4IAPA

Crystal structure of ph domain of osh3 from saccharomyces cerevisiae
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
256
structure length
256
Chain Sequence
GRYLQGYLLKKRRVDNIFEMLRIDEGLRLKIYKNTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYVDQGFKKRFFTLDFRYGTLSYYLNDHNQTCRGEIVISLSSVSANKKDKIIIIDSGMEVWVLKATTKENWQSWVDALQTCFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oxysterol-binding protein homolog 3,Endolysin,Oxysterol-bind
publication title Structure of osh3 reveals a conserved mode of phosphoinositide binding in oxysterol-binding proteins
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Lipid binding protein/ hydrorase
total genus 76
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2012-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00959 Phage_lysozyme Phage lysozyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.530.40 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 4iapA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4iapA01
1KY1A 1L75A 1BTKA 1C64A 1K5GB 1C6QA 4EKRA 1C69A 3D8FA 1L74A 1L25A 1LYDA 107LA 1I7AA 1CVKA 2LZMA 195LA 238LA 2RAZX 4LDOA 4YXAC 3U8ZA 2I1KA 2RGNB 1L60A 1L63A 1SGHA 1KNIA 2RBRA 2YVCA 4HDQA 1EF1A 2MKRA 1C6IA 2K00A 4YL8A 4CYEA 2D9ZA 4ARQB 2D9VA 1C6BA 2Z6BA 1PFJA 2RBQA 3DN2A 247LA 2OTZX 4I7QA 1XX0A 2YS1A 2HE7A 1C63A 1NTYA 2Z0PA 3HUKA 1DYNA 123LA 143LA 1CU6A 2RB2X 3OE6A 2LKOA 4W52A 1G0PA 4EKSA 3KRXA 2OU9A 1QSQA 3GUMA 1KS3A 3G3VA 139LA 205LA 178LA 1L15A 4Z2NA 3FA0A 1T8FA 1G1VA 1W1GA 2YRYA 3MPXA 4EMOA 5J3QA 1I6SA 1C6JA 230LA 1SWZA 4I7SA 3HH4A 3SBBC 1TXDA 2CRFA 2L2IA 3F0WA 1J0WA 1CV1A 4D0NB 2B73A 1PQKA 2RBOA 2O4WA 2OTYX 3C8RA 1G06A 4L6EA 1L69A 1L53A 1WG7A 224LA 1P6SA 1L14A 4ARPA 2Q9EA 4MT7A 5HE3A 157LA 137LA 188LA 4ZRIA 1L92A 201LA 3VOQA 2B7XA 2RBPA 2D9XA 2AEHA 5FI0A 3ULBA 240LA 2KUPA 4IAPA 2OEAX 1C6TA 2Q9DA 2D10A 3HUQA 2RSGA 160LA 2DYQA 1L93A 2DYNA 2RLOA 3GYPA 1FGZA 3DN4A 3AU4A 1ZYTA 1QS5A 126LA 1LLHA 2B6ZA 1C6AA 2L78A 1BTNA 1P3RA 2LOXA 3SB6A 1L88A 1TQZA 4EKPA 1L57A 2UZSA 2YS3A 5KCVA 4DX90 2Z0OA 4F7HA 4F7UP 2DTCA 1SHCA 2LYDA 1LGXA 1PQMA 3HT6A 3DN8A 1MIZB 2O79A 2GJYA 108LA 4CHMA 4YX7C 2NTHA 4EKUA 223LA 5J3YA 4DBBA 4F7GA 1QTDA 1L37A 3NYAA 215LA 1D9WA 3DXCA 1WI1A 1MIXA 2I1JA 2X18A 1L34A 1L19A 1OV5A 1D3JA 1L02A 3C83A 4HAYB 197LA 174LA 4W53A 2IFSA 3F8VA 5C5BB 1KY0A 1OV7A 1Q67A 2EJ8A 1P2LA 4I7KA 1NU2A 3UONA 2CY5A 2QB0B 1L80A 245LA 217LA 3HDFA 3L64A 3C7ZA 2W2XC 5KQ4A 1L31A 3LZMA 4W57A 6LZMA 3QIJA 1C68A 5DHAB 2K2JA 2YF0A 1DYGA 4HB3B 228LA 3DMVA 3TFMA 4DJHA 3C7WA 196LA 1LYIA 3HWLA 1EAZA 158LA 1JTMA 1L06A 1L99A 1WGQA 3A98B 1L09A 4I7OA 113LA 1RJ2A 165LA 1P5TA 187LA 3AU5A 4NSWA 1L41A 1OQNA 2J59M 1MK7B 2OU8A 1X1FA 2P0DA 3WYFB 1KW7A 199LA 1UNRA 3PVWA 2P0HA 156LA 180LA 1PMSA 4HAZB 2GS0A 140LA 227LA 3FSSA 4A6FA 4B6HA 3DXDA 5HE0A 231LA 2ROVA 5LZMA 2AL6A 1LYEA 1L23A 1C6GA 2RB1X 2COCA 3P6AA 3OE8A 1C65A 213LA 1L58A 4P7IA 122LA 1L50A 3SN6R 4PQ0A 1L05A 2D4QA 1E5WA 1DDMA 3TCAA 1L32A 103LA 5DIFB 1L62A 2VSZA 2E2XA 112LA 4GRVA 5FI1A 234LA 4I7MA 4HHVA 3SV1A 2ELBA 173LA 1H10A 1L56A 219LA 1WGUA 4GZUA 3TO1A 1L90A 1T6HA 251LA 2HUKA 168LA 2B6TA 1P56A 3T06A 155LA 1X1GA 1L71A 1EVHA 1W1HA 1KI1B 1P3NA 3DN6A 2J0MA 3HW2B 1LWKA 4HATB 1QTBA 1V5PA 4IOYX 5LONB 3SB9A 4K17A 2LG1A 3WA0A 3MDBC 3GUJA 3SB7A 1ZWNA 1LI2A 4ARMA 1L44A 2UZRA 2DX5A 1L79A 2LULA 1QSBA 1UNQA 2MWNB 163LA 4GN1A 1P7SA 3QAKA 1L36A 2ADZA 2KCJA 4ARLA 4I7JA 1L17A 2RH1A 167LA 1K5DB 3KZ1A 1L21A 1UPRA 5D27A 2F47A 1QC6A 3D4SA 170LA 236LA 2RAYX 2Z0QA 5HE1A 1QTZA 3FEHA 1C6NA 1NHBA 4KHOA 1CX6A 3L2XA 4NY0A 2J0JA 147LA 2Y8GA 109LA 1L03A 2DN6A 5DI9B 1U5EA 2RBNA 225LA 4EPIA 3JR6A 177LA 3HQCA 1PQJA 1U2BA 1X86A 4K81A 1MK9B 4I7NA 5CLQB 1G0GA 183LA 1L30A 3DKEX 1QTVA 1T8AA 1CUPA 3NY9A 2EMSA 1P64A 1PQOA 2QARC 5C16A 3VIAA 2ZPYA 3VW7A 1KZGA 3C81A 1L45A 5C79A 1ZSQA 3CXBB 3PP2A 128LA 258LA 4W54A 120LA 1V5MA 1X05A 159LA 2LCBA 1L72A 3HT9A 1C67A 3HTDA 5I14A 2DHIA 1LI3A 1GC6A 1L04A 1L55A 2IGCA 4WJ7A 1QUDA 4C0AA 2A4TA 1OY2A 2CUUA 2N23A 5JLJB 4TKNA 2D2QA 2B6YA 1XCGA 1D3FA 2RNRB 146LA 4K2PA 1MAIA 1SSYA 3FI5A 1CV0A 110LA 3N7CA 2HUMA 1XKEA 1B6IA 2HULA 1SX2A 1XODA 239LA 1P46A 3C82A 4E97A 2GCJA 4WVFB 4DXAB 114LA 3SUZA 1V88A 2OE7X 2CODA 1CX7A 2JP2A 4A6HA 1L68A 3ODWA 2VRWB 2COFA 4BBKA 253LA 4DKLA 3K2RA 3CDRA 1U29A 1G0QA 1DYDA 1FGYA 2CAYA 4W58A 3SB8A 2MDXA 2OE4X 1SWYA 3HUAA 1L61A 3SO6A 2OU0X 3M1IB 1L67A 246LA 1CUQA 2L1CA 138LA 4W51A 1LI6A 3AJ4A 166LA 1ZC3B 3F5RA 4K2OA 5D3WA 1L46A 2ANVA 1U5GA 125LA 2YT0A 4KHAA 1OWZA 1DYCA 1L28A 1QTCA 4HB2B 1L51A 1L0KA 1QS9A 2I5FA 3PZDA 2RUKB 2K2UA 3UZTA 1L97A 4DAJA 241LA 1Y5OA 2D9YA 3O96A 3V2YA 1LB1A 4EJ4A 1LYHA 1C6HA 1L76A 1QT3A 4KAXB 3V5WA 4W55A 220LA 129LA 4A6FB 1QQGA 1D2YA 1DYFA 1BWNA 1L86A 1LGWA 1LYFA 1C60A 2EMTA 1G0JA 4ZRJA 3OE0A 1C62A 1L38A 3FM8C 2CY4A 2EC1A 2YSZA 1FB8A 1QT7A 1UNPA 1XJTA 2B74A 1DROA 182LA 2N0YA 3C7YA 4KVGB 1D2WA 1L91A 2DKPA 1QT6A 3RZEA 1V89A 2H7DA 169LA 1CV4A 2VKIA 1DBHA 1GG3A 1KZ7A 1NI2A 260LA 2ROZB 1L42A 3A8PA 1LPYA 144LA 3C8SA 2DKQA 7LZMA 1L07A 3IVFA 1RRPB 3QWMA 5HE2A 5KQ1A 1ISNA 1WJMA 2Y8FA 4LDEA 3TVVA 3DN1A 2UVMA 210LA 1AQCA 1CU2A 1D3MA 181LA 3DNAA 3C80A 3EMLA 4ARMB 1L26A 255LA 152LA 1FHWA 1LGUA 1QT5A 4W56A 3OE9A 1EGXA 4HDOA 4EJNA 1L39A 176LA 222LA 1FOEA 1T97A 3HH5A 1L84A 2BCJA 1L65A 3CDTA 1OMWA 206LA 4HAVB 2D11A 4Z2MB 3GYOA 3KSYA 1L24A 4HAXB 3DMZA 2W2WA 1L83A 145LA 4ARJA 3PVLA 1OVHA 4OO9A 1C6KA 2HTHB 3CDQA 3HU9A 4GXBA 130LA 1L52A 4W59A 1P2RA 3SYXA 1L12A 1L33A 2LOZA 2YS5A 190LA 1C6FA 1LYJA 1W1DA 1OVJA 1QTHA 3G9WA 5EFXA 4EPFA 1U5DA 250LA 4AQNA 1U5FA 5LOPB 1ZURA 4PJZA 3CDOA 4MY6A 1TLAA 5CLLB 1C6MA 162LA 1L40A 151LA 1L47A 1L94A 3C8QA 218LA 2IYBA 3X23A 1L49A 4HB4B 1ZVRA 1FHOA 1QT8A 3KRWA 2QKMA 2M14A 4IFSA 3SBAA 142LA 216LA 2RVBB 1ZM0A 3A8QA 4EKQA 3G3WA 2F2QA 149LA 3GUPA 257LA 2DA0A 192LA 5DHFB 1CU5A 1L85A 3ODUA 1B55A 1CTWA 2LC9A 1EPYA 1DYAA 1UPQA 1C66A 2F32A 3SB5A 150LA 3G3XA 2B72A 226LA 1L77A 1L48A 1GC7A 2OE9X 5C6RA 2M38A 3BINA 4DX8A 5JP4A 148LE 3HT8A 5D3YA 185LA 1L08A 1QUOA 248LA 4XWXA 1XR0B 1L59A 1C6PA 1OYUA 2W2XD 4GBRB 5L81A 1G0MA 2B75A 1XEPA 119LA 1G0LA 2ANXA 4LDLA 4HAWB 3GUNA 102LA 1PQIA 1L22A 1D3NA 1L66A 3HH6A 111LA 3CDVA 261LA 3ML4A 3NSUA 4A5KA 2QKLA 2R0DA 4I7PA 1G1WA 1L64A 4ARQA 2P8VA 1H4RA 1P6YA 2V76A 1C6DA 2DHJA 2NZ8B 3D8EA 2GCLA 1UEFA 1K28A 1AWEA 1L98A 3LJUX 3SNHA 1LYGA 1CU0A 2DFKA 2FJLA 2Y7BA 3RCPA 4CHJA 249LA 3HTGA 1QT4A 191LA 3TW1A 189LA 3DMXA 1P36A 4TYZA 127LA 115LA 172LA 1L70A 254LA 1WJ1A 1MKEA 4ZPUA 3ODOA 1U27A 1LW3A 161LA 4A6KA 3HT7A 1FAOA 3GULA 4GMVA 4PNKA 1L11A 2H7EA 1PQDA 1JQUA 5DH9B 252LA 1L95A 214LA 4PK0A 2YT1A 1T8GA 3PEGA 3HDEA 2COAA 1FHXA 3ZDTA 1L20A 1P5CA 3GUKA 1DDWA 1Y19B 1BAKA 2MFQA 175LA 243LA 1C6LA 1ZC4B 233LA 184LA 141LA 2PZ1A 1SX7A 1IRSA 1L43A 5JHHA 3HK0A 262LA 2R09A 164LA 2O7AA 1L96A 1XD4A 1N3HA 3HH3A 1C6EA 1Z87A 1L27A 1KW5A 2P0FA 3F9LA 1DYEA 1CV5A 1L01A 1C61A 3HU8A 4I7TA 2ELAA 1L0JA 4WSFA 5D3XA 3QBVB 1L87A 3BJIA 1LWGA 1L18A 1OVKA 2B70A 235LA 2Q13A 131LA 4YXCA 3D8DA 259LA 3NY8A 3PDSA 4MK0A 1LW9A 2RBSA 3OANA 1L13A 1P37A 1QUHA 3V2WA 237LA 5GOWB 4YONA 256LA 4HAUB 4HB0B 1CV6A 3RUNA 4I7RA 2RB0X 4GMXB 4EXMA 200LA 1DYBA 2B6XA 2OQBA 4K5YA 212LA 3CIKA 1WVHA 242LA 3GUOA 1OWYA 244LA 3DXEA 1V61A 1NTVA 1V5UA 186LA 2NTGA 4I7LA 1QUGA 221LA 2I5CA 3P7ZA 4H8SA 4KHBB 118LA 2NMBA 5C5BA 171LA 1X11A 1M7EA 2J0KA 1L00A 1L73A 1L54A 1SSWA 4LZMA 3DN0A 2G35A 3ZVRA 1WTHA 1TJ6A 2DX1A 229LA 3PBLA 1L81A 4Y94A 3ULCA 1DDVA 232LA 1L82A 3PSCA 1XJUA 1G0KA 4S0WA 1PLSA 1L10A 3GUIA 1CV3A 2D9WA 1L16A 4GPTB 1C6CA 1I2HA 4ZRKA 3U7DA 209LA 1J19A 211LA 3DN3A 2KGXB 198LA 1M7RA 3KY9A 2DLWA 3HTFA 1JTNA 2B6WA 1G07A 1CU3A 3PG7A 3FADA 1L29A 1L35A 5J3TA 104LA 3HTBA 2OTXA 3ODXA 1L89A 5D3VA 1MPHA 3PVUA 2DHKA 5JHGA 2XQNM
chains in the Genus database with same CATH superfamily
153LA 1C6QA 4EKRA 1C69A 3U12A 107LA 1CVKA 4TUNA 4WO9A 1GPQC 1FLYA 2I1KA 1L63A 4RW2A 1QTKA 5ILCA 1UACY 2D9ZA 1C6BA 1PFJA 2RBQA 2Z13A 247LA 1GEZA 4I7QA 1CKFA 2B5ZA 4QGZA 4IASA 1DYNA 1GF0A 3OE6A 4W52A 1G0PA 3N9EA 4YENA 4LYZA 1QSQA 1LMTA 1JPOA 3TXKA 205LA 1T8FA 1LJHA 1I6SA 4I7SA 2L2IA 2BQBA 1TXDA 3OJPA 3WUAA 3HBDA 2BQIA 1GFUA 4GN5C 2RBOA 2O4WA 3KAMA 5B59A 3M3UA 4L6EA 1L69A 1L53A 2BLYA 2D4IA 1LOZA 1LSFA 4ARPA 5HE3A 188LA 4WOAA 2B7XA 2AEHA 4WM5A 1DI5A 1LHIA 1YKZX 4IAPA 1C6TA 2Q9DA 3HFMY 3HUQA 4CSQA 5IELA 1RI8B 3GYPA 1FGZA 1GAYA 4QEQA 2MEGA 1QS5A 2L78A 2XQNM 2UZSA 4BS7A 2KIEA 1GFEA 4W96A 4CHMA 1MIZB 2ZIKA 2NTHA 1LZ6A 4EKUA 5J3YA 4B1AA 1BGIA 2ZYPA 2I25L 4NGIA 3A3QA 3DXCA 2CWIA 1WI1A 2DQEY 2X18A 1LCNA 1D3JA 1LMOA 3F8VA 5KXPA 1KY0A 1OV7A 3TXEA 5FCPA 4I7KA 1IOSA 1A4VA 2QB0B 245LA 4WL7A 217LA 3L64A 3C7ZA 2XJWA 5KQ4A 3QIJA 1C68A 2K2JA 1FLUA 1IWVA 3DMVA 3C7WA 4N8ZA 1F0WA 1L06A 1L99A 4WG1A 3A6BY 5AMYA 1GF3A 1HSWA 2P0DA 1B7MA 1HFYA 1GWDA 2P0HA 3RU5A 3CSQA 140LA 3J4GA 4B6HA 1FN5A 5LZMA 1FBIX 4BAFA 4CGEA 1JUGA 1WVVA 154LA 1QDTA 1L58A 1DDMA 1L50A 2FYDA 5DIFB 2E2XA 1OUIA 4I7MA 4DD2A 173LA 219LA 5HLLA 4HATB 1EVHA 3DN6A 1ZVYB 4ARMA 1MI1A 1H6MA 208LA 1UIFA 5LVKA 1B9OA 4LYBA 2MWNB 4WO6A 1P7SA 1L36A 1XEIA 2KCJA 3AZ5A 1L17A 1LHHA 4MSTA 170LA 1GDWA 236LA 2Z0QA 2LYOA 1A2YC 1QTZA 1NHBA 3B0KA 147LA 1REXA 3W6AA 2DN6A 3HQCA 1X86A 1W6ZA 1MK9B 1J1OY 1BHZA 1CUPA 1NKHA 1QSWA 2EMSA 1PQOA 1GE0A 4YM8A 1GF9A 5M4YB 2CGIA 3C81A 4IJ4A 5C79A 1ZSQA 1F6RA 3PP2A 4W54A 1V5MA 159LA 2DQHY 1L72A 2LCBA 4J1AA 2BQAA 3TXJA 1BB7A 1VDPA 4HTKA 1XCGA 1D3FA 146LA 2KR0A 4K2PA 1IC4Y 3N7CA 1B5YA 4N1EI 239LA 1OUGA 3C82A 4E97A 2GCJA 5D5FA 1V88A 2CODA 4DKLA 1U29A 3CDRA 1FGYA 1RE2A 3AYQA 1KXYA 2OU0X 1L67A 2Z19A 2L1CA 138LA 3F5RA 1LI6A 166LA 1ZC3B 2XQOA 4K2OA 1OWZA 2G4QA 1DYCA 1QS9A 1GB5A 3PZDA 2BQFA 2A7DA 241LA 1LB1A 1C6HA 1QT3A 5B1FA 3A94A 1D2YA 1IR8A 4I0CA 1BWJA 3OE0A 2EC1A 1XJTA 2B74A 2HUBA 1VDSA 3G3BB 2ZYCA 2DKPA 3RZEA 1EL1A 2HEBA 1LSNA 1V7TA 1LPYA 3C8SA 5LIOA 1L07A 1RRPB 5F16A 3QWMA 1IP5A 1JKDA 3W6CA 1WJMA 3TVVA 2XBRA 3DN1A 2UVMA 210LA 255LA 4H94A 1QT5A 4L1RA 4LYCA 1L39A 4EJNA 4H8YA 1OUEA 2I26L 2NBVA 1OMWA 1LZ8A 1TCYA 4N5RA 3GYOA 3TMVA 3KSYA 4FDYA 4HAXB 3PVLA 4ARJA 1OVHA 4OO9A 1C6KA 3CDQA 1L52A 4W59A 1P2RA 3SYXA 190LA 1OVJA 1IORA 5EFXA 1REZA 4EPFA 2CJLA 4AQNA 1U5FA 1ZURA 3WU9A 3AW6A 1D9UA 2KUQA 3C8QA 218LA 1LSCA 4HB4B 1FHOA 1MELL 3G3WA 2F2QA 1LZAA 5FEKA 1CU5A 3ODUA 2LC9A 5B07A 1DYAA 3SB5A 1LKSA 1RCMA 1L77A 1L48A 1LJIA 1EQ4A 2OE9X 1L59A 1OYUA 1BWIA 1NMMA 3A3RX 2HEDA 1D3NA 4A5KA 261LA 4NHTA 5KXWA 2R0DA 4ETAA 1G1WA 5II3A 4ARQA 2P8VA 1P6YA 2NZ8B 4EMNA 2GCLA 1K28A 1L98A 3LJUX 1LMCA 4H8XA 3BKHA 2DKVA 189LA 3HBEX 1JEFA 1P36A 4TYZA 1L70A 3LYMA 1WJ1A 1HEQA 3ODOA 3ULRA 1LW3A 1QDRA 2F30A 1HELA 2H7EA 1PQDA 4PK0A 3PEGA 1DKKA 207LA 3HDEA 1L20A 1INUA 4CFPA 