N4FA 3TMWA 3SBBC 249LA 5B59A 1L91A 1L02A 1L55A 3MPXA 3B0KA 5I5QA 139LA 1QT7A 160LA 1L59A 1HFXA 3LHMA 3C7YA 3HBHA 2DKQA 147LA 1SX2A 2DHKA 2I6ZA 4HB4B 1U5GA 4D0NB 1WGQA 4GN5C 4KHBA 1GB6A 2BQCA 4WM3A 1CVKA 4WO6A 1ZVRA 2DQAA 1QIOA 1EQ4A 1REYA 2LOZA 5FDJA 4DKLA 221LA 4DX90 1OUBA 3D4SA 5F14A 4HSIA 3WU8A 4II8A 5JHHA 1XR0B 1LZ1A 3QY4A 3TMUA 5E4PA 3GUNA 4HSFA 3A6BY 4HB2B 4GRVA 1U5EA 2H7DA 1IR7A 2ZILA 2BQDA 4DDBA 2D2QA 1IP5A 1JSEA 5I14A 5B1GA 1T8AA 1QQGA 2X18A 1L08A 1V7SA 1YIKA 1H10A 4LFXA 4ETBA 1VDTA 3A92A 1PMSA 1C6IA 144LA 2FYDA 4DYGA 4GMVA 2J0MA 4WL6A 1GDXA 4HAWB 5KXYA 4ZPUA 2EPEA 4ZRKA 2UZRA 1D0LA 2VRWB 1I6SA 1IP1A 1RJCB 5JENB 3QNGA 2EIZC 1DI4A 1FBIX 5IHGA 3SYXA 4W58A 1P3RA 2F4GA 1OVKA 4I7MA 3ODWA 4K81A 2RAYX 1L26A 1WQQA 1D6QA 1BVXA 1QSBA 3GXKA 1GF6A 1LZBA 232LA 2BLYA 4G4HA 4GPTB 2XTHA 1GEZA 4FDYA 1P36A 1JIYA 1JTOL 2IGCA 1I2HA 3PDSA 4DIXA 3OJPA 241LA 1K5GB 3HSAA 213LA 3AZ5A 222LA 1OUAA 1LHHA 5FEKA 3IVFA 2K49A 1BB3A 4H93A 4OO9A 4DD1A 1G1VA 1C6JA 1L75A 2I1JA 1JWRA 1T8GA 4PPOA 153LA 5KQ4A 2W1MA 2LKOA 1IWVA 115LA 5FHWA 4ML7A 4Z2MB 4AGAA 140LA 1WVVA 4HV2A 1C64A 4GMXB 5I4YA 1IC4Y 1UCOA 1GB3A 1XSFA 5B06A 4HAYB 234LA 261LA 1G7MC 1C6BA 1L05A 2B74A 186LA 3FA0A 1G0MA 1JTNA 1YANA 2YBJA 1WQNA 3LYTA 4RLMA 123LA 185LA 4NSGA 2B5ZA 1C6DA 192LA 4NFVA 113LA 1MLCE 3AYQA 1MI1A 3SB5A 4ARLA 5D5FA 2DKVA 2RBPA 1NF5A 1PQIA 2ZKMX 1JISA 1HHLA 1KNIA 1GB7A 5L3HA 4CSQA 1YAOA 2IFFY 4I0CA 5ILCA 1ZM0A 3FI7A 2YS1A 1KXYA 2WARA 2CODA 154LA 1G07A 216LA 3EXDA 1C6AA 2D6BA 2MDXA 3EO5A 3A95A 1B9OA 131LA 4DDCA 1L17A 188LA 4A5KA 1GFVA 1GB0A 173LA 1LKRA 1UC0A 2OQBA 1L52A 158LA 238LA 4BAPA 3DN0A 118LA 4N0JA 148LE 1L73A 3GUIA 4HV1A 2M38A 1KIQC 1L01A 2B72A 4ZIXA 1FLWA 1L0KA 2CJLA 251LA 1DYGA 2Z2FA 3DN8A 2ZYPA 1B5VA 1GC7A 2VSZA 1GFHA 1SSWA 4H9BA 3LYMA 3FSSA 4TWSA 2EQLA 1AT6A 3CIKA 1MELL 1XD4A 5APDA 1DKKA 4IOYX 5FSTA 1LMQA 3ZEKA 1FKVA 2W1XA 133LA 1NBZC 1B7QA 3KRWA 1GF9A 3C81A 1F0WA 3PVLA 1FHOA 3SB8A 2KIEA 1L77A 1QT3A 3FI5A 2GJYA 3RZEA 1LYYA 2DTCA 239LA 3P7ZA 3TXEA 1M7RA 4X3BA 1REMA 1WTMA 1WG7A 2HTHB 1BWJA 2Q0MX 4WJ7A 3F5RA 5KXLA 244LA 3IJUA 2LCBA 1O23A 5B1FA 2C8PA 4PJZA 1DYFA 151LA 1OV5A 3DN3A 4ET8A 182LA 1LAAA 2HEFA 256LA 3WPLA 1L57A 260LA 1G0QA 1LMCA 3CB7A 1B7PA 1DQJC 2QKLA 1JKBA 1L09A 199LA 1LJ4A 5FI1A 3KY9A 2HTXA 1REXA 7LZMA 231LA 2P0DA 2ZWBA 3J4GA 4XADA 170LA 2K2JA 4J7VA 3ULCA 224LA 2DLWA 2DN6A 2HE7A 1IP4A 4ARJA 1Q67A 143LA 3WPJA 1IOCA 1GDWA 2Z59A 1P37A 1EQ5A 1T3PA 4CHMA 1VEDA 3CDVA 3U12A 1D3FA 4EKQA 2PC2A 1UBZA 5E9RA 1MAIA 2A7DA 198LA 3HDEA 1G06A 4W96A 1CV5A 255LA 227LA 2MEAA 2COFA 1GB9A 4NGLA 1L34A 169LA 2HUBA 1TEWA 1HEOA 1LYGA 1C62A 2AEHA 4YM8A 4I7NA 2IYBA 4DT3A 3OE6A 1DYDA 2K2UA 2FJLA 5LG4B 3BKHA 2COCA 1TBYA 5D3WA 1ZMYL 4B4EA 2W2XD 1JJ0A 1F6RA 1MK9B 2MKRA 1L30A 166LA 2F32A 4RLNA 259LA 1LHLA 1LZDA 7LYZA 2DX1A 4F7GA 1I20A 1L11A 1W6ZA 4B4IA 177LA 4G4BA 2DYQA 1C6NA 2H7EA 2NMBA 180LA 1XEKA 2ZNWY 149LA 5I54A 3HUQA 2D9XA 1GHLA 4KVGB 129LA 3VIAA 2GUMA 3C83A 4I7JA 1HF4A 4HAZB 200LA 4H9IA 3OANA 4YEMA 4IAPA 4K5YA 1XKEA 211LA 1CJ6A 2FBBA 1CUPA 2D91A 4XJHA 2LYMA 1TQZA 1L70A 2EMTA 2YBLA 3ATOA 1X1GA 2MEGA 5APEA 1DI5A 3PZDA 4LZTA 1LZ5A 1LJIA 3MGWA 4TX7A 4E97A 4EPIA 1LW3A 1L35A 2BQLA 3NWDA 1L97A 1NDMC 120LA 4DD9A 1B7MA 3LYOA 2RGNB 2D4KA 1L21A 4KPMA 1IWXA 8LYZA 2B73A 4G49A 4GBRB 1GWDA 1LSPA 4NGOA 4NWHA 1GF0A 4Z46A 1XEPA 4W52A 5LYMA 119LA 1MKEA 4KHOA 3DXDA 5KXRA 5JLJB 3TCAA 1GXXA 4R6CA 4HPEA 1K5DB 4G4CA 4O34A 4HHVA 2W1YA 1PLSA 1QSWA 2DFKA 4L6EA 1GFEA 1CJ9A 1KXXA 5DM9A 5D5CA 4H94A 5DN5A 1LMAA 4CHJA 1FGYA 1UUZC 1LSGA 1LZTA 1IWZA 226LA 4HJYA 4HB0B 1GF5A 4Z2NA 5DI9B 4D6WA 1OUFA 3HQCA 4Z3MA 2QARC 4NGYA 3DN6A 3NWAA 5APCA 3T36A 1FGZA 4LT0A 4WG1A 3M18B 1L48A 1HENA 2LC9A 4DQ5A 3G3WA 3HU8A 1CKGA 1HEPA 2DYNA 4J1BA 1QSAA 4W53A 2G4PA 1L40A 2DHIA 4L41A 5LA8A 2F2QA 2DHJA 1LPYA 4ETEA 1IP2A 4I7RA 3ATNA 2BPUA 2ANVA 1LMNA 3QAKA 4DAJA 3VW7A 246LA 1GE2A 4H8XA 1DYEA 5J3QA 1QSQA 1L60A 1C7PA 4I7SA 4PRQA 1CUQA 1GFKA 2VB1A 2LULA 4MK0A 3GUJA 1P6YA 2IFSA 3G3XA 1CV1A 1XJTA 1LZ9A 108LA 3A6CY 4HAXB 1C60A 5KXTA 3CXBB 3WYFB 1L06A 1T77A 2YS3A 3P65A 3GULA 3C8RA 4J0LA 5KXWA 5C6RA 1DI3A 2Y8FA 1WQOA 4ETAA 1LZGA 3PBLA 5AMYA 1C6EA 176LA 5KJ9A 1VAUA 4EKPA 1LSFA 3RU5A 4MCKA 1LHMA 1UIGA 2NZ8B 1NI2A 135LA 1LWKA 1IWUA 2B6TA 5KCVA 258LA 1F10A 2PZ1A 4YL8A 1B5ZA 2QKMA 4WM1A 1C08C 4W59A 2DQIY 4DWXA 3SO6A 2CY4A 3DXEA 4HAVB 5HNCA 1UICA 1V61A 4OWHA 1L31A 1L92A 1FLUA 2Z0PA 4TYZA 1LMTA 1HFZA 5C6JA 4H8YA 4IATA 1L44A 250LA 2BCJA 1L86A 2FJUB 3GYOA 1CKHA 2B6ZA 1PFJA 1CKFA 3A3RX 3RT5X 5APFA 3BINA 4WLYA 4TUNA 1OUCA 2HEDA 4B49A 1L27A 4H8SA 2RBRA 1QTVA 4GLVA 257LA 1CKCA 1SWYA 4P7IA 1AKIA 3UONA 4PQ0A 1YAPA 3AW6A 4C5FA 3HTFA 4NWEA 2L78A 1IP3A 152LA 1P2LA 4W57A 3WA0A 1ZC3B 1IOSA 1CU2A 3C7WA 1XGQC 2J59M 1WGUA 2BAAA 5HE0A 207LA 1L94A 1YKZX 4W54A 4KT3A 3G3AB 2K00A 2L2IA 3ZDTA 3M1IB 2MECA 3G3BB 4KHBB 1L89A 1P3NA 3DKEX 5KXKA 1FOEA 3CDOA 1B55A 5A3EA 3D9AC 4WLXA 3UZTA 3BKVA 1DKJA 1BB6A 4WOAA 1KXWA 3F6ZA 3WVYA 1DPXA 3WXTA 3FVCA 4YXAC 2LHMA 1IORA 134LA 2YDGA 3HTGA 1L41A 4NSJA 1GG3A 1WVHA 5DHFB 2B6YA 4OSNA 214LA 2RAZX 2HECA 102LA 1L66A 4QJ5B 4EMNA 1GF4A 4YXCA 145LA 5D3XA 201LA 3L2XA 2R09A 1LMOA 1H87A 1IR9A 2COAA 1T97A 2LZ2A 1A4VA 1B7NA 3V2YA 4QGZA 3KAMA 1TCYA 2D9YA 2BQEA 3DN4A 2UVMA 1LYDA 127LA 122LA 4W56A 6LZMA 2H9JA 1EL1A 1LJJA 4XJDA 5KXMA 3AJNA 4AQNA 1GAYA 4HJZA 4LGKA 3ZVQA 1JTPL 3HH4A 1FAOA 1FLYA 1L24A 1L19A 228LA 2I25L 125LA 4ZEEA 2RSGA 2G35A 4ZRIA 3A8ZA 1LHIA 3WULA 4NHTA 5L81A 4CFPA 2HU3A 1DYNA 2DKPA 4WSFA 1HEWA 2RBOA 4NY5A 1RRPB 1NHBA 1EPYA 2EKSC 3TXBA 3HIEA 1L87A 1EQEA 208LA 1SQ2L 1UIDA 1VDQA 1W1DA 1YROA 4W51A 3DN2A 4P2EA 3K3TA 2DQFC 3C80A 2Z4DA 4DD3A 2M14A 3U7DA 1L33A 1GFTA 1BTKA 3AJ4A 4NSWA 3TFMA 4LDLA 4YEOA 1QT5A 2Z37A 2YT2A 1B7SA 1QTKA 2Z12A 4CGEA 5LVJA 4AXTA 1LLHA 5KY1A 3LJUX 1RJ2A 4HTQA 1ISNA 137LA 4NSIA 1XGUC 1LHKA 159LA 1LYSA 229LA 1V88A 2ANXA 1GC6A 1GEVA 2HUMA 3HFMY 5I4XA 3WL2A 114LA 172LA 1H6MA 3IJVA 1LYZA 1L99A 2Z0QA 1GBSA 1B2KA 2IHLA 1GF8A 1IC7Y 1WJ1A 4CFOA 1L69A 197LA 1L22A 1LSYA 4G9SA 1IWTA 1IP6A 2OTYX 3B6LA 2LYOA 2Z13A 5T3FA 2RB1X 2DQDY 1QTHA 1QTCA 1LCNA 4ETDA 4QY9A 2D9WA 3DXCA 2Q13A 3NW8A 3HU9A 2GS0A 3TXFA 1NKHA 1L65A 1VDPA 3PG7A 1C67A 1CU3A 1GBOA 4WLTA 4NSHA 4GNKB 3AZ4A 4K2PA 212LA 1BWHA 2BQFA 1H4RA 2HEBA 3GUPA 1IX0A 181LA 1BVKC 3CDRA 109LA 3W6BA 4W94A 3TXJA 5KXSA 1UPRA 3SNHA 3BJIA 245LA 1L68A 1OUJA 1QUDA 3TMXA 3F8VA 1C6KA 5LYZA 168LA 1L85A 1C6QA 4HAUB 3TXIA 2Z19A 3RW8A 219LA 2YT0A 3AB6A 2YT1A 1QDTA 4UWUA 2RB2X 3WMKA 1RI8B 2D4IA 4PHIA 4QJ4B 2C8OA 1ZWNA 5M1YA 1QDRA 1LSDA 3PEGA 2Y7BA 4LDEA 1AWEA 2ELAA 1PQMA 2R0DA 1OUDA 1BB4A 2O79A 1SGHA 2AUBA 2ELBA 3QIJA 1HSWA 1SHCA 1D6PA 3AU5A 1TXDA 183LA 1JJ1A 1P5CA 2HEAA 4WMGA 1L54A 1L03A 2OEAX 3D8DA 3HW2B 2DQHY 2BQOA 2D9ZA 2RNRB 2XBRA 1L28A 1LSMA 3B77A 5ILFA 3FM8C 5EBHA 4GCFA 1U27A 1L58A 2B7XA 2D4JA 3DMXA 4A6FB 2Z2EA 1L15A 4ARMB 3TXGA 1Z87A 175LA 1UACY 2F30A 1C61A 1C63A 1NHEA 4FJRA 2XJWA 3HH6A 1NBYC 4TSCA 4EXMA 1GB5A 4HATB 1LJFA 5CLQB 1KW5A 1DXJA 4ARMA 174LA 5LXWA 4H9EA 3TXDA 2I5FA 1I7AA 5JP4A 2CY5A 138LA 1G0GA 1L90A 1LW9A 111LA 3WH1A 1L36A 3L64A 2ZYCA 3T06A 1J19A 1T6VL 4HP0A 1GBYA 4OW1A 4IFSA 1YQVY 1D3NA 3WU9A 5J3TA 4NGJA 1L67A 5HE3A 1BHZA 1L32A 3QE8A 1B7OA 1G1WA 1I1ZA 1L74A 1YAQA 3A98B 1ZVHL 2N23A 3NSUA 4XN6A 2RBNA 1D0MA 2RH1A 1JQUA 1CTWA 3KSYA 1LYFA 2LYDA 3HWLA 2KR0A 2G4QA 1BTNA 3LZTA 5I4WA 3KRXA 4GCEA 2KUPA 1ZURA 1DDWA 2Z38A 2BQJA 4EKRA 4GZUA 1L96A 1LOZA 1IP7A 5C6IA 235LA 3J6KA 2YBNA 4XJBA 4EPFA 4KXIA 3FADA 1KS3A 1LGWA 2UZSA 205LA 242LA 3SB9A 4I7PA 1GE4A 2YVCA 5J7CA 3A34A 1W1HA 2Y8GA 2QB0B 1LJKA 4PJ2C 4RDSA 2I1KA 5C6LA 3HT8A 2RVBB 1GBZA 5DH9B 1L64A 189LA 3A90A 1B5WA 1YKYX 3CDQA 1QS5A 2DX5A 4LDOA 1CKDA 142LA 1L46A 4WLDA 1GF3A 1L98A 4LYCA 2NWDX 3WUMA 1OUGA 2HULA 2P0HA 2DBTA 1WQMA 3W6FA 3P4ZA 1IR8A 5KKJA 1UIAA 4I7OA 3HBDA 3SV1A 1G7LC 3WUNA 1B7RA 1KW7A 248LA 5B05A 3OE9A 1C6FA 3ZVRA 1U29A 1L79A 2AL6A 3DNAA 9LYZA 5LZMA 4K17A 1U5DA 1C43A 4LT2A 4DQJA 1LHJA 1RFPA 191LA 5L3IA 2ROZB 171LA 2MFQA 3VWOA 2HEEA 1C6PA 165LA 4RW2A 1XGRC 4N8ZA 233LA 2CAYA 1ZV5L 4A7DA 4OT1A 1AT5A 1L50A 3RNXA 3P66A 1JKDA 5EFXA 3OE8A 1CNSA 4LYOA 4DD7A 1DYAA 194LA 1GFJA 2Q9DA 167LA 225LA 1LZ8A 2RUKB 157LA 1SLYA 4QEQA 164LA 2DA0A 4GCDA 2RB0X 110LA 5KQ1A 1PQKA 2A4TA 1KY1A 190LA 3AZ7A 1G7IC 1HNLA 5D3YA 178LA 1D3MA 254LA 128LA 2MEIA 2D9VA 3HUAA 4N9RA 1PQDA 2NBVA 5DHAB 4WM5A 1L38A 4GCCA 4EOFA 3JR6A 4ZRJA 4GLAA 1OP9B 2BQHA 3OK0A 5DL9A 2EJ8A 2Z0OA 3CSZA 5KXNA 1QQYA 1L43A 4F7HA 4DX8A 2H5ZA 4QJ3B 1L13A 1L42A 4R0FA 1CV6A 1L45A 2OE4X 6LYTA 4ARQA 3ML4A 1UNQA 1GE3A 2KGXB 4WM6A 4A6HA 4DD2A 4NHPA 1QUHA 4DBBA 4EKSA 4QDNA 3VOQA 1LSZA 4H91A 2GCJA 4C0AA 1G7HC 1UPQA 4N1EI 3C8QA 1JTMA 1L76A 1C65A 2L1CA 4M6DA 1YL0X 4GXBA 2A7FA 1C46A 4NGIA 2MEEA 3WVXA 1GE0A 3B72A 4LYZA 3QBVB 2NTGA 1QT6A 1P2RA 3PVUA 146LA 1LZ4A 3C8SA 3GUOA 1IOQA 2D11A 4CYEA 4CJ2A 1D9WA 4BAFA 4HB3B 1L81A 1LPIA 4B6HA 4D9ZA 1X11A 3WW5A 1G0LA 2YSSC 3N9AA 3GUMA 243LA 4XJIA 1GBWA 156LA 1XGPC 1L82A 1L88A 236LA 2W1LA 4OWCA 1D2YA 1G0PA 2HUKA 218LA 3E3DA 1G0KA 5D27A 6LYZA 4TKNA 1IO5A 4I8SA 209LA 1E5WA 1JITA 4BADA 4ARPA 5A3ZA 3SUZA 112LA 3TXHA 5DIFB 5LIOA 1KI1B 5KXXA 1LZNA 1UA6Y 4H9FA 3WXUA 3A58A 1PS5A 3OHMB 4NIJA 2VKIA 4WM2A 3U8ZA 3C7ZA 1QT8A 1IVMA 1L56A 3TXKA 2N0YA 196LA 1RCMA 1QUGA 1LZ6A 1L16A 1C6TA 3N9CA 104LA 4XYYA 1AQCA 253LA 4NG1A 2MEBA 193LA 1L71A 3SBAA 1L29A 2O7AA 3NWFA 1PQOA 1HERA 2BQNA 4WO9A 1T8FA 1EAZA 2YVBA 3HT7A 1W1GA 