1VEDA 1ZC4B 233LA 4XENA 141LA 2CDSA 4PPOA 3TMXA 1XD4A 1N3HA 3WVXA 1IC7Y 2C8PA 1CV5A 1QTEA 3BKVA 4WSFA 4N0JA 3BJIA 3WXUA 2B70A 259LA 3NY8A 3V2WA 5GOWB 1IP1A 4YONA 4HAUB 1CV6A 4I7RA 4DQ7A 4C3WA 1DYBA 3GUOA 3RNXA 244LA 3DXEA 134LA 1NTVA 1V5UA 1G7JC 2H9JA 2NTGA 3P7ZA 2I5CA 4KHBB 1GB2A 1LSEA 1GF6A 3GXKA 1WTHA 1TJ6A 2DX1A 1QUTA 3G3AB 4RLMA 3A92A 4HJZA 1DDVA 1L82A 5IHGA 1C45A 1P2CC 1CV3A 4GPTB 1C6CA 1IP6A 4N1CC 1XGUC 2Z38A 3HTFA 1HENA 1G07A 1CU3A 4L41A 5I5QA 1JWRA 3PVUA 4H91A 4H1PA 1KY1A 4AXTA 4WLXA 4NWEA 3D8FA 195LA 2RAZX 3T36A 1KNIA 2RBRA 3HIEA 1EF1A 5KXKA 1C6IA 4LYMA 1C63A 1CU6A 1B7SA 2F2NA 4EKSA 4ET8A 4NWHA 139LA 1L15A 5LVHA 1DXJA 2YRYA 3MPXA 5J3QA 230LA 1C6JA 3SBBC 3F0WA 1UIDA 1Z55A 1LJEA 1JITA 2LHMA 1GF4A 1G06A 1WG7A 2FJUB 4MT7A 1LZEA 1L92A 1BVXA 3ULBA 2KUPA 2D10A 1XFPL 1QIOA 2DYQA 2DYNA 2I6ZA 2MEFA 3DN4A 5LA8A 126LA 3F6ZA 1C6AA 1CJ8A 1L88A 4EKPA 5KCVA 4DX90 4F7HA 4F7UP 4NG1A 2DTCA 1GB7A 1LGXA 3WXTA 3DN8A 2O79A 4YX7C 4DBBA 4OWCA 1L37A 5IDDA 1GE4A 3M18B 4HSFA 3ZVQB 4G9SA 2I1JA 1B2KA 1L19A 1B0DA 1L02A 4HAYB 174LA 5C5BB 5I4XA 4DD1A 1Q67A 2BQNA 2EJ8A 5T3FA 1P2LA 1L80A 3QY4A 3AZ6A 1QSAA 3P64A 4W57A 6LZMA 1HF4A 4DYGA 3TFMA 4DJHA 3A95A 2BPUA 196LA 1LYIA 2G4NA 1WGQA 3A98B 1L09A 1RJ2A 165LA 1L41A 1GBYA 5L3HA 1BVKC 2OU8A 5KXSA 1JJ1A 2HEEA 1KW7A 199LA 180LA 4HAZB 2LZ2A 4IATA 4CHXA 3WW6A 2GS0A 3FSSA 4A6FA 231LA 4DT3A 1OUAA 1BQLY 2Z2EA 2RB1X 3OE8A 3LYOA 4P7IA 122LA 1L05A 2D4QA 1E5WA 3TCAA 1L32A 103LA 3WUMA 2VSZA 112LA 1GFTA 1DZBX 1L56A 5KY1A 1CKCA 2HUKA 251LA 2B6TA 3FVCA 1JISA 1P56A 155LA 1X1GA 1LHLA 4NGJA 1YAOA 1LWKA 3EBAB 1QTBA 4IOYX 3SB9A 4K17A 1XEJA 3SB7A 1ZWNA 5J7CA 1VATA 1L79A 2LULA 1QSBA 4Z46A 3QAKA 2ADZA 4ARLA 1GFGA 4D6WA 4I7JA 2RH1A 2BQMA 1K5DB 3KZ1A 5D27A 5KXOA 3D4SA 1LHJA 1WTMA 4ANRA 1HMLA 1NHEA 3FEHA 4KHOA 1CX6A 1HEMA 3L2XA 4NY0A 2Y8GA 2HEFA 9LYZA 3W6FA 2RBNA 4KPMA 5D5CA 1PQJA 1U2BA 1WTNA 1LSPA 3WPLA 1YROA 1G0GA 5CLQB 1T8AA 4HPIA 1H87A 1DPXA 4RLNA 5C16A 1WVUA 2ZPYA 1KZGA 4GCFA 1L45A 3CXBB 258LA 4NGWA 1VDQA 1X05A 3CQLA 3HTDA 3TXFA 1GC6A 4QJ5B 4H92A 1L55A 3NWAA 1CNSA 3A58A 2N23A 4TKNA 1MAIA 1LSAA 110LA 1IR9A 4QJ4B 4NG8A 5LAFA 1D0LA 1GFJA 1WQNA 1GE3A 1IWZA 2JP2A 1CX7A 1TBYA 2DQIY 1YQVY 4HJYA 3ODWA 5HMVA 2COFA 3K2RA 1G0QA 1O23A 4W58A 4ZFPA 1SWYA 1PS5A 4B0DA 3SO6A 246LA 5D3WA 4W51A 4NGVA 3AJ4A 1L46A 1U5GA 2YT0A 2I5FA 3UZTA 3O96A 4EJ4A 4D9ZA 193LA 1YL1X 4KAXB 4W55A 5LYTA 1IR7A 4I8SA 5APDA 2D91A 2K49A 1JSFA 4CJ2A 3LZTA 1B5UA 1C60A 1LYFA 1NBYC 5F9UA 2YVBA 2Z39A 3FM8C 2CY4A 2YSZA 182LA 1LMPA 4KVGB 4DD0A 2BQJA 5FDJA 1QT6A 1V89A 2H7DA 1CV4A 2VKIA 1IOTA 4DD9A 260LA 3A8PA 1LJGA 1LSYA 1LSDA 2DKQA 3IVFA 1FLQA 1B7QA 1UIEA 3VWOA 2BQOA 4RDSA 3DNAA 152LA 5F81A 3LYTA 4HDOA 222LA 1AT5A 1L65A 1SLYA 3CDTA 4HAVB 1GDXA 3A91A 1L24A 2ZNWY 1L83A 5LAGA 5I54A 4FJRA 2HTHB 5LG4B 2HU1A 3MGWA 1C6FA 1W1DA 3G9WA 1GXXA 1U5DA 5LOPB 4E3UA 1TLAA 1XSFA 1C6MA 2KIGA 151LA 1L47A 1TDYA 2QKMA 194LA 2RVBB 1WQOA 3A8QA 3LN2A 4EKQA 4HV1A 4TSBA 4H9BA 192LA 5DHFB 1B55A 1CTWA 3TMUA 1LZNA 4C5FA 2F32A 1B7NA 2B72A 226LA 3HT8A 1LMNA 2A7FA 4LT1A 5DN5A 3QE8A 5LVJA 4R6CA 1C6PA 4GBRB 5L81A 1G0MA 4LDLA 1G0LA 1JKCA 1PQIA 1L22A 1KIQC 111LA 3CDVA 4I7PA 1LYSA 3ATOA 1YAQA 2ZILA 2V76A 1C6DA 1GBSA 4WM6A 5LINA 3W6BA 1UEFA 1JJ3A 5LYZA 1LYGA 1CU0A 2K8EA 2FJLA 3RCPA 3HTGA 1QT4A 191LA 3TW1A 1HEPA 3B77A 115LA 5C6JA 1PZYA 161LA 3HT7A 1EQ5A 4ZEEA 2Z14A 2D6BA 4WM2A 5DH9B 4GCCA 1GD6A 3CT5A 1FHXA 1P5CA 2MFQA 2BQDA 175LA 1GB9A 243LA 5DL9A 1SX7A 5JHHA 3HK0A 262LA 2DQDY 2O7AA 1L96A 1L01A 1C61A 1G7LC 3B0IA 235LA 3D8DA 5I2SA 5KXYA 2BLXA 1C7PA 1G7IC 5KXXA 1L13A 3AGGG 2YBHA 3N9CA 4OOTA 4XJDA 1B5WA 3N9AA 1LZ4A 1UBZA 4KXIA 242LA 221LA 118LA 171LA 1X11A 1SSWA 1LAAA 1L54A 5HQ1A 3ZVRA 3DN0A 4R0FA 229LA 4N9RA 1L81A 4Y94A 1WQMA 1OUBA 232LA 2D4KA 2Q0MX 3GUIA 4HSIA 4G49A 1GFKA 4ZRKA 5FSTA 1OUCA 1J19A 1C10A 1M7RA 2DLWA 1LZTA 4LYOA 2BQHA 5HNLA 4HJVA 4DQJA 8LYZA 3FADA 1L35A 104LA 3ODXA 3WULA 1DI4A 4LYTA 1NWGA 2BQGA 4CFOA 1L74A 1L25A 238LA 4Z98A 4YXAC 3HSAA 2YVCA 4WL6A 2K00A 4YL8A 4CYEA 1JJ0A 2IFFY 2D9VA 2Z6BA 3DN2A 4GN3A 2OTZX 4GCEA 2Z0PA 2RB2X 3CT1A 3KRXA 1GE1A 1VDTA 2WARA 4AGAA 2OU9A 3GUMA 1KS3A 2RSCA 1FKVA 3AGIA 4LFPA 3WYHA 1V7SA 5FELA 1G1VA 1T6VL 2Z59A 1CV1A 4D0NB 2B73A 1B7RA 3A67Y 1LKRA 4NSJA 3B0OA 224LA 1L14A 1GF8A 137LA 4ZRIA 4NY5A 1BB5A 2D9XA 3DCXA 1LJ4A 1UICA 2OEAX 3AGHA 2PC2A 2RSGA 1BB3A 1IVMA 2DQFC 2RLOA 1LZBA 2ZKMX 4OW1A 3AU4A 1ZYTA 2LYMA 2B6ZA 4YF2A 1ZVHL 2YS3A 3TMWA 1B7PA 1LPIA 1ZV5L 2LYDA 1PQMA 2GJYA 108LA 4B49A 4GNKB 1QTDA 5KXRA 1VAUA 5DM9A 215LA 4DC4A 1LJNA 2F4AA 4ETBA 5KXZA 1OV5A 197LA 2IFSA 2FBBA 1OUDA 1UIHA 2MEBA 3UONA 4B4EA 3LZMA 5DHAB 1XGPC 2YF0A 4HB3B 1LZ5A 228LA 1LSMA 4OWAA 1LZDA 3HWLA 1EAZA 1JTMA 4M6DA 3AU5A 187LA 3TXHA 4NSWA 4G4HA 3NWFA 2J59M 1GF5A 1X1FA 1IWWA 156LA 1PMSA 2MEAA 1HEWA 1LZYA 3CB7A 3DXDA 5HE0A 2ROVA 2DQAA 2AL6A 1LYEA 1L23A 1C6GA 3P68A 2COCA 3P6AA 2FBDA 1C65A 213LA 1E8LA 3P4ZA 2ZNXY 1HC0A 1L62A 1CJ7A 4GRVA 5FI1A 234LA 4HHVA 3SV1A 1WGUA 4GZUA 1L90A 3RZ4A 3T06A 2J0MA 3HW2B 3HBHA 1IWUA 5KKJA 1V5PA 4RW1A 3WA0A 1LI2A 2UZRA 1L44A 1TAYA 5LVIA 1HHLA 163LA 4GN1A 167LA 1L21A 1UPRA 5DN4A 1QC6A 4TX7A 2RAYX 5LYMA 2J0JA 2LYZA 109LA 1L03A 1BB6A 1U5EA 5DI9B 5M1YA 225LA 4NGKA 4EPIA 3JR6A 177LA 4K81A 4I7NA 2EQLA 1LZ1A 1QTVA 3D9AC 4TSCA 1IP3A 3NY9A 1FKQA 4WM3A 1REYA 4W94A 3VIAA 4GOUA 4OWHA 4NHPA 120LA 5I14A 1L04A 1UA6Y 4WJ7A 2CUUA 3ATNA 2D2QA 3A8ZA 1LYYA 1SSYA 3FI5A 1AM7A 3A93A 2GUMA 2HUMA 5L9JA 1XKEA 1CKGA 2HULA 1P46A 1D6QA 3SUZA 2OE7X 4BADA 3WU7A 4A6HA 3IJUA 2VRWB 253LA 1TEWA 2N5ZA 1YANA 1DYDA 3W3EA 2BQEA 3SB8A 2OE4X 1HNLA 1L61A 1UIAA 1FDLY 4NFVA 4OWEA 2AUBA 4H90A 1OQMA 2GV0A 125LA 5KXLA 4HB2B 4H9IA 4NEBA 1L51A 2RUKB 2K2UA 1L97A 1Y5OA 4UWVA 2BAAA 3V5WA 1YL0X 129LA 1DYFA 3FI7A 4U3XB 1LGWA 4GLVA 4YEMA 1C62A 1L38A 1LZRA 1FB8A 1UNPA 2N0YA 1D2WA 169LA 1KZ7A 2ROZB 144LA 1LJJA 4J0LA 5HE2A 5KQ1A 1D3MA 181LA 3EMLA 4ARMB 1FHWA 1L26A 5C6LA 133LA 176LA 5K7OA 1KXXA 1FOEA 3P66A 1T97A 1LJKA 1BB4A 4DD3A 5FHWA 2FYCA 2D11A 3DMZA 145LA 4OT1A 1XGTC 4H9AA 1NDMC 4KHBA 1L12A 1L33A 2YS5A 4OWBA 1LYJA 2ZQ3A 4NGLA 4DD7A 1LYOA 4QDNA 5CLLB 1L40A 1L94A 5LXWA 2IYBA 3TXIA 1L49A 1ZVRA 1YIKA 216LA 1ZM0A 1OP9B 149LA 257LA 4NSGA 2H5ZA 4QXAB 1EPYA 4G4BA 1UPQA 1C66A 3BINA 4GCBA 1AZFA 5D3YA 185LA 4XWXA 1QUOA 4WM1A 1HSXA 2W2XD 2B75A 1XEPA 4DIXA 2VB1A 5EBHA 102LA 4P2EA 3NSUA 1L66A 3WVYA 5APFA 4H8ZA 1NBZC 4KL7A 3AW7A 1AWEA 3TXGA 2Y7BA 5I4WA 4ETEA 3RT5X 1JTPL 3DMXA 4II8A 3WL2A 5C6IA 172LA 5B05A 4ZPUA 4XJIA 1U27A 1NQIA 4A6KA 4WLDA 1FAOA 1GFVA 1UIGA 1C43A 1GB0A 2X0AA 4PRUA 1L11A 3E3DA 1I20A 1GB6A 1T3PA 3IJVA 2YT1A 4H93A 1CJ6A 3ZDTA 3GUKA 1DDWA 1Y19B 3W6EA 5F14A 4HP0A 2PZ1A 4YEOA 1LSZA 2MEDA 1IRSA 1L43A 2YBJA 1FLWA 5ILFA 164LA 1JHLA 3EXDA 3HH3A 3A96A 4X3BA 1KW5A 4DQ5A 3B6LA 1Z87A 2P0FA 1ZMYL 3WMKA 3EMSA 4I7TA 3W6DA 1L0JA 2ELAA 5D3XA 1L18A 1OVKA 2Q13A 4WMGA 3AZ4A 2LZTA 4YXCA 2Z4DA 1G7MC 4H9CA 1WQPA 3OANA 2EKSC 237LA 256LA 4TWSA 3RUNA 4EXMA 1JKBA 200LA 3NWDA 2Y8PA 1DPWA 1QQYA 4NSHA 4EOFA 4ZIXA 1OWYA 3ZVQA 1V61A 186LA 1QUGA 5B06A 2R2YA 1CJ9A 5C5BA 1CKDA 2J0KA 1QUSA 1L73A 1SQ2L 2DQCY 3PBLA 1I1ZA 3ULCA 1JTOL 3PSCA 1IY4A 1PLSA 1G0KA 1L10A 2HEAA 2D9WA 1L16A 1I2HA 1GB3A 1LMQA 209LA 211LA 3A90A 3WPKA 2B6WA 1GXV2 3T6UA 2HTXA 1L29A 3AZ7A 3HTBA 1L89A 1MPHA 1L75A 1C64A 1K5GB 1UCOA 1LYDA 1CKHA 1I7AA 1C08C 2LZMA 4NGYA 5APEA 1F6SA 4LDOA 1IY3A 3U8ZA 4HDQA 2RGNB 1L60A 1SGHA 2MKRA 1YKXX 4ARQB 5E4PA 1HEOA 2W1XA 1XX0A 2HE7A 2BQKA 2YS1A 3OHMB 3P65A 1NTYA 3HUKA 123LA 143LA 1MLCE 2LKOA 2MEHA 2YBLA 1LJFA 1IWXA 3G3VA 5A3EA 178LA 4Z2NA 1XEKA 3FA0A 1W1GA 4EMOA 1SWZA 1IX0A 3HH4A 4XJGA 2ZIJA 2CRFA 5JENB 1GF7A 1J0WA 1PQKA 2OTYX 3C8RA 1WQRA 1P6SA 2Q9EA 4NHSA 3VOQA 157LA 4QJ3B 1KIRC 201LA 2RBPA 2W1YA 5FI0A 1UC0A 240LA 1HFZA 160LA 1L93A 1LLHA 1BTNA 1P3RA 2LOXA 4QY9A 3SB6A 4NIJA 1TQZA 1L57A 1LZCA 1B5XA 5I4YA 2Z0OA 3GXRA 1LZSA 1SHCA 4XYYA 4UWNA 3HT6A 3B72A 3AB6A 1GE2A 1YAMA 223LA 4F7GA 3NYAA 1D9WA 1LYZA 4HPEA 5LVGA 4Z41A 1MIXA 1L34A 2RRFA 3NW8A 4WLYA 1XGRC 2ZWBA 3C83A 1WQQA 4W53A 2NWDX 1NDGC 3LZ2A 3K3TA 4KT3A 1NU2A 2CY5A 3D3DA 3HDFA 2W2XC 1J1PY 1L31A 7LYZA 1DYGA 1W08A 4OSNA 158LA 1N4FA 4I7OA 113LA 1P5TA 2Z2FA 2MEEA 1IO5A 1YKYX 1OQNA 1MK7B 3WYFB 1GB8A 1UNRA 1LHMA 3PVWA 2EIZC 227LA 4J7VA 2F4GA 1GBOA 4HTQA 1D6PA 3A6CY 3SN6R 4PQ0A 1B7OA 2Z37A 3LYZA 2Z18A 4ET9A 2W1LA 4LZTA 2ELBA 1H10A 3TO1A 1GBWA 1YAPA 1T6HA 168LA 1L71A 1W1HA 1KI1B 1P3NA 5LONB 2LG1A 3MDBC 3GUJA 1AT6A 4HV2A 2H9KA 2DX5A 4DWXA 4XJFA 4G4CA 1UNQA 2BQLA 3CT0A 4GCDA 4A7DA 4HTNA 1UIBA 1G7HC 2F47A 2MECA 4WLTA 1IP2A 5KKIA 5HE1A 2DBTA 1C6NA 2W1MA 4ETCA 1OUJA 2DQGY 1LMAA 1C46A 183LA 1IOCA 1L30A 3DKEX 2YBMA 1P64A 2QARC 4NHIA 5B1GA 3VW7A 2EPEA 4XJHA 128LA 3HT9A 1C67A 2DHIA 1LI3A 2IGCA 1NF5A 2XTHA 1QUDA 1LTMA 4C0AA 2A4TA 1OY2A 5I2MA 1GFHA 3AJNA 5JLJB 2B6YA 2RNRB 3FE0A 1CV0A 4O34A 1B6IA 1HMKA 4PRQA 1SX2A 1KIPC 1XODA 2YT2A 4WVFB 4DXAB 114LA 1L68A 4NGOA 4BBKA 1IC5Y 4LFXA 2CAYA 4DDAA 2MDXA 3HUAA 3M1IB 1CUQA 3RW8A 2ANVA 4H9FA 3ZEKA 1XGQC 1REMA 5HNCA 4M4OA 2BQCA 4KHAA 1L28A 1IEEA 1QTCA 3WW5A 4GN4A 1GHLA 1L0KA 5APCA 1JKAA 1GBZA 4DAJA 2D9YA 4LT3A 3V2YA 5L3IA 1DI3A 1LSBA 1LYHA 1L76A 3J6KA 220LA 5E9RA 132LA 4A6FB 1QQGA 1BWNA 1L86A 2EMTA 2YBIA 1IP7A 1G0JA 4ZRJA 2HECA 1QT7A 1DROA 1ZYIA 3C7YA 1L91A 4WM4A 1AKIA 3EO5A 2Z12A 1DBHA 1GG3A 1NI2A 2G4PA 2IHLA 1OUFA 1IIZA 1DQJC 1HFXA 1L42A 1GAZA 1JTTL 7LZMA 4PJ2C 3WU8A 1HERA 1ISNA 2Y8FA 1VFBC 4LDEA 1T77A 3WUNA 1AQCA 1BTKA 1CU2A 3C80A 4LT2A 1LHKA 1LGUA 4W56A 3OE9A 1EGXA 1JSEA 1UUZC 3HH5A 1L84A 2BCJA 4OOOA 5DLAA 206LA 1D0MA 4Z2MB 3CSZA 4XJBA 2W2WA 3LHMA 5KXMA 4GXBA 3HU9A 130LA 2LOZA 1QTHA 250LA 4PJZA 3CDOA 4MY6A 4H9HA 162LA 3X23A 1QT8A 3OK0A 5A3ZA 3KRWA 1GFAA 3CSRA 1JIYA 2M14A 4IFSA 3SBAA 142LA 4ML7A 4LGKA 3GUPA 1F10A 2DA0A 5F9XA 1GBXA 1L85A 4DDCA 1DKJA 150LA 3G3XA 3A34A 1GC7A 5C6RA 4B4IA 2M38A 4DX8A 5JP4A 4WG7A 148LE 4NSIA 1L08A 248LA 4MR1A 1XR0B 1BWHA 1YILA 119LA 4HAWB 2ANXA 3GUNA 1IP4A 3HH6A 3ML4A 5I53A 2QKLA 3WPJA 2YSSC 1L64A 1H4RA 2DQJY 1LJ3A 4ETDA 2DHJA 3D8EA 3SNHA 1OUHA 2DFKA 4CHJA 249LA 3QNGA 2C8OA 1RFPA 4B4JA 5KXNA 4XADA 3SP3A 127LA 6LYZA 254LA 4YOPA 1MKEA 4J1BA 1LSGA 4DDBA 4Z3MA 3GULA 4GMVA 4PNKA 1JQUA 252LA 1L95A 214LA 1GFRA 1B5ZA 1T8GA 5LA5A 1J1XY 2COAA 2D4JA 5KJ9A 1BAKA 1C6LA 4BAPA 184LA 4NGZA 2R09A 1IOQA 2XBSA 1IWTA 135LA 1C6EA 1L27A 3F9LA 4XN6A 1DYEA 3HU8A 3QBVB 1L87A 2ZQ4A 1LWGA 5IRSA 131LA 4MK0A 3PDSA 1LW9A 2RBSA 1RJCB 1P37A 1QUHA 4H9EA 4MCKA 6LYTA 4GLAA 4HB0B 4GMXB 2RB0X 4PHIA 4UWUA 4TTDA 1GEVA 1LZ9A 2B6XA 2OQBA 4K5YA 212LA 3CIKA 1WVHA 3TXBA 2HU3A 2YBNA 4I7LA 4H8SA 5HMJA 2NMBA 1M7EA 1EQEA 1L00A 4LT0A 4LZMA 2G35A 3TXDA 1XJUA 4S0WA 1LZGA 2MEIA 1KXWA 4PGJB 1B7LA 1IWYA 3U7DA 3IWRA 3DN3A 4NHQA 198LA 3KY9A 5KXTA 1JTNA 1I56A 3PG7A 2YDGA 1ALCA 5J3TA 2OTXA 3WH1A 2KGXB 5D3VA 1B5VA 1D0KA 2DHKA 5JHGA
chains in the Genus database with same CATH topology
153LA 1C6QA 4EKRA 1C69A 107LA 1CVKA 4TUNA 4WO9A 1GPQC 1FLYA 2I1KA 1L63A 4RW2A 1QTKA 5ILCA 1UACY 2D9ZA 1C6BA 1PFJA 2RBQA 247LA 1GEZA 4I7QA 1CKFA 2B5ZA 4QGZA 4IASA 1DYNA 1GF0A 3OE6A 4W52A 1G0PA 3N9EA 4YENA 4LYZA 1QSQA 1LMTA 1JPOA 3TXKA 205LA 1T8FA 1LJHA 1I6SA 4I7SA 2L2IA 2BQBA 1TXDA 3OJPA 3WUAA 3HBDA 2BQIA 1GFUA 4GN5C 2RBOA 2O4WA 3KAMA 5B59A 3M3UA 4L6EA 1L69A 1L53A 2BLYA 2D4IA 1LOZA 1LSFA 4ARPA 5HE3A 188LA 4WOAA 2B7XA 2AEHA 4WM5A 1DI5A 1LHIA 1YKZX 4IAPA 1C6TA 2Q9DA 3HFMY 3HUQA 5IELA 1RI8B 3GYPA 1FGZA 1GAYA 4QEQA 2MEGA 1QS5A 2L78A 2XQNM 2UZSA 4BS7A 1GFEA 4W96A 4CHMA 1MIZB 2ZIKA 2NTHA 1LZ6A 4EKUA 5J3YA 4B1AA 1BGIA 2ZYPA 2I25L 4NGIA 3A3QA 3DXCA 2CWIA 1WI1A 2DQEY 2X18A 1LCNA 1D3JA 1LMOA 3F8VA 5KXPA 1KY0A 1OV7A 3TXEA 5FCPA 4I7KA 1IOSA 1A4VA 2QB0B 245LA 4WL7A 217LA 3L64A 3C7ZA 2XJWA 5KQ4A 3QIJA 1C68A 2K2JA 1FLUA 1IWVA 3DMVA 3C7WA 4N8ZA 1F0WA 1L06A 1L99A 4WG1A 3A6BY 5AMYA 1GF3A 1HSWA 2P0DA 1B7MA 1HFYA 1GWDA 2P0HA 3RU5A 3CSQA 140LA 3J4GA 4B6HA 1FN5A 5LZMA 1FBIX 4BAFA 4CGEA 1JUGA 1WVVA 154LA 1QDTA 1L58A 1DDMA 1L50A 2FYDA 5DIFB 2E2XA 1OUIA 4I7MA 4DD2A 173LA 219LA 5HLLA 4HATB 1EVHA 3DN6A 1ZVYB 4ARMA 1H6MA 208LA 1UIFA 5LVKA 1B9OA 4LYBA 2MWNB 4WO6A 1P7SA 1L36A 1XEIA 2KCJA 3AZ5A 1L17A 1LHHA 4MSTA 170LA 1GDWA 236LA 2Z0QA 2LYOA 1A2YC 1QTZA 1NHBA 3B0KA 147LA 1REXA 3W6AA 2DN6A 3HQCA 1X86A 1W6ZA 1MK9B 1J1OY 1BHZA 1CUPA 1NKHA 1QSWA 2EMSA 1PQOA 1GE0A 4YM8A 1GF9A 2CGIA 3C81A 4IJ4A 5C79A 1ZSQA 1F6RA 3PP2A 4W54A 1V5MA 159LA 2DQHY 1L72A 2LCBA 4J1AA 2BQAA 3TXJA 1BB7A 1VDPA 4HTKA 1XCGA 1D3FA 146LA 4K2PA 1IC4Y 3N7CA 1B5YA 4N1EI 239LA 1OUGA 3C82A 4E97A 2GCJA 5D5FA 1V88A 2CODA 4DKLA 1U29A 3CDRA 1FGYA 1RE2A 3AYQA 1KXYA 2OU0X 1L67A 2Z19A 2L1CA 138LA 3F5RA 1LI6A 166LA 1ZC3B 2XQOA 4K2OA 1OWZA 2G4QA 1DYCA 1QS9A 1GB5A 3PZDA 2BQFA 2A7DA 241LA 1LB1A 1C6HA 1QT3A 5B1FA 3A94A 1D2YA 1IR8A 4I0CA 1BWJA 3OE0A 2EC1A 1XJTA 2B74A 2HUBA 1VDSA 3G3BB 2ZYCA 2DKPA 3RZEA 1EL1A 2HEBA 1LSNA 1V7TA 1LPYA 3C8SA 5LIOA 1L07A 1RRPB 5F16A 3QWMA 1IP5A 1JKDA 3W6CA 1WJMA 3TVVA 2XBRA 3DN1A 2UVMA 210LA 255LA 4H94A 1QT5A 4LYCA 1L39A 4EJNA 4H8YA 1OUEA 2I26L 1OMWA 1LZ8A 1TCYA 4N5RA 3GYOA 3TMVA 3KSYA 4FDYA 4HAXB 3PVLA 4ARJA 1OVHA 4OO9A 1C6KA 3CDQA 1L52A 4W59A 1P2RA 3SYXA 190LA 1OVJA 1IORA 5EFXA 1REZA 4EPFA 2CJLA 4AQNA 1U5FA 1ZURA 3WU9A 3AW6A 1D9UA 3C8QA 218LA 1LSCA 4HB4B 1FHOA 1MELL 3G3WA 2F2QA 1LZAA 5FEKA 1CU5A 3ODUA 2LC9A 5B07A 1DYAA 3SB5A 1LKSA 1RCMA 1L77A 1L48A 1LJIA 1EQ4A 2OE9X 1L59A 1OYUA 1BWIA 1NMMA 3A3RX 2HEDA 1D3NA 4A5KA 261LA 4NHTA 5KXWA 2R0DA 4ETAA 1G1WA 5II3A 4ARQA 2P8VA 1P6YA 2NZ8B 4EMNA 2GCLA 1K28A 1L98A 3LJUX 1LMCA 4H8XA 3BKHA 2DKVA 189LA 3HBEX 1JEFA 1P36A 4TYZA 1L70A 3LYMA 1WJ1A 1HEQA 3ODOA 3ULRA 1LW3A 1QDRA 2F30A 1HELA 2H7EA 1PQDA 4PK0A 3PEGA 1DKKA 207LA 3HDEA 1L20A 1INUA 4CFPA 1VEDA 1ZC4B 233LA 4XENA 141LA 2CDSA 4PPOA 3TMXA 1XD4A 1N3HA 3WVXA 1IC7Y 2C8PA 1CV5A 1QTEA 3BKVA 4WSFA 4N0JA 3BJIA 3WXUA 2B70A 259LA 3NY8A 3V2WA 5GOWB 1IP1A 4YONA 4HAUB 1CV6A 4I7RA 4DQ7A 4C3WA 1DYBA 3GUOA 3RNXA 244LA 3DXEA 134LA 1NTVA 1V5UA 1G7JC 2H9JA 2NTGA 3P7ZA 2I5CA 4KHBB 1GB2A 1LSEA 1GF6A 3GXKA 1WTHA 1TJ6A 2DX1A 1QUTA 3G3AB 4RLMA 3A92A 4HJZA 1DDVA 1L82A 5IHGA 1C45A 1P2CC 1CV3A 4GPTB 1C6CA 1IP6A 4N1CC 1XGUC 2Z38A 3HTFA 1HENA 1G07A 1CU3A 4L41A 5I5QA 1JWRA 3PVUA 4H91A 4H1PA 1KY1A 4AXTA 4WLXA 4NWEA 3D8FA 195LA 2RAZX 3T36A 1KNIA 2RBRA 1EF1A 5KXKA 1C6IA 4LYMA 1C63A 1CU6A 1B7SA 2F2NA 4EKSA 4ET8A 4NWHA 139LA 1L15A 5LVHA 1DXJA 2YRYA 3MPXA 5J3QA 230LA 1C6JA 3SBBC 3F0WA 1UIDA 1Z55A 1LJEA 1JITA 2LHMA 1GF4A 1G06A 1WG7A 4MT7A 1LZEA 1L92A 1BVXA 3ULBA 2KUPA 2D10A 1XFPL 1QIOA 2DYQA 2DYNA 2I6ZA 2MEFA 3DN4A 5LA8A 126LA 3F6ZA 1C6AA 1CJ8A 1L88A 4EKPA 5KCVA 4DX90 4F7HA 4F7UP 4NG1A 2DTCA 1GB7A 1LGXA 3WXTA 3DN8A 2O79A 4YX7C 4DBBA 4OWCA 1L37A 5IDDA 1GE4A 3M18B 4HSFA 3ZVQB 4G9SA 2I1JA 1B2KA 1L19A 1B0DA 1L02A 4HAYB 174LA 5C5BB 5I4XA 4DD1A 1Q67A 2BQNA 2EJ8A 5T3FA 1P2LA 1L80A 3QY4A 3AZ6A 1QSAA 3P64A 4W57A 6LZMA 1HF4A 4DYGA 3TFMA 4DJHA 3A95A 2BPUA 196LA 1LYIA 2G4NA 1WGQA 3A98B 1L09A 1RJ2A 165LA 1L41A 1GBYA 5L3HA 1BVKC 2OU8A 5KXSA 1JJ1A 2HEEA 1KW7A 199LA 180LA 4HAZB 2LZ2A 4IATA 4CHXA 3WW6A 2GS0A 3FSSA 4A6FA 231LA 4DT3A 1OUAA 1BQLY 2Z2EA 2RB1X 3OE8A 3LYOA 4P7IA 122LA 1L05A 2D4QA 1E5WA 3TCAA 1L32A 103LA 3WUMA 2VSZA 112LA 1GFTA 1DZBX 1L56A 5KY1A 1CKCA 2HUKA 251LA 2B6TA 1JISA 1P56A 155LA 1X1GA 1LHLA 4NGJA 1YAOA 1LWKA 3EBAB 1QTBA 4IOYX 3SB9A 4K17A 1XEJA 3SB7A 1ZWNA 5J7CA 1VATA 1L79A 2LULA 1QSBA 4Z46A 3QAKA 2ADZA 4ARLA 1GFGA 4I7JA 2RH1A 2BQMA 1K5DB 3KZ1A 5D27A 5KXOA 3D4SA 1LHJA 1WTMA 4ANRA 1HMLA 1NHEA 3FEHA 4KHOA 1CX6A 1HEMA 3L2XA 4NY0A 2Y8GA 2HEFA 9LYZA 3W6FA 2RBNA 4KPMA 5D5CA 1PQJA 1U2BA 1WTNA 1LSPA 3WPLA 1YROA 1G0GA 5CLQB 1T8AA 4HPIA 1H87A 1DPXA 4RLNA 5C16A 1WVUA 2ZPYA 1KZGA 4GCFA 1L45A 3CXBB 258LA 4NGWA 1VDQA 1X05A 3CQLA 3HTDA 3TXFA 1GC6A 4H92A 1L55A 1CNSA 2N23A 4TKNA 1MAIA 1LSAA 110LA 1IR9A 4NG8A 5LAFA 1D0LA 1GFJA 1WQNA 1GE3A 1IWZA 2JP2A 1CX7A 1TBYA 2DQIY 1YQVY 4HJYA 3ODWA 5HMVA 2COFA 3K2RA 1G0QA 1O23A 4W58A 4ZFPA 1SWYA 1PS5A 4B0DA 3SO6A 246LA 5D3WA 4W51A 4NGVA 3AJ4A 1L46A 1U5GA 2YT0A 2I5FA 3UZTA 3O96A 4EJ4A 4D9ZA 193LA 1YL1X 4KAXB 4W55A 5LYTA 1IR7A 4I8SA 5APDA 2D91A 1JSFA 4CJ2A 3LZTA 1B5UA 1C60A 1LYFA 1NBYC 5F9UA 2YVBA 2Z39A 3FM8C 2CY4A 2YSZA 182LA 1LMPA 4KVGB 4DD0A 2BQJA 5FDJA 1QT6A 1V89A 2H7DA 1CV4A 2VKIA 1IOTA 4DD9A 260LA 3A8PA 1LJGA 1LSYA 1LSDA 2DKQA 3IVFA 1FLQA 1B7QA 1UIEA 3VWOA 2BQOA 4RDSA 3DNAA 152LA 5F81A 3LYTA 4HDOA 222LA 1AT5A 1L65A 1SLYA 3CDTA 4HAVB 1GDXA 3A91A 1L24A 2ZNWY 1L83A 5LAGA 5I54A 4FJRA 2HTHB 2HU1A 3MGWA 1C6FA 1W1DA 3G9WA 1GXXA 1U5DA 5LOPB 4E3UA 1TLAA 1XSFA 1C6MA 151LA 1L47A 1TDYA 2QKMA 194LA 2RVBB 1WQOA 3A8QA 3LN2A 4EKQA 4HV1A 4TSBA 4H9BA 192LA 5DHFB 1B55A 1CTWA 3TMUA 1LZNA 4C5FA 2F32A 1B7NA 2B72A 226LA 3HT8A 1LMNA 2A7FA 4LT1A 5DN5A 3QE8A 5LVJA 4R6CA 1C6PA 4GBRB 5L81A 1G0MA 4LDLA 1G0LA 1JKCA 1PQIA 1L22A 1KIQC 111LA 3CDVA 4I7PA 1LYSA 3ATOA 1YAQA 2ZILA 2V76A 1C6DA 1GBSA 4WM6A 5LINA 3W6BA 1UEFA 1JJ3A 5LYZA 1LYGA 1CU0A 2FJLA 3RCPA 3HTGA 1QT4A 191LA 3TW1A 1HEPA 115LA 5C6JA 1PZYA 161LA 3HT7A 1EQ5A 4ZEEA 2D6BA 4WM2A 5DH9B 4GCCA 1GD6A 3CT5A 1FHXA 1P5CA 2MFQA 2BQDA 175LA 1GB9A 243LA 5DL9A 1SX7A 5JHHA 3HK0A 262LA 2DQDY 2O7AA 1L96A 1L01A 1C61A 1G7LC 3B0IA 235LA 3D8DA 5KXYA 2BLXA 1C7PA 1G7IC 5KXXA 1L13A 3AGGG 2YBHA 3N9CA 4OOTA 4XJDA 1B5WA 3N9AA 1LZ4A 1UBZA 4KXIA 242LA 221LA 118LA 171LA 1X11A 1SSWA 1LAAA 1L54A 5HQ1A 3ZVRA 3DN0A 4R0FA 229LA 4N9RA 1L81A 4Y94A 1WQMA 1OUBA 232LA 2D4KA 2Q0MX 3GUIA 4G49A 1GFKA 4ZRKA 5FSTA 1OUCA 1J19A 1C10A 1M7RA 2DLWA 1LZTA 4LYOA 2BQHA 5HNLA 4HJVA 4DQJA 8LYZA 3FADA 1L35A 104LA 3ODXA 3WULA 1DI4A 4LYTA 1NWGA 2BQGA 4CFOA 1L74A 1L25A 238LA 4Z98A 4YXAC 2YVCA 4WL6A 2K00A 4YL8A 4CYEA 1JJ0A 2IFFY 2D9VA 2Z6BA 3DN2A 4GN3A 2OTZX 4GCEA 2Z0PA 2RB2X 3CT1A 3KRXA 1GE1A 1VDTA 2WARA 4AGAA 2OU9A 3GUMA 1KS3A 2RSCA 1FKVA 3AGIA 4LFPA 3WYHA 1V7SA 5FELA 1G1VA 1T6VL 1CV1A 4D0NB 2B73A 1B7RA 3A67Y 1LKRA 4NSJA 3B0OA 224LA 1L14A 1GF8A 137LA 4ZRIA 4NY5A 1BB5A 2D9XA 1LJ4A 1UICA 2OEAX 3AGHA 2PC2A 2RSGA 1BB3A 1IVMA 2DQFC 2RLOA 1LZBA 4OW1A 3AU4A 1ZYTA 2LYMA 2B6ZA 4YF2A 1ZVHL 2YS3A 3TMWA 1B7PA 1LPIA 1ZV5L 2LYDA 1PQMA 2GJYA 108LA 4B49A 1QTDA 5KXRA 1VAUA 5DM9A 215LA 4DC4A 1LJNA 2F4AA 4ETBA 5KXZA 1OV5A 197LA 2IFSA 2FBBA 1OUDA 1UIHA 2MEBA 3UONA 4B4EA 3LZMA 5DHAB 1XGPC 2YF0A 4HB3B 1LZ5A 228LA 1LSMA 4OWAA 1LZDA 3HWLA 1EAZA 1JTMA 4M6DA 3AU5A 187LA 3TXHA 4NSWA 4G4HA 2J59M 1GF5A 1X1FA 1IWWA 156LA 1PMSA 2MEAA 1HEWA 1LZYA 3CB7A 3DXDA 5HE0A 2ROVA 2DQAA 2AL6A 1LYEA 1L23A 1C6GA 3P68A 2COCA 3P6AA 2FBDA 1C65A 213LA 1E8LA 3P4ZA 2ZNXY 1HC0A 1L62A 1CJ7A 4GRVA 5FI1A 234LA 4HHVA 3SV1A 1WGUA 4GZUA 1L90A 3RZ4A 3T06A 2J0MA 3HW2B 3HBHA 1IWUA 5KKJA 1V5PA 4RW1A 3WA0A 1LI2A 2UZRA 1L44A 1TAYA 5LVIA 1HHLA 163LA 4GN1A 167LA 1L21A 1UPRA 5DN4A 1QC6A 4TX7A 2RAYX 5LYMA 2J0JA 2LYZA 109LA 1L03A 1BB6A 1U5EA 5DI9B 5M1YA 225LA 4NGKA 4EPIA 3JR6A 177LA 4K81A 4I7NA 2EQLA 1LZ1A 1QTVA 3D9AC 4TSCA 1IP3A 3NY9A 1FKQA 4WM3A 1REYA 4W94A 3VIAA 4OWHA 4NHPA 120LA 5I14A 1L04A 1UA6Y 4WJ7A 2CUUA 3ATNA 2D2QA 3A8ZA 1LYYA 1SSYA 3FI5A 1AM7A 3A93A 2HUMA 5L9JA 1XKEA 1CKGA 2HULA 1P46A 1D6QA 3SUZA 2OE7X 4BADA 3WU7A 4A6HA 3IJUA 2VRWB 253LA 1TEWA 2N5ZA 1YANA 1DYDA 3W3EA 2BQEA 3SB8A 2OE4X 1HNLA 1L61A 1UIAA 1FDLY 4NFVA 4OWEA 2AUBA 4H90A 1OQMA 2GV0A 125LA 5KXLA 4HB2B 4H9IA 4NEBA 1L51A 2RUKB 2K2UA 1L97A 1Y5OA 4UWVA 2BAAA 3V5WA 1YL0X 129LA 1DYFA 3FI7A 4U3XB 1LGWA 4GLVA 4YEMA 1C62A 1L38A 1LZRA 1FB8A 1UNPA 2N0YA 1D2WA 169LA 1KZ7A 2ROZB 144LA 1LJJA 4J0LA 5HE2A 5KQ1A 1D3MA 181LA 3EMLA 4ARMB 1FHWA 1L26A 5C6LA 133LA 176LA 5K7OA 1KXXA 1FOEA 3P66A 1T97A 1LJKA 1BB4A 4DD3A 5FHWA 2FYCA 2D11A 3DMZA 145LA 1XGTC 4H9AA 1NDMC 1L12A 1L33A 2YS5A 4OWBA 1LYJA 2ZQ3A 4NGLA 4DD7A 1LYOA 4QDNA 5CLLB 1L40A 1L94A 5LXWA 2IYBA 3TXIA 1L49A 1ZVRA 1YIKA 216LA 1ZM0A 1OP9B 149LA 257LA 4NSGA 2H5ZA 1EPYA 4G4BA 1UPQA 1C66A 3BINA 4GCBA 1AZFA 5D3YA 185LA 4XWXA 1QUOA 4WM1A 1HSXA 2W2XD 2B75A 1XEPA 2VB1A 5EBHA 102LA 4P2EA 3NSUA 1L66A 3WVYA 5APFA 4H8ZA 1NBZC 4KL7A 3AW7A 1AWEA 3TXGA 2Y7BA 5I4WA 4ETEA 3RT5X 1JTPL 3DMXA 4II8A 3WL2A 5C6IA 172LA 5B05A 4ZPUA 4XJIA 1U27A 1NQIA 4A6KA 4WLDA 1FAOA 1GFVA 1UIGA 1C43A 1GB0A 2X0AA 4PRUA 1L11A 3E3DA 1I20A 1GB6A 1T3PA 3IJVA 2YT1A 4H93A 1CJ6A 3ZDTA 3GUKA 1DDWA 1Y19B 3W6EA 5F14A 4HP0A 2PZ1A 4YEOA 1LSZA 2MEDA 1IRSA 1L43A 2YBJA 1FLWA 5ILFA 164LA 1JHLA 3EXDA 3HH3A 3A96A 4X3BA 1KW5A 4DQ5A 3B6LA 1Z87A 2P0FA 1ZMYL 3WMKA 3EMSA 4I7TA 3W6DA 1L0JA 2ELAA 5D3XA 1L18A 1OVKA 2Q13A 4WMGA 3AZ4A 2LZTA 4YXCA 1G7MC 4H9CA 1WQPA 3OANA 2EKSC 237LA 256LA 4TWSA 3RUNA 4EXMA 1JKBA 200LA 2Y8PA 1DPWA 1QQYA 4NSHA 4EOFA 4ZIXA 1OWYA 3ZVQA 1V61A 186LA 1QUGA 5B06A 1CJ9A 5C5BA 1CKDA 2J0KA 1QUSA 1L73A 1SQ2L 2DQCY 3PBLA 1I1ZA 3ULCA 1JTOL 3PSCA 1IY4A 1PLSA 1G0KA 1L10A 2HEAA 2D9WA 1L16A 1I2HA 1GB3A 1LMQA 209LA 211LA 3A90A 3WPKA 2B6WA 1GXV2 3T6UA 2HTXA 1L29A 3AZ7A 3HTBA 1L89A 1MPHA 1L75A 1C64A 1K5GB 1UCOA 1LYDA 1CKHA 1I7AA 1C08C 2LZMA 4NGYA 5APEA 1F6SA 4LDOA 1IY3A 3U8ZA 4HDQA 2RGNB 1L60A 1SGHA 2MKRA 1YKXX 4ARQB 5E4PA 1HEOA 2W1XA 1XX0A 2HE7A 2BQKA 2YS1A 3P65A 1NTYA 3HUKA 123LA 143LA 1MLCE 2LKOA 2MEHA 2YBLA 1LJFA 1IWXA 3G3VA 5A3EA 178LA 4Z2NA 1XEKA 3FA0A 1W1GA 4EMOA 1SWZA 1IX0A 3HH4A 4XJGA 2ZIJA 2CRFA 5JENB 1GF7A 1J0WA 1PQKA 2OTYX 3C8RA 1WQRA 1P6SA 2Q9EA 4NHSA 3VOQA 157LA 1KIRC 201LA 2RBPA 2W1YA 5FI0A 1UC0A 240LA 1HFZA 160LA 1L93A 1LLHA 1BTNA 1P3RA 2LOXA 4QY9A 3SB6A 4NIJA 1TQZA 1L57A 1LZCA 1B5XA 5I4YA 2Z0OA 3GXRA 1LZSA 1SHCA 4XYYA 4UWNA 3HT6A 3B72A 3AB6A 1GE2A 1YAMA 223LA 4F7GA 3NYAA 1D9WA 1LYZA 4HPEA 5LVGA 4Z41A 1MIXA 1L34A 4WLYA 1XGRC 2ZWBA 3C83A 