1KIPC 2FYCA 1NDGC 3TW1A 1YL1X 1JKCA 2RSCA 3ULRA 2F4AA 4OOOA 1VATA 1YAMA 1XEIA 5LAFA 3PP2A 1BGIA 1LJNA 3B0IA 1V7TA 1FLQA 1LJGA 4H9CA 1L49A 1I56A 1BB5A 1BWIA 1C6CA 1C69A 2LOXA 4UWNA 1C45A 5HE2A 2BQAA 3CDTA 5HE1A 4OWEA 4DDAA 2ZIKA 4H8ZA 1ALCA 1WVUA 3HDFA 2MEDA 150LA 4UWVA 3A91A 4GN1A 1PQJA 3AW7A 2MWNB 1T6HA 2YBIA 4KAXB 3HBEX 3WUAA 4I7LA 3A67Y 1TLAA 1WI1A 3NY8A 3TVVA 4QXAB 4MT7A 3KZ1A 1TDYA 4EMOA 2KIGA 5LVKA 2O4WA 1AZFA 3LN2A 3WYHA 3WPKA 5K7OA 247LA 2MEFA 5KKIA 1OWZA 2ADZA 5CLLB 4YONA 5LVGA 2MEHA 184LA 1P64A 1P2CC 3FE0A 5F9UA 3TMVA 1X05A 1J1OY 4TSBA 3V2WA 1WTNA 5DN4A 1CX7A 3F9LA 1L39A 1L25A 3A96A 4DD0A 2OU0X 1L84A 1LZCA 1WJMA 1LZYA 2B70A 4DJHA 1B5XA 1B5YA 5LVIA 1EVHA 3M3UA 1DYBA 1L61A 1QTDA 2YBMA 3PVWA 2BQIA 1OV7A 1SX7A 4DC4A 4OWBA 1LKSA 2YSZA 1ZYIA 4HPIA 1BQLY 2H9KA 1L63A 1LJEA 1IIZA 1LYJA 2G4NA 1BWNA 2HU1A 2YRYA 1C68A 2DQEY 2ZIJA 1QTEA 1SSYA 1P6SA 1INUA 1CJ7A 3N7CA 4A6FA 5M4YB 1L07A 4LT1A 1AM7A 4B0DA 1NMMA 4GOUA 1LGUA 3GXRA 1QUOA 2BQMA 4XJFA 3AGIA 1UIEA 1D9UA 2KCJA 4LYBA 2BLXA 4ARQB 1DDMA 3W6EA 5II3A 4YENA 5LA5A 3HTDA 1LWGA 2LG1A 2Y8PA 3RUNA 5C5BA 1OY2A 1Z55A 1L72A 2F2NA 3EMLA 3GUKA 1LSBA 1WQPA 2ZNXY 3X23A 3A94A 155LA 2BQBA 1CX6A 2N5ZA 1GBXA 1FHXA 4TTDA 2I5CA 3MDBC 1LZAA 4N1CC 3OE0A 4LZMA 3SB7A 3HH5A 1L23A 1UIHA 1DROA 1UIFA 4F7UP 1C66A 1XJUA 4EJ4A 220LA 2RRFA 1HMLA 2BQKA 3GYPA 4NGWA 2J0KA 3A3QA 1LYHA 4HTNA 3G9WA 3SP3A 3HUKA 1MIXA 130LA 187LA 4C3WA 1LZRA 5LINA 5HQ1A 5LVHA 4LYMA 4PGJB 3DN1A 1LSNA 1EF1A 1B5UA 1KZ7A 4KL7A 1OMWA 1M7EA 1C6MA 3WW6A 1JHLA 4H90A 4PK0A 1JSFA 2EC1A 1C6LA 4GN3A 5IELA 2CGIA 1QC6A 5FCPA 4H9HA 4HTKA 4RW1A 1DPWA 4I7KA 1KY0A 4ZFPA 2RLOA 3P6AA 4XJGA 4E3UA 1E8LA 4OOTA 1ZSQA 132LA 4NHQA 4CHXA 2GCLA 2CDSA 5J3YA 1LYIA 5HLLA 3N9EA 3SB6A 2YF0A 3D3DA 107LA 4LT3A 1GD6A 1LI3A 1HSXA 1OQMA 3LZMA 1LZSA 3WU7A 2LZMA 3CSRA 3AU4A
chains in the Genus database with same CATH topology
1HMKA 1YILA 4W55A 103LA 3NYAA 1UNRA 1LSAA 2ROVA 3EMSA 252LA 1L0JA 4IJ4A 3P68A 1VDSA 1HELA 4ETCA 3V5WA 4YX7C 1KZGA 1LZEA 230LA 4WG7A 1LYOA 5LAGA 2CUUA 4GN4A 2X0AA 1KIRC 1GFUA 1Y19B 1LI6A 4HDQA 1LMPA 4A6KA 4YF2A 1F6SA 3AZ6A 1QS9A 4S0WA 2V76A 1L51A 262LA 1V89A 2E2XA 1EGXA 1QT4A 3W6CA 4IASA 5LOPB 4GCBA 2JP2A 1XGTC 4N5RA 4BS7A 3HT9A 4XWXA 1GB2A 2B75A 4M4OA 1B6IA 1JEFA 1Y5OA 5GOWB 4NGKA 1P5TA 3FEHA 240LA 4OWAA 4I7QA 2ZQ4A 1RE2A 1G7JC 2OTXA 3D8FA 3A8PA 1NWGA 1JUGA 2W2XC 1CV0A 3RCPA 1UEFA 1L12A 2D4QA 2ZPYA 1C6GA 2YS5A 1LJHA 1OUIA 1L00A 5KXZA 5C5BB 1QTZA 1UIBA 3HT6A 4NHSA 5F9XA 1D3JA 2OE7X 217LA 4XENA 2J0JA 1GAZA 1OVHA 1REZA 1DZBX 1XFPL 4PNKA 3CT5A 1XCGA 2XQOA 1WQRA 1L95A 237LA 3W6DA 1BAKA 2XBSA 5F16A 4BBKA 3O96A 3T6UA 1CU5A 1GFRA 1OYUA 4DQ7A 2XQNM 2GV0A 1NTYA 1P7SA 4WL7A 2CRFA 3ODOA 2I26L 2DQCY 1JKAA 3LYZA 1LSEA 1NQIA 5FI0A 1MIZB 3G3VA 4MY6A 3K2RA 1GFGA 3CSQA 1V5UA 3HK0A 1X1FA 1OUHA 4H92A 1IC5Y 3W3EA 1FDLY 4NGVA 1J0WA 4Y94A 1V5PA 163LA 4EKUA 1L80A 3QWMA 1VFBC 2RBQA 4MSTA 1IRSA 4U3XB 2D10A 1B0DA 3PSCA 1DYCA 2FBDA 1L14A 1SWZA 3HTBA 3ODUA 1P46A 2EMSA 2DQJY 5HNLA 5JHGA 5KXOA 1IWWA 1FKQA 1GFAA 1ZYTA 4YOPA 162LA 4NY0A 1L47A 4NGZA 1L53A 5L9JA 2RBSA 1U5FA 1K28A 1CU0A 3DMZA 4ET9A 4DXAB 1CU6A 3DMVA 5FELA 1MK7B 1PZYA 5C16A 1FB8A 4Z41A 1J1XY 4EJNA 1LB1A 1BB7A 1LGXA 141LA 1D2WA 1QUSA 2Z6BA 5B07A 5KXPA 1TAYA 3HH3A 1OWYA 5C79A 4Z98A 1MPHA 3AGHA 2B6WA 1ZVYB 223LA 1D0KA 4LYTA 1JPOA 4HDOA 1FHWA 2OU8A 2YBHA 4K2OA 2DQGY 5IDDA 1GF7A 1HC0A 1JJ3A 1QUTA 215LA 2Z39A 3EBAB 1L18A 1WTHA 1NU2A 1V5MA 4WVFB 1LYEA 3SN6R 2CWIA 3P64A 1HFYA 1OUEA 3D8EA 1A2YC 3AGGG 3A8QA 5F81A 2ZQ3A 1DDVA 4WM4A 4PRUA 5LYTA 2LZTA 1YKXX 1NTVA 1IEEA 1QTBA 1GXV2 2LYZA 4HJVA 2W2WA 1N3HA 3TO1A 2B6XA 1JTTL 1L04A 5I53A 1CV3A 2NTHA 206LA 4B4JA 1IWYA 2OE9X 1GB8A 1G0JA 126LA 4LFPA 3ODXA 3CT0A 5HMVA 1IY4A 1DBHA 1ZC4B 1XEJA 4NHIA 1U2BA 1L93A 3ULBA 1LI2A 4H9AA 1L83A 1CJ8A 1C10A 1C6HA 3A93A 1LSCA 2BQGA 2OTZX 161LA 1XODA 3LZ2A 2P0FA 1GE1A 4KHAA 3F0WA 1P56A 2F47A 3CT1A 1LTMA 1OQNA 4H1PA 2OU9A 3ZVQB 2P8VA 3RZ4A 1GPQC 1L10A 3NY9A 4I7TA 195LA 1LJ3A 5HMJA 3CQLA 1W08A 1HEQA 4ANRA 1HEMA 3C82A 3W6AA 3B0OA 1IOTA 1B7LA 4MR1A 2Q9EA 1L37A 1TJ6A 1L20A 4J1AA 1CV4A 5DLAA 1IY3A 1FN5A 4NEBA 4NG8A 210LA 1J1PY 1OVJA 1X86A 5D3VA 4B1AA 3IWRA 1XX0A 5LONB 1L62A 2Z18A 1UNPA 1N4FA 3TMWA 3SBBC 249LA 5B59A 1L91A 1L02A 1L55A 3MPXA 3B0KA 5I5QA 139LA 1QT7A 160LA 1L59A 1HFXA 3LHMA 3C7YA 3HBHA 2DKQA 147LA 1SX2A 2DHKA 2I6ZA 4HB4B 1U5GA 4D0NB 1WGQA 4GN5C 1GB6A 2BQCA 4WM3A 1CVKA 4WO6A 1ZVRA 2DQAA 1QIOA 1EQ4A 1REYA 2LOZA 5FDJA 4DKLA 221LA 4DX90 1OUBA 3D4SA 5F14A 3WU8A 4II8A 5JHHA 1XR0B 1LZ1A 3QY4A 3TMUA 5E4PA 3GUNA 4HSFA 3A6BY 4HB2B 4GRVA 1U5EA 2H7DA 1IR7A 2ZILA 2BQDA 4DDBA 2D2QA 1IP5A 1JSEA 5I14A 5B1GA 1T8AA 1QQGA 2X18A 1L08A 1V7SA 1YIKA 1H10A 4LFXA 4ETBA 1VDTA 3A92A 1PMSA 1C6IA 144LA 2FYDA 4DYGA 4GMVA 2J0MA 4WL6A 1GDXA 4HAWB 5KXYA 4ZPUA 2EPEA 4ZRKA 2UZRA 1D0LA 2VRWB 1I6SA 1IP1A 1RJCB 5JENB 3QNGA 2EIZC 1DI4A 1FBIX 5IHGA 3SYXA 4W58A 1P3RA 2F4GA 1OVKA 4I7MA 3ODWA 4K81A 2RAYX 1L26A 1WQQA 1D6QA 1BVXA 1QSBA 3GXKA 1GF6A 1LZBA 232LA 2BLYA 4G4HA 4GPTB 2XTHA 1GEZA 4FDYA 1P36A 1JIYA 1JTOL 2IGCA 1I2HA 3PDSA 3OJPA 241LA 1K5GB 213LA 3AZ5A 222LA 1OUAA 1LHHA 5FEKA 3IVFA 1BB3A 4H93A 4OO9A 4DD1A 1G1VA 1C6JA 1L75A 2I1JA 1JWRA 1T8GA 4PPOA 153LA 5KQ4A 2W1MA 2LKOA 1IWVA 115LA 5FHWA 4ML7A 4Z2MB 4AGAA 140LA 1WVVA 4HV2A 1C64A 4GMXB 5I4YA 1IC4Y 1UCOA 1GB3A 1XSFA 5B06A 4HAYB 234LA 261LA 1G7MC 1C6BA 1L05A 2B74A 186LA 3FA0A 1G0MA 1JTNA 1YANA 2YBJA 1WQNA 3LYTA 4RLMA 123LA 185LA 4NSGA 2B5ZA 1C6DA 192LA 4NFVA 113LA 1MLCE 3AYQA 3SB5A 4ARLA 5D5FA 2DKVA 2RBPA 1NF5A 1PQIA 1JISA 1HHLA 1KNIA 1GB7A 5L3HA 1YAOA 2IFFY 4I0CA 5ILCA 1ZM0A 3FI7A 2YS1A 1KXYA 2WARA 2CODA 154LA 1G07A 216LA 3EXDA 1C6AA 2D6BA 2MDXA 3EO5A 3A95A 1B9OA 131LA 4DDCA 1L17A 188LA 4A5KA 1GFVA 1GB0A 173LA 1LKRA 1UC0A 2OQBA 1L52A 158LA 238LA 4BAPA 3DN0A 118LA 4N0JA 148LE 1L73A 3GUIA 4HV1A 2M38A 1KIQC 1L01A 2B72A 4ZIXA 1FLWA 1L0KA 2CJLA 251LA 1DYGA 2Z2FA 3DN8A 2ZYPA 1B5VA 1GC7A 2VSZA 1GFHA 1SSWA 4H9BA 3LYMA 3FSSA 4TWSA 2EQLA 1AT6A 3CIKA 1MELL 1XD4A 5APDA 1DKKA 4IOYX 5FSTA 1LMQA 3ZEKA 1FKVA 2W1XA 133LA 1NBZC 1B7QA 3KRWA 1GF9A 3C81A 1F0WA 3PVLA 1FHOA 3SB8A 1L77A 1QT3A 3FI5A 2GJYA 3RZEA 1LYYA 2DTCA 239LA 3P7ZA 3TXEA 1M7RA 4X3BA 1REMA 1WTMA 1WG7A 2HTHB 1BWJA 2Q0MX 4WJ7A 3F5RA 5KXLA 244LA 3IJUA 2LCBA 1O23A 5B1FA 2C8PA 4PJZA 1DYFA 151LA 1OV5A 3DN3A 4ET8A 182LA 1LAAA 2HEFA 256LA 3WPLA 1L57A 260LA 1G0QA 1LMCA 3CB7A 1B7PA 1DQJC 2QKLA 1JKBA 1L09A 199LA 1LJ4A 5FI1A 3KY9A 2HTXA 1REXA 7LZMA 231LA 2P0DA 2ZWBA 3J4GA 4XADA 170LA 2K2JA 4J7VA 3ULCA 224LA 2DLWA 2DN6A 2HE7A 1IP4A 4ARJA 1Q67A 143LA 3WPJA 1IOCA 1GDWA 1P37A 1EQ5A 1T3PA 4CHMA 1VEDA 3CDVA 1D3FA 4EKQA 2PC2A 1UBZA 5E9RA 1MAIA 2A7DA 198LA 3HDEA 1G06A 4W96A 1CV5A 255LA 227LA 2MEAA 2COFA 1GB9A 4NGLA 1L34A 169LA 2HUBA 1TEWA 1HEOA 1LYGA 1C62A 2AEHA 4YM8A 4I7NA 2IYBA 4DT3A 3OE6A 1DYDA 2K2UA 2FJLA 3BKHA 2COCA 1TBYA 5D3WA 1ZMYL 4B4EA 2W2XD 1JJ0A 1F6RA 1MK9B 2MKRA 1L30A 166LA 2F32A 4RLNA 259LA 1LHLA 1LZDA 7LYZA 2DX1A 4F7GA 1I20A 1L11A 1W6ZA 4B4IA 177LA 4G4BA 2DYQA 1C6NA 2H7EA 2NMBA 180LA 1XEKA 2ZNWY 149LA 5I54A 3HUQA 2D9XA 1GHLA 4KVGB 129LA 3VIAA 3C83A 4I7JA 1HF4A 4HAZB 200LA 4H9IA 3OANA 4YEMA 4IAPA 4K5YA 1XKEA 211LA 1CJ6A 2FBBA 1CUPA 2D91A 4XJHA 2LYMA 1TQZA 1L70A 2EMTA 2YBLA 3ATOA 1X1GA 2MEGA 5APEA 1DI5A 3PZDA 4LZTA 1LZ5A 1LJIA 3MGWA 4TX7A 4E97A 4EPIA 1LW3A 1L35A 2BQLA 1L97A 1NDMC 120LA 4DD9A 1B7MA 3LYOA 2RGNB 2D4KA 1L21A 4KPMA 1IWXA 8LYZA 2B73A 4G49A 4GBRB 1GWDA 1LSPA 4NGOA 4NWHA 1GF0A 4Z46A 1XEPA 4W52A 5LYMA 119LA 1MKEA 4KHOA 3DXDA 5KXRA 5JLJB 3TCAA 1GXXA 4R6CA 4HPEA 1K5DB 4G4CA 4O34A 4HHVA 2W1YA 1PLSA 1QSWA 2DFKA 4L6EA 1GFEA 1CJ9A 1KXXA 5DM9A 5D5CA 4H94A 5DN5A 1LMAA 4CHJA 1FGYA 1UUZC 1LSGA 1LZTA 1IWZA 226LA 4HJYA 4HB0B 1GF5A 4Z2NA 5DI9B 1OUFA 3HQCA 4Z3MA 2QARC 4NGYA 3DN6A 5APCA 3T36A 1FGZA 4LT0A 4WG1A 3M18B 1L48A 1HENA 2LC9A 4DQ5A 3G3WA 3HU8A 1CKGA 1HEPA 2DYNA 4J1BA 1QSAA 4W53A 2G4PA 1L40A 2DHIA 4L41A 5LA8A 2F2QA 2DHJA 1LPYA 4ETEA 1IP2A 4I7RA 3ATNA 2BPUA 2ANVA 1LMNA 3QAKA 4DAJA 3VW7A 246LA 1GE2A 4H8XA 1DYEA 5J3QA 1QSQA 1L60A 1C7PA 4I7SA 4PRQA 1CUQA 1GFKA 2VB1A 2LULA 4MK0A 3GUJA 1P6YA 2IFSA 3G3XA 1CV1A 1XJTA 1LZ9A 108LA 3A6CY 4HAXB 1C60A 5KXTA 3CXBB 3WYFB 1L06A 2YS3A 3P65A 3GULA 3C8RA 4J0LA 5KXWA 5C6RA 1DI3A 2Y8FA 1WQOA 4ETAA 1LZGA 3PBLA 5AMYA 1C6EA 176LA 5KJ9A 1VAUA 4EKPA 1LSFA 3RU5A 4MCKA 1LHMA 1UIGA 2NZ8B 1NI2A 135LA 1LWKA 1IWUA 2B6TA 5KCVA 258LA 1F10A 2PZ1A 4YL8A 1B5ZA 2QKMA 4WM1A 1C08C 4W59A 2DQIY 4DWXA 3SO6A 2CY4A 3DXEA 4HAVB 5HNCA 1UICA 1V61A 4OWHA 1L31A 1L92A 1FLUA 2Z0PA 4TYZA 1LMTA 1HFZA 5C6JA 4H8YA 4IATA 1L44A 250LA 2BCJA 1L86A 3GYOA 1CKHA 2B6ZA 1PFJA 1CKFA 3A3RX 3RT5X 5APFA 3BINA 4WLYA 4TUNA 1OUCA 2HEDA 4B49A 1L27A 4H8SA 2RBRA 1QTVA 4GLVA 257LA 1CKCA 1SWYA 4P7IA 1AKIA 3UONA 4PQ0A 1YAPA 3AW6A 4C5FA 3HTFA 4NWEA 2L78A 1IP3A 152LA 1P2LA 4W57A 3WA0A 1ZC3B 1IOSA 1CU2A 3C7WA 1XGQC 2J59M 1WGUA 2BAAA 5HE0A 207LA 1L94A 1YKZX 4W54A 4KT3A 3G3AB 2K00A 2L2IA 3ZDTA 3M1IB 2MECA 3G3BB 4KHBB 1L89A 1P3NA 3DKEX 5KXKA 1FOEA 3CDOA 1B55A 5A3EA 3D9AC 4WLXA 3UZTA 3BKVA 1DKJA 1BB6A 4WOAA 1KXWA 3F6ZA 3WVYA 1DPXA 3WXTA 4YXAC 2LHMA 1IORA 134LA 2YDGA 3HTGA 1L41A 4NSJA 1GG3A 1WVHA 5DHFB 2B6YA 214LA 2RAZX 2HECA 102LA 1L66A 4EMNA 1GF4A 4YXCA 145LA 5D3XA 201LA 3L2XA 2R09A 1LMOA 1H87A 1IR9A 2COAA 1T97A 2LZ2A 1A4VA 1B7NA 3V2YA 4QGZA 3KAMA 1TCYA 2D9YA 2BQEA 3DN4A 2UVMA 1LYDA 127LA 122LA 4W56A 6LZMA 2H9JA 1EL1A 1LJJA 4XJDA 5KXMA 3AJNA 4AQNA 1GAYA 