1WQQA 4W53A 2NWDX 1NDGC 3LZ2A 3K3TA 4KT3A 1NU2A 2CY5A 3D3DA 3HDFA 2W2XC 1J1PY 1L31A 7LYZA 1DYGA 1W08A 158LA 1N4FA 4I7OA 113LA 1P5TA 2Z2FA 2MEEA 1IO5A 1YKYX 1OQNA 1MK7B 3WYFB 1GB8A 1UNRA 1LHMA 3PVWA 2EIZC 227LA 4J7VA 2F4GA 1GBOA 4HTQA 1D6PA 3A6CY 3SN6R 4PQ0A 1B7OA 2Z37A 3LYZA 2Z18A 4ET9A 2W1LA 4LZTA 2ELBA 1H10A 3TO1A 1GBWA 1YAPA 1T6HA 168LA 1L71A 1W1HA 1KI1B 1P3NA 5LONB 2LG1A 3MDBC 3GUJA 1AT6A 4HV2A 2H9KA 2DX5A 4DWXA 4XJFA 4G4CA 1UNQA 2BQLA 3CT0A 4GCDA 4A7DA 4HTNA 1UIBA 1G7HC 2F47A 2MECA 4WLTA 1IP2A 5KKIA 5HE1A 2DBTA 1C6NA 2W1MA 4ETCA 1OUJA 2DQGY 1LMAA 1C46A 183LA 1IOCA 1L30A 3DKEX 2YBMA 1P64A 2QARC 4NHIA 5B1GA 3VW7A 2EPEA 4XJHA 128LA 3HT9A 1C67A 2DHIA 1LI3A 2IGCA 1NF5A 2XTHA 1QUDA 1LTMA 4C0AA 2A4TA 1OY2A 1GFHA 3AJNA 5JLJB 2B6YA 2RNRB 3FE0A 1CV0A 4O34A 1B6IA 1HMKA 4PRQA 1SX2A 1KIPC 1XODA 4WVFB 4DXAB 114LA 1L68A 4NGOA 4BBKA 1IC5Y 4LFXA 2CAYA 4DDAA 2MDXA 3HUAA 3M1IB 1CUQA 3RW8A 2ANVA 4H9FA 3ZEKA 1XGQC 1REMA 5HNCA 4M4OA 2BQCA 4KHAA 1L28A 1IEEA 1QTCA 3WW5A 4GN4A 1GHLA 1L0KA 5APCA 1JKAA 1GBZA 4DAJA 2D9YA 4LT3A 3V2YA 5L3IA 1DI3A 1LSBA 1LYHA 1L76A 3J6KA 220LA 5E9RA 132LA 4A6FB 1QQGA 1BWNA 1L86A 2EMTA 2YBIA 1IP7A 1G0JA 4ZRJA 2HECA 1QT7A 1DROA 3C7YA 1L91A 4WM4A 1AKIA 3EO5A 2Z12A 1DBHA 1GG3A 1NI2A 2G4PA 2IHLA 1OUFA 1IIZA 1DQJC 1HFXA 1L42A 1GAZA 1JTTL 7LZMA 4PJ2C 3WU8A 1HERA 1ISNA 2Y8FA 1VFBC 4LDEA 3WUNA 1AQCA 1BTKA 1CU2A 3C80A 4LT2A 1LHKA 1LGUA 4W56A 3OE9A 1EGXA 1JSEA 1UUZC 3HH5A 1L84A 2BCJA 4OOOA 5DLAA 206LA 1D0MA 4Z2MB 3CSZA 4XJBA 2W2WA 3LHMA 5KXMA 4GXBA 3HU9A 130LA 2LOZA 1QTHA 250LA 4PJZA 3CDOA 4MY6A 4H9HA 162LA 3X23A 1QT8A 3OK0A 5A3ZA 3KRWA 1GFAA 3CSRA 1JIYA 2M14A 4IFSA 3SBAA 142LA 4ML7A 4LGKA 3GUPA 1F10A 2DA0A 5F9XA 1GBXA 1L85A 4DDCA 1DKJA 150LA 3G3XA 3A34A 1GC7A 5C6RA 4B4IA 2M38A 4DX8A 5JP4A 4WG7A 148LE 4NSIA 1L08A 248LA 4MR1A 1XR0B 1BWHA 1YILA 119LA 4HAWB 2ANXA 3GUNA 1IP4A 3HH6A 3ML4A 5I53A 2QKLA 3WPJA 2YSSC 1L64A 1H4RA 2DQJY 1LJ3A 4ETDA 2DHJA 3D8EA 3SNHA 1OUHA 2DFKA 4CHJA 249LA 3QNGA 2C8OA 1RFPA 4B4JA 5KXNA 4XADA 3SP3A 127LA 6LYZA 254LA 4YOPA 1MKEA 4J1BA 1LSGA 4DDBA 4Z3MA 3GULA 4GMVA 4PNKA 1JQUA 252LA 1L95A 214LA 1GFRA 1B5ZA 1T8GA 5LA5A 1J1XY 2COAA 2D4JA 5KJ9A 1BAKA 1C6LA 4BAPA 184LA 4NGZA 2R09A 1IOQA 2XBSA 1IWTA 135LA 1C6EA 1L27A 3F9LA 4XN6A 1DYEA 3HU8A 3QBVB 1L87A 2ZQ4A 1LWGA 131LA 4MK0A 3PDSA 1LW9A 2RBSA 1RJCB 1P37A 1QUHA 4H9EA 4MCKA 6LYTA 4GLAA 4HB0B 4GMXB 2RB0X 4PHIA 4UWUA 4TTDA 1GEVA 1LZ9A 2B6XA 2OQBA 4K5YA 212LA 3CIKA 1WVHA 3TXBA 2HU3A 2YBNA 4I7LA 4H8SA 5HMJA 2NMBA 1M7EA 1EQEA 1L00A 4LT0A 4LZMA 2G35A 3TXDA 1XJUA 4S0WA 1LZGA 2MEIA 1KXWA 4PGJB 1B7LA 1IWYA 3U7DA 3IWRA 3DN3A 4NHQA 198LA 3KY9A 5KXTA 1JTNA 1I56A 3PG7A 2YDGA 1ALCA 5J3TA 2OTXA 3WH1A 2KGXB 5D3VA 1B5VA 1D0KA 2DHKA 5JHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KY1 A;  1L75 A;  1BTK A;  1C64 A;  1K5G B;  1C6Q A;  4EKR A;  1C69 A;  3D8F A;  1L74 A;  1L25 A;  1LYD A;  107L A;  1I7A A;  1CVK A;  2LZM A;  195L A;  238L A;  2RAZ X;  4LDO A;  4YXA C;  3U8Z A;  2I1K A;  2RGN B;  1L60 A;  1L63 A;  1SGH A;  1KNI A;  2RBR A;  2YVC A;  4HDQ A;  1EF1 A;  2MKR A;  1C6I A;  2K00 A;  4YL8 A;  4CYE A;  2D9Z A;  4ARQ B;  2D9V A;  1C6B A;  2Z6B A;  1PFJ A;  2RBQ A;  3DN2 A;  247L A;  2OTZ X;  4I7Q A;  1XX0 A;  2YS1 A;  2HE7 A;  1C63 A;  1NTY A;  2Z0P A;  3HUK A;  1DYN A;  123L A;  143L A;  1CU6 A;  2RB2 X;  3OE6 A;  2LKO A;  4W52 A;  1G0P A;  4EKS A;  3KRX A;  2OU9 A;  1QSQ A;  3GUM A;  1KS3 A;  3G3V A;  139L A;  205L A;  178L A;  1L15 A;  4Z2N A;  3FA0 A;  1T8F A;  1G1V A;  1W1G A;  2YRY A;  3MPX A;  4EMO A;  5J3Q A;  1I6S A;  1C6J A;  230L A;  1SWZ A;  4I7S A;  3HH4 A;  3SBB C;  1TXD A;  2CRF A;  2L2I A;  3F0W A;  1J0W A;  1CV1 A;  4D0N B;  2B73 A;  1PQK A;  2RBO A;  2O4W A;  2OTY X;  3C8R A;  1G06 A;  4L6E A;  1L69 A;  1L53 A;  1WG7 A;  224L A;  1P6S A;  1L14 A;  4ARP A;  2Q9E A;  4MT7 A;  5HE3 A;  157L A;  137L A;  188L A;  4ZRI A;  1L92 A;  201L A;  3VOQ A;  2B7X A;  2RBP A;  2D9X A;  2AEH A;  5FI0 A;  3ULB A;  240L A;  2KUP A;  4IAP A;  2OEA X;  1C6T A;  2Q9D A;  2D10 A;  3HUQ A;  2RSG A;  160L A;  2DYQ A;  1L93 A;  2DYN A;  2RLO A;  3GYP A;  1FGZ A;  3DN4 A;  3AU4 A;  1ZYT A;  1QS5 A;  126L A;  1LLH A;  2B6Z A;  1C6A A;  2L78 A;  1BTN A;  1P3R A;  2LOX A;  3SB6 A;  1L88 A;  1TQZ A;  4EKP A;  1L57 A;  2UZS A;  2YS3 A;  5KCV A;  4DX9 0;  2Z0O A;  4F7H A;  4F7U P;  2DTC A;  1SHC A;  2LYD A;  1LGX A;  1PQM A;  3HT6 A;  3DN8 A;  1MIZ B;  2O79 A;  2GJY A;  108L A;  4CHM A;  4YX7 C;  2NTH A;  4EKU A;  223L A;  5J3Y A;  4DBB A;  4F7G A;  1QTD A;  1L37 A;  3NYA A;  215L A;  1D9W A;  3DXC A;  1WI1 A;  1MIX A;  2I1J A;  2X18 A;  1L34 A;  1L19 A;  1OV5 A;  1D3J A;  1L02 A;  3C83 A;  4HAY B;  197L A;  174L A;  4W53 A;  2IFS A;  3F8V A;  5C5B B;  1KY0 A;  1OV7 A;  1Q67 A;  2EJ8 A;  1P2L A;  4I7K A;  1NU2 A;  3UON A;  2CY5 A;  2QB0 B;  1L80 A;  245L A;  217L A;  3HDF A;  3L64 A;  3C7Z A;  2W2X C;  5KQ4 A;  1L31 A;  3LZM A;  4W57 A;  6LZM A;  3QIJ A;  1C68 A;  5DHA B;  2K2J A;  2YF0 A;  1DYG A;  4HB3 B;  228L A;  3DMV A;  3TFM A;  4DJH A;  3C7W A;  196L A;  1LYI A;  3HWL A;  1EAZ A;  158L A;  1JTM A;  1L06 A;  1L99 A;  1WGQ A;  3A98 B;  1L09 A;  4I7O A;  113L A;  1RJ2 A;  165L A;  1P5T A;  187L A;  3AU5 A;  4NSW A;  1L41 A;  1OQN A;  2J59 M;  1MK7 B;  2OU8 A;  1X1F A;  2P0D A;  3WYF B;  1KW7 A;  199L A;  1UNR A;  3PVW A;  2P0H A;  156L A;  180L A;  1PMS A;  4HAZ B;  2GS0 A;  140L A;  227L A;  3FSS A;  4A6F A;  4B6H A;  3DXD A;  5HE0 A;  231L A;  2ROV A;  5LZM A;  2AL6 A;  1LYE A;  1L23 A;  1C6G A;  2RB1 X;  2COC A;  3P6A A;  3OE8 A;  1C65 A;  213L A;  1L58 A;  4P7I A;  122L A;  1L50 A;  3SN6 R;  4PQ0 A;  1L05 A;  2D4Q A;  1E5W A;  1DDM A;  3TCA A;  1L32 A;  103L A;  5DIF B;  1L62 A;  2VSZ A;  2E2X A;  112L A;  4GRV A;  5FI1 A;  234L A;  4I7M A;  4HHV A;  3SV1 A;  2ELB A;  173L A;  1H10 A;  1L56 A;  219L A;  1WGU A;  4GZU A;  3TO1 A;  1L90 A;  1T6H A;  251L A;  2HUK A;  168L A;  2B6T A;  1P56 A;  3T06 A;  155L A;  1X1G A;  1L71 A;  1EVH A;  1W1H A;  1KI1 B;  1P3N A;  3DN6 A;  2J0M A;  3HW2 B;  1LWK A;  4HAT B;  1QTB A;  1V5P A;  4IOY X;  5LON B;  3SB9 A;  4K17 A;  2LG1 A;  3WA0 A;  3MDB C;  3GUJ A;  3SB7 A;  1ZWN A;  1LI2 A;  4ARM A;  1L44 A;  2UZR A;  2DX5 A;  1L79 A;  2LUL A;  1QSB A;  1UNQ A;  2MWN B;  163L A;  4GN1 A;  1P7S A;  3QAK A;  1L36 A;  2ADZ A;  2KCJ A;  4ARL A;  4I7J A;  1L17 A;  2RH1 A;  167L A;  1K5D B;  3KZ1 A;  1L21 A;  1UPR A;  5D27 A;  2F47 A;  1QC6 A;  3D4S A;  170L A;  236L A;  2RAY X;  2Z0Q A;  5HE1 A;  1QTZ A;  3FEH A;  1C6N A;  1NHB A;  4KHO A;  1CX6 A;  3L2X A;  4NY0 A;  2J0J A;  147L A;  2Y8G A;  109L A;  1L03 A;  2DN6 A;  5DI9 B;  1U5E A;  2RBN A;  225L A;  4EPI A;  3JR6 A;  177L A;  3HQC A;  1PQJ A;  1U2B A;  1X86 A;  4K81 A;  1MK9 B;  4I7N A;  5CLQ B;  1G0G A;  183L A;  1L30 A;  3DKE X;  1QTV A;  1T8A A;  1CUP A;  3NY9 A;  2EMS A;  1P64 A;  1PQO A;  2QAR C;  5C16 A;  3VIA A;  2ZPY A;  3VW7 A;  1KZG A;  3C81 A;  1L45 A;  5C79 A;  1ZSQ A;  3CXB B;  3PP2 A;  128L A;  258L A;  4W54 A;  120L A;  1V5M A;  1X05 A;  159L A;  2LCB A;  1L72 A;  3HT9 A;  1C67 A;  3HTD A;  5I14 A;  2DHI A;  1LI3 A;  1GC6 A;  1L04 A;  1L55 A;  2IGC A;  4WJ7 A;  1QUD A;  4C0A A;  2A4T A;  1OY2 A;  2CUU A;  2N23 A;  5JLJ B;  4TKN A;  2D2Q A;  2B6Y A;  1XCG A;  1D3F A;  2RNR B;  146L A;  4K2P A;  1MAI A;  1SSY A;  3FI5 A;  1CV0 A;  110L A;  3N7C A;  2HUM A;  1XKE A;  1B6I A;  2HUL A;  1SX2 A;  1XOD A;  239L A;  1P46 A;  3C82 A;  4E97 A;  2GCJ A;  4WVF B;  4DXA B;  114L A;  3SUZ A;  1V88 A;  2OE7 X;  2COD A;  1CX7 A;  2JP2 A;  4A6H A;  1L68 A;  3ODW A;  2VRW B;  2COF A;  4BBK A;  253L A;  4DKL A;  3K2R A;  3CDR A;  1U29 A;  1G0Q A;  1DYD A;  1FGY A;  2CAY A;  4W58 A;  3SB8 A;  2MDX A;  2OE4 X;  1SWY A;  3HUA A;  1L61 A;  3SO6 A;  2OU0 X;  3M1I B;  1L67 A;  246L A;  1CUQ A;  2L1C A;  138L A;  4W51 A;  1LI6 A;  3AJ4 A;  166L A;  1ZC3 B;  3F5R A;  4K2O A;  5D3W A;  1L46 A;  2ANV A;  1U5G A;  125L A;  2YT0 A;  4KHA A;  1OWZ A;  1DYC A;  1L28 A;  1QTC A;  4HB2 B;  1L51 A;  1L0K A;  1QS9 A;  2I5F A;  3PZD A;  2RUK B;  2K2U A;  3UZT A;  1L97 A;  4DAJ A;  241L A;  1Y5O A;  2D9Y A;  3O96 A;  3V2Y A;  1LB1 A;  4EJ4 A;  1LYH A;  1C6H A;  1L76 A;  1QT3 A;  4KAX B;  3V5W A;  4W55 A;  220L A;  129L A;  4A6F B;  1QQG A;  1D2Y A;  1DYF A;  1BWN A;  1L86 A;  1LGW A;  1LYF A;  1C60 A;  2EMT A;  1G0J A;  4ZRJ A;  3OE0 A;  1C62 A;  1L38 A;  3FM8 C;  2CY4 A;  2EC1 A;  2YSZ A;  1FB8 A;  1QT7 A;  1UNP A;  1XJT A;  2B74 A;  1DRO A;  182L A;  2N0Y A;  3C7Y A;  4KVG B;  1D2W A;  1L91 A;  2DKP A;  1QT6 A;  3RZE A;  1V89 A;  2H7D A;  169L A;  1CV4 A;  2VKI A;  1DBH A;  1GG3 A;  1KZ7 A;  1NI2 A;  260L A;  2ROZ B;  1L42 A;  3A8P A;  1LPY A;  144L A;  3C8S A;  2DKQ A;  7LZM A;  1L07 A;  3IVF A;  1RRP B;  3QWM A;  5HE2 A;  5KQ1 A;  1ISN A;  1WJM A;  2Y8F A;  4LDE A;  3TVV A;  3DN1 A;  2UVM A;  210L A;  1AQC A;  1CU2 A;  1D3M A;  181L A;  3DNA A;  3C80 A;  3EML A;  4ARM B;  1L26 A;  255L A;  152L A;  1FHW A;  1LGU A;  1QT5 A;  4W56 A;  3OE9 A;  1EGX A;  4HDO A;  4EJN A;  1L39 A;  176L A;  222L A;  1FOE A;  1T97 A;  3HH5 A;  1L84 A;  2BCJ A;  1L65 A;  3CDT A;  1OMW A;  206L A;  4HAV B;  2D11 A;  4Z2M B;  3GYO A;  3KSY A;  1L24 A;  4HAX B;  3DMZ A;  2W2W A;  1L83 A;  145L A;  4ARJ A;  3PVL A;  1OVH A;  4OO9 A;  1C6K A;  2HTH B;  3CDQ A;  3HU9 A;  4GXB A;  130L A;  1L52 A;  4W59 A;  1P2R A;  3SYX A;  1L12 A;  1L33 A;  2LOZ A;  2YS5 A;  190L A;  1C6F A;  1LYJ A;  1W1D A;  1OVJ A;  1QTH A;  3G9W A;  5EFX A;  4EPF A;  1U5D A;  250L A;  4AQN A;  1U5F A;  5LOP B;  1ZUR A;  4PJZ A;  3CDO A;  4MY6 A;  1TLA A;  5CLL B;  1C6M A;  162L A;  1L40 A;  151L A;  1L47 A;  1L94 A;  3C8Q A;  218L A;  2IYB A;  3X23 A;  1L49 A;  4HB4 B;  1ZVR A;  1FHO A;  1QT8 A;  3KRW A;  2QKM A;  2M14 A;  4IFS A;  3SBA A;  142L A;  216L A;  2RVB B;  1ZM0 A;  3A8Q A;  4EKQ A;  3G3W A;  2F2Q A;  149L A;  3GUP A;  257L A;  2DA0 A;  192L A;  5DHF B;  1CU5 A;  1L85 A;  3ODU A;  1B55 A;  1CTW A;  2LC9 A;  1EPY A;  1DYA A;  1UPQ A;  1C66 A;  2F32 A;  3SB5 A;  150L A;  3G3X A;  2B72 A;  226L A;  1L77 A;  1L48 A;  1GC7 A;  2OE9 X;  5C6R A;  2M38 A;  3BIN A;  4DX8 A;  5JP4 A;  148L E;  3HT8 A;  5D3Y A;  185L A;  1L08 A;  1QUO A;  248L A;  4XWX A;  1XR0 B;  1L59 A;  1C6P A;  1OYU A;  2W2X D;  4GBR B;  5L81 A;  1G0M A;  2B75 A;  1XEP A;  119L A;  1G0L A;  2ANX A;  4LDL A;  4HAW B;  3GUN A;  102L A;  1PQI A;  1L22 A;  1D3N A;  1L66 A;  3HH6 A;  111L A;  3CDV A;  261L A;  3ML4 A;  3NSU A;  4A5K A;  2QKL A;  2R0D A;  4I7P A;  1G1W A;  1L64 A;  4ARQ A;  2P8V A;  1H4R A;  1P6Y A;  2V76 A;  1C6D A;  2DHJ A;  2NZ8 B;  3D8E A;  2GCL A;  1UEF A;  1K28 A;  1AWE A;  1L98 A;  3LJU X;  3SNH A;  1LYG A;  1CU0 A;  2DFK A;  2FJL A;  2Y7B A;  3RCP A;  4CHJ A;  249L A;  3HTG A;  1QT4 A;  191L A;  3TW1 A;  189L A;  3DMX A;  1P36 A;  4TYZ A;  127L A;  115L A;  172L A;  1L70 A;  254L A;  1WJ1 A;  1MKE A;  4ZPU A;  3ODO A;  1U27 A;  1LW3 A;  161L A;  4A6K A;  3HT7 A;  1FAO A;  3GUL A;  4GMV A;  4PNK A;  1L11 A;  2H7E A;  1PQD A;  1JQU A;  5DH9 B;  252L A;  1L95 A;  214L A;  4PK0 A;  2YT1 A;  1T8G A;  3PEG A;  3HDE A;  2COA A;  1FHX A;  3ZDT A;  1L20 A;  1P5C A;  3GUK A;  1DDW A;  1Y19 B;  1BAK A;  2MFQ A;  175L A;  243L A;  1C6L A;  1ZC4 B;  233L A;  184L A;  141L A;  2PZ1 A;  1SX7 A;  1IRS A;  1L43 A;  5JHH A;  3HK0 A;  262L A;  2R09 A;  164L A;  2O7A A;  1L96 A;  1XD4 A;  1N3H A;  3HH3 A;  1C6E A;  1Z87 A;  1L27 A;  1KW5 A;  2P0F A;  3F9L A;  1DYE A;  1CV5 A;  1L01 A;  1C61 A;  3HU8 A;  4I7T A;  2ELA A;  1L0J A;  4WSF A;  5D3X A;  3QBV B;  1L87 A;  3BJI A;  1LWG A;  1L18 A;  1OVK A;  2B70 A;  235L A;  2Q13 A;  131L A;  4YXC A;  3D8D A;  259L A;  3NY8 A;  3PDS A;  4MK0 A;  1LW9 A;  2RBS A;  3OAN A;  1L13 A;  1P37 A;  1QUH A;  3V2W A;  237L A;  5GOW B;  4YON A;  256L A;  4HAU B;  4HB0 B;  1CV6 A;  3RUN A;  4I7R A;  2RB0 X;  4GMX B;  4EXM A;  200L A;  1DYB A;  2B6X A;  2OQB A;  4K5Y A;  212L A;  3CIK A;  1WVH A;  242L A;  3GUO A;  1OWY A;  244L A;  3DXE A;  1V61 A;  1NTV A;  1V5U A;  186L A;  2NTG A;  4I7L A;  1QUG A;  221L A;  2I5C A;  3P7Z A;  4H8S A;  4KHB B;  118L A;  2NMB A;  5C5B A;  171L A;  1X11 A;  1M7E A;  2J0K A;  1L00 A;  1L73 A;  1L54 A;  1SSW A;  4LZM A;  3DN0 A;  2G35 A;  3ZVR A;  1WTH A;  1TJ6 A;  2DX1 A;  229L A;  3PBL A;  1L81 A;  4Y94 A;  3ULC A;  1DDV A;  232L A;  1L82 A;  3PSC A;  1XJU A;  1G0K A;  4S0W A;  1PLS A;  1L10 A;  3GUI A;  1CV3 A;  2D9W A;  1L16 A;  4GPT B;  1C6C A;  1I2H A;  4ZRK A;  3U7D A;  209L A;  1J19 A;  211L A;  3DN3 A;  2KGX B;  198L A;  1M7R A;  3KY9 A;  2DLW A;  3HTF A;  1JTN A;  2B6W A;  1G07 A;  1CU3 A;  3PG7 A;  3FAD A;  1L29 A;  1L35 A;  5J3T A;  104L A;  3HTB A;  2OTX A;  3ODX A;  1L89 A;  5D3V A;  1MPH A;  3PVU A;  2DHK A;  5JHG A;  2XQN M; 
#chains in the Genus database with same CATH topology
 153L A;  1C6Q A;  4EKR A;  1C69 A;  3U12 A;  107L A;  1CVK A;  4TUN A;  4WO9 A;  1GPQ C;  1FLY A;  2I1K A;  1L63 A;  4RW2 A;  1QTK A;  5ILC A;  1UAC Y;  2D9Z A;  1C6B A;  1PFJ A;  2RBQ A;  2Z13 A;  247L A;  1GEZ A;  4I7Q A;  1CKF A;  2B5Z A;  4QGZ A;  4IAS A;  1DYN A;  1GF0 A;  3OE6 A;  4W52 A;  1G0P A;  3N9E A;  4YEN A;  4LYZ A;  1QSQ A;  1LMT A;  1JPO A;  3TXK A;  205L A;  1T8F A;  1LJH A;  1I6S A;  4I7S A;  2L2I A;  2BQB A;  1TXD A;  3OJP A;  3WUA A;  3HBD A;  2BQI A;  1GFU A;  4GN5 C;  2RBO A;  2O4W A;  3KAM A;  5B59 A;  3M3U A;  4L6E A;  1L69 A;  1L53 A;  2BLY A;  2D4I A;  1LOZ A;  1LSF A;  4ARP A;  5HE3 A;  188L A;  4WOA A;  2B7X A;  2AEH A;  4WM5 A;  1DI5 A;  1LHI A;  1YKZ X;  4IAP A;  1C6T A;  2Q9D A;  3HFM Y;  3HUQ A;  4CSQ A;  5IEL A;  1RI8 B;  3GYP A;  1FGZ A;  1GAY A;  4QEQ A;  2MEG A;  1QS5 A;  2L78 A;  2XQN M;  2UZS A;  4BS7 A;  2KIE A;  1GFE A;  4W96 A;  4CHM A;  1MIZ B;  2ZIK A;  2NTH A;  1LZ6 A;  4EKU A;  5J3Y A;  4B1A A;  1BGI A;  2ZYP A;  2I25 L;  4NGI A;  3A3Q A;  3DXC A;  2CWI A;  1WI1 A;  2DQE Y;  2X18 A;  1LCN A;  1D3J A;  1LMO A;  3F8V A;  5KXP A;  1KY0 A;  1OV7 A;  3TXE A;  5FCP A;  4I7K A;  1IOS A;  1A4V A;  2QB0 B;  245L A;  4WL7 A;  217L A;  3L64 A;  3C7Z A;  2XJW A;  5KQ4 A;  3QIJ A;  1C68 A;  2K2J A;  1FLU A;  1IWV A;  3DMV A;  3C7W A;  4N8Z A;  1F0W A;  1L06 A;  1L99 A;  4WG1 A;  3A6B Y;  5AMY A;  1GF3 A;  1HSW A;  2P0D A;  1B7M A;  1HFY A;  1GWD A;  2P0H A;  3RU5 A;  3CSQ A;  140L A;  3J4G A;  4B6H A;  1FN5 A;  5LZM A;  1FBI X;  4BAF A;  4CGE A;  1JUG A;  1WVV A;  154L A;  1QDT A;  1L58 A;  1DDM A;  1L50 A;  2FYD A;  5DIF B;  2E2X A;  1OUI A;  4I7M A;  4DD2 A;  173L A;  219L A;  5HLL A;  4HAT B;  1EVH A;  3DN6 A;  1ZVY B;  4ARM A;  1MI1 A;  1H6M A;  208L A;  1UIF A;  5LVK A;  1B9O A;  4LYB A;  2MWN B;  4WO6 A;  1P7S A;  1L36 A;  1XEI A;  2KCJ A;  3AZ5 A;  1L17 A;  1LHH A;  4MST A;  170L A;  1GDW A;  236L A;  2Z0Q A;  2LYO A;  1A2Y C;  1QTZ A;  1NHB A;  3B0K A;  147L A;  1REX A;  3W6A A;  2DN6 A;  3HQC A;  1X86 A;  1W6Z A;  1MK9 B;  1J1O Y;  1BHZ A;  1CUP A;  1NKH A;  1QSW A;  2EMS A;  1PQO A;  1GE0 A;  4YM8 A;  1GF9 A;  5M4Y B;  2CGI A;  3C81 A;  4IJ4 A;  5C79 A;  1ZSQ A;  1F6R A;  3PP2 A;  4W54 A;  1V5M A;  159L A;  2DQH Y;  1L72 A;  2LCB A;  4J1A A;  2BQA A;  3TXJ A;  1BB7 A;  1VDP A;  4HTK A;  1XCG A;  1D3F A;  146L A;  2KR0 A;  4K2P A;  1IC4 Y;  3N7C A;  1B5Y A;  4N1E I;  239L A;  1OUG A;  3C82 A;  4E97 A;  2GCJ A;  5D5F A;  1V88 A;  2COD A;  4DKL A;  1U29 A;  3CDR A;  1FGY A;  1RE2 A;  3AYQ A;  1KXY A;  2OU0 X;  1L67 A;  2Z19 A;  2L1C A;  138L A;  3F5R A;  1LI6 A;  166L A;  1ZC3 B;  2XQO A;  4K2O A;  1OWZ A;  2G4Q A;  1DYC A;  1QS9 A;  1GB5 A;  3PZD A;  2BQF A;  2A7D A;  241L A;  1LB1 A;  1C6H A;  1QT3 A;  5B1F A;  3A94 A;  1D2Y A;  1IR8 A;  4I0C A;  1BWJ A;  3OE0 A;  2EC1 A;  1XJT A;  2B74 A;  2HUB A;  1VDS A;  3G3B B;  2ZYC A;  2DKP A;  3RZE A;  1EL1 A;  2HEB A;  1LSN A;  1V7T A;  1LPY A;  3C8S A;  5LIO A;  1L07 A;  1RRP B;  5F16 A;  3QWM A;  1IP5 A;  1JKD A;  3W6C A;  1WJM A;  3TVV A;  2XBR A;  3DN1 A;  2UVM A;  210L A;  255L A;  4H94 A;  1QT5 A;  4L1R A;  4LYC A;  1L39 A;  4EJN A;  4H8Y A;  1OUE A;  2I26 L;  2NBV A;  1OMW A;  1LZ8 A;  1TCY A;  4N5R A;  3GYO A;  3TMV A;  3KSY A;  4FDY A;  4HAX B;  3PVL A;  4ARJ A;  1OVH A;  4OO9 A;  1C6K A;  3CDQ A;  1L52 A;  4W59 A;  1P2R A;  3SYX A;  190L A;  1OVJ A;  1IOR A;  5EFX A;  1REZ A;  4EPF A;  2CJL A;  4AQN A;  1U5F A;  1ZUR A;  3WU9 A;  3AW6 A;  1D9U A;  2KUQ A;  3C8Q A;  218L A;  1LSC A;  4HB4 B;  1FHO A;  1MEL L;  3G3W A;  2F2Q A;  1LZA A;  5FEK A;  1CU5 A;  3ODU A;  2LC9 A;  5B07 A;  1DYA A;  3SB5 A;  1LKS A;  1RCM A;  1L77 A;  1L48 A;  1LJI A;  1EQ4 A;  2OE9 X;  1L59 A;  1OYU A;  1BWI A;  1NMM A;  3A3R X;  2HED A;  1D3N A;  4A5K A;  261L A;  4NHT A;  5KXW A;  2R0D A;  4ETA A;  1G1W A;  5II3 A;  4ARQ A;  2P8V A;  1P6Y A;  2NZ8 B;  4EMN A;  2GCL A;  1K28 A;  1L98 A;  3LJU X;  1LMC A;  4H8X A;  3BKH A;  2DKV A;  189L A;  3HBE X;  1JEF A;  1P36 A;  4TYZ A;  1L70 A;  3LYM A;  1WJ1 A;  1HEQ A;  3ODO A;  3ULR A;  1LW3 A;  1QDR A;  2F30 A;  1HEL A;  2H7E A;  1PQD A;  4PK0 A;  3PEG A;  1DKK A;  207L A;  3HDE A;  1L20 A;  1INU A;  4CFP A;  1VED A;  1ZC4 B;  233L A;  4XEN A;  141L A;  2CDS A;  4PPO A;  3TMX A;  1XD4 A;  1N3H A;  3WVX A;  1IC7 Y;  2C8P A;  1CV5 A;  1QTE A;  3BKV A;  4WSF A;  4N0J A;  3BJI A;  3WXU A;  2B70 A;  259L A;  3NY8 A;  3V2W A;  5GOW B;  1IP1 A;  4YON A;  4HAU B;  1CV6 A;  4I7R A;  4DQ7 A;  4C3W A;  1DYB A;  3GUO A;  3RNX A;  244L A;  3DXE A;  134L A;  1NTV A;  1V5U A;  1G7J C;  2H9J A;  2NTG A;  3P7Z A;  2I5C A;  4KHB B;  1GB2 A;  1LSE A;  1GF6 A;  3GXK A;  1WTH A;  1TJ6 A;  2DX1 A;  1QUT A;  3G3A B;  4RLM A;  3A92 A;  4HJZ A;  1DDV A;  1L82 A;  5IHG A;  1C45 A;  1P2C C;  1CV3 A;  4GPT B;  1C6C A;  1IP6 A;  4N1C C;  1XGU C;  2Z38 A;  3HTF A;  1HEN A;  1G07 A;  1CU3 A;  4L41 A;  5I5Q A;  1JWR A;  3PVU A;  4H91 A;  4H1P A;  1KY1 A;  4AXT A;  4WLX A;  4NWE A;  3D8F A;  195L A;  2RAZ X;  3T36 A;  1KNI A;  2RBR A;  3HIE A;  1EF1 A;  5KXK A;  1C6I A;  4LYM A;  1C63 A;  1CU6 A;  1B7S A;  2F2N A;  4EKS A;  4ET8 A;  4NWH A;  139L A;  1L15 A;  5LVH A;  1DXJ A;  2YRY A;  3MPX A;  5J3Q A;  230L A;  1C6J A;  3SBB C;  3F0W A;  1UID A;  1Z55 A;  1LJE A;  1JIT A;  2LHM A;  1GF4 A;  1G06 A;  1WG7 A;  2FJU B;  4MT7 A;  1LZE A;  1L92 A;  1BVX A;  3ULB A;  2KUP A;  2D10 A;  1XFP L;  1QIO A;  2DYQ A;  2DYN A;  2I6Z A;  2MEF A;  3DN4 A;  5LA8 A;  126L A;  3F6Z A;  1C6A A;  1CJ8 A;  1L88 A;  4EKP A;  5KCV A;  4DX9 0;  4F7H A;  4F7U P;  4NG1 A;  2DTC A;  1GB7 A;  1LGX A;  3WXT A;  3DN8 A;  2O79 A;  4YX7 C;  4DBB A;  4OWC A;  1L37 A;  5IDD A;  1GE4 A;  3M18 B;  4HSF A;  3ZVQ B;  4G9S A;  2I1J A;  1B2K A;  1L19 A;  1B0D A;  1L02 A;  4HAY B;  174L A;  5C5B B;  5I4X A;  4DD1 A;  1Q67 A;  2BQN A;  2EJ8 A;  5T3F A;  1P2L A;  1L80 A;  3QY4 A;  3AZ6 A;  1QSA A;  3P64 A;  4W57 A;  6LZM A;  1HF4 A;  4DYG A;  3TFM A;  4DJH A;  3A95 A;  2BPU A;  196L A;  1LYI A;  2G4N A;  1WGQ A;  3A98 B;  1L09 A;  1RJ2 A;  165L A;  1L41 A;  1GBY A;  5L3H A;  1BVK C;  2OU8 A;  5KXS A;  1JJ1 A;  2HEE A;  1KW7 A;  199L A;  180L A;  4HAZ B;  2LZ2 A;  4IAT A;  4CHX A;  3WW6 A;  2GS0 A;  3FSS A;  4A6F A;  231L A;  4DT3 A;  1OUA A;  1BQL Y;  2Z2E A;  2RB1 X;  3OE8 A;  3LYO A;  4P7I A;  122L A;  1L05 A;  2D4Q A;  1E5W A;  3TCA A;  1L32 A;  103L A;  3WUM A;  2VSZ A;  112L A;  1GFT A;  1DZB X;  1L56 A;  5KY1 A;  1CKC A;  2HUK A;  251L A;  2B6T A;  3FVC A;  1JIS A;  1P56 A;  155L A;  1X1G A;  1LHL A;  4NGJ A;  1YAO A;  1LWK A;  3EBA B;  1QTB A;  4IOY X;  3SB9 A;  4K17 A;  1XEJ A;  3SB7 A;  1ZWN A;  5J7C A;  1VAT A;  1L79 A;  2LUL A;  1QSB A;  4Z46 A;  3QAK A;  2ADZ A;  4ARL A;  1GFG A;  4D6W A;  4I7J A;  2RH1 A;  2BQM A;  1K5D B;  3KZ1 A;  5D27 A;  5KXO A;  3D4S A;  1LHJ A;  1WTM A;  4ANR A;  1HML A;  1NHE A;  3FEH A;  4KHO A;  1CX6 A;  1HEM A;  3L2X A;  4NY0 A;  2Y8G A;  2HEF A;  9LYZ A;  3W6F A;  2RBN A;  4KPM A;  5D5C A;  1PQJ A;  1U2B A;  1WTN A;  1LSP A;  3WPL A;  1YRO A;  1G0G A;  5CLQ B;  1T8A A;  4HPI A;  1H87 A;  1DPX A;  4RLN A;  5C16 A;  1WVU A;  2ZPY A;  1KZG A;  4GCF A;  1L45 A;  3CXB B;  258L A;  4NGW A;  1VDQ A;  1X05 A;  3CQL A;  3HTD A;  3TXF A;  1GC6 A;  4QJ5 B;  4H92 A;  1L55 A;  3NWA A;  1CNS A;  3A58 A;  2N23 A;  4TKN A;  1MAI A;  1LSA A;  110L A;  1IR9 A;  4QJ4 B;  4NG8 A;  5LAF A;  1D0L A;  1GFJ A;  1WQN A;  1GE3 A;  1IWZ A;  2JP2 A;  1CX7 A;  1TBY A;  2DQI Y;  1YQV Y;  4HJY A;  3ODW A;  5HMV A;  2COF A;  3K2R A;  1G0Q A;  1O23 A;  4W58 A;  4ZFP A;  1SWY A;  1PS5 A;  4B0D A;  3SO6 A;  246L A;  5D3W A;  4W51 A;  4NGV A;  3AJ4 A;  1L46 A;  1U5G A;  2YT0 A;  2I5F A;  3UZT A;  3O96 A;  4EJ4 A;  4D9Z A;  193L A;  1YL1 X;  4KAX B;  4W55 A;  5LYT A;  1IR7 A;  4I8S A;  5APD A;  2D91 A;  2K49 A;  1JSF A;  4CJ2 A;  3LZT A;  1B5U A;  1C60 A;  1LYF A;  1NBY C;  5F9U A;  2YVB A;  2Z39 A;  3FM8 C;  2CY4 A;  2YSZ A;  182L A;  1LMP A;  4KVG B;  4DD0 A;  2BQJ A;  5FDJ A;  1QT6 A;  1V89 A;  2H7D A;  1CV4 A;  2VKI A;  1IOT A;  4DD9 A;  260L A;  3A8P A;  1LJG A;  1LSY A;  1LSD A;  2DKQ A;  3IVF A;  1FLQ A;  1B7Q A;  1UIE A;  3VWO A;  2BQO A;  4RDS A;  3DNA A;  152L A;  5F81 A;  3LYT A;  4HDO A;  222L A;  1AT5 A;  1L65 A;  1SLY A;  3CDT A;  4HAV B;  1GDX A;  3A91 A;  1L24 