4HJZA 4LGKA 3ZVQA 1JTPL 3HH4A 1FAOA 1FLYA 1L24A 1L19A 228LA 2I25L 125LA 4ZEEA 2RSGA 2G35A 4ZRIA 3A8ZA 1LHIA 3WULA 4NHTA 5L81A 4CFPA 2HU3A 1DYNA 2DKPA 4WSFA 1HEWA 2RBOA 4NY5A 1RRPB 1NHBA 1EPYA 2EKSC 3TXBA 1L87A 1EQEA 208LA 1SQ2L 1UIDA 1VDQA 1W1DA 1YROA 4W51A 3DN2A 4P2EA 3K3TA 2DQFC 3C80A 4DD3A 2M14A 3U7DA 1L33A 1GFTA 1BTKA 3AJ4A 4NSWA 3TFMA 4LDLA 4YEOA 1QT5A 2Z37A 1B7SA 1QTKA 2Z12A 4CGEA 5LVJA 4AXTA 1LLHA 5KY1A 3LJUX 1RJ2A 4HTQA 1ISNA 137LA 4NSIA 1XGUC 1LHKA 159LA 1LYSA 229LA 1V88A 2ANXA 1GC6A 1GEVA 2HUMA 3HFMY 5I4XA 3WL2A 114LA 172LA 1H6MA 3IJVA 1LYZA 1L99A 2Z0QA 1GBSA 1B2KA 2IHLA 1GF8A 1IC7Y 1WJ1A 4CFOA 1L69A 197LA 1L22A 1LSYA 4G9SA 1IWTA 1IP6A 2OTYX 3B6LA 2LYOA 5T3FA 2RB1X 2DQDY 1QTHA 1QTCA 1LCNA 4ETDA 4QY9A 2D9WA 3DXCA 2Q13A 3HU9A 2GS0A 3TXFA 1NKHA 1L65A 1VDPA 3PG7A 1C67A 1CU3A 1GBOA 4WLTA 4NSHA 3AZ4A 4K2PA 212LA 1BWHA 2BQFA 1H4RA 2HEBA 3GUPA 1IX0A 181LA 1BVKC 3CDRA 109LA 3W6BA 4W94A 3TXJA 5KXSA 1UPRA 3SNHA 3BJIA 245LA 1L68A 1OUJA 1QUDA 3TMXA 3F8VA 1C6KA 5LYZA 168LA 1L85A 1C6QA 4HAUB 3TXIA 2Z19A 3RW8A 219LA 2YT0A 3AB6A 2YT1A 1QDTA 4UWUA 2RB2X 3WMKA 1RI8B 2D4IA 4PHIA 2C8OA 1ZWNA 5M1YA 1QDRA 1LSDA 3PEGA 2Y7BA 4LDEA 1AWEA 2ELAA 1PQMA 2R0DA 1OUDA 1BB4A 2O79A 1SGHA 2AUBA 2ELBA 3QIJA 1HSWA 1SHCA 1D6PA 3AU5A 1TXDA 183LA 1JJ1A 1P5CA 2HEAA 4WMGA 1L54A 1L03A 2OEAX 3D8DA 3HW2B 2DQHY 2BQOA 2D9ZA 2RNRB 2XBRA 1L28A 1LSMA 5ILFA 3FM8C 5EBHA 4GCFA 1U27A 1L58A 2B7XA 2D4JA 3DMXA 4A6FB 2Z2EA 1L15A 4ARMB 3TXGA 1Z87A 175LA 1UACY 2F30A 1C61A 1C63A 1NHEA 4FJRA 2XJWA 3HH6A 1NBYC 4TSCA 4EXMA 1GB5A 4HATB 1LJFA 5CLQB 1KW5A 1DXJA 4ARMA 174LA 5LXWA 4H9EA 3TXDA 2I5FA 1I7AA 5JP4A 2CY5A 138LA 1G0GA 1L90A 1LW9A 111LA 3WH1A 1L36A 3L64A 2ZYCA 3T06A 1J19A 1T6VL 4HP0A 1GBYA 4OW1A 4IFSA 1YQVY 1D3NA 3WU9A 5J3TA 4NGJA 1L67A 5HE3A 1BHZA 1L32A 3QE8A 1B7OA 1G1WA 1I1ZA 1L74A 1YAQA 3A98B 1ZVHL 2N23A 3NSUA 4XN6A 2RBNA 1D0MA 2RH1A 1JQUA 1CTWA 3KSYA 1LYFA 2LYDA 3HWLA 2G4QA 1BTNA 3LZTA 5I4WA 3KRXA 4GCEA 2KUPA 1ZURA 1DDWA 2Z38A 2BQJA 4EKRA 4GZUA 1L96A 1LOZA 1IP7A 5C6IA 235LA 3J6KA 2YBNA 4XJBA 4EPFA 4KXIA 3FADA 1KS3A 1LGWA 2UZSA 205LA 242LA 3SB9A 4I7PA 1GE4A 2YVCA 5J7CA 3A34A 1W1HA 2Y8GA 2QB0B 1LJKA 4PJ2C 4RDSA 2I1KA 5C6LA 3HT8A 2RVBB 1GBZA 5DH9B 1L64A 189LA 3A90A 1B5WA 1YKYX 3CDQA 1QS5A 2DX5A 4LDOA 1CKDA 142LA 1L46A 4WLDA 1GF3A 1L98A 4LYCA 2NWDX 3WUMA 1OUGA 2HULA 2P0HA 2DBTA 1WQMA 3W6FA 3P4ZA 1IR8A 5KKJA 1UIAA 4I7OA 3HBDA 3SV1A 1G7LC 3WUNA 1B7RA 1KW7A 248LA 5B05A 3OE9A 1C6FA 3ZVRA 1U29A 1L79A 2AL6A 3DNAA 9LYZA 5LZMA 4K17A 1U5DA 1C43A 4LT2A 4DQJA 1LHJA 1RFPA 191LA 5L3IA 2ROZB 171LA 2MFQA 3VWOA 2HEEA 1C6PA 165LA 4RW2A 1XGRC 4N8ZA 233LA 2CAYA 1ZV5L 4A7DA 1AT5A 1L50A 3RNXA 3P66A 1JKDA 5EFXA 3OE8A 1CNSA 4LYOA 4DD7A 1DYAA 194LA 1GFJA 2Q9DA 167LA 225LA 1LZ8A 2RUKB 157LA 1SLYA 4QEQA 164LA 2DA0A 4GCDA 2RB0X 110LA 5KQ1A 1PQKA 2A4TA 1KY1A 190LA 3AZ7A 1G7IC 1HNLA 5D3YA 178LA 1D3MA 254LA 128LA 2MEIA 2D9VA 3HUAA 4N9RA 1PQDA 5DHAB 4WM5A 1L38A 4GCCA 4EOFA 3JR6A 4ZRJA 4GLAA 1OP9B 2BQHA 3OK0A 5DL9A 2EJ8A 2Z0OA 3CSZA 5KXNA 1QQYA 1L43A 4F7HA 4DX8A 2H5ZA 1L13A 1L42A 4R0FA 1CV6A 1L45A 2OE4X 6LYTA 4ARQA 3ML4A 1UNQA 1GE3A 2KGXB 4WM6A 4A6HA 4DD2A 4NHPA 1QUHA 4DBBA 4EKSA 4QDNA 3VOQA 1LSZA 4H91A 2GCJA 4C0AA 1G7HC 1UPQA 4N1EI 3C8QA 1JTMA 1L76A 1C65A 2L1CA 4M6DA 1YL0X 4GXBA 2A7FA 1C46A 4NGIA 2MEEA 3WVXA 1GE0A 3B72A 4LYZA 3QBVB 2NTGA 1QT6A 1P2RA 3PVUA 146LA 1LZ4A 3C8SA 3GUOA 1IOQA 2D11A 4CYEA 4CJ2A 1D9WA 4BAFA 4HB3B 1L81A 1LPIA 4B6HA 4D9ZA 1X11A 3WW5A 1G0LA 2YSSC 3N9AA 3GUMA 243LA 4XJIA 1GBWA 156LA 1XGPC 1L82A 1L88A 236LA 2W1LA 4OWCA 1D2YA 1G0PA 2HUKA 218LA 3E3DA 1G0KA 5D27A 6LYZA 4TKNA 1IO5A 4I8SA 209LA 1E5WA 1JITA 4BADA 4ARPA 5A3ZA 3SUZA 112LA 3TXHA 5DIFB 5LIOA 1KI1B 5KXXA 1LZNA 1UA6Y 4H9FA 3WXUA 1PS5A 4NIJA 2VKIA 4WM2A 3U8ZA 3C7ZA 1QT8A 1IVMA 1L56A 3TXKA 2N0YA 196LA 1RCMA 1QUGA 1LZ6A 1L16A 1C6TA 3N9CA 104LA 4XYYA 1AQCA 253LA 4NG1A 2MEBA 193LA 1L71A 3SBAA 1L29A 2O7AA 1PQOA 1HERA 2BQNA 4WO9A 1T8FA 1EAZA 2YVBA 3HT7A 1W1GA 1KIPC 2FYCA 1NDGC 3TW1A 1YL1X 1JKCA 2RSCA 3ULRA 2F4AA 4OOOA 1VATA 1YAMA 1XEIA 5LAFA 3PP2A 1BGIA 1LJNA 3B0IA 1V7TA 1FLQA 1LJGA 4H9CA 1L49A 1I56A 1BB5A 1BWIA 1C6CA 1C69A 2LOXA 4UWNA 1C45A 5HE2A 2BQAA 3CDTA 5HE1A 4OWEA 4DDAA 2ZIKA 4H8ZA 1ALCA 1WVUA 3HDFA 2MEDA 150LA 4UWVA 3A91A 4GN1A 1PQJA 3AW7A 2MWNB 1T6HA 2YBIA 4KAXB 3HBEX 3WUAA 4I7LA 3A67Y 1TLAA 1WI1A 3NY8A 3TVVA 4MT7A 3KZ1A 1TDYA 4EMOA 5LVKA 2O4WA 1AZFA 3LN2A 3WYHA 3WPKA 5K7OA 247LA 2MEFA 5KKIA 1OWZA 2ADZA 5CLLB 4YONA 5LVGA 2MEHA 184LA 1P64A 1P2CC 3FE0A 5F9UA 3TMVA 1X05A 1J1OY 4TSBA 3V2WA 1WTNA 5DN4A 1CX7A 3F9LA 1L39A 1L25A 3A96A 4DD0A 2OU0X 1L84A 1LZCA 1WJMA 1LZYA 2B70A 4DJHA 1B5XA 1B5YA 5LVIA 1EVHA 3M3UA 1DYBA 1L61A 1QTDA 2YBMA 3PVWA 2BQIA 1OV7A 1SX7A 4DC4A 4OWBA 1LKSA 2YSZA 4HPIA 1BQLY 2H9KA 1L63A 1LJEA 1IIZA 1LYJA 2G4NA 1BWNA 2HU1A 2YRYA 1C68A 2DQEY 2ZIJA 1QTEA 1SSYA 1P6SA 1INUA 1CJ7A 3N7CA 4A6FA 1L07A 4LT1A 1AM7A 4B0DA 1NMMA 1LGUA 3GXRA 1QUOA 2BQMA 4XJFA 3AGIA 1UIEA 1D9UA 2KCJA 4LYBA 2BLXA 4ARQB 1DDMA 3W6EA 5II3A 4YENA 5LA5A 3HTDA 1LWGA 2LG1A 2Y8PA 3RUNA 5C5BA 1OY2A 1Z55A 1L72A 2F2NA 3EMLA 3GUKA 1LSBA 1WQPA 2ZNXY 3X23A 3A94A 155LA 2BQBA 1CX6A 2N5ZA 1GBXA 1FHXA 4TTDA 2I5CA 3MDBC 1LZAA 4N1CC 3OE0A 4LZMA 3SB7A 3HH5A 1L23A 1UIHA 1DROA 1UIFA 4F7UP 1C66A 1XJUA 4EJ4A 220LA 1HMLA 2BQKA 3GYPA 4NGWA 2J0KA 3A3QA 1LYHA 4HTNA 3G9WA 3SP3A 3HUKA 1MIXA 130LA 187LA 4C3WA 1LZRA 5LINA 5HQ1A 5LVHA 4LYMA 4PGJB 3DN1A 1LSNA 1EF1A 1B5UA 1KZ7A 4KL7A 1OMWA 1M7EA 1C6MA 3WW6A 1JHLA 4H90A 4PK0A 1JSFA 2EC1A 1C6LA 4GN3A 5IELA 2CGIA 1QC6A 5FCPA 4H9HA 4HTKA 4RW1A 1DPWA 4I7KA 1KY0A 4ZFPA 2RLOA 3P6AA 4XJGA 4E3UA 1E8LA 4OOTA 1ZSQA 132LA 4NHQA 4CHXA 2GCLA 2CDSA 5J3YA 1LYIA 5HLLA 3N9EA 3SB6A 2YF0A 3D3DA 107LA 4LT3A 1GD6A 1LI3A 1HSXA 1OQMA 3LZMA 1LZSA 3WU7A 2LZMA 3CSRA 3AU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PZ1 A;  4W55 A;  103L A;  4YL8 A;  3NYA A;  1UNR A;  4OO9 A;  2ROV A;  2QKM A;  1G1V A;  252L A;  4W59 A;  3SO6 A;  1L0J A;  2CY4 A;  3DXE A;  4HAV B;  1C6J A;  1L75 A;  2I1J A;  191L A;  2ROZ B;  1V61 A;  171L A;  1T8G A;  2MFQ A;  1L31 A;  1L92 A;  1C6P A;  2Z0P A;  165L A;  4TYZ A;  3V5W A;  5KQ4 A;  4YX7 C;  2CAY A;  233L A;  1KZG A;  115L A;  2LKO A;  230L A;  4Z2M B;  1L50 A;  1L44 A;  250L A;  2BCJ A;  140L A;  5EFX A;  2CUU A;  1L86 A;  3OE8 A;  3GYO A;  1C64 A;  4GMX B;  1DYA A;  1Y19 B;  1LI6 A;  4HDQ A;  5KQ1 A;  2B6Z A;  1PFJ A;  4A6K A;  2Q9D A;  167L A;  225L A;  3BIN A;  2RUK B;  157L A;  1QS9 A;  164L A;  4S0W A;  2V76 A;  2DA0 A;  4HAY B;  234L A;  261L A;  1L51 A;  1C6B A;  1L05 A;  2B74 A;  2RB0 X;  110L A;  186L A;  1G0M A;  1JTN A;  1L27 A;  262L A;  1PQK A;  3FA0 A;  2RBR A;  2A4T A;  1V89 A;  2E2X A;  1KY1 A;  1QTV A;  4H8S A;  1EGX A;  190L A;  1QT4 A;  257L A;  5LOP B;  5D3Y A;  123L A;  185L A;  2JP2 A;  178L A;  1D3M A;  254L A;  3HT9 A;  128L A;  4XWX A;  1SWY A;  4P7I A;  1C6D A;  2D9V A;  3UON A;  2B75 A;  192L A;  1B6I A;  3HUA A;  113L A;  1PQD A;  1Y5O A;  5GOW B;  5DHA B;  1P5T A;  3FEH A;  240L A;  4PQ0 A;  1L38 A;  4I7Q A;  3SB5 A;  3HTF A;  2OTX A;  3D8F A;  2L78 A;  3A8P A;  4ARL A;  3JR6 A;  152L A;  1P2L A;  4W57 A;  2W2X C;  1ZC3 B;  4ZRJ A;  3WA0 A;  2RBP A;  2Z0O A;  3C7W A;  1CU2 A;  2EJ8 A;  1CV0 A;  1WGU A;  1PQI A;  1UEF A;  2J59 M;  3RCP A;  5HE0 A;  1KNI A;  1L94 A;  1L12 A;  2D4Q A;  2ZPY A;  4W54 A;  1C6G A;  1L43 A;  4F7H A;  4DX8 A;  2K00 A;  1ZM0 A;  2YS5 A;  5C5B B;  1L00 A;  2L2I A;  2YS1 A;  3ZDT A;  2COD A;  3M1I B;  1L13 A;  1L42 A;  1QTZ A;  3HT6 A;  1G07 A;  216L A;  1CV6 A;  1C6A A;  1D3J A;  1L45 A;  2OE7 X;  2MDX A;  2OE4 X;  4KHB B;  1L89 A;  1P3N A;  217L A;  3DKE X;  4ARQ A;  1FOE A;  3CDO A;  1B55 A;  131L A;  1OVH A;  2J0J A;  3ML4 A;  1UNQ A;  1L17 A;  3UZT A;  188L A;  4PNK A;  4A5K A;  1XCG A;  2KGX B;  4DBB A;  173L A;  4A6H A;  1QUH A;  2OQB A;  4EKS A;  1L95 A;  1L52 A;  237L A;  3VOQ A;  158L A;  2GCJ A;  4C0A A;  1BAK A;  238L A;  3DN0 A;  3O96 A;  4BBK A;  118L A;  1UPQ A;  148L E;  4YXA C;  3C8Q A;  1CU5 A;  1JTM A;  1OYU A;  2XQN M;  1L76 A;  1C65 A;  3DXC A;  1L73 A;  2L1C A;  3GUI A;  1NTY A;  3HTG A;  1L41 A;  5DHF B;  1GG3 A;  1P7S A;  1WVH A;  2M38 A;  4GXB A;  1L01 A;  2B72 A;  2B6Y A;  214L A;  2CRF A;  3ODO A;  1L0K A;  251L A;  1DYG A;  3DN8 A;  2RAZ X;  3QBV B;  102L A;  2NTG A;  1QT6 A;  1L66 A;  1P2R A;  1GC7 A;  2VSZ A;  146L A;  3PVU A;  1SSW A;  3C8S A;  3GUO A;  2D11 A;  4CYE A;  3FSS A;  4YXC A;  145L A;  5D3X A;  201L A;  3L2X A;  2R09 A;  5FI0 A;  1MIZ B;  3G3V A;  3CIK A;  4MY6 A;  1D9W A;  2COA A;  1XD4 A;  1T97 A;  3K2R A;  4HB3 B;  3V2Y A;  1L81 A;  1V5U A;  3HK0 A;  4IOY X;  2D9Y A;  4B6H A;  3DN4 A;  1X11 A;  2UVM A;  1LYD A;  1G0L A;  127L A;  1X1F A;  122L A;  4W56 A;  6LZM A;  3GUM A;  243L A;  156L A;  1J0W A;  1V5P A;  4Y94 A;  4AQN A;  1L82 A;  1L88 A;  3KRW A;  163L A;  236L A;  3C81 A;  3HH4 A;  1L80 A;  3QWM A;  4EKU A;  1FAO A;  1L24 A;  1L19 A;  1D2Y A;  228L A;  1G0P A;  125L A;  2RSG A;  3SB8 A;  3PVL A;  2G35 A;  2RBQ A;  1FHO A;  4ZRI A;  1L77 A;  1QT3 A;  3FI5 A;  1IRS A;  3RZE A;  2GJY A;  5L81 A;  2D10 A;  2HUK A;  3PSC A;  218L A;  2DTC A;  1DYC A;  239L A;  1L14 A;  1SWZ A;  3HTB A;  3ODU A;  1DYN A;  2DKP A;  1M7R A;  1P46 A;  2RBO A;  1RRP B;  3P7Z A;  4WSF A;  1NHB A;  1G0K A;  1WG7 A;  1EPY A;  2EMS A;  2HTH B;  4WJ7 A;  1L87 A;  5JHG A;  3F5R