A;  2ZNW Y;  1L83 A;  5LAG A;  5I54 A;  4FJR A;  2HTH B;  5LG4 B;  2HU1 A;  3MGW A;  1C6F A;  1W1D A;  3G9W A;  1GXX A;  1U5D A;  5LOP B;  4E3U A;  1TLA A;  1XSF A;  1C6M A;  2KIG A;  151L A;  1L47 A;  1TDY A;  2QKM A;  194L A;  2RVB B;  1WQO A;  3A8Q A;  3LN2 A;  4EKQ A;  4HV1 A;  4TSB A;  4H9B A;  192L A;  5DHF B;  1B55 A;  1CTW A;  3TMU A;  1LZN A;  4C5F A;  2F32 A;  1B7N A;  2B72 A;  226L A;  3HT8 A;  1LMN A;  2A7F A;  4LT1 A;  5DN5 A;  3QE8 A;  5LVJ A;  4R6C A;  1C6P A;  4GBR B;  5L81 A;  1G0M A;  4LDL A;  1G0L A;  1JKC A;  1PQI A;  1L22 A;  1KIQ C;  111L A;  3CDV A;  4I7P A;  1LYS A;  3ATO A;  1YAQ A;  2ZIL A;  2V76 A;  1C6D A;  1GBS A;  4WM6 A;  5LIN A;  3W6B A;  1UEF A;  1JJ3 A;  5LYZ A;  1LYG A;  1CU0 A;  2K8E A;  2FJL A;  3RCP A;  3HTG A;  1QT4 A;  191L A;  3TW1 A;  1HEP A;  3B77 A;  115L A;  5C6J A;  1PZY A;  161L A;  3HT7 A;  1EQ5 A;  4ZEE A;  2Z14 A;  2D6B A;  4WM2 A;  5DH9 B;  4GCC A;  1GD6 A;  3CT5 A;  1FHX A;  1P5C A;  2MFQ A;  2BQD A;  175L A;  1GB9 A;  243L A;  5DL9 A;  1SX7 A;  5JHH A;  3HK0 A;  262L A;  2DQD Y;  2O7A A;  1L96 A;  1L01 A;  1C61 A;  1G7L C;  3B0I A;  235L A;  3D8D A;  5I2S A;  5KXY A;  2BLX A;  1C7P A;  1G7I C;  5KXX A;  1L13 A;  3AGG G;  2YBH A;  3N9C A;  4OOT A;  4XJD A;  1B5W A;  3N9A A;  1LZ4 A;  1UBZ A;  4KXI A;  242L A;  221L A;  118L A;  171L A;  1X11 A;  1SSW A;  1LAA A;  1L54 A;  5HQ1 A;  3ZVR A;  3DN0 A;  4R0F A;  229L A;  4N9R A;  1L81 A;  4Y94 A;  1WQM A;  1OUB A;  232L A;  2D4K A;  2Q0M X;  3GUI A;  4HSI A;  4G49 A;  1GFK A;  4ZRK A;  5FST A;  1OUC A;  1J19 A;  1C10 A;  1M7R A;  2DLW A;  1LZT A;  4LYO A;  2BQH A;  5HNL A;  4HJV A;  4DQJ A;  8LYZ A;  3FAD A;  1L35 A;  104L A;  3ODX A;  3WUL A;  1DI4 A;  4LYT A;  1NWG A;  2BQG A;  4CFO A;  1L74 A;  1L25 A;  238L A;  4Z98 A;  4YXA C;  3HSA A;  2YVC A;  4WL6 A;  2K00 A;  4YL8 A;  4CYE A;  1JJ0 A;  2IFF Y;  2D9V A;  2Z6B A;  3DN2 A;  4GN3 A;  2OTZ X;  4GCE A;  2Z0P A;  2RB2 X;  3CT1 A;  3KRX A;  1GE1 A;  1VDT A;  2WAR A;  4AGA A;  2OU9 A;  3GUM A;  1KS3 A;  2RSC A;  1FKV A;  3AGI A;  4LFP A;  3WYH A;  1V7S A;  5FEL A;  1G1V A;  1T6V L;  2Z59 A;  1CV1 A;  4D0N B;  2B73 A;  1B7R A;  3A67 Y;  1LKR A;  4NSJ A;  3B0O A;  224L A;  1L14 A;  1GF8 A;  137L A;  4ZRI A;  4NY5 A;  1BB5 A;  2D9X A;  3DCX A;  1LJ4 A;  1UIC A;  2OEA X;  3AGH A;  2PC2 A;  2RSG A;  1BB3 A;  1IVM A;  2DQF C;  2RLO A;  1LZB A;  2ZKM X;  4OW1 A;  3AU4 A;  1ZYT A;  2LYM A;  2B6Z A;  4YF2 A;  1ZVH L;  2YS3 A;  3TMW A;  1B7P A;  1LPI A;  1ZV5 L;  2LYD A;  1PQM A;  2GJY A;  108L A;  4B49 A;  4GNK B;  1QTD A;  5KXR A;  1VAU A;  5DM9 A;  215L A;  4DC4 A;  1LJN A;  2F4A A;  4ETB A;  5KXZ A;  1OV5 A;  197L A;  2IFS A;  2FBB A;  1OUD A;  1UIH A;  2MEB A;  3UON A;  4B4E A;  3LZM A;  5DHA B;  1XGP C;  2YF0 A;  4HB3 B;  1LZ5 A;  228L A;  1LSM A;  4OWA A;  1LZD A;  3HWL A;  1EAZ A;  1JTM A;  4M6D A;  3AU5 A;  187L A;  3TXH A;  4NSW A;  4G4H A;  3NWF A;  2J59 M;  1GF5 A;  1X1F A;  1IWW A;  156L A;  1PMS A;  2MEA A;  1HEW A;  1LZY A;  3CB7 A;  3DXD A;  5HE0 A;  2ROV A;  2DQA A;  2AL6 A;  1LYE A;  1L23 A;  1C6G A;  3P68 A;  2COC A;  3P6A A;  2FBD A;  1C65 A;  213L A;  1E8L A;  3P4Z A;  2ZNX Y;  1HC0 A;  1L62 A;  1CJ7 A;  4GRV A;  5FI1 A;  234L A;  4HHV A;  3SV1 A;  1WGU A;  4GZU A;  1L90 A;  3RZ4 A;  3T06 A;  2J0M A;  3HW2 B;  3HBH A;  1IWU A;  5KKJ A;  1V5P A;  4RW1 A;  3WA0 A;  1LI2 A;  2UZR A;  1L44 A;  1TAY A;  5LVI A;  1HHL A;  163L A;  4GN1 A;  167L A;  1L21 A;  1UPR A;  5DN4 A;  1QC6 A;  4TX7 A;  2RAY X;  5LYM A;  2J0J A;  2LYZ A;  109L A;  1L03 A;  1BB6 A;  1U5E A;  5DI9 B;  5M1Y A;  225L A;  4NGK A;  4EPI A;  3JR6 A;  177L A;  4K81 A;  4I7N A;  2EQL A;  1LZ1 A;  1QTV A;  3D9A C;  4TSC A;  1IP3 A;  3NY9 A;  1FKQ A;  4WM3 A;  1REY A;  4W94 A;  3VIA A;  4GOU A;  4OWH A;  4NHP A;  120L A;  5I14 A;  1L04 A;  1UA6 Y;  4WJ7 A;  2CUU A;  3ATN A;  2D2Q A;  3A8Z A;  1LYY A;  1SSY A;  3FI5 A;  1AM7 A;  3A93 A;  2GUM A;  2HUM A;  5L9J A;  1XKE A;  1CKG A;  2HUL A;  1P46 A;  1D6Q A;  3SUZ A;  2OE7 X;  4BAD A;  3WU7 A;  4A6H A;  3IJU A;  2VRW B;  253L A;  1TEW A;  2N5Z A;  1YAN A;  1DYD A;  3W3E A;  2BQE A;  3SB8 A;  2OE4 X;  1HNL A;  1L61 A;  1UIA A;  1FDL Y;  4NFV A;  4OWE A;  2AUB A;  4H90 A;  1OQM A;  2GV0 A;  125L A;  5KXL A;  4HB2 B;  4H9I A;  4NEB A;  1L51 A;  2RUK B;  2K2U A;  1L97 A;  1Y5O A;  4UWV A;  2BAA A;  3V5W A;  1YL0 X;  129L A;  1DYF A;  3FI7 A;  4U3X B;  1LGW A;  4GLV A;  4YEM A;  1C62 A;  1L38 A;  1LZR A;  1FB8 A;  1UNP A;  2N0Y A;  1D2W A;  169L A;  1KZ7 A;  2ROZ B;  144L A;  1LJJ A;  4J0L A;  5HE2 A;  5KQ1 A;  1D3M A;  181L A;  3EML A;  4ARM B;  1FHW A;  1L26 A;  5C6L A;  133L A;  176L A;  5K7O A;  1KXX A;  1FOE A;  3P66 A;  1T97 A;  1LJK A;  1BB4 A;  4DD3 A;  5FHW A;  2FYC A;  2D11 A;  3DMZ A;  145L A;  4OT1 A;  1XGT C;  4H9A A;  1NDM C;  4KHB A;  1L12 A;  1L33 A;  2YS5 A;  4OWB A;  1LYJ A;  2ZQ3 A;  4NGL A;  4DD7 A;  1LYO A;  4QDN A;  5CLL B;  1L40 A;  1L94 A;  5LXW A;  2IYB A;  3TXI A;  1L49 A;  1ZVR A;  1YIK A;  216L A;  1ZM0 A;  1OP9 B;  149L A;  257L A;  4NSG A;  2H5Z A;  4QXA B;  1EPY A;  4G4B A;  1UPQ A;  1C66 A;  3BIN A;  4GCB A;  1AZF A;  5D3Y A;  185L A;  4XWX A;  1QUO A;  4WM1 A;  1HSX A;  2W2X D;  2B75 A;  1XEP A;  4DIX A;  2VB1 A;  5EBH A;  102L A;  4P2E A;  3NSU A;  1L66 A;  3WVY A;  5APF A;  4H8Z A;  1NBZ C;  4KL7 A;  3AW7 A;  1AWE A;  3TXG A;  2Y7B A;  5I4W A;  4ETE A;  3RT5 X;  1JTP L;  3DMX A;  4II8 A;  3WL2 A;  5C6I A;  172L A;  5B05 A;  4ZPU A;  4XJI A;  1U27 A;  1NQI A;  4A6K A;  4WLD A;  1FAO A;  1GFV A;  1UIG A;  1C43 A;  1GB0 A;  2X0A A;  4PRU A;  1L11 A;  3E3D A;  1I20 A;  1GB6 A;  1T3P A;  3IJV A;  2YT1 A;  4H93 A;  1CJ6 A;  3ZDT A;  3GUK A;  1DDW A;  1Y19 B;  3W6E A;  5F14 A;  4HP0 A;  2PZ1 A;  4YEO A;  1LSZ A;  2MED A;  1IRS A;  1L43 A;  2YBJ A;  1FLW A;  5ILF A;  164L A;  1JHL A;  3EXD A;  3HH3 A;  3A96 A;  4X3B A;  1KW5 A;  4DQ5 A;  3B6L A;  1Z87 A;  2P0F A;  1ZMY L;  3WMK A;  3EMS A;  4I7T A;  3W6D A;  1L0J A;  2ELA A;  5D3X A;  1L18 A;  1OVK A;  2Q13 A;  4WMG A;  3AZ4 A;  2LZT A;  4YXC A;  2Z4D A;  1G7M C;  4H9C A;  1WQP A;  3OAN A;  2EKS C;  237L A;  256L A;  4TWS A;  3RUN A;  4EXM A;  1JKB A;  200L A;  3NWD A;  2Y8P A;  1DPW A;  1QQY A;  4NSH A;  4EOF A;  4ZIX A;  1OWY A;  3ZVQ A;  1V61 A;  186L A;  1QUG A;  5B06 A;  2R2Y A;  1CJ9 A;  5C5B A;  1CKD A;  2J0K A;  1QUS A;  1L73 A;  1SQ2 L;  2DQC Y;  3PBL A;  1I1Z A;  3ULC A;  1JTO L;  3PSC A;  1IY4 A;  1PLS A;  1G0K A;  1L10 A;  2HEA A;  2D9W A;  1L16 A;  1I2H A;  1GB3 A;  1LMQ A;  209L A;  211L A;  3A90 A;  3WPK A;  2B6W A;  1GXV 2;  3T6U A;  2HTX A;  1L29 A;  3AZ7 A;  3HTB A;  1L89 A;  1MPH A;  1L75 A;  1C64 A;  1K5G B;  1UCO A;  1LYD A;  1CKH A;  1I7A A;  1C08 C;  2LZM A;  4NGY A;  5APE A;  1F6S A;  4LDO A;  1IY3 A;  3U8Z A;  4HDQ A;  2RGN B;  1L60 A;  1SGH A;  2MKR A;  1YKX X;  4ARQ B;  5E4P A;  1HEO A;  2W1X A;  1XX0 A;  2HE7 A;  2BQK A;  2YS1 A;  3OHM B;  3P65 A;  1NTY A;  3HUK A;  123L A;  143L A;  1MLC E;  2LKO A;  2MEH A;  2YBL A;  1LJF A;  1IWX A;  3G3V A;  5A3E A;  178L A;  4Z2N A;  1XEK A;  3FA0 A;  1W1G A;  4EMO A;  1SWZ A;  1IX0 A;  3HH4 A;  4XJG A;  2ZIJ A;  2CRF A;  5JEN B;  1GF7 A;  1J0W A;  1PQK A;  2OTY X;  3C8R A;  1WQR A;  1P6S A;  2Q9E A;  4NHS A;  3VOQ A;  157L A;  4QJ3 B;  1KIR C;  201L A;  2RBP A;  2W1Y A;  5FI0 A;  1UC0 A;  240L A;  1HFZ A;  160L A;  1L93 A;  1LLH A;  1BTN A;  1P3R A;  2LOX A;  4QY9 A;  3SB6 A;  4NIJ A;  1TQZ A;  1L57 A;  1LZC A;  1B5X A;  5I4Y A;  2Z0O A;  3GXR A;  1LZS A;  1SHC A;  4XYY A;  4UWN A;  3HT6 A;  3B72 A;  3AB6 A;  1GE2 A;  1YAM A;  223L A;  4F7G A;  3NYA A;  1D9W A;  1LYZ A;  4HPE A;  5LVG A;  4Z41 A;  1MIX A;  1L34 A;  2RRF A;  3NW8 A;  4WLY A;  1XGR C;  2ZWB A;  3C83 A;  1WQQ A;  4W53 A;  2NWD X;  1NDG C;  3LZ2 A;  3K3T A;  4KT3 A;  1NU2 A;  2CY5 A;  3D3D A;  3HDF A;  2W2X C;  1J1P Y;  1L31 A;  7LYZ A;  1DYG A;  1W08 A;  4OSN A;  158L A;  1N4F A;  4I7O A;  113L A;  1P5T A;  2Z2F A;  2MEE A;  1IO5 A;  1YKY X;  1OQN A;  1MK7 B;  3WYF B;  1GB8 A;  1UNR A;  1LHM A;  3PVW A;  2EIZ C;  227L A;  4J7V A;  2F4G A;  1GBO A;  4HTQ A;  1D6P A;  3A6C Y;  3SN6 R;  4PQ0 A;  1B7O A;  2Z37 A;  3LYZ A;  2Z18 A;  4ET9 A;  2W1L A;  4LZT A;  2ELB A;  1H10 A;  3TO1 A;  1GBW A;  1YAP A;  1T6H A;  168L A;  1L71 A;  1W1H A;  1KI1 B;  1P3N A;  5LON B;  2LG1 A;  3MDB C;  3GUJ A;  1AT6 A;  4HV2 A;  2H9K A;  2DX5 A;  4DWX A;  4XJF A;  4G4C A;  1UNQ A;  2BQL A;  3CT0 A;  4GCD A;  4A7D A;  4HTN A;  1UIB A;  1G7H C;  2F47 A;  2MEC A;  4WLT A;  1IP2 A;  5KKI A;  5HE1 A;  2DBT A;  1C6N A;  2W1M A;  4ETC A;  1OUJ A;  2DQG Y;  1LMA A;  1C46 A;  183L A;  1IOC A;  1L30 A;  3DKE X;  2YBM A;  1P64 A;  2QAR C;  4NHI A;  5B1G A;  3VW7 A;  2EPE A;  4XJH A;  128L A;  3HT9 A;  1C67 A;  2DHI A;  1LI3 A;  2IGC A;  1NF5 A;  2XTH A;  1QUD A;  1LTM A;  4C0A A;  2A4T A;  1OY2 A;  5I2M A;  1GFH A;  3AJN A;  5JLJ B;  2B6Y A;  2RNR B;  3FE0 A;  1CV0 A;  4O34 A;  1B6I A;  1HMK A;  4PRQ A;  1SX2 A;  1KIP C;  1XOD A;  2YT2 A;  4WVF B;  4DXA B;  114L A;  1L68 A;  4NGO A;  4BBK A;  1IC5 Y;  4LFX A;  2CAY A;  4DDA A;  2MDX A;  3HUA A;  3M1I B;  1CUQ A;  3RW8 A;  2ANV A;  4H9F A;  3ZEK A;  1XGQ C;  1REM A;  5HNC A;  4M4O A;  2BQC A;  4KHA A;  1L28 A;  1IEE A;  1QTC A;  3WW5 A;  4GN4 A;  1GHL A;  1L0K A;  5APC A;  1JKA A;  1GBZ A;  4DAJ A;  2D9Y A;  4LT3 A;  3V2Y A;  5L3I A;  1DI3 A;  1LSB A;  1LYH A;  1L76 A;  3J6K A;  220L A;  5E9R A;  132L A;  4A6F B;  1QQG A;  1BWN A;  1L86 A;  2EMT A;  2YBI A;  1IP7 A;  1G0J A;  4ZRJ A;  2HEC A;  1QT7 A;  1DRO A;  1ZYI A;  3C7Y A;  1L91 A;  4WM4 A;  1AKI A;  3EO5 A;  2Z12 A;  1DBH A;  1GG3 A;  1NI2 A;  2G4P A;  2IHL A;  1OUF A;  1IIZ A;  1DQJ C;  1HFX A;  1L42 A;  1GAZ A;  1JTT L;  7LZM A;  4PJ2 C;  3WU8 A;  1HER A;  1ISN A;  2Y8F A;  1VFB C;  4LDE A;  1T77 A;  3WUN A;  1AQC A;  1BTK A;  1CU2 A;  3C80 A;  4LT2 A;  1LHK A;  1LGU A;  4W56 A;  3OE9 A;  1EGX A;  1JSE A;  1UUZ C;  3HH5 A;  1L84 A;  2BCJ A;  4OOO A;  5DLA A;  206L A;  1D0M A;  4Z2M B;  3CSZ A;  4XJB A;  2W2W A;  3LHM A;  5KXM A;  4GXB A;  3HU9 A;  130L A;  2LOZ A;  1QTH A;  250L A;  4PJZ A;  3CDO A;  4MY6 A;  4H9H A;  162L A;  3X23 A;  1QT8 A;  3OK0 A;  5A3Z A;  3KRW A;  1GFA A;  3CSR A;  1JIY A;  2M14 A;  4IFS A;  3SBA A;  142L A;  4ML7 A;  4LGK A;  3GUP A;  1F10 A;  2DA0 A;  5F9X A;  1GBX A;  1L85 A;  4DDC A;  1DKJ A;  150L A;  3G3X A;  3A34 A;  1GC7 A;  5C6R A;  4B4I A;  2M38 A;  4DX8 A;  5JP4 A;  4WG7 A;  148L E;  4NSI A;  1L08 A;  248L A;  4MR1 A;  1XR0 B;  1BWH A;  1YIL A;  119L A;  4HAW B;  2ANX A;  3GUN A;  1IP4 A;  3HH6 A;  3ML4 A;  5I53 A;  2QKL A;  3WPJ A;  2YSS C;  1L64 A;  1H4R A;  2DQJ Y;  1LJ3 A;  4ETD A;  2DHJ A;  3D8E A;  3SNH A;  1OUH A;  2DFK A;  4CHJ A;  249L A;  3QNG A;  2C8O A;  1RFP A;  4B4J A;  5KXN A;  4XAD A;  3SP3 A;  127L A;  6LYZ A;  254L A;  4YOP A;  1MKE A;  4J1B A;  1LSG A;  4DDB A;  4Z3M A;  3GUL A;  4GMV A;  4PNK A;  1JQU A;  252L A;  1L95 A;  214L A;  1GFR A;  1B5Z A;  1T8G A;  5LA5 A;  1J1X Y;  2COA A;  2D4J A;  5KJ9 A;  1BAK A;  1C6L A;  4BAP A;  184L A;  4NGZ A;  2R09 A;  1IOQ A;  2XBS A;  1IWT A;  135L A;  1C6E A;  1L27 A;  3F9L A;  4XN6 A;  1DYE A;  3HU8 A;  3QBV B;  1L87 A;  2ZQ4 A;  1LWG A;  5IRS A;  131L A;  4MK0 A;  3PDS A;  1LW9 A;  2RBS A;  1RJC B;  1P37 A;  1QUH A;  4H9E A;  4MCK A;  6LYT A;  4GLA A;  4HB0 B;  4GMX B;  2RB0 X;  4PHI A;  4UWU A;  4TTD A;  1GEV A;  1LZ9 A;  2B6X A;  2OQB A;  4K5Y A;  212L A;  3CIK A;  1WVH A;  3TXB A;  2HU3 A;  2YBN A;  4I7L A;  4H8S A;  5HMJ A;  2NMB A;  1M7E A;  1EQE A;  1L00 A;  4LT0 A;  4LZM A;  2G35 A;  3TXD A;  1XJU A;  4S0W A;  1LZG A;  2MEI A;  1KXW A;  4PGJ B;  1B7L A;  1IWY A;  3U7D A;  3IWR A;  3DN3 A;  4NHQ A;  198L A;  3KY9 A;  5KXT A;  1JTN A;  1I56 A;  3PG7 A;  2YDG A;  1ALC A;  5J3T A;  2OTX A;  3WH1 A;  2KGX B;  5D3V A;  1B5V A;  1D0K A;  2DHK A;  5JHG A; 
#chains in the Genus database with same CATH homology
 153L A;  1C6Q A;  4EKR A;  1C69 A;  107L A;  1CVK A;  4TUN A;  4WO9 A;  1GPQ C;  1FLY A;  2I1K A;  1L63 A;  4RW2 A;  1QTK A;  5ILC A;  1UAC Y;  2D9Z A;  1C6B A;  1PFJ A;  2RBQ A;  247L A;  1GEZ A;  4I7Q A;  1CKF A;  2B5Z A;  4QGZ A;  4IAS A;  1DYN A;  1GF0 A;  3OE6 A;  4W52 A;  1G0P A;  3N9E A;  4YEN A;  4LYZ A;  1QSQ A;  1LMT A;  1JPO A;  3TXK A;  205L A;  1T8F A;  1LJH A;  1I6S A;  4I7S A;  2L2I A;  2BQB A;  1TXD A;  3OJP A;  3WUA A;  3HBD A;  2BQI A;  1GFU A;  4GN5 C;  2RBO A;  2O4W A;  3KAM A;  5B59 A;  3M3U A;  4L6E A;  1L69 A;  1L53 A;  2BLY A;  2D4I A;  1LOZ A;  1LSF A;  4ARP A;  5HE3 A;  188L A;  4WOA A;  2B7X A;  2AEH A;  4WM5 A;  1DI5 A;  1LHI A;  1YKZ X;  4IAP A;  1C6T A;  2Q9D A;  3HFM Y;  3HUQ A;  5IEL A;  1RI8 B;  3GYP A;  1FGZ A;  1GAY A;  4QEQ A;  2MEG A;  1QS5 A;  2L78 A;  2XQN M;  2UZS A;  4BS7 A;  1GFE A;  4W96 A;  4CHM A;  1MIZ B;  2ZIK A;  2NTH A;  1LZ6 A;  4EKU A;  5J3Y A;  4B1A A;  1BGI A;  2ZYP A;  2I25 L;  4NGI A;  3A3Q A;  3DXC A;  2CWI A;  1WI1 A;  2DQE Y;  2X18 A;  1LCN A;  1D3J A;  1LMO A;  3F8V A;  5KXP A;  1KY0 A;  1OV7 A;  3TXE A;  5FCP A;  4I7K A;  1IOS A;  1A4V A;  2QB0 B;  245L A;  4WL7 A;  217L A;  3L64 A;  3C7Z A;  2XJW A;  5KQ4 A;  3QIJ A;  1C68 A;  2K2J A;  1FLU A;  1IWV A;  3DMV A;  3C7W A;  4N8Z A;  1F0W A;  1L06 A;  1L99 A;  4WG1 A;  3A6B Y;  5AMY A;  1GF3 A;  1HSW A;  2P0D A;  1B7M A;  1HFY A;  1GWD A;  2P0H A;  3RU5 A;  3CSQ A;  140L A;  3J4G A;  4B6H A;  1FN5 A;  5LZM A;  1FBI X;  4BAF A;  4CGE A;  1JUG A;  1WVV A;  154L A;  1QDT A;  1L58 A;  1DDM A;  1L50 A;  2FYD A;  5DIF B;  2E2X A;  1OUI A;  4I7M A;  4DD2 A;  173L A;  219L A;  5HLL A;  4HAT B;  1EVH A;  3DN6 A;  1ZVY B;  4ARM A;  1H6M A;  208L A;  1UIF A;  5LVK A;  1B9O A;  4LYB A;  2MWN B;  4WO6 A;  1P7S A;  1L36 A;  1XEI A;  2KCJ A;  3AZ5 A;  1L17 A;  1LHH A;  4MST A;  170L A;  1GDW A;  236L A;  2Z0Q A;  2LYO A;  1A2Y C;  1QTZ A;  1NHB A;  3B0K A;  147L A;  1REX A;  3W6A A;  2DN6 A;  3HQC A;  1X86 A;  1W6Z A;  1MK9 B;  1J1O Y;  1BHZ A;  1CUP A;  1NKH A;  1QSW A;  2EMS A;  1PQO A;  1GE0 A;  4YM8 A;  1GF9 A;  2CGI A;  3C81 A;  4IJ4 A;  5C79 A;  1ZSQ A;  1F6R A;  3PP2 A;  4W54 A;  1V5M A;  159L A;  2DQH Y;  1L72 A;  2LCB A;  4J1A A;  2BQA A;  3TXJ A;  1BB7 A;  1VDP A;  4HTK A;  1XCG A;  1D3F A;  146L A;  4K2P A;  1IC4 Y;  3N7C A;  1B5Y A;  4N1E I;  239L A;  1OUG A;  3C82 A;  4E97 A;  2GCJ A;  5D5F A;  1V88 A;  2COD A;  4DKL A;  1U29 A;  3CDR A;  1FGY A;  1RE2 A;  3AYQ A;  1KXY A;  2OU0 X;  1L67 A;  2Z19 A;  2L1C A;  138L A;  3F5R A;  1LI6 A;  166L A;  1ZC3 B;  2XQO A;  4K2O A;  1OWZ A;  2G4Q A;  1DYC A;  1QS9 A;  1GB5 A;  3PZD A;  2BQF A;  2A7D A;  241L A;  1LB1 A;  1C6H A;  1QT3 A;  5B1F A;  3A94 A;  1D2Y A;  1IR8 A;  4I0C A;  1BWJ A;  3OE0 A;  2EC1 A;  1XJT A;  2B74 A;  2HUB A;  1VDS A;  3G3B B;  2ZYC A;  2DKP A;  3RZE A;  1EL1 A;  2HEB A;  1LSN A;  1V7T A;  1LPY A;  3C8S A;  5LIO A;  1L07 A;  1RRP B;  5F16 A;  3QWM A;  1IP5 A;  1JKD A;  3W6C A;  1WJM A;  3TVV A;  2XBR A;  3DN1 A;  2UVM A;  210L A;  255L A;  4H94 A;  1QT5 A;  4LYC A;  1L39 A;  4EJN A;  4H8Y A;  1OUE A;  2I26 L;  1OMW A;  1LZ8 A;  1TCY A;  4N5R A;  3GYO A;  3TMV A;  3KSY A;  4FDY A;  4HAX B;  3PVL A;  4ARJ A;  1OVH A;  4OO9 A;  1C6K A;  3CDQ A;  1L52 A;  4W59 A;  1P2R A;  3SYX A;  190L A;  1OVJ A;  1IOR A;  5EFX A;  1REZ A;  4EPF A;  2CJL A;  4AQN A;  1U5F A;  1ZUR A;  3WU9 A;  3AW6 A;  1D9U A;  3C8Q A;  218L A;  1LSC A;  4HB4 B;  1FHO A;  1MEL L;  3G3W A;  2F2Q A;  1LZA A;  5FEK A;  1CU5 A;  3ODU A;  2LC9 A;  5B07 A;  1DYA A;  3SB5 A;  1LKS A;  1RCM A;  1L77 A;  1L48 A;  1LJI A;  1EQ4 A;  2OE9 X;  1L59 A;  1OYU A;  1BWI A;  1NMM A;  3A3R X;  2HED A;  1D3N A;  4A5K A;  261L A;  4NHT A;  5KXW A;  2R0D A;  4ETA A;  1G1W A;  5II3 A;  4ARQ A;  2P8V A;  1P6Y A;  2NZ8 B;  4EMN A;  2GCL A;  1K28 A;  1L98 A;  3LJU X;  1LMC A;  4H8X A;  3BKH A;  2DKV A;  189L A;  3HBE X;  1JEF A;  1P36 A;  4TYZ A;  1L70 A;  3LYM A;  1WJ1 A;  1HEQ A;  3ODO A;  3ULR A;  1LW3 A;  1QDR A;  2F30 A;  1HEL A;  2H7E A;  1PQD A;  4PK0 A;  3PEG A;  1DKK A;  207L A;  3HDE A;  1L20 A;  1INU A;  4CFP A;  1VED A;  1ZC4 B;  233L A;  4XEN A;  141L A;  2CDS A;  4PPO A;  3TMX A;  1XD4 A;  1N3H A;  3WVX A;  1IC7 Y;  2C8P A;  1CV5 A;  1QTE A;  3BKV A;  4WSF A;  4N0J A;  3BJI A;  3WXU A;  2B70 A;  259L A;  3NY8 A;  3V2W A;  5GOW B;  1IP1 A;  4YON A;  4HAU B;  1CV6 A;  4I7R A;  4DQ7 A;  4C3W A;  1DYB A;  3GUO A;  3RNX A;  244L A;  3DXE A;  134L A;  1NTV A;  1V5U A;  1G7J C;  2H9J A;  2NTG A;  3P7Z A;  2I5C A;  4KHB B;  1GB2 A;  1LSE A;  1GF6 A;  3GXK A;  1WTH A;  1TJ6 A;  2DX1 A;  1QUT A;  3G3A B;  4RLM A;  3A92 A;  4HJZ A;  1DDV A;  1L82 A;  5IHG A;  1C45 A;  1P2C C;  1CV3 A;  4GPT B;  1C6C A;  1IP6 A;  4N1C C;  1XGU C;  2Z38 A;  3HTF A;  1HEN A;  1G07 A;  1CU3 A;  4L41 A;  5I5Q A;  1JWR A;  3PVU A;  4H91 A;  4H1P A;  1KY1 A;  4AXT A;  4WLX A;  4NWE A;  3D8F A;  195L A;  2RAZ X;  3T36 A;  1KNI A;  2RBR A;  1EF1 A;  5KXK A;  1C6I A;  4LYM A;  1C63 A;  1CU6 A;  1B7S A;  2F2N A;  4EKS A;  4ET8 A;  4NWH A;  139L A;  1L15 A;  5LVH A;  1DXJ A;  2YRY A;  3MPX A;  5J3Q A;  230L A;  1C6J A;  3SBB C;  3F0W A;  1UID A;  1Z55 A;  1LJE A;  1JIT A;  2LHM A;  1GF4 A;  1G06 A;  1WG7 A;  4MT7 A;  1LZE A;  1L92 A;  1BVX A;  3ULB A;  2KUP A;  2D10 A;  1XFP L;  1QIO A;  2DYQ A;  2DYN A;  2I6Z A;  2MEF A;  3DN4 A;  5LA8 A;  126L A;  3F6Z A;  1C6A A;  1CJ8 A;  1L88 A;  4EKP A;  5KCV A;  4DX9 0;  4F7H A;  4F7U P;  4NG1 A;  2DTC A;  1GB7 A;  1LGX A;  3WXT A;  3DN8 A;  2O79 A;  4YX7 C;  4DBB A;  4OWC A;  1L37 A;  5IDD A;  1GE4 A;  3M18 B;  4HSF A;  3ZVQ B;  4G9S A;  2I1J A;  1B2K A;  1L19 A;  1B0D A;  1L02 A;  4HAY B;  174L A;  5C5B B;  5I4X A;  4DD1 A;  1Q67 A;  2BQN A;  2EJ8 A;  5T3F A;  1P2L A;  1L80 A;  3QY4 A;  3AZ6 A;  1QSA A;  3P64 A;  4W57 A;  6LZM A;  1HF4 A;  4DYG A;  3TFM A;  4DJH A;  3A95 A;  2BPU A;  196L A;  1LYI A;  2G4N A;  1WGQ A;  3A98 B;  1L09 A;  1RJ2 A;  165L A;  1L41 A;  1GBY A;  5L3H A;  1BVK C;  2OU8 A;  5KXS A;  1JJ1 A;  2HEE A;  1KW7 A;  199L A;  180L A;  4HAZ B;  2LZ2 A;  4IAT A;  4CHX A;  3WW6 A;  2GS0 A;  3FSS A;  4A6F A;  231L A;  4DT3 A;  1OUA A;  1BQL Y;  2Z2E A;  2RB1 X;  3OE8 A;  3LYO A;  4P7I A;  122L A;  1L05 A;  2D4Q A;  1E5W A;  3TCA A;  1L32 A;  103L A;  3WUM A;  2VSZ A;  112L A;  1GFT A;  1DZB X;  1L56 A;  5KY1 A;  1CKC A;  2HUK A;  251L A;  2B6T A;  1JIS A;  1P56 A;  155L A;  1X1G A;  1LHL A;  4NGJ A;  1YAO A;  1LWK A;  3EBA B;  1QTB A;  4IOY X;  3SB9 A;  4K17 A;  1XEJ A;  3SB7 A;  1ZWN A;  5J7C A;  1VAT A;  1L79 A;  2LUL A;  1QSB A;  4Z46 A;  3QAK A;  2ADZ A;  4ARL A;  1GFG A;  4I7J A;  2RH1 A;  2BQM A;  1K5D B;  3KZ1 A;  5D27 A;  5KXO A;  3D4S A;  1LHJ A;  1WTM A;  4ANR A;  1HML A;  1NHE A;  3FEH A;  4KHO A;  1CX6 A;  1HEM A;  3L2X A;  4NY0 A;  2Y8G A;  2HEF A;  9LYZ A;  3W6F A;  2RBN A;  4KPM A;  5D5C A;  1PQJ A;  1U2B A;  1WTN A;  1LSP A;  3WPL A;  1YRO A;  1G0G A;  5CLQ B;  1T8A A;  4HPI A;  1H87 A;  1DPX A;  4RLN A;  5C16 A;  1WVU A;  2ZPY A;  1KZG A;  4GCF A;  1L45 A;  3CXB B;  258L A;  4NGW A;  1VDQ A;  1X05 A;  3CQL A;  3HTD A;  3TXF A;  1GC6 A;  4H92 A;  1L55 A;  1CNS A;  2N23 A;  4TKN A;  1MAI A;  1LSA A;  110L A;  1IR9 A;  4NG8 A;  5LAF A;  1D0L A;  1GFJ A;  1WQN A;  1GE3 A;  1IWZ A;  2JP2 A;  1CX7 A;  1TBY A;  2DQI Y;  1YQV Y;  4HJY A;  3ODW A;  5HMV A;  2COF A;  3K2R A;  1G0Q A;  1O23 A;  4W58 A;  4ZFP A;  1SWY A;  1PS5 A;  4B0D A;  3SO6 A;  246L A;  5D3W A;  4W51 A;  4NGV A;  3AJ4 A;  1L46 A;  1U5G A;  2YT0 A;  2I5F A;  3UZT A;  3O96 A;  4EJ4 A;  4D9Z A;  193L A;  1YL1 X;  4KAX B;  4W55 A;  5LYT A;  1IR7 A;  4I8S A;  5APD A;  2D91 A;  1JSF A;  4CJ2 A;  3LZT A;  1B5U A;  1C60 A;  1LYF A;  1NBY C;  5F9U A;  2YVB A;  2Z39 A;  3FM8 C;  2CY4 A;  2YSZ A;  182L A;  1LMP A;  4KVG B;  4DD0 A;  2BQJ A;  5FDJ A;  1QT6 A;  1V89 A;  2H7D A;  1CV4 A;  2VKI A;  1IOT A;  4DD9 A;  260L A;  3A8P A;  1LJG A;  1LSY A;  1LSD A;  2DKQ A;  3IVF A;  1FLQ A;  1B7Q A;  1UIE A;  3VWO A;  2BQO A;  4RDS A;  3DNA A;  152L A;  5F81 A;  3LYT A;  4HDO A;  222L A;  1AT5 A;  1L65 A;  1SLY A;  3CDT A;  4HAV B;  1GDX A;  3A91 A;  1L24 A;  2ZNW Y;  1L83 A;  5LAG A;  5I54 A;  4FJR A;  2HTH B;  2HU1 A;  3MGW A;  1C6F A;  1W1D A;  3G9W A;  1GXX A;  1U5D A;  5LOP B;  4E3U A;  1TLA A;  1XSF A;  1C6M A;  151L A;  1L47 A;  1TDY A;  2QKM A;  194L A;  2RVB B;  1WQO A;  3A8Q A;  3LN2 A;  4EKQ A;  4HV1 A;  4TSB A;  4H9B A;  192L A;  5DHF B;  1B55 A;  1CTW A;  3TMU A;  1LZN A;  4C5F A;  2F32 A;  1B7N A;  2B72 A;  226L A;  3HT8 A;  1LMN A;  2A7F A;  4LT1 A;  5DN5 A;  3QE8 A;  5LVJ A;  4R6C A;  1C6P A;  4GBR B;  5L81 A;  1G0M A;  4LDL A;  1G0L A;  1JKC A;  1PQI A;  1L22 A;  1KIQ C;  111L A;  3CDV A;  4I7P A;  1LYS A;  3ATO A;  1YAQ A;  2ZIL A;  2V76 A;  1C6D A;  1GBS A;  4WM6 A;  5LIN A;  3W6B A;  1UEF A;  1JJ3 A;  5LYZ A;  1LYG A;  1CU0 A;  2FJL A;  3RCP A;  3HTG A;  1QT4 A;  191L A;  3TW1 A;  1HEP A;  115L A;  5C6J A;  1PZY A;  161L A;  3HT7 A;  1EQ5 A;  4ZEE A;  2D6B A;  4WM2 A;  5DH9 B;  4GCC A;  1GD6 A;  3CT5 A;  1FHX A;  1P5C A;  2MFQ A;  2BQD A;  175L A;  1GB9 A;  243L A;  5DL9 A;  1SX7 A;  5JHH A;  3HK0 A;  262L A;  2DQD Y;  2O7A A;  1L96 A;  1L01 