A;  1ZYT A;  244L A;  162L A;  4TKN A;  5D27 A;  1W1D A;  209L A;  4NY0 A;  1E5W A;  2LCB A;  3DN2 A;  4W51 A;  4ARP A;  1L47 A;  3SUZ A;  3C80 A;  1L53 A;  2M14 A;  2RBS A;  1U5F A;  3U7D A;  1L33 A;  4PJZ A;  112L A;  1DYF A;  1CU0 A;  1K28 A;  3DMZ A;  151L A;  1OV5 A;  3DN3 A;  1BTK A;  1KI1 B;  5DIF B;  4DXA B;  3AJ4 A;  182L A;  1CU6 A;  3DMV A;  4NSW A;  3TFM A;  256L A;  4LDL A;  1MK7 B;  5C16 A;  1QT5 A;  1L57 A;  1FB8 A;  260L A;  1G0Q A;  2VKI A;  3U8Z A;  4EJN A;  3C7Z A;  1QT8 A;  2QKL A;  1L56 A;  1L09 A;  1LLH A;  3LJU X;  2N0Y A;  196L A;  1LB1 A;  1LGX A;  141L A;  1D2W A;  1RJ2 A;  199L A;  1QUG A;  2Z6B A;  137L A;  1ISN A;  3KY9 A;  5FI1 A;  1L16 A;  159L A;  1C6T A;  7LZM A;  229L A;  104L A;  1V88 A;  231L A;  2P0D A;  3HH3 A;  1OWY A;  2ANX A;  1AQC A;  1GC6 A;  253L A;  5C79 A;  1L71 A;  1MPH A;  3SBA A;  2HUM A;  1L29 A;  170L A;  2B6W A;  2O7A A;  2K2J A;  114L A;  1PQO A;  3ULC A;  224L A;  2DLW A;  2DN6 A;  172L A;  2HE7 A;  4ARJ A;  1Q67 A;  143L A;  1L99 A;  223L A;  2Z0Q A;  1T8F A;  1EAZ A;  1P37 A;  3HT7 A;  1W1G A;  4CHM A;  1WJ1 A;  1L69 A;  197L A;  4HDO A;  1L22 A;  1FHW A;  2OU8 A;  2OTY X;  3CDV A;  4K2O A;  2RB1 X;  1QTH A;  1QTC A;  3TW1 A;  1D3F A;  4EKQ A;  215L A;  1MAI A;  1L18 A;  1WTH A;  198L A;  1NU2 A;  3HDE A;  1LYE A;  3SN6 R;  1V5M A;  1G06 A;  2D9W A;  2Q13 A;  4WVF B;  3HU9 A;  2GS0 A;  1CV5 A;  3PP2 A;  1L65 A;  255L A;  227L A;  3PG7 A;  1C67 A;  1CU3 A;  2COF A;  1L49 A;  3D8E A;  1L34 A;  169L A;  4K2P A;  212L A;  1C6C A;  1C69 A;  1H4R A;  2LOX A;  3A8Q A;  3GUP A;  5HE2 A;  3CDT A;  1LYG A;  1DDV A;  5HE1 A;  181L A;  3CDR A;  109L A;  1C62 A;  2AEH A;  1NTV A;  1QTB A;  2W2W A;  4I7N A;  3HDF A;  2IYB A;  1N3H A;  150L A;  3TO1 A;  2B6X A;  1L04 A;  1UPR A;  3SNH A;  4GN1 A;  1PQJ A;  3OE6 A;  3BJI A;  2MWN B;  1T6H A;  245L A;  1CV3 A;  1L68 A;  1DYD A;  2K2U A;  2FJL A;  4KAX B;  2NTH A;  1QUD A;  206L A;  3F8V A;  2COC A;  1C6K A;  2OE9 X;  4I7L A;  5D3W A;  168L A;  1TLA A;  1G0J A;  1WI1 A;  3NY8 A;  3TVV A;  126L A;  3ODX A;  1L85 A;  1DBH A;  4MT7 A;  1C6Q A;  3KZ1 A;  4HAU B;  1ZC4 B;  2W2X D;  4EMO A;  2O4W A;  219L A;  1MK9 B;  1U2B A;  2YT1 A;  2YT0 A;  1L93 A;  2MKR A;  1L30 A;  2RB2 X;  166L A;  247L A;  3ULB A;  2F32 A;  259L A;  4F7G A;  1LI2 A;  1OWZ A;  1ZWN A;  2ADZ A;  2DX1 A;  1L83 A;  5CLL B;  4YON A;  3PEG A;  1C6H A;  2Y7B A;  184L A;  1P64 A;  4LDE A;  1AWE A;  1L11 A;  177L A;  2ELA A;  2OTZ X;  161L A;  1C6N A;  1PQM A;  1XOD A;  2DYQ A;  2H7E A;  2NMB A;  2R0D A;  180L A;  2P0F A;  4KHA A;  2O79 A;  149L A;  3F0W A;  1P56 A;  3HUQ A;  1SGH A;  2D9X A;  2ELB A;  2F47 A;  1X05 A;  1SHC A;  3QIJ A;  4KVG B;  129L A;  3V2W A;  1OQN A;  1TXD A;  183L A;  1P5C A;  3AU5 A;  3VIA A;  2OU9 A;  1CX7 A;  3F9L A;  1L39 A;  1L25 A;  2P8V A;  3C83 A;  1L10 A;  1L03 A;  1L54 A;  2OEA X;  2OU0 X;  3NY9 A;  4I7J A;  4I7T A;  3D8D A;  195L A;  1L84 A;  1WJM A;  2RNR B;  2D9Z A;  4HAZ B;  1L28 A;  200L A;  2B70 A;  4DJH A;  3FM8 C;  3OAN A;  1EVH A;  4IAP A;  4K5Y A;  1DYB A;  1L58 A;  2B7X A;  211L A;  1L61 A;  1U27 A;  1XKE A;  3DMX A;  3C82 A;  1CUP A;  4A6F B;  1QTD A;  3PVW A;  1L15 A;  1OV7 A;  1TQZ A;  1SX7 A;  1L70 A;  2EMT A;  4ARM B;  1X1G A;  2Q9E A;  1L37 A;  3HW2 B;  1TJ6 A;  3PZD A;  1Z87 A;  175L A;  1L20 A;  2YSZ A;  1CV4 A;  4EPI A;  1C61 A;  1C63 A;  4E97 A;  1L63 A;  1LW3 A;  1L35 A;  1LYJ A;  210L A;  1OVJ A;  3HH6 A;  1BWN A;  1L97 A;  1X86 A;  120L A;  5D3V A;  4EXM A;  2YRY A;  2RGN B;  1C68 A;  1XX0 A;  5LON B;  1L21 A;  1SSY A;  1L62 A;  4HAT B;  5CLQ B;  1KW5 A;  2B73 A;  4GBR B;  4ARM A;  1P6S A;  1UNP A;  174L A;  1XEP A;  3N7C A;  4A6F A;  4W52 A;  1L07 A;  3SBB C;  119L A;  1MKE A;  4KHO A;  3DXD A;  249L A;  2I5F A;  1I7A A;  5JP4 A;  1LGU A;  2CY5 A;  1L91 A;  138L A;  1G0G A;  1L55 A;  1L02 A;  1L90 A;  1LW9 A;  3MPX A;  1QT7 A;  139L A;  3TCA A;  111L A;  160L A;  5JLJ B;  1L59 A;  1QUO A;  3C7Y A;  1L36 A;  3L64 A;  1K5D B;  2DKQ A;  3T06 A;  4HHV A;  147L A;  1J19 A;  1SX2 A;  2DHK A;  2KCJ A;  4HB4 B;  4ARQ B;  1U5G A;  4IFS A;  4D0N B;  1DDM A;  1WGQ A;  1D3N A;  5J3T A;  1PLS A;  1L67 A;  1CVK A;  5HE3 A;  1ZVR A;  3HTD A;  1LWG A;  2DFK A;  4L6E A;  2LG1 A;  3RUN A;  1L32 A;  5C5B A;  1G1W A;  1L74 A;  1OY2 A;  3A98 B;  1L72 A;  2LOZ A;  4CHJ A;  2N23 A;  3EML A;  221L A;  4DKL A;  3GUK A;  4DX9 0;  3NSU A;  1FGY A;  226L A;  2RBN A;  4HB0 B;  3D4S A;  3X23 A;  155L A;  2RH1 A;  1CX6 A;  5DI9 B;  1JQU A;  4Z2N A;  1XR0 B;  5JHH A;  3HQC A;  2QAR C;  1CTW A;  1FHX A;  3KSY A;  2I5C A;  1LYF A;  3MDB C;  3DN6 A;  2LYD A;  3GUN A;  1FGZ A;  3HWL A;  1BTN A;  3OE0 A;  4LZM A;  1L48 A;  3SB7 A;  4HB2 B;  3HH5 A;  1L23 A;  2LC9 A;  3KRX A;  4GRV A;  3G3W A;  2KUP A;  1DRO A;  1U5E A;  4F7U P;  1ZUR A;  1DDW A;  2H7D A;  3HU8 A;  4EKR A;  4GZU A;  1C66 A;  2DYN A;  1L96 A;  1XJU A;  2D2Q A;  4EJ4 A;  220L A;  5I14 A;  4W53 A;  3GYP A;  1L40 A;  1T8A A;  2J0K A;  1QQG A;  2DHI A;  235L A;  2F2Q A;  2DHJ A;  1LYH A;  3G9W A;  4EPF A;  2X18 A;  1LPY A;  1L08 A;  3FAD A;  3AU4 A;  1KS3 A;  3HUK A;  4I7R A;  1LGW A;  1H10 A;  205L A;  242L A;  2ANV A;  130L A;  3QAK A;  187L A;  1MIX A;  2UZS A;  1PMS A;  4DAJ A;  3SB9 A;  4I7P A;  3VW7 A;  246L A;  2YVC A;  5J3Q A;  1DYE A;  1QSQ A;  1C6I A;  144L A;  1L60 A;  1W1H A;  2Y8G A;  4I7S A;  2QB0 B;  4GMV A;  3IVF A;  2J0M A;  1CUQ A;  3DN1 A;  2LUL A;  4MK0 A;  2I1K A;  3GUJ A;  3HT8 A;  1P6Y A;  2RVB B;  1EF1 A;  2IFS A;  3G3X A;  1L64 A;  1KZ7 A;  5DH9 B;  1CV1 A;  4HAW B;  189L A;  4ZPU A;  1OMW A;  1M7E A;  1C6M A;  1XJT A;  4PK0 A;  4ZRK A;  108L A;  2UZR A;  2EC1 A;  2VRW B;  1I6S A;  3CDQ A;  1QS5 A;  1C6L A;  4HAX B;  2DX5 A;  1C60 A;  4LDO A;  142L A;  3CXB B;  1L46 A;  3SYX A;  1L06 A;  1QC6 A;  2YS3 A;  4W58 A;  1P3R A;  3WYF B;  1OVK A;  1L98 A;  4I7M A;  3ODW A;  3GUL A;  3C8R A;  4K81 A;  2HUL A;  2P0H A;  4I7K A;  5C6R A;  1KY0 A;  2RAY X;  2RLO A;  2Y8F A;  1L26 A;  3P6A A;  1QSB A;  3PBL A;  232L A;  4GPT B;  1C6E A;  176L A;  4I7O A;  3SV1 A;  1ZSQ A;  1KW7 A;  4EKP A;  248L A;  1P36 A;  2GCL A;  3OE9 A;  1C6F A;  2IGC A;  1LYI A;  5J3Y A;  1I2H A;  3ZVR A;  3PDS A;  1L79 A;  3SB6 A;  1U29 A;  2YF0 A;  2AL6 A;  2NZ8 B;  107L A;  1NI2 A;  241L A;  3DNA A;  1LI3 A;  2B6T A;  1LWK A;  5LZM A;  1K5G B;  213L A;  3LZM A;  4K17 A;  2LZM A;  5KCV A;  222L A;  258L A;  1U5D A; 
#chains in the Genus database with same CATH topology
 1HMK A;  1YIL A;  4W55 A;  103L A;  3NYA A;  1UNR A;  1LSA A;  2ROV A;  3EMS A;  252L A;  1L0J A;  4IJ4 A;  3P68 A;  1VDS A;  1HEL A;  4ETC A;  3V5W A;  4YX7 C;  1KZG A;  1LZE A;  230L A;  4WG7 A;  1LYO A;  5LAG A;  2CUU A;  4GN4 A;  2X0A A;  1KIR C;  1GFU A;  1Y19 B;  1LI6 A;  4HDQ A;  1LMP A;  4A6K A;  4YF2 A;  1F6S A;  3AZ6 A;  1QS9 A;  4S0W A;  2V76 A;  1L51 A;  262L A;  1V89 A;  2E2X A;  1EGX A;  1QT4 A;  3W6C A;  4IAS A;  5LOP B;  4GCB A;  2JP2 A;  1XGT C;  4N5R A;  4BS7 A;  3HT9 A;  4XWX A;  1GB2 A;  2B75 A;  4M4O A;  1B6I A;  1JEF A;  1Y5O A;  5GOW B;  4NGK A;  1P5T A;  3FEH A;  240L A;  4OWA A;  4I7Q A;  2ZQ4 A;  1RE2 A;  1G7J C;  2OTX A;  3D8F A;  3A8P A;  1NWG A;  1JUG A;  2W2X C;  1CV0 A;  3RCP A;  1UEF A;  1L12 A;  2D4Q A;  2ZPY A;  1C6G A;  2YS5 A;  1LJH A;  1OUI A;  1L00 A;  5KXZ A;  5C5B B;  1QTZ A;  1UIB A;  3HT6 A;  4NHS A;  5F9X A;  1D3J A;  2OE7 X;  217L A;  4XEN A;  2J0J A;  1GAZ A;  1OVH A;  1REZ A;  1DZB X;  1XFP L;  4PNK A;  3CT5 A;  1XCG A;  2XQO A;  1WQR A;  1L95 A;  237L A;  3W6D A;  1BAK A;  2XBS A;  5F16 A;  4BBK A;  3O96 A;  3T6U A;  1CU5 A;  1GFR A;  1OYU A;  4DQ7 A;  2XQN M;  2GV0 A;  1NTY A;  1P7S A;  4WL7 A;  2CRF A;  3ODO A;  2I26 L;  2DQC Y;  1JKA A;  3LYZ A;  1LSE A;  1NQI A;  5FI0 A;  1MIZ B;  3G3V A;  4MY6 A;  3K2R A;  1GFG A;  3CSQ A;  1V5U A;  3HK0 A;  1X1F A;  1OUH A;  4H92 A;  1IC5 Y;  3W3E A;  1FDL Y;  4NGV A;  1J0W A;  4Y94 A;  1V5P A;  163L A;  4EKU A;  1L80 A;  3QWM A;  1VFB C;  2RBQ A;  4MST A;  1IRS A;  4U3X B;  2D10 A;  1B0D A;  3PSC A;  1DYC A;  2FBD A;  1L14 A;  1SWZ A;  3HTB A;  3ODU A;  1P46 A;  2EMS A;  2DQJ Y;  5HNL A;  5JHG A;  5KXO A;  1IWW A;  1FKQ A;  1GFA A;  1ZYT A;  4YOP A;  162L A;  4NY0 A;  1L47 A;  4NGZ A;  1L53 A;  5L9J A;  2RBS A;  1U5F A;  1K28 A;  1CU0 A;  3DMZ A;  4ET9 A;  4DXA B;  1CU6 A;  3DMV A;  5FEL A;  1MK7 B;  1PZY A;  5C16 A;  1FB8 A;  4Z41 A;  1J1X Y;  4EJN A;  1LB1 A;  1BB7 A;  1LGX A;  141L A;  1D2W A;  1QUS A;  2Z6B A;  5B07 A;  3DCX A;  5KXP A;  1TAY A;  3HH3 A;  1OWY A;  5C79 A;  4Z98 A;  1MPH A;  3AGH A;  2B6W A;  2KUQ A;  1ZVY B;  223L A;  1D0K A;  4LYT A;  1JPO A;  4HDO A;  1FHW A;  2OU8 A;  2YBH A;  4K2O A;  2DQG Y;  5IDD A;  1GF7 A;  1HC0 A;  1JJ3 A;  1QUT A;  215L A;  2Z39 A;  3EBA B;  2Z14 A;  1L18 A;  1WTH A;  1NU2 A;  1V5M A;  4WVF B;  1LYE A;  3SN6 R;  2CWI A;  3P64 A;  1HFY A;  1OUE A;  3D8E A;  1A2Y C;  3AGG G;  3A8Q A;  5F81 A;  2ZQ3 A;  1DDV A;  4WM4 A;  4PRU A;  5LYT A;  2LZT A;  1YKX X;  1NTV A;  1IEE A;  1QTB A;  1GXV 2;  2LYZ A;  4HJV A;  2W2W A;  1N3H A;  3TO1 A;  2B6X A;  1JTT L;  1L04 A;  5I53 A;  1CV3 A;  2NTH A;  206L A;  4B4J A;  1IWY A;  2OE9 X;  1GB8 A;  1G0J A;  126L A;  4LFP A;  3ODX A;  3CT0 A;  5HMV A;  1IY4 A;  1DBH A;  1ZC4 B;  1XEJ A;  4NHI A;  1U2B