A;  1C61 A;  1G7L C;  3B0I A;  235L A;  3D8D A;  5KXY A;  2BLX A;  1C7P A;  1G7I C;  5KXX A;  1L13 A;  3AGG G;  2YBH A;  3N9C A;  4OOT A;  4XJD A;  1B5W A;  3N9A A;  1LZ4 A;  1UBZ A;  4KXI A;  242L A;  221L A;  118L A;  171L A;  1X11 A;  1SSW A;  1LAA A;  1L54 A;  5HQ1 A;  3ZVR A;  3DN0 A;  4R0F A;  229L A;  4N9R A;  1L81 A;  4Y94 A;  1WQM A;  1OUB A;  232L A;  2D4K A;  2Q0M X;  3GUI A;  4G49 A;  1GFK A;  4ZRK A;  5FST A;  1OUC A;  1J19 A;  1C10 A;  1M7R A;  2DLW A;  1LZT A;  4LYO A;  2BQH A;  5HNL A;  4HJV A;  4DQJ A;  8LYZ A;  3FAD A;  1L35 A;  104L A;  3ODX A;  3WUL A;  1DI4 A;  4LYT A;  1NWG A;  2BQG A;  4CFO A;  1L74 A;  1L25 A;  238L A;  4Z98 A;  4YXA C;  2YVC A;  4WL6 A;  2K00 A;  4YL8 A;  4CYE A;  1JJ0 A;  2IFF Y;  2D9V A;  2Z6B A;  3DN2 A;  4GN3 A;  2OTZ X;  4GCE A;  2Z0P A;  2RB2 X;  3CT1 A;  3KRX A;  1GE1 A;  1VDT A;  2WAR A;  4AGA A;  2OU9 A;  3GUM A;  1KS3 A;  2RSC A;  1FKV A;  3AGI A;  4LFP A;  3WYH A;  1V7S A;  5FEL A;  1G1V A;  1T6V L;  1CV1 A;  4D0N B;  2B73 A;  1B7R A;  3A67 Y;  1LKR A;  4NSJ A;  3B0O A;  224L A;  1L14 A;  1GF8 A;  137L A;  4ZRI A;  4NY5 A;  1BB5 A;  2D9X A;  1LJ4 A;  1UIC A;  2OEA X;  3AGH A;  2PC2 A;  2RSG A;  1BB3 A;  1IVM A;  2DQF C;  2RLO A;  1LZB A;  4OW1 A;  3AU4 A;  1ZYT A;  2LYM A;  2B6Z A;  4YF2 A;  1ZVH L;  2YS3 A;  3TMW A;  1B7P A;  1LPI A;  1ZV5 L;  2LYD A;  1PQM A;  2GJY A;  108L A;  4B49 A;  1QTD A;  5KXR A;  1VAU A;  5DM9 A;  215L A;  4DC4 A;  1LJN A;  2F4A A;  4ETB A;  5KXZ A;  1OV5 A;  197L A;  2IFS A;  2FBB A;  1OUD A;  1UIH A;  2MEB A;  3UON A;  4B4E A;  3LZM A;  5DHA B;  1XGP C;  2YF0 A;  4HB3 B;  1LZ5 A;  228L A;  1LSM A;  4OWA A;  1LZD A;  3HWL A;  1EAZ A;  1JTM A;  4M6D A;  3AU5 A;  187L A;  3TXH A;  4NSW A;  4G4H A;  2J59 M;  1GF5 A;  1X1F A;  1IWW A;  156L A;  1PMS A;  2MEA A;  1HEW A;  1LZY A;  3CB7 A;  3DXD A;  5HE0 A;  2ROV A;  2DQA A;  2AL6 A;  1LYE A;  1L23 A;  1C6G A;  3P68 A;  2COC A;  3P6A A;  2FBD A;  1C65 A;  213L A;  1E8L A;  3P4Z A;  2ZNX Y;  1HC0 A;  1L62 A;  1CJ7 A;  4GRV A;  5FI1 A;  234L A;  4HHV A;  3SV1 A;  1WGU A;  4GZU A;  1L90 A;  3RZ4 A;  3T06 A;  2J0M A;  3HW2 B;  3HBH A;  1IWU A;  5KKJ A;  1V5P A;  4RW1 A;  3WA0 A;  1LI2 A;  2UZR A;  1L44 A;  1TAY A;  5LVI A;  1HHL A;  163L A;  4GN1 A;  167L A;  1L21 A;  1UPR A;  5DN4 A;  1QC6 A;  4TX7 A;  2RAY X;  5LYM A;  2J0J A;  2LYZ A;  109L A;  1L03 A;  1BB6 A;  1U5E A;  5DI9 B;  5M1Y A;  225L A;  4NGK A;  4EPI A;  3JR6 A;  177L A;  4K81 A;  4I7N A;  2EQL A;  1LZ1 A;  1QTV A;  3D9A C;  4TSC A;  1IP3 A;  3NY9 A;  1FKQ A;  4WM3 A;  1REY A;  4W94 A;  3VIA A;  4OWH A;  4NHP A;  120L A;  5I14 A;  1L04 A;  1UA6 Y;  4WJ7 A;  2CUU A;  3ATN A;  2D2Q A;  3A8Z A;  1LYY A;  1SSY A;  3FI5 A;  1AM7 A;  3A93 A;  2HUM A;  5L9J A;  1XKE A;  1CKG A;  2HUL A;  1P46 A;  1D6Q A;  3SUZ A;  2OE7 X;  4BAD A;  3WU7 A;  4A6H A;  3IJU A;  2VRW B;  253L A;  1TEW A;  2N5Z A;  1YAN A;  1DYD A;  3W3E A;  2BQE A;  3SB8 A;  2OE4 X;  1HNL A;  1L61 A;  1UIA A;  1FDL Y;  4NFV A;  4OWE A;  2AUB A;  4H90 A;  1OQM A;  2GV0 A;  125L A;  5KXL A;  4HB2 B;  4H9I A;  4NEB A;  1L51 A;  2RUK B;  2K2U A;  1L97 A;  1Y5O A;  4UWV A;  2BAA A;  3V5W A;  1YL0 X;  129L A;  1DYF A;  3FI7 A;  4U3X B;  1LGW A;  4GLV A;  4YEM A;  1C62 A;  1L38 A;  1LZR A;  1FB8 A;  1UNP A;  2N0Y A;  1D2W A;  169L A;  1KZ7 A;  2ROZ B;  144L A;  1LJJ A;  4J0L A;  5HE2 A;  5KQ1 A;  1D3M A;  181L A;  3EML A;  4ARM B;  1FHW A;  1L26 A;  5C6L A;  133L A;  176L A;  5K7O A;  1KXX A;  1FOE A;  3P66 A;  1T97 A;  1LJK A;  1BB4 A;  4DD3 A;  5FHW A;  2FYC A;  2D11 A;  3DMZ A;  145L A;  1XGT C;  4H9A A;  1NDM C;  1L12 A;  1L33 A;  2YS5 A;  4OWB A;  1LYJ A;  2ZQ3 A;  4NGL A;  4DD7 A;  1LYO A;  4QDN A;  5CLL B;  1L40 A;  1L94 A;  5LXW A;  2IYB A;  3TXI A;  1L49 A;  1ZVR A;  1YIK A;  216L A;  1ZM0 A;  1OP9 B;  149L A;  257L A;  4NSG A;  2H5Z A;  1EPY A;  4G4B A;  1UPQ A;  1C66 A;  3BIN A;  4GCB A;  1AZF A;  5D3Y A;  185L A;  4XWX A;  1QUO A;  4WM1 A;  1HSX A;  2W2X D;  2B75 A;  1XEP A;  2VB1 A;  5EBH A;  102L A;  4P2E A;  3NSU A;  1L66 A;  3WVY A;  5APF A;  4H8Z A;  1NBZ C;  4KL7 A;  3AW7 A;  1AWE A;  3TXG A;  2Y7B A;  5I4W A;  4ETE A;  3RT5 X;  1JTP L;  3DMX A;  4II8 A;  3WL2 A;  5C6I A;  172L A;  5B05 A;  4ZPU A;  4XJI A;  1U27 A;  1NQI A;  4A6K A;  4WLD A;  1FAO A;  1GFV A;  1UIG A;  1C43 A;  1GB0 A;  2X0A A;  4PRU A;  1L11 A;  3E3D A;  1I20 A;  1GB6 A;  1T3P A;  3IJV A;  2YT1 A;  4H93 A;  1CJ6 A;  3ZDT A;  3GUK A;  1DDW A;  1Y19 B;  3W6E A;  5F14 A;  4HP0 A;  2PZ1 A;  4YEO A;  1LSZ A;  2MED A;  1IRS A;  1L43 A;  2YBJ A;  1FLW A;  5ILF A;  164L A;  1JHL A;  3EXD A;  3HH3 A;  3A96 A;  4X3B A;  1KW5 A;  4DQ5 A;  3B6L A;  1Z87 A;  2P0F A;  1ZMY L;  3WMK A;  3EMS A;  4I7T A;  3W6D A;  1L0J A;  2ELA A;  5D3X A;  1L18 A;  1OVK A;  2Q13 A;  4WMG A;  3AZ4 A;  2LZT A;  4YXC A;  1G7M C;  4H9C A;  1WQP A;  3OAN A;  2EKS C;  237L A;  256L A;  4TWS A;  3RUN A;  4EXM A;  1JKB A;  200L A;  2Y8P A;  1DPW A;  1QQY A;  4NSH A;  4EOF A;  4ZIX A;  1OWY A;  3ZVQ A;  1V61 A;  186L A;  1QUG A;  5B06 A;  1CJ9 A;  5C5B A;  1CKD A;  2J0K A;  1QUS A;  1L73 A;  1SQ2 L;  2DQC Y;  3PBL A;  1I1Z A;  3ULC A;  1JTO L;  3PSC A;  1IY4 A;  1PLS A;  1G0K A;  1L10 A;  2HEA A;  2D9W A;  1L16 A;  1I2H A;  1GB3 A;  1LMQ A;  209L A;  211L A;  3A90 A;  3WPK A;  2B6W A;  1GXV 2;  3T6U A;  2HTX A;  1L29 A;  3AZ7 A;  3HTB A;  1L89 A;  1MPH A;  1L75 A;  1C64 A;  1K5G B;  1UCO A;  1LYD A;  1CKH A;  1I7A A;  1C08 C;  2LZM A;  4NGY A;  5APE A;  1F6S A;  4LDO A;  1IY3 A;  3U8Z A;  4HDQ A;  2RGN B;  1L60 A;  1SGH A;  2MKR A;  1YKX X;  4ARQ B;  5E4P A;  1HEO A;  2W1X A;  1XX0 A;  2HE7 A;  2BQK A;  2YS1 A;  3P65 A;  1NTY A;  3HUK A;  123L A;  143L A;  1MLC E;  2LKO A;  2MEH A;  2YBL A;  1LJF A;  1IWX A;  3G3V A;  5A3E A;  178L A;  4Z2N A;  1XEK A;  3FA0 A;  1W1G A;  4EMO A;  1SWZ A;  1IX0 A;  3HH4 A;  4XJG A;  2ZIJ A;  2CRF A;  5JEN B;  1GF7 A;  1J0W A;  1PQK A;  2OTY X;  3C8R A;  1WQR A;  1P6S A;  2Q9E A;  4NHS A;  3VOQ A;  157L A;  1KIR C;  201L A;  2RBP A;  2W1Y A;  5FI0 A;  1UC0 A;  240L A;  1HFZ A;  160L A;  1L93 A;  1LLH A;  1BTN A;  1P3R A;  2LOX A;  4QY9 A;  3SB6 A;  4NIJ A;  1TQZ A;  1L57 A;  1LZC A;  1B5X A;  5I4Y A;  2Z0O A;  3GXR A;  1LZS A;  1SHC A;  4XYY A;  4UWN A;  3HT6 A;  3B72 A;  3AB6 A;  1GE2 A;  1YAM A;  223L A;  4F7G A;  3NYA A;  1D9W A;  1LYZ A;  4HPE A;  5LVG A;  4Z41 A;  1MIX A;  1L34 A;  4WLY A;  1XGR C;  2ZWB A;  3C83 A;  1WQQ A;  4W53 A;  2NWD X;  1NDG C;  3LZ2 A;  3K3T A;  4KT3 A;  1NU2 A;  2CY5 A;  3D3D A;  3HDF A;  2W2X C;  1J1P Y;  1L31 A;  7LYZ A;  1DYG A;  1W08 A;  158L A;  1N4F A;  4I7O A;  113L A;  1P5T A;  2Z2F A;  2MEE A;  1IO5 A;  1YKY X;  1OQN A;  1MK7 B;  3WYF B;  1GB8 A;  1UNR A;  1LHM A;  3PVW A;  2EIZ C;  227L A;  4J7V A;  2F4G A;  1GBO A;  4HTQ A;  1D6P A;  3A6C Y;  3SN6 R;  4PQ0 A;  1B7O A;  2Z37 A;  3LYZ A;  2Z18 A;  4ET9 A;  2W1L A;  4LZT A;  2ELB A;  1H10 A;  3TO1 A;  1GBW A;  1YAP A;  1T6H A;  168L A;  1L71 A;  1W1H A;  1KI1 B;  1P3N A;  5LON B;  2LG1 A;  3MDB C;  3GUJ A;  1AT6 A;  4HV2 A;  2H9K A;  2DX5 A;  4DWX A;  4XJF A;  4G4C A;  1UNQ A;  2BQL A;  3CT0 A;  4GCD A;  4A7D A;  4HTN A;  1UIB A;  1G7H C;  2F47 A;  2MEC A;  4WLT A;  1IP2 A;  5KKI A;  5HE1 A;  2DBT A;  1C6N A;  2W1M A;  4ETC A;  1OUJ A;  2DQG Y;  1LMA A;  1C46 A;  183L A;  1IOC A;  1L30 A;  3DKE X;  2YBM A;  1P64 A;  2QAR C;  4NHI A;  5B1G A;  3VW7 A;  2EPE A;  4XJH A;  128L A;  3HT9 A;  1C67 A;  2DHI A;  1LI3 A;  2IGC A;  1NF5 A;  2XTH A;  1QUD A;  1LTM A;  4C0A A;  2A4T A;  1OY2 A;  1GFH A;  3AJN A;  5JLJ B;  2B6Y A;  2RNR B;  3FE0 A;  1CV0 A;  4O34 A;  1B6I A;  1HMK A;  4PRQ A;  1SX2 A;  1KIP C;  1XOD A;  4WVF B;  4DXA B;  114L A;  1L68 A;  4NGO A;  4BBK A;  1IC5 Y;  4LFX A;  2CAY A;  4DDA A;  2MDX A;  3HUA A;  3M1I B;  1CUQ A;  3RW8 A;  2ANV A;  4H9F A;  3ZEK A;  1XGQ C;  1REM A;  5HNC A;  4M4O A;  2BQC A;  4KHA A;  1L28 A;  1IEE A;  1QTC A;  3WW5 A;  4GN4 A;  1GHL A;  1L0K A;  5APC A;  1JKA A;  1GBZ A;  4DAJ A;  2D9Y A;  4LT3 A;  3V2Y A;  5L3I A;  1DI3 A;  1LSB A;  1LYH A;  1L76 A;  3J6K A;  220L A;  5E9R A;  132L A;  4A6F B;  1QQG A;  1BWN A;  1L86 A;  2EMT A;  2YBI A;  1IP7 A;  1G0J A;  4ZRJ A;  2HEC A;  1QT7 A;  1DRO A;  3C7Y A;  1L91 A;  4WM4 A;  1AKI A;  3EO5 A;  2Z12 A;  1DBH A;  1GG3 A;  1NI2 A;  2G4P A;  2IHL A;  1OUF A;  1IIZ A;  1DQJ C;  1HFX A;  1L42 A;  1GAZ A;  1JTT L;  7LZM A;  4PJ2 C;  3WU8 A;  1HER A;  1ISN A;  2Y8F A;  1VFB C;  4LDE A;  3WUN A;  1AQC A;  1BTK A;  1CU2 A;  3C80 A;  4LT2 A;  1LHK A;  1LGU A;  4W56 A;  3OE9 A;  1EGX A;  1JSE A;  1UUZ C;  3HH5 A;  1L84 A;  2BCJ A;  4OOO A;  5DLA A;  206L A;  1D0M A;  4Z2M B;  3CSZ A;  4XJB A;  2W2W A;  3LHM A;  5KXM A;  4GXB A;  3HU9 A;  130L A;  2LOZ A;  1QTH A;  250L A;  4PJZ A;  3CDO A;  4MY6 A;  4H9H A;  162L A;  3X23 A;  1QT8 A;  3OK0 A;  5A3Z A;  3KRW A;  1GFA A;  3CSR A;  1JIY A;  2M14 A;  4IFS A;  3SBA A;  142L A;  4ML7 A;  4LGK A;  3GUP A;  1F10 A;  2DA0 A;  5F9X A;  1GBX A;  1L85 A;  4DDC A;  1DKJ A;  150L A;  3G3X A;  3A34 A;  1GC7 A;  5C6R A;  4B4I A;  2M38 A;  4DX8 A;  5JP4 A;  4WG7 A;  148L E;  4NSI A;  1L08 A;  248L A;  4MR1 A;  1XR0 B;  1BWH A;  1YIL A;  119L A;  4HAW B;  2ANX A;  3GUN A;  1IP4 A;  3HH6 A;  3ML4 A;  5I53 A;  2QKL A;  3WPJ A;  2YSS C;  1L64 A;  1H4R A;  2DQJ Y;  1LJ3 A;  4ETD A;  2DHJ A;  3D8E A;  3SNH A;  1OUH A;  2DFK A;  4CHJ A;  249L A;  3QNG A;  2C8O A;  1RFP A;  4B4J A;  5KXN A;  4XAD A;  3SP3 A;  127L A;  6LYZ A;  254L A;  4YOP A;  1MKE A;  4J1B A;  1LSG A;  4DDB A;  4Z3M A;  3GUL A;  4GMV A;  4PNK A;  1JQU A;  252L A;  1L95 A;  214L A;  1GFR A;  1B5Z A;  1T8G A;  5LA5 A;  1J1X Y;  2COA A;  2D4J A;  5KJ9 A;  1BAK A;  1C6L A;  4BAP A;  184L A;  4NGZ A;  2R09 A;  1IOQ A;  2XBS A;  1IWT A;  135L A;  1C6E A;  1L27 A;  3F9L A;  4XN6 A;  1DYE A;  3HU8 A;  3QBV B;  1L87 A;  2ZQ4 A;  1LWG A;  131L A;  4MK0 A;  3PDS A;  1LW9 A;  2RBS A;  1RJC B;  1P37 A;  1QUH A;  4H9E A;  4MCK A;  6LYT A;  4GLA A;  4HB0 B;  4GMX B;  2RB0 X;  4PHI A;  4UWU A;  4TTD A;  1GEV A;  1LZ9 A;  2B6X A;  2OQB A;  4K5Y A;  212L A;  3CIK A;  1WVH A;  3TXB A;  2HU3 A;  2YBN A;  4I7L A;  4H8S A;  5HMJ A;  2NMB A;  1M7E A;  1EQE A;  1L00 A;  4LT0 A;  4LZM A;  2G35 A;  3TXD A;  1XJU A;  4S0W A;  1LZG A;  2MEI A;  1KXW A;  4PGJ B;  1B7L A;  1IWY A;  3U7D A;  3IWR A;  3DN3 A;  4NHQ A;  198L A;  3KY9 A;  5KXT A;  1JTN A;  1I56 A;  3PG7 A;  2YDG A;  1ALC A;  5J3T A;  2OTX A;  3WH1 A;  2KGX B;  5D3V A;  1B5V A;  1D0K A;  2DHK A;  5JHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...