A;  1L93 A;  3ULB A;  1LI2 A;  4H9A A;  1L83 A;  1CJ8 A;  1C10 A;  1C6H A;  3A93 A;  1LSC A;  2R2Y A;  2BQG A;  2OTZ X;  161L A;  1XOD A;  3LZ2 A;  2P0F A;  1GE1 A;  4KHA A;  3F0W A;  1P56 A;  2F47 A;  3CT1 A;  1LTM A;  1OQN A;  4H1P A;  2OU9 A;  3ZVQ B;  2P8V A;  3RZ4 A;  1GPQ C;  1L10 A;  3NY9 A;  4I7T A;  195L A;  1LJ3 A;  5HMJ A;  3CQL A;  1W08 A;  1HEQ A;  5IRS A;  4ANR A;  1HEM A;  3C82 A;  3W6A A;  3B0O A;  1IOT A;  1B7L A;  4MR1 A;  2K8E A;  2Q9E A;  1L37 A;  1TJ6 A;  1L20 A;  4J1A A;  1CV4 A;  5DLA A;  1IY3 A;  1FN5 A;  5I2M A;  4NEB A;  4NG8 A;  210L A;  1J1P Y;  1OVJ A;  1X86 A;  5D3V A;  4B1A A;  3IWR A;  1XX0 A;  5LON B;  1L62 A;  2Z18 A;  1UNP A;  4L1R A;  5I2S A;  1N4F A;  3TMW A;  3SBB C;  249L A;  5B59 A;  1L91 A;  1L02 A;  1L55 A;  3MPX A;  3B0K A;  5I5Q A;  139L A;  1QT7 A;  160L A;  1L59 A;  1HFX A;  3LHM A;  3C7Y A;  3HBH A;  2DKQ A;  147L A;  1SX2 A;  2DHK A;  2I6Z A;  4HB4 B;  1U5G A;  4D0N B;  1WGQ A;  4GN5 C;  4KHB A;  1GB6 A;  2BQC A;  4WM3 A;  1CVK A;  4WO6 A;  1ZVR A;  2DQA A;  1QIO A;  1EQ4 A;  1REY A;  2LOZ A;  5FDJ A;  4DKL A;  221L A;  4DX9 0;  1OUB A;  3D4S A;  5F14 A;  4HSI A;  3WU8 A;  4II8 A;  5JHH A;  1XR0 B;  1LZ1 A;  3QY4 A;  3TMU A;  5E4P A;  3GUN A;  4HSF A;  3A6B Y;  4HB2 B;  4GRV A;  1U5E A;  2H7D A;  1IR7 A;  2ZIL A;  2BQD A;  4DDB A;  2D2Q A;  1IP5 A;  1JSE A;  5I14 A;  5B1G A;  1T8A A;  1QQG A;  2X18 A;  1L08 A;  1V7S A;  1YIK A;  1H10 A;  4LFX A;  4ETB A;  1VDT A;  3A92 A;  1PMS A;  1C6I A;  144L A;  2FYD A;  4DYG A;  4GMV A;  2J0M A;  4WL6 A;  1GDX A;  4HAW B;  5KXY A;  4ZPU A;  2EPE A;  4ZRK A;  2UZR A;  1D0L A;  2VRW B;  1I6S A;  1IP1 A;  1RJC B;  5JEN B;  3QNG A;  2EIZ C;  1DI4 A;  1FBI X;  5IHG A;  3SYX A;  4W58 A;  1P3R A;  2F4G A;  1OVK A;  4I7M A;  3ODW A;  4K81 A;  2RAY X;  1L26 A;  1WQQ A;  1D6Q A;  1BVX A;  1QSB A;  3GXK A;  1GF6 A;  1LZB A;  232L A;  2BLY A;  4G4H A;  4GPT B;  2XTH A;  1GEZ A;  4FDY A;  1P36 A;  1JIY A;  1JTO L;  2IGC A;  1I2H A;  3PDS A;  4DIX A;  3OJP A;  241L A;  1K5G B;  3HSA A;  213L A;  3AZ5 A;  222L A;  1OUA A;  1LHH A;  5FEK A;  3IVF A;  2K49 A;  1BB3 A;  4H93 A;  4OO9 A;  4DD1 A;  1G1V A;  1C6J A;  1L75 A;  2I1J A;  1JWR A;  1T8G A;  4PPO A;  153L A;  5KQ4 A;  2W1M A;  2LKO A;  1IWV A;  115L A;  5FHW A;  4ML7 A;  4Z2M B;  4AGA A;  140L A;  1WVV A;  4HV2 A;  1C64 A;  4GMX B;  5I4Y A;  1IC4 Y;  1UCO A;  1GB3 A;  1XSF A;  5B06 A;  4HAY B;  234L A;  261L A;  1G7M C;  1C6B A;  1L05 A;  2B74 A;  186L A;  3FA0 A;  1G0M A;  1JTN A;  1YAN A;  2YBJ A;  1WQN A;  3LYT A;  4RLM A;  123L A;  185L A;  4NSG A;  2B5Z A;  1C6D A;  192L A;  4NFV A;  113L A;  1MLC E;  3AYQ A;  1MI1 A;  3SB5 A;  4ARL A;  5D5F A;  2DKV A;  2RBP A;  1NF5 A;  1PQI A;  2ZKM X;  1JIS A;  1HHL A;  1KNI A;  1GB7 A;  5L3H A;  4CSQ A;  1YAO A;  2IFF Y;  4I0C A;  5ILC A;  1ZM0 A;  3FI7 A;  2YS1 A;  1KXY A;  2WAR A;  2COD A;  154L A;  1G07 A;  216L A;  3EXD A;  1C6A A;  2D6B A;  2MDX A;  3EO5 A;  3A95 A;  1B9O A;  131L A;  4DDC A;  1L17 A;  188L A;  4A5K A;  1GFV A;  1GB0 A;  173L A;  1LKR A;  1UC0 A;  2OQB A;  1L52 A;  158L A;  238L A;  4BAP A;  3DN0 A;  118L A;  4N0J A;  148L E;  1L73 A;  3GUI A;  4HV1 A;  2M38 A;  1KIQ C;  1L01 A;  2B72 A;  4ZIX A;  1FLW A;  1L0K A;  2CJL A;  251L A;  1DYG A;  2Z2F A;  3DN8 A;  2ZYP A;  1B5V A;  1GC7 A;  2VSZ A;  1GFH A;  1SSW A;  4H9B A;  3LYM A;  3FSS A;  4TWS A;  2EQL A;  1AT6 A;  3CIK A;  1MEL L;  1XD4 A;  5APD A;  1DKK A;  4IOY X;  5FST A;  1LMQ A;  3ZEK A;  1FKV A;  2W1X A;  133L A;  1NBZ C;  1B7Q A;  3KRW A;  1GF9 A;  3C81 A;  1F0W A;  3PVL A;  1FHO A;  3SB8 A;  2KIE A;  1L77 A;  1QT3 A;  3FI5 A;  2GJY A;  3RZE A;  1LYY A;  2DTC A;  239L A;  3P7Z A;  3TXE A;  1M7R A;  4X3B A;  1REM A;  1WTM A;  1WG7 A;  2HTH B;  1BWJ A;  2Q0M X;  4WJ7 A;  3F5R A;  5KXL A;  244L A;  3IJU A;  2LCB A;  1O23 A;  5B1F A;  2C8P A;  4PJZ A;  1DYF A;  151L A;  1OV5 A;  3DN3 A;  4ET8 A;  182L A;  1LAA A;  2HEF A;  256L A;  3WPL A;  1L57 A;  260L A;  1G0Q A;  1LMC A;  3CB7 A;  1B7P A;  1DQJ C;  2QKL A;  1JKB A;  1L09 A;  199L A;  1LJ4 A;  5FI1 A;  3KY9 A;  2HTX A;  1REX A;  7LZM A;  231L A;  2P0D A;  2ZWB A;  3J4G A;  4XAD A;  170L A;  2K2J A;  4J7V A;  3ULC A;  224L A;  2DLW A;  2DN6 A;  2HE7 A;  1IP4 A;  4ARJ A;  1Q67 A;  143L A;  3WPJ A;  1IOC A;  1GDW A;  2Z59 A;  1P37 A;  1EQ5 A;  1T3P A;  4CHM A;  1VED A;  3CDV A;  3U12 A;  1D3F A;  4EKQ A;  2PC2 A;  1UBZ A;  5E9R A;  1MAI A;  2A7D A;  198L A;  3HDE A;  1G06 A;  4W96 A;  1CV5 A;  255L A;  227L A;  2MEA A;  2COF A;  1GB9 A;  4NGL A;  1L34 A;  169L A;  2HUB A;  1TEW A;  1HEO A;  1LYG A;  1C62 A;  2AEH A;  4YM8 A;  4I7N A;  2IYB A;  4DT3 A;  3OE6 A;  1DYD A;  2K2U A;  2FJL A;  5LG4 B;  3BKH A;  2COC A;  1TBY A;  5D3W A;  1ZMY L;  4B4E A;  2W2X D;  1JJ0 A;  1F6R A;  1MK9 B;  2MKR A;  1L30 A;  166L A;  2F32 A;  4RLN A;  259L A;  1LHL A;  1LZD A;  7LYZ A;  2DX1 A;  4F7G A;  1I20 A;  1L11 A;  1W6Z A;  4B4I A;  177L A;  4G4B A;  2DYQ A;  1C6N A;  2H7E A;  2NMB A;  180L A;  1XEK A;  2ZNW Y;  149L A;  5I54 A;  3HUQ A;  2D9X A;  1GHL A;  4KVG B;  129L A;  3VIA A;  2GUM A;  3C83 A;  4I7J A;  1HF4 A;  4HAZ B;  200L A;  4H9I A;  3OAN A;  4YEM A;  4IAP A;  4K5Y A;  1XKE A;  211L A;  1CJ6 A;  2FBB A;  1CUP A;  2D91 A;  4XJH A;  2LYM A;  1TQZ A;  1L70 A;  2EMT A;  2YBL A;  3ATO A;  1X1G A;  2MEG A;  5APE A;  1DI5 A;  3PZD A;  4LZT A;  1LZ5 A;  1LJI A;  3MGW A;  4TX7 A;  4E97 A;  4EPI A;  1LW3 A;  1L35 A;  2BQL A;  3NWD A;  1L97 A;  1NDM C;  120L A;  4DD9 A;  1B7M A;  3LYO A;  2RGN B;  2D4K A;  1L21 A;  4KPM A;  1IWX A;  8LYZ A;  2B73 A;  4G49 A;  4GBR B;  1GWD A;  1LSP A;  4NGO A;  4NWH A;  1GF0 A;  4Z46 A;  1XEP A;  4W52 A;  5LYM A;  119L A;  1MKE A;  4KHO A;  3DXD A;  5KXR A;  5JLJ B;  3TCA A;  1GXX A;  4R6C A;  4HPE A;  1K5D B;  4G4C A;  4O34 A;  4HHV A;  2W1Y A;  1PLS A;  1QSW A;  2DFK A;  4L6E A;  1GFE A;  1CJ9 A;  1KXX A;  5DM9 A;  5D5C A;  4H94 A;  5DN5 A;  1LMA A;  4CHJ A;  1FGY A;  1UUZ C;  1LSG A;  1LZT A;  1IWZ A;  226L A;  4HJY A;  4HB0 B;  1GF5 A;  4Z2N A;  5DI9 B;  4D6W A;  1OUF A;  3HQC A;  4Z3M A;  2QAR C;  4NGY A;  3DN6 A;  3NWA A;  5APC A;  3T36 A;  1FGZ A;  4LT0 A;  4WG1 A;  3M18 B;  1L48 A;  1HEN A;  2LC9 A;  4DQ5 A;  3G3W A;  3HU8 A;  1CKG A;  1HEP A;  2DYN A;  4J1B A;  1QSA A;  4W53 A;  2G4P A;  1L40 A;  2DHI A;  4L41 A;  5LA8 A;  2F2Q A;  2DHJ A;  1LPY A;  4ETE A;  1IP2 A;  4I7R A;  3ATN A;  2BPU A;  2ANV A;  1LMN A;  3QAK A;  4DAJ A;  3VW7 A;  246L A;  1GE2 A;  4H8X A;  1DYE A;  5J3Q A;  1QSQ A;  1L60 A;  1C7P A;  4I7S A;  4PRQ A;  1CUQ A;  1GFK A;  2VB1 A;  2LUL A;  4MK0 A;  3GUJ A;  1P6Y A;  2IFS A;  3G3X A;  1CV1 A;  1XJT A;  1LZ9 A;  108L A;  3A6C Y;  4HAX B;  1C60 A;  5KXT A;  3CXB B;  3WYF B;  1L06 A;  1T77 A;  2YS3 A;  3P65 A;  3GUL A;  3C8R A;  4J0L A;  5KXW A;  5C6R A;  1DI3 A;  2Y8F A;  1WQO A;  4ETA A;  1LZG A;  3PBL A;  5AMY A;  1C6E A;  176L A;  5KJ9 A;  1VAU A;  4EKP A;  1LSF A;  3RU5 A;  4MCK A;  1LHM A;  1UIG A;  2NZ8 B;  1NI2 A;  135L A;  1LWK A;  1IWU A;  2B6T A;  5KCV A;  258L A;  1F10 A;  2PZ1 A;  4YL8 A;  1B5Z A;  2QKM A;  4WM1 A;  1C08 C;  4W59 A;  2DQI Y;  4DWX A;  3SO6 A;  2CY4 A;  3DXE A;  4HAV B;  5HNC A;  1UIC A;  1V61 A;  4OWH A;  1L31 A;  1L92 A;  1FLU A;  2Z0P A;  4TYZ A;  1LMT A;  1HFZ A;  5C6J A;  4H8Y A;  4IAT A;  1L44 A;  250L A;  2BCJ A;  1L86 A;  2FJU B;  3GYO A;  1CKH A;  2B6Z A;  1PFJ A;  1CKF A;  3A3R X;  3RT5 X;  5APF A;  3BIN A;  4WLY A;  4TUN A;  1OUC A;  2HED A;  4B49 A;  1L27 A;  4H8S A;  2RBR A;  1QTV A;  4GLV A;  257L A;  1CKC A;  1SWY A;  4P7I A;  1AKI A;  3UON A;  4PQ0 A;  1YAP A;  3AW6 A;  4C5F A;  3HTF A;  4NWE A;  2L78 A;  1IP3 A;  152L A;  1P2L A;  4W57 A;  3WA0 A;  1ZC3 B;  1IOS A;  1CU2 A;  3C7W A;  1XGQ C;  2J59 M;  1WGU A;  2BAA A;  5HE0 A;  207L A;  1L94 A;  1YKZ X;  4W54 A;  4KT3 A;  3G3A B;  2K00 A;  2L2I A;  3ZDT A;  3M1I B;  2MEC A;  3G3B B;  4KHB B;  1L89 A;  1P3N A;  3DKE X;  5KXK A;  1FOE A;  3CDO A;  1B55 A;  5A3E A;  3D9A C;  4WLX A;  3UZT A;  3BKV A;  1DKJ A;  1BB6 A;  4WOA A;  1KXW A;  3F6Z A;  3WVY A;  1DPX A;  3WXT A;  3FVC A;  4YXA C;  2LHM A;  1IOR A;  134L A;  2YDG A;  3HTG A;  1L41 A;  4NSJ A;  1GG3 A;  1WVH A;  5DHF B;  2B6Y A;  4OSN A;  214L A;  2RAZ X;  2HEC A;  102L A;  1L66 A;  4QJ5 B;  4EMN A;  1GF4 A;  4YXC A;  145L A;  5D3X A;  201L A;  3L2X A;  2R09 A;  1LMO A;  1H87 A;  1IR9 A;  2COA A;  1T97 A;  2LZ2 A;  1A4V A;  1B7N A;  3V2Y A;  4QGZ A;  3KAM A;  1TCY A;  2D9Y A;  2BQE A;  3DN4 A;  2UVM A;  1LYD A;  127L A;  122L A;  4W56 A;  6LZM A;  2H9J A;  1EL1 A;  1LJJ A;  4XJD A;  5KXM A;  3AJN A;  4AQN A;  1GAY A;  4HJZ A;  4LGK A;  3ZVQ A;  1JTP L;  3HH4 A;  1FAO A;  1FLY A;  1L24 A;  1L19 A;  228L A;  2I25 L;  125L A;  4ZEE A;  2RSG A;  2G35 A;  4ZRI A;  3A8Z A;  1LHI A;  3WUL A;  4NHT A;  5L81 A;  4CFP A;  2HU3 A;  1DYN A;  2DKP A;  4WSF A;  1HEW A;  2RBO A;  4NY5 A;  1RRP B;  1NHB A;  1EPY A;  2EKS C;  3TXB A;  3HIE A;  1L87 A;  1EQE A;  208L A;  1SQ2 L;  1UID A;  1VDQ A;  1W1D A;  1YRO A;  4W51 A;  3DN2 A;  4P2E A;  3K3T A;  2DQF C;  3C80 A;  2Z4D A;  4DD3 A;  2M14 A;  3U7D A;  1L33 A;  1GFT A;  1BTK A;  3AJ4 A;  4NSW A;  3TFM A;  4LDL A;  4YEO A;  1QT5 A;  2Z37 A;  2YT2 A;  1B7S A;  1QTK A;  2Z12 A;  4CGE A;  5LVJ A;  4AXT A;  1LLH A;  5KY1 A;  3LJU X;  1RJ2 A;  4HTQ A;  1ISN A;  137L A;  4NSI A;  1XGU C;  1LHK A;  159L A;  1LYS A;  229L A;  1V88 A;  2ANX A;  1GC6 A;  1GEV A;  2HUM A;  3HFM Y;  5I4X A;  3WL2 A;  114L A;  172L A;  1H6M A;  3IJV A;  1LYZ A;  1L99 A;  2Z0Q A;  1GBS A;  1B2K A;  2IHL A;  1GF8 A;  1IC7 Y;  1WJ1 A;  4CFO A;  1L69 A;  197L A;  1L22 A;  1LSY A;  4G9S A;  1IWT A;  1IP6 A;  2OTY X;  3B6L A;  2LYO A;  2Z13 A;  5T3F A;  2RB1 X;  2DQD Y;  1QTH A;  1QTC A;  1LCN A;  4ETD A;  4QY9 A;  2D9W A;  3DXC A;  2Q13 A;  3NW8 A;  3HU9 A;  2GS0 A;  3TXF A;  1NKH A;  1L65 A;  1VDP A;  3PG7 A;  1C67 A;  1CU3 A;  1GBO A;  4WLT A;  4NSH A;  4GNK B;  3AZ4 A;  4K2P A;  212L A;  1BWH A;  2BQF A;  1H4R A;  2HEB A;  3GUP A;  1IX0 A;  181L A;  1BVK C;  3CDR A;  109L A;  3W6B A;  4W94 A;  3TXJ A;  5KXS A;  1UPR A;  3SNH A;  3BJI A;  245L A;  1L68 A;  1OUJ A;  1QUD A;  3TMX A;  3F8V A;  1C6K A;  5LYZ A;  168L A;  1L85 A;  1C6Q A;  4HAU B;  3TXI A;  2Z19 A;  3RW8 A;  219L A;  2YT0 A;  3AB6 A;  2YT1 A;  1QDT A;  4UWU A;  2RB2 X;  3WMK A;  1RI8 B;  2D4I A;  4PHI A;  4QJ4 B;  2C8O A;  1ZWN A;  5M1Y A;  1QDR A;  1LSD A;  3PEG A;  2Y7B A;  4LDE A;  1AWE A;  2ELA A;  1PQM A;  2R0D A;  1OUD A;  1BB4 A;  2O79 A;  1SGH A;  2AUB A;  2ELB A;  3QIJ A;  1HSW A;  1SHC A;  1D6P A;  3AU5 A;  1TXD A;  183L A;  1JJ1 A;  1P5C A;  2HEA A;  4WMG A;  1L54 A;  1L03 A;  2OEA X;  3D8D A;  3HW2 B;  2DQH Y;  2BQO A;  2D9Z A;  2RNR B;  2XBR A;  1L28 A;  1LSM A;  3B77 A;  5ILF A;  3FM8 C;  5EBH A;  4GCF A;  1U27 A;  1L58 A;  2B7X A;  2D4J A;  3DMX A;  4A6F B;  2Z2E A;  1L15 A;  4ARM B;  3TXG A;  1Z87 A;  175L A;  1UAC Y;  2F30 A;  1C61 A;  1C63 A;  1NHE A;  4FJR A;  2XJW A;  3HH6 A;  1NBY C;  4TSC A;  4EXM A;  1GB5 A;  4HAT B;  1LJF A;  5CLQ B;  1KW5 A;  1DXJ A;  4ARM A;  174L A;  5LXW A;  4H9E A;  3TXD A;  2I5F A;  1I7A A;  5JP4 A;  2CY5 A;  138L A;  1G0G A;  1L90 A;  1LW9 A;  111L A;  3WH1 A;  1L36 A;  3L64 A;  2ZYC A;  3T06 A;  1J19 A;  1T6V L;  4HP0 A;  1GBY A;  4OW1 A;  4IFS A;  1YQV Y;  1D3N A;  3WU9 A;  5J3T A;  4NGJ A;  1L67 A;  5HE3 A;  1BHZ A;  1L32 A;  3QE8 A;  1B7O A;  1G1W A;  1I1Z A;  1L74 A;  1YAQ A;  3A98 B;  1ZVH L;  2N23 A;  3NSU A;  4XN6 A;  2RBN A;  1D0M A;  2RH1 A;  1JQU A;  1CTW A;  3KSY A;  1LYF A;  2LYD A;  3HWL A;  2KR0 A;  2G4Q A;  1BTN A;  3LZT A;  5I4W A;  3KRX A;  4GCE A;  2KUP A;  1ZUR A;  1DDW A;  2Z38 A;  2BQJ A;  4EKR A;  4GZU A;  1L96 A;  1LOZ A;  1IP7 A;  5C6I A;  235L A;  3J6K A;  2YBN A;  4XJB A;  4EPF A;  4KXI A;  3FAD A;  1KS3 A;  1LGW A;  2UZS A;  205L A;  242L A;  3SB9 A;  4I7P A;  1GE4 A;  2YVC A;  5J7C A;  3A34 A;  1W1H A;  2Y8G A;  2QB0 B;  1LJK A;  4PJ2 C;  4RDS A;  2I1K A;  5C6L A;  3HT8 A;  2RVB B;  1GBZ A;  5DH9 B;  1L64 A;  189L A;  3A90 A;  1B5W A;  1YKY X;  3CDQ A;  1QS5 A;  2DX5 A;  4LDO A;  1CKD A;  142L A;  1L46 A;  4WLD A;  1GF3 A;  1L98 A;  4LYC A;  2NWD X;  3WUM A;  1OUG A;  2HUL A;  2P0H A;  2DBT A;  1WQM A;  3W6F A;  3P4Z A;  1IR8 A;  5KKJ A;  1UIA A;  4I7O A;  3HBD A;  3SV1 A;  1G7L C;  3WUN A;  1B7R A;  1KW7 A;  248L A;  5B05 A;  3OE9 A;  1C6F A;  3ZVR A;  1U29 A;  1L79 A;  2AL6 A;  3DNA A;  9LYZ A;  5LZM A;  4K17 A;  1U5D A;  1C43 A;  4LT2 A;  4DQJ A;  1LHJ A;  1RFP A;  191L A;  5L3I A;  2ROZ B;  171L A;  2MFQ A;  3VWO A;  2HEE A;  1C6P A;  165L A;  4RW2 A;  1XGR C;  4N8Z A;  233L A;  2CAY A;  1ZV5 L;  4A7D A;  4OT1 A;  1AT5 A;  1L50 A;  3RNX A;  3P66 A;  1JKD A;  5EFX A;  3OE8 A;  1CNS A;  4LYO A;  4DD7 A;  1DYA A;  194L A;  1GFJ A;  2Q9D A;  167L A;  225L A;  1LZ8 A;  2RUK B;  157L A;  1SLY A;  4QEQ A;  164L A;  2DA0 A;  4GCD A;  2RB0 X;  110L A;  5KQ1 A;  1PQK A;  2A4T A;  1KY1 A;  190L A;  3AZ7 A;  1G7I C;  1HNL A;  5D3Y A;  178L A;  1D3M A;  254L A;  128L A;  2MEI A;  2D9V A;  3HUA A;  4N9R A;  1PQD A;  2NBV A;  5DHA B;  4WM5 A;  1L38 A;  4GCC A;  4EOF A;  3JR6 A;  4ZRJ A;  4GLA A;  1OP9 B;  2BQH A;  3OK0 A;  5DL9 A;  2EJ8 A;  2Z0O A;  3CSZ A;  5KXN A;  1QQY A;  1L43 A;  4F7H A;  4DX8 A;  2H5Z A;  4QJ3 B;  1L13 A;  1L42 A;  4R0F A;  1CV6 A;  1L45 A;  2OE4 X;  6LYT A;  4ARQ A;  3ML4 A;  1UNQ A;  1GE3 A;  2KGX B;  4WM6 A;  4A6H A;  4DD2 A;  4NHP A;  1QUH A;  4DBB A;  4EKS A;  4QDN A;  3VOQ A;  1LSZ A;  4H91 A;  2GCJ A;  4C0A A;  1G7H C;  1UPQ A;  4N1E I;  3C8Q A;  1JTM A;  1L76 A;  1C65 A;  2L1C A;  4M6D A;  1YL0 X;  4GXB A;  2A7F A;  1C46 A;  4NGI A;  2MEE A;  3WVX A;  1GE0 A;  3B72 A;  4LYZ A;  3QBV B;  2NTG A;  1QT6 A;  1P2R A;  3PVU A;  146L A;  1LZ4 A;  3C8S A;  3GUO A;  1IOQ A;  2D11 A;  4CYE A;  4CJ2 A;  1D9W A;  4BAF A;  4HB3 B;  1L81 A;  1LPI A;  4B6H A;  4D9Z A;  1X11 A;  3WW5 A;  1G0L A;  2YSS C;  3N9A A;  3GUM A;  243L A;  4XJI A;  1GBW A;  156L A;  1XGP C;  1L82 A;  1L88 A;  236L A;  2W1L A;  4OWC A;  1D2Y A;  1G0P A;  2HUK A;  218L A;  3E3D A;  1G0K A;  5D27 A;  6LYZ A;  4TKN A;  1IO5 A;  4I8S A;  209L A;  1E5W A;  1JIT A;  4BAD A;  4ARP A;  5A3Z A;  3SUZ A;  112L A;  3TXH A;  5DIF B;  5LIO A;  1KI1 B;  5KXX A;  1LZN A;  1UA6 Y;  4H9F A;  3WXU A;  3A58 A;  1PS5 A;  3OHM B;  4NIJ A;  2VKI A;  4WM2 A;  3U8Z A;  3C7Z A;  1QT8 A;  1IVM A;  1L56 A;  3TXK A;  2N0Y A;  196L A;  1RCM A;  1QUG A;  1LZ6 A;  1L16 A;  1C6T A;  3N9C A;  104L A;  4XYY A;  1AQC A;  253L A;  4NG1 A;  2MEB A;  193L A;  1L71 A;  3SBA A;  1L29 A;  2O7A A;  3NWF A;  1PQO A;  1HER A;  2BQN A;  4WO9 A;  1T8F A;  1EAZ A;  2YVB A;  3HT7 A;  1W1G A;  1KIP C;  2FYC A;  1NDG C;  3TW1 A;  1YL1 X;  1JKC A;  2RSC A;  3ULR A;  2F4A A;  4OOO A;  1VAT A;  1YAM A;  1XEI A;  5LAF A;  3PP2 A;  1BGI A;  1LJN A;  3B0I A;  1V7T A;  1FLQ A;  1LJG A;  4H9C A;  1L49 A;  1I56 A;  1BB5 A;  1BWI A;  1C6C A;  1C69 A;  2LOX A;  4UWN A;  1C45 A;  5HE2 A;  2BQA A;  3CDT A;  5HE1 A;  4OWE A;  4DDA A;  2ZIK A;  4H8Z A;  1ALC A;  1WVU A;  3HDF A;  2MED A;  150L A;  4UWV A;  3A91 A;  4GN1 A;  1PQJ A;  3AW7 A;  2MWN B;  1T6H A;  2YBI A;  4KAX B;  3HBE X;  3WUA A;  4I7L A;  3A67 Y;  1TLA A;  1WI1 A;  3NY8 A;  3TVV A;  4QXA B;  4MT7 A;  3KZ1 A;  1TDY A;  4EMO A;  2KIG A;  5LVK A;  2O4W A;  1AZF A;  3LN2 A;  3WYH A;  3WPK A;  5K7O A;  247L A;  2MEF A;  5KKI A;  1OWZ A;  2ADZ A;  5CLL B;  4YON A;  5LVG A;  2MEH A;  184L A;  1P64 A;  1P2C C;  3FE0 A;  5F9U A;  3TMV A;  1X05 A;  1J1O Y;  4TSB A;  3V2W A;  1WTN A;  5DN4 A;  1CX7 A;  3F9L A;  1L39 A;  1L25 A;  3A96 A;  4DD0 A;  2OU0 X;  1L84 A;  1LZC A;  1WJM A;  1LZY A;  2B70 A;  4DJH A;  1B5X A;  1B5Y A;  5LVI A;  1EVH A;  3M3U A;  1DYB A;  1L61 A;  1QTD A;  2YBM A;  3PVW A;  2BQI A;  1OV7 A;  1SX7 A;  4DC4 A;  4OWB A;  1LKS A;  2YSZ A;  1ZYI A;  4HPI A;  1BQL Y;  2H9K A;  1L63 A;  1LJE A;  1IIZ A;  1LYJ A;  2G4N A;  1BWN A;  2HU1 A;  2YRY A;  1C68 A;  2DQE Y;  2ZIJ A;  1QTE A;  1SSY A;  1P6S A;  1INU A;  1CJ7 A;  3N7C A;  4A6F A;  5M4Y B;  1L07 A;  4LT1 A;  1AM7 A;  4B0D A;  1NMM A;  4GOU A;  1LGU A;  3GXR A;  1QUO A;  2BQM A;  4XJF A;  3AGI A;  1UIE A;  1D9U A;  2KCJ A;  4LYB A;  2BLX A;  4ARQ B;  1DDM A;  3W6E A;  5II3 A;  4YEN A;  5LA5 A;  3HTD A;  1LWG A;  2LG1 A;  2Y8P A;  3RUN A;  5C5B A;  1OY2 A;  1Z55 A;  1L72 A;  2F2N A;  3EML A;  3GUK A;  1LSB A;  1WQP A;  2ZNX Y;  3X23 A;  3A94 A;  155L A;  2BQB A;  1CX6 A;  2N5Z A;  1GBX A;  1FHX A;  4TTD A;  2I5C A;  3MDB C;  1LZA A;  4N1C C;  3OE0 A;  4LZM A;  3SB7 A;  3HH5 A;  1L23 A;  1UIH A;  1DRO A;  1UIF A;  4F7U P;  1C66 A;  1XJU A;  4EJ4 A;  220L A;  2RRF A;  1HML A;  2BQK A;  3GYP A;  4NGW A;  2J0K A;  3A3Q A;  1LYH A;  4HTN A;  3G9W A;  3SP3 A;  3HUK A;  1MIX A;  130L A;  187L A;  4C3W A;  1LZR A;  5LIN A;  5HQ1 A;  5LVH A;  4LYM A;  4PGJ B;  3DN1 A;  1LSN A;  1EF1 A;  1B5U A;  1KZ7 A;  4KL7 A;  1OMW A;  1M7E A;  1C6M A;  3WW6 A;  1JHL A;  4H90 A;  4PK0 A;  1JSF A;  2EC1 A;  1C6L A;  4GN3 A;  5IEL A;  2CGI A;  1QC6 A;  5FCP A;  4H9H A;  4HTK A;  4RW1 A;  1DPW A;  4I7K A;  1KY0 A;  4ZFP A;  2RLO A;  3P6A A;  4XJG A;  4E3U A;  1E8L A;  4OOT A;  1ZSQ A;  132L A;  4NHQ A;  4CHX A;  2GCL A;  2CDS A;  5J3Y A;  1LYI A;  5HLL A;  3N9E A;  3SB6 A;  2YF0 A;  3D3D A;  107L A;  4LT3 A;  1GD6 A;  1LI3 A;  1HSX A;  1OQM A;  3LZM A;  1LZS A;  3WU7 A;  2LZM A;  3CSR A;  3AU4 A; 
#chains in the Genus database with same CATH homology
 1HMK A;  1YIL A;  4W55 A;  103L A;  3NYA A;  1UNR A;  1LSA A;  2ROV A;  3EMS A;  252L A;  1L0J A;  4IJ4 A;  3P68 A;  1VDS A;  1HEL A;  4ETC A;  3V5W A;  4YX7 C;  1KZG A;  1LZE A;  230L A;  4WG7 A;  1LYO A;  5LAG A;  2CUU A;  4GN4 A;  2X0A A;  1KIR C;  1GFU A;  1Y19 B;  1LI6 A;  4HDQ A;  1LMP A;  4A6K A;  4YF2 A;  1F6S A;  3AZ6 A;  1QS9 A;  4S0W A;  2V76 A;  1L51 A;  262L A;  1V89 A;  2E2X A;  1EGX A;  1QT4 A;  3W6C A;  4IAS A;  5LOP B;  4GCB A;  2JP2 A;  1XGT C;  4N5R A;  4BS7 A;  3HT9 A;  4XWX A;  1GB2 A;  2B75 A;  4M4O A;  1B6I A;  1JEF A;  1Y5O A;  5GOW B;  4NGK A;  1P5T A;  3FEH A;  240L A;  4OWA A;  4I7Q A;  2ZQ4 A;  1RE2 A;  1G7J C;  2OTX A;  3D8F A;  3A8P A;  1NWG A;  1JUG A;  2W2X C;  1CV0 A;  3RCP A;  1UEF A;  1L12 A;  2D4Q A;  2ZPY A;  1C6G A;  2YS5 A;  1LJH A;  1OUI A;  1L00 A;  5KXZ A;  5C5B B;  1QTZ A;  1UIB A;  3HT6 A;  4NHS A;  5F9X A;  1D3J A;  2OE7 X;  217L A;  4XEN A;  2J0J A;  1GAZ A;  1OVH A;  1REZ A;  1DZB X;  1XFP L;  4PNK A;  3CT5 A;  1XCG A;  2XQO A;  1WQR A;  1L95 A;  237L A;  3W6D A;  1BAK A;  2XBS A;  5F16 A;  4BBK A;  3O96 A;  3T6U A;  1CU5 A;  1GFR A;  1OYU A;  4DQ7 A;  2XQN M;  2GV0 A;  1NTY A;  1P7S A;  4WL7 A;  2CRF A;  3ODO A;  2I26 L;  2DQC Y;  1JKA A;  3LYZ A;  1LSE A;  1NQI A;  5FI0 A;  1MIZ B;  3G3V A;  4MY6 A;  3K2R A;  1GFG A;  3CSQ A;  1V5U A;  3HK0 A;  1X1F A;  1OUH A;  4H92 A;  1IC5 Y;  3W3E A;  1FDL Y;  4NGV A;  1J0W A;  4Y94 A;  1V5P A;  163L A;  4EKU A;  1L80 A;  3QWM A;  1VFB C;  2RBQ A;  4MST A;  1IRS A;  4U3X B;  2D10 A;  1B0D A;  3PSC A;  1DYC A;  2FBD A;  1L14 A;  1SWZ A;  3HTB A;  3ODU A;  1P46 A;  2EMS A;  2DQJ Y;  5HNL A;  5JHG A;  5KXO A;  1IWW A;  1FKQ A;  1GFA A;  1ZYT A;  4YOP A;  162L A;  4NY0 A;  1L47 A;  4NGZ A;  1L53 A;  5L9J A;  2RBS A;  1U5F A;  1K28 A;  1CU0 A;  3DMZ A;  4ET9 A;  4DXA B;  1CU6 A;  3DMV A;  5FEL A;  1MK7 B;  1PZY A;  5C16 A;  1FB8 A;  4Z41 A;  1J1X Y;  4EJN A;  1LB1 A;  1BB7 A;  1LGX A;  141L A;  1D2W A;  1QUS A;  2Z6B A;  5B07 A;  5KXP A;  1TAY A;  3HH3 A;  1OWY A;  5C79 A;  4Z98 A;  1MPH A;  3AGH A;  2B6W A;  1ZVY B;  223L A;  1D0K A;  4LYT A;  1JPO A;  4HDO A;  1FHW A;  2OU8 A;  2YBH A;  4K2O A;  2DQG Y;  5IDD A;  1GF7 A;  1HC0 A;  1JJ3 A;  1QUT A;  215L A;  2Z39 A;  3EBA B;  1L18 A;  1WTH A;  1NU2 A;  1V5M A;  4WVF B;  1LYE A;  3SN6 R;  2CWI A;  3P64 A;  1HFY A;  1OUE A;  3D8E A;  1A2Y C;  3AGG G;  3A8Q A;  5F81 A;  2ZQ3 A;  1DDV A;  4WM4 A;  4PRU A;  5LYT A;  2LZT A;  1YKX X;  1NTV A;  1IEE A;  1QTB A;  1GXV 2;  2LYZ A;  4HJV A;  2W2W A;  1N3H A;  3TO1 A;  2B6X A;  1JTT L;  1L04 A;  5I53 A;  1CV3 A;  2NTH A;  206L A;  4B4J A;  1IWY A;  2OE9 X;  1GB8 A;  1G0J A;  126L A;  4LFP A;  3ODX A;  3CT0 A;  5HMV A;  1IY4 A;  1DBH A;  1ZC4 B;  1XEJ A;  4NHI A;  1U2B A;  1L93 A;  3ULB A;  1LI2 A;  4H9A A;  1L83 A;  1CJ8 A;  1C10 A;  1C6H A;  3A93 A;  1LSC A;  2BQG A;  2OTZ X;  161L A;  1XOD A;  3LZ2 A;  2P0F A;  1GE1 A;  4KHA A;  3F0W A;  1P56 A;  2F47 A;  3CT1 A;  1LTM A;  1OQN A;  4H1P A;  2OU9 A;  3ZVQ B;  2P8V A;  3RZ4 A;  1GPQ C;  1L10 A;  3NY9 A;  4I7T A;  195L A;  1LJ3 A;  5HMJ A;  3CQL A;  1W08 A;  1HEQ A;  4ANR A;  1HEM A;  3C82 A;  3W6A A;  3B0O A;  1IOT A;  1B7L A;  4MR1 A;  2Q9E A;  1L37 A;  1TJ6 A;  1L20 A;  4J1A A;  1CV4 A;  5DLA A;  1IY3 A;  1FN5 A;  4NEB A;  4NG8 A;  210L A;  1J1P Y;  1OVJ A;  1X86 A;  5D3V A;  4B1A A;  3IWR A;  1XX0 A;  5LON B;  1L62 A;  2Z18 A;  1UNP A;  1N4F A;  3TMW A;  3SBB C;  249L A;  5B59 A;  1L91 A;  1L02 A;  1L55 A;  3MPX A;  3B0K A;  5I5Q A;  139L A;  1QT7 A;  160L A;  1L59 A;  1HFX A;  3LHM A;  3C7Y A;  3HBH A;  2DKQ A;  147L A;  1SX2 A;  2DHK A;  2I6Z A;  4HB4 B;  1U5G A;  4D0N B;  1WGQ A;  4GN5 C;  1GB6 A;  2BQC A;  4WM3 A;  1CVK A;  4WO6 A;  1ZVR A;  2DQA A;  1QIO A;  1EQ4 A;  1REY A;  2LOZ A;  5FDJ A;  4DKL A;  221L A;  4DX9 0;  1OUB A;  3D4S A;  5F14 A;  3WU8 A;  4II8 A;  5JHH A;  1XR0 B;  1LZ1 A;  3QY4 A;  3TMU A;  5E4P A;  3GUN A;  4HSF A;  3A6B Y;  4HB2 B;  4GRV A;  1U5E A;  2H7D A;  1IR7 A;  2ZIL A;  2BQD A;  4DDB A;  2D2Q A;  1IP5 A;  1JSE A;  5I14 A;  5B1G A;  1T8A A;  1QQG A;  2X18 A;  1L08 A;  1V7S A;  1YIK A;  1H10 A;  4LFX A;  4ETB A;  1VDT A;  3A92 A;  1PMS A;  1C6I A;  144L A;  2FYD A;  4DYG A;  4GMV A;  2J0M A;  4WL6 A;  1GDX A;  4HAW B;  5KXY A;  4ZPU A;  2EPE A;  4ZRK A;  2UZR A;  1D0L A;  2VRW B;  1I6S A;  1IP1 A;  1RJC B;  5JEN B;  3QNG A;  2EIZ C;  1DI4 A;  1FBI X;  5IHG A;  3SYX A;  4W58 A;  1P3R A;  2F4G A;  1OVK A;  4I7M A;  3ODW A;  4K81 A;  2RAY X;  1L26 A;  1WQQ A;  1D6Q A;  1BVX A;  1QSB A;  3GXK A;  1GF6 A;  1LZB A;  232L A;  2BLY A;  4G4H A;  4GPT B;  2XTH A;  1GEZ A;  4FDY A;  1P36 A;  1JIY A;  1JTO L;  2IGC A;  1I2H A;  3PDS A;  3OJP A;  241L A;  1K5G B;  213L A;  3AZ5 A;  222L A;  1OUA A;  1LHH A;  5FEK A;  3IVF A;  1BB3 A;  4H93 A;  4OO9 A;  4DD1 A;  1G1V A;  1C6J A;  1L75 A;  2I1J A;  1JWR A;  1T8G A;  4PPO A;  153L A;  5KQ4 A;  2W1M A;  2LKO A;  1IWV A;  115L A;  5FHW A;  4ML7 A;  4Z2M B;  4AGA A;  140L A;  1WVV A;  4HV2 A;  1C64 A;  4GMX B;  5I4Y A;  1IC4 Y;  1UCO A;  1GB3 A;  1XSF A;  5B06 A;  4HAY B;  234L A;  261L A;  1G7M C;  1C6B A;  1L05 A;  2B74 A;  186L A;  3FA0 A;  1G0M A;  1JTN A;  1YAN A;  2YBJ A;  1WQN A;  3LYT A;  4RLM A;  123L A;  185L A;  4NSG A;  2B5Z A;  1C6D A;  192L A;  4NFV A;  113L A;  1MLC E;  3AYQ A;  3SB5 A;  4ARL A;  5D5F A;  2DKV A;  2RBP A;  1NF5 A;  1PQI A;  1JIS A;  1HHL A;  1KNI A;  1GB7 A;  5L3H A;  1YAO A;  2IFF Y;  4I0C A;  5ILC A;  1ZM0 A;  3FI7 A;  2YS1 A;  1KXY A;  2WAR A;  2COD A;  154L A;  1G07 A;  216L A;  3EXD A;  1C6A A;  2D6B A;  2MDX A;  3EO5 A;  3A95 A;  1B9O A;  131L A;  4DDC A;  1L17 A;  188L A;  4A5K A;  1GFV A;  1GB0 A;  173L A;  1LKR A;  1UC0 A;  2OQB A;  1L52 A;  158L A;  238L A;  4BAP A;  3DN0 A;  118L A;  4N0J A;  148L E;  1L73 A;  3GUI A;  4HV1 A;  2M38 A;  1KIQ C;  1L01 A;  2B72 A;  4ZIX A;  1FLW A;  1L0K A;  2CJL A;  251L A;  1DYG A;  2Z2F A;  3DN8 A;  2ZYP A;  1B5V A;  1GC7 A;  2VSZ A;  1GFH A;  1SSW A;  4H9B A;  3LYM A;  3FSS A;  4TWS A;  2EQL A;  1AT6 A;  3CIK A;  1MEL L;  1XD4 A;  5APD A;  1DKK A;  4IOY X;  5FST A;  1LMQ A;  3ZEK A;  1FKV A;  2W1X A;  133L A;  1NBZ C;  1B7Q A;  3KRW A;  1GF9 A;  3C81 A;  1F0W A;  3PVL A;  1FHO A;  3SB8 A;  1L77 A;  1QT3 A;  3FI5 A;  2GJY A;  3RZE A;  1LYY A;  2DTC A;  239L A;  3P7Z A;  3TXE A;  1M7R A;  4X3B A;  1REM A;  1WTM A;  1WG7 A;  2HTH B;  1BWJ A;  2Q0M X;  4WJ7 A;  3F5R A;  5KXL A;  244L A;  3IJU A;  2LCB A;  1O23 A;  5B1F A;  2C8P A;  4PJZ A;  1DYF A;  151L A;  1OV5 A;  3DN3 A;  4ET8 A;  182L A;  1LAA A;  2HEF A;  256L A;  3WPL A;  1L57 A;  260L A;  1G0Q A;  1LMC A;  3CB7 A;  1B7P A;  1DQJ C;  2QKL A;  1JKB A;  1L09 A;  199L A;  1LJ4 A;  5FI1 A;  3KY9 A;  2HTX A;  1REX A;  7LZM A;  231L A;  2P0D A;  2ZWB A;  3J4G A;  4XAD A;  170L A;  2K2J A;  4J7V A;  3ULC A;  224L A;  2DLW A;  2DN6 A;  2HE7 A;  1IP4 A;  4ARJ A;  1Q67 A;  143L A;  3WPJ A;  1IOC A;  1GDW A;  1P37 A;  1EQ5 A;  1T3P A;  4CHM A;  1VED A;  3CDV A;  1D3F A;  4EKQ A;  2PC2 A;  1UBZ A;  5E9R A;  1MAI A;  2A7D A;  198L A;  3HDE A;  1G06 A;  4W96 A;  1CV5 A;  255L A;  227L A;  2MEA A;  2COF A;  1GB9 A;  4NGL A;  1L34 A;  169L A;  2HUB A;  1TEW A;  1HEO A;  1LYG A;  1C62 A;  2AEH A;  4YM8 A;  4I7N A;  2IYB A;  4DT3 A;  3OE6 A;  1DYD A;  2K2U A;  2FJL A;  3BKH A;  2COC A;  1TBY A;  5D3W A;  1ZMY L;  4B4E A;  2W2X D;  1JJ0 A;  1F6R A;  1MK9 B;  2MKR A;  1L30 A;  166L A;  2F32 A;  4RLN A;  259L A;  1LHL A;  1LZD A;  7LYZ A;  2DX1 A;  4F7G A;  1I20 A;  1L11 A;  1W6Z A;  4B4I A;  177L A;  4G4B A;  2DYQ A;  1C6N A;  2H7E A;  2NMB A;  180L A;  1XEK A;  2ZNW Y;  149L A;  5I54 A;  3HUQ A;  2D9X A;  1GHL A;  4KVG B;  129L A;  3VIA A;  3C83 A;  4I7J A;  1HF4 A;  4HAZ B;  200L A;  4H9I A;  3OAN A;  4YEM A;  4IAP A;  4K5Y A;  1XKE A;  211L A;  1CJ6 A;  2FBB A;  1CUP A;  2D91 A;  4XJH A;  2LYM A;  1TQZ A;  1L70 A;  2EMT A;  2YBL A;  3ATO A;  1X1G A;  2MEG A;  5APE A;  1DI5 A;  3PZD A;  4LZT A;  1LZ5 A;  1LJI A;  3MGW A;  4TX7 A;  4E97 A;  4EPI A;  1LW3 A;  1L35 A;  2BQL A;  1L97 A;  1NDM C;  120L A;  4DD9 A;  1B7M A;  3LYO A;  2RGN B;  2D4K A;  1L21 A;  4KPM A;  1IWX A;  8LYZ A;  2B73 A;  4G49 A;  4GBR B;  1GWD A;  1LSP A;  4NGO A;  4NWH A;  1GF0 A;  4Z46 A;  1XEP A;  4W52 A;  5LYM A;  119L A;  1MKE A;  4KHO A;  3DXD A;  5KXR A;  5JLJ B;  3TCA A;  1GXX A;  4R6C A;  4HPE A;  1K5D B;  4G4C A;  4O34 A;  4HHV A;  2W1Y A;  1PLS A;  1QSW A;  2DFK A;  4L6E A;  1GFE A;  1CJ9 A;  1KXX A;  5DM9 A;  5D5C A;  4H94 A;  5DN5 A;  1LMA A;  4CHJ A;  1FGY A;  1UUZ C;  1LSG A;  1LZT A;  1IWZ A;  226L A;  4HJY A;  4HB0 B;  1GF5 A;  4Z2N A;  5DI9 B;  1OUF A;  3HQC A;  4Z3M A;  2QAR C;  4NGY A;  3DN6 A;  5APC A;  3T36 A;  1FGZ A;  4LT0 A;  4WG1 A;  3M18 B;  1L48 A;  1HEN A;  2LC9 A;  4DQ5 A;  3G3W A;  3HU8 A;  1CKG A;  1HEP A;  2DYN A;  4J1B A;  1QSA A;  4W53 A;  2G4P A;  1L40 A;  2DHI A;  4L41 A;  5LA8 A;  2F2Q A;  2DHJ A;  1LPY A;  4ETE A;  1IP2 A;  4I7R A;  3ATN A;  2BPU A;  2ANV A;  1LMN A;  3QAK A;  4DAJ A;  3VW7 A;  246L A;  1GE2 A;  4H8X A;  1DYE A;  5J3Q A;  1QSQ A;  1L60 A;  1C7P A;  4I7S A;  4PRQ A;  1CUQ A;  1GFK A;  2VB1 A;  2LUL A;  4MK0 A;  3GUJ A;  1P6Y A;  2IFS A;  3G3X A;  1CV1 A;  1XJT A;  1LZ9 A;  108L A;  3A6C Y;  4HAX B;  1C60 A;  5KXT A;  3CXB B;  3WYF B;  1L06 A;  2YS3 A;  3P65 A;  3GUL A;  3C8R A;  4J0L A;  5KXW A;  5C6R A;  1DI3 A;  2Y8F A;  1WQO A;  4ETA A;  1LZG A;  3PBL A;  5AMY A;  1C6E A;  176L A;  5KJ9 A;  1VAU A;  4EKP A;  1LSF A;  3RU5 A;  4MCK A;  1LHM A;  1UIG A;  2NZ8 B;  1NI2 A;  135L A;  1LWK A;  1IWU A;  2B6T A;  5KCV A;  258L A;  1F10 A;  2PZ1 A;  4YL8 A;  1B5Z A;  2QKM A;  4WM1 A;  1C08 C;  4W59 A;  2DQI Y;  4DWX A;  3SO6 A;  2CY4 A;  3DXE A;  4HAV B;  5HNC A;  1UIC A;  1V61 A;  4OWH A;  1L31 A;  1L92 A;  1FLU A;  2Z0P A;  4TYZ A;  1LMT A;  1HFZ A;  5C6J A;  4H8Y A;  4IAT A;  1L44 A;  250L A;  2BCJ A;  1L86 A;  3GYO A;  1CKH A;  2B6Z A;  1PFJ A;  1CKF A;  3A3R X;  3RT5 X;  5APF A;  3BIN A;  4WLY A;  4TUN A;  1OUC A;  2HED A;  4B49 A;  1L27 A;  4H8S A;  2RBR A;  1QTV A;  4GLV A;  257L A;  1CKC A;  1SWY A;  4P7I A;  1AKI A;  3UON A;  4PQ0 A;  1YAP A;  3AW6 A;  4C5F A;  3HTF A;  4NWE A;  2L78 A;  1IP3 A;  152L A;  1P2L A;  4W57 A;  3WA0 A;  1ZC3 B;  1IOS A;  1CU2 A;  3C7W A;  1XGQ C;  2J59 M;  1WGU A;  2BAA A;  5HE0 A;  207L A;  1L94 A;  1YKZ X;  4W54 A;  4KT3 A;  3G3A B;  2K00 A;  2L2I A;  3ZDT A;  3M1I B;  2MEC A;  3G3B B;  4KHB B;  1L89 A;  1P3N A;  3DKE X;  5KXK A;  1FOE A;  3CDO A;  1B55 A;  5A3E A;  3D9A C;  4WLX A;  3UZT A;  3BKV A;  1DKJ A;  1BB6 A;  4WOA A;  1KXW A;  3F6Z A;  3WVY A;  1DPX A;  3WXT A;  4YXA C;  2LHM A;  1IOR A;  134L A;  2YDG A;  3HTG A;  1L41 A;  4NSJ A;  1GG3 A;  1WVH A;  5DHF B;  2B6Y A;  214L A;  2RAZ X;  2HEC A;  102L A;  1L66 A;  4EMN A;  1GF4 A;  4YXC A;  145L A;  5D3X A;  201L A;  3L2X A;  2R09 A;  1LMO A;  1H87 A;  1IR9 A;  2COA A;  1T97 A;  2LZ2 A;  1A4V A;  1B7N A;  3V2Y A;  4QGZ A;  3KAM A;  1TCY A;  2D9Y A;  2BQE A;  3DN4 A;  2UVM A;  1LYD A;  127L A;  122L A;  4W56 A;  6LZM A;  2H9J A;  1EL1 A;  1LJJ A;  4XJD A;  5KXM A;  3AJN A;  4AQN A;  1GAY A;  4HJZ A;  4LGK A;  3ZVQ A;  1JTP L;  3HH4 A;  1FAO A;  1FLY A;  1L24 A;  1L19 A;  228L A;  2I25 L;  125L A;  4ZEE A;  2RSG A;  2G35 A;  4ZRI A;  3A8Z A;  1LHI A;  3WUL A;  4NHT A;  5L81 A;  4CFP A;  2HU3 A;  1DYN A;  2DKP A;  4WSF A;  1HEW A;  2RBO A;  4NY5 A;  1RRP B;  1NHB A;  1EPY A;  2EKS C;  3TXB A;  1L87 A;  1EQE A;  208L A;  1SQ2 L;  1UID A;  1VDQ A;  1W1D A;  1YRO A;  4W51 A;  3DN2 A;  4P2E A;  3K3T A;  2DQF C;  3C80 A;  4DD3 A;  2M14 A;  3U7D A;  1L33 A;  1GFT A;  1BTK A;  3AJ4 A;  4NSW A;  3TFM A;  4LDL A;  4YEO A;  1QT5 A;  2Z37 A;  1B7S A;  1QTK A;  2Z12 A;  4CGE A;  5LVJ A;  4AXT A;  1LLH A;  5KY1 A;  3LJU X;  1RJ2 A;  4HTQ A;  1ISN A;  137L A;  4NSI A;  1XGU C;  1LHK A;  159L A;  1LYS A;  229L A;  1V88 A;  2ANX A;  1GC6 A;  1GEV A;  2HUM A;  3HFM Y;  5I4X A;  3WL2 A;  114L A;  172L A;  1H6M A;  3IJV A;  1LYZ A;  1L99 A;  2Z0Q A;  1GBS A;  1B2K A;  2IHL A;  1GF8 A;  1IC7 Y;  1WJ1 A;  4CFO A;  1L69 A;  197L A;  1L22 A;  1LSY A;  4G9S A;  1IWT A;  1IP6 A;  2OTY X;  3B6L A;  2LYO A;  5T3F A;  2RB1 X;  2DQD Y;  1QTH A;  1QTC A;  1LCN A;  4ETD A;  4QY9 A;  2D9W A;  3DXC A;  2Q13 A;  3HU9 A;  2GS0 A;  3TXF A;  1NKH A;  1L65 A;  1VDP A;  3PG7 A;  1C67 A;  1CU3 A;  1GBO A;  4WLT A;  4NSH A;  3AZ4 A;  4K2P A;  212L A;  1BWH A;  2BQF A;  1H4R A;  2HEB A;  3GUP A;  1IX0 A;  181L A;  1BVK C;  3CDR A;  109L A;  3W6B A;  4W94 A;  3TXJ A;  5KXS A;  1UPR A;  3SNH A;  3BJI A;  245L A;  1L68 A;  1OUJ A;  1QUD A;  3TMX A;  3F8V A;  1C6K A;  5LYZ A;  168L A;  1L85 A;  1C6Q A;  4HAU B;  3TXI A;  2Z19 A;  3RW8 A;  219L A;  2YT0 A;  3AB6 A;  2YT1 A;  1QDT A;  4UWU A;  2RB2 X;  3WMK A;  1RI8 B;  2D4I A;  4PHI A;  2C8O A;  1ZWN A;  5M1Y A;  1QDR A;  1LSD A;  3PEG A;  2Y7B A;  4LDE A;  1AWE A;  2ELA A;  1PQM A;  2R0D A;  1OUD A;  1BB4 A;  2O79 A;  1SGH A;  2AUB A;  2ELB A;  3QIJ A;  1HSW A;  1SHC A;  1D6P A;  3AU5 A;  1TXD A;  183L A;  1JJ1 A;  1P5C A;  2HEA A;  4WMG A;  1L54 A;  1L03 A;  2OEA X;  3D8D A;  3HW2 B;  2DQH Y;  2BQO A;  2D9Z A;  2RNR B;  2XBR A;  1L28 A;  1LSM A;  5ILF A;  3FM8 C;  5EBH A;  4GCF A;  1U27 A;  1L58 A;  2B7X A;  2D4J A;  3DMX A;  4A6F B;  2Z2E A;  1L15 A;  4ARM B;  3TXG A;  1Z87 A;  175L A;  1UAC Y;  2F30 A;  1C61 A;  1C63 A;  1NHE A;  4FJR A;  2XJW A;  3HH6 A;  1NBY C;  4TSC A;  4EXM A;  1GB5 A;  4HAT B;  1LJF A;  5CLQ B;  1KW5 A;  1DXJ A;  4ARM A;  174L A;  5LXW A;  4H9E A;  3TXD A;  2I5F A;  1I7A A;  5JP4 A;  2CY5 A;  138L A;  1G0G A;  1L90 A;  1LW9 A;  111L A;  3WH1 A;  1L36 A;  3L64 A;  2ZYC A;  3T06 A;  1J19 A;  1T6V L;  4HP0 A;  1GBY A;  4OW1 A;  4IFS A;  1YQV Y;  1D3N A;  3WU9 A;  5J3T A;  4NGJ A;  1L67 A;  5HE3 A;  1BHZ A;  1L32 A;  3QE8 A;  1B7O A;  1G1W A;  1I1Z A;  1L74 A;  1YAQ A;  3A98 B;  1ZVH L;  2N23 A;  3NSU A;  4XN6 A;  2RBN A;  1D0M A;  2RH1 A;  1JQU A;  1CTW A;  3KSY A;  1LYF A;  2LYD A;  3HWL A;  2G4Q A;  1BTN A;  3LZT A;  5I4W A;  3KRX A;  4GCE A;  2KUP A;  1ZUR A;  1DDW A;  2Z38 A;  2BQJ A;  4EKR A;  4GZU A;  1L96 A;  1LOZ A;  1IP7 A;  5C6I A;  235L A;  3J6K A;  2YBN A;  4XJB A;  4EPF A;  4KXI A;  3FAD A;  1KS3 A;  1LGW A;  2UZS A;  205L A;  242L A;  3SB9 A;  4I7P A;  1GE4 A;  2YVC A;  5J7C A;  3A34 A;  1W1H A;  2Y8G A;  2QB0 B;  1LJK A;  4PJ2 C;  4RDS A;  2I1K A;  5C6L A;  3HT8 A;  2RVB B;  1GBZ A;  5DH9 B;  1L64 A;  189L A;  3A90 A;  1B5W A;  1YKY X;  3CDQ A;  1QS5 A;  2DX5 A;  4LDO A;  1CKD A;  142L A;  1L46 A;  4WLD A;  1GF3 A;  1L98 A;  4LYC A;  2NWD X;  3WUM A;  1OUG A;  2HUL A;  2P0H A;  2DBT A;  1WQM A;  3W6F A;  3P4Z A;  1IR8 A;  5KKJ A;  1UIA A;  4I7O A;  3HBD A;  3SV1 A;  1G7L C;  3WUN A;  1B7R A;  1KW7 A;  248L A;  5B05 A;  3OE9 A;  1C6F A;  3ZVR A;  1U29 A;  1L79 A;  2AL6 A;  3DNA A;  9LYZ A;  5LZM A;  4K17 A;  1U5D A;  1C43 A;  4LT2 A;  4DQJ A;  1LHJ A;  1RFP A;  191L A;  5L3I A;  2ROZ B;  171L A;  2MFQ A;  3VWO A;  2HEE A;  1C6P A;  165L A;  4RW2 A;  1XGR C;  4N8Z A;  233L A;  2CAY A;  1ZV5 L;  4A7D A;  1AT5 A;  1L50 A;  3RNX A;  3P66 A;  1JKD A;  5EFX A;  3OE8 A;  1CNS A;  4LYO A;  4DD7 A;  1DYA A;  194L A;  1GFJ A;  2Q9D A;  167L A;  225L A;  1LZ8 A;  2RUK B;  157L A;  1SLY A;  4QEQ A;  164L A;  2DA0 A;  4GCD A;  2RB0 X;  110L A;  5KQ1 A;  1PQK A;  2A4T A;  1KY1 A;  190L A;  3AZ7 A;  1G7I C;  1HNL A;  5D3Y A;  178L A;  1D3M A;  254L A;  128L A;  2MEI A;  2D9V A;  3HUA A;  4N9R A;  1PQD A;  5DHA B;  4WM5 A;  1L38 A;  4GCC A;  4EOF A;  3JR6 A;  4ZRJ A;  4GLA A;  1OP9 B;  2BQH A;  3OK0 A;  5DL9 A;  2EJ8 A;  2Z0O A;  3CSZ A;  5KXN A;  1QQY A;  1L43 A;  4F7H A;  4DX8 A;  2H5Z A;  1L13 A;  1L42 A;  4R0F A;  1CV6 A;  1L45 A;  2OE4 X;  6LYT A;  4ARQ A;  3ML4 A;  1UNQ A;  1GE3 A;  2KGX B;  4WM6 A;  4A6H A;  4DD2 A;  4NHP A;  1QUH A;  4DBB A;  4EKS A;  4QDN A;  3VOQ A;  1LSZ A;  4H91 A;  2GCJ A;  4C0A A;  1G7H C;  1UPQ A;  4N1E I;  3C8Q A;  1JTM A;  1L76 A;  1C65 A;  2L1C A;  4M6D A;  1YL0 X;  4GXB A;  2A7F A;  1C46 A;  4NGI A;  2MEE A;  3WVX A;  1GE0 A;  3B72 A;  4LYZ A;  3QBV B;  2NTG A;  1QT6 A;  1P2R A;  3PVU A;  146L A;  1LZ4 A;  3C8S A;  3GUO A;  1IOQ A;  2D11 A;  4CYE A;  4CJ2 A;  1D9W A;  4BAF A;  4HB3 B;  1L81 A;  1LPI A;  4B6H A;  4D9Z A;  1X11 A;  3WW5 A;  1G0L A;  2YSS C;  3N9A A;  3GUM A;  243L A;  4XJI A;  1GBW A;  156L A;  1XGP C;  1L82 A;  1L88 A;  236L A;  2W1L A;  4OWC A;  1D2Y A;  1G0P A;  2HUK A;  218L A;  3E3D A;  1G0K A;  5D27 A;  6LYZ A;  4TKN A;  1IO5 A;  4I8S A;  209L A;  1E5W A;  1JIT A;  4BAD A;  4ARP A;  5A3Z A;  3SUZ A;  112L A;  3TXH A;  5DIF B;  5LIO A;  1KI1 B;  5KXX A;  1LZN A;  1UA6 Y;  4H9F A;  3WXU A;  1PS5 A;  4NIJ A;  2VKI A;  4WM2 A;  3U8Z A;  3C7Z A;  1QT8 A;  1IVM A;  1L56 A;  3TXK A;  2N0Y A;  196L A;  1RCM A;  1QUG A;  1LZ6 A;  1L16 A;  1C6T A;  3N9C A;  104L A;  4XYY A;  1AQC A;  253L A;  4NG1 A;  2MEB A;  193L A;  1L71 A;  3SBA A;  1L29 A;  2O7A A;  1PQO A;  1HER A;  2BQN A;  4WO9 A;  1T8F A;  1EAZ A;  2YVB A;  3HT7 A;  1W1G A;  1KIP C;  2FYC A;  1NDG C;  3TW1 A;  1YL1 X;  1JKC A;  2RSC A;  3ULR A;  2F4A A;  4OOO A;  1VAT A;  1YAM A;  1XEI A;  5LAF A;  3PP2 A;  1BGI A;  1LJN A;  3B0I A;  1V7T A;  1FLQ A;  1LJG A;  4H9C A;  1L49 A;  1I56 A;  1BB5 A;  1BWI A;  1C6C A;  1C69 A;  2LOX A;  4UWN A;  1C45 A;  5HE2 A;  2BQA A;  3CDT A;  5HE1 A;  4OWE A;  4DDA A;  2ZIK A;  4H8Z A;  1ALC A;  1WVU A;  3HDF A;  2MED A;  150L A;  4UWV A;  3A91 A;  4GN1 A;  1PQJ A;  3AW7 A;  2MWN B;  1T6H A;  2YBI A;  4KAX B;  3HBE X;  3WUA A;  4I7L A;  3A67 Y;  1TLA A;  1WI1 A;  3NY8 A;  3TVV A;  4MT7 A;  3KZ1 A;  1TDY A;  4EMO A;  5LVK A;  2O4W A;  1AZF A;  3LN2 A;  3WYH A;  3WPK A;  5K7O A;  247L A;  2MEF A;  5KKI A;  1OWZ A;  2ADZ A;  5CLL B;  4YON A;  5LVG A;  2MEH A;  184L A;  1P64 A;  1P2C C;  3FE0 A;  5F9U A;  3TMV A;  1X05 A;  1J1O Y;  4TSB A;  3V2W A;  1WTN A;  5DN4 A;  1CX7 A;  3F9L A;  1L39 A;  1L25 A;  3A96 A;  4DD0 A;  2OU0 X;  1L84 A;  1LZC A;  1WJM A;  1LZY A;  2B70 A;  4DJH A;  1B5X A;  1B5Y A;  5LVI A;  1EVH A;  3M3U A;  1DYB A;  1L61 A;  1QTD A;  2YBM A;  3PVW A;  2BQI A;  1OV7 A;  1SX7 A;  4DC4 A;  4OWB A;  1LKS A;  2YSZ A;  4HPI A;  1BQL Y;  2H9K A;  1L63 A;  1LJE A;  1IIZ A;  1LYJ A;  2G4N A;  1BWN A;  2HU1 A;  2YRY A;  1C68 A;  2DQE Y;  2ZIJ A;  1QTE A;  1SSY A;  1P6S A;  1INU A;  1CJ7 A;  3N7C A;  4A6F A;  1L07 A;  4LT1 A;  1AM7 A;  4B0D A;  1NMM A;  1LGU A;  3GXR A;  1QUO A;  2BQM A;  4XJF A;  3AGI A;  1UIE A;  1D9U A;  2KCJ A;  4LYB A;  2BLX A;  4ARQ B;  1DDM A;  3W6E A;  5II3 A;  4YEN A;  5LA5 A;  3HTD A;  1LWG A;  2LG1 A;  2Y8P A;  3RUN A;  5C5B A;  1OY2 A;  1Z55 A;  1L72 A;  2F2N A;  3EML A;  3GUK A;  1LSB A;  1WQP A;  2ZNX Y;  3X23 A;  3A94 A;  155L A;  2BQB A;  1CX6 A;  2N5Z A;  1GBX A;  1FHX A;  4TTD A;  2I5C A;  3MDB C;  1LZA A;  4N1C C;  3OE0 A;  4LZM A;  3SB7 A;  3HH5 A;  1L23 A;  1UIH A;  1DRO A;  1UIF A;  4F7U P;  1C66 A;  1XJU A;  4EJ4 A;  220L A;  1HML A;  2BQK A;  3GYP A;  4NGW A;  2J0K A;  3A3Q A;  1LYH A;  4HTN A;  3G9W A;  3SP3 A;  3HUK A;  1MIX A;  130L A;  187L A;  4C3W A;  1LZR A;  5LIN A;  5HQ1 A;  5LVH A;  4LYM A;  4PGJ B;  3DN1 A;  1LSN A;  1EF1 A;  1B5U A;  1KZ7 A;  4KL7 A;  1OMW A;  1M7E A;  1C6M A;  3WW6 A;  1JHL A;  4H90 A;  4PK0 A;  1JSF A;  2EC1 A;  1C6L A;  4GN3 A;  5IEL A;  2CGI A;  1QC6 A;  5FCP A;  4H9H A;  4HTK A;  4RW1 A;  1DPW A;  4I7K A;  1KY0 A;  4ZFP A;  2RLO A;  3P6A A;  4XJG A;  4E3U A;  1E8L A;  4OOT A;  1ZSQ A;  132L A;  4NHQ A;  4CHX A;  2GCL A;  2CDS A;  5J3Y A;  1LYI A;  5HLL A;  3N9E A;  3SB6 A;  2YF0 A;  3D3D A;  107L A;  4LT3 A;  1GD6 A;  1LI3 A;  1HSX A;  1OQM A;  3LZM A;  1LZS A;  3WU7 A;  2LZM A;  3CSR A;  3AU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...