4IAPA

Crystal structure of ph domain of osh3 from saccharomyces cerevisiae
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
256
structure length
256
Chain Sequence
GRYLQGYLLKKRRVDNIFEMLRIDEGLRLKIYKNTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYVDQGFKKRFFTLDFRYGTLSYYLNDHNQTCRGEIVISLSSVSANKKDKIIIIDSGMEVWVLKATTKENWQSWVDALQTCFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of osh3 reveals a conserved mode of phosphoinositide binding in oxysterol-binding proteins
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Lipid binding protein/ hydrorase
molecule keywords Oxysterol-binding protein homolog 3,Endolysin,Oxysterol-bind
total genus 76
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2012-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00959 Phage_lysozyme Phage lysozyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.530.40 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 4iapA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4iapA01
2OTYX 3DKEX 1LYHA 4W52A 1FB8A 4A5KA 1L34A 3DXEA 184LA 1BTNA 2GCLA 3AU4A 3PSCA 241LA 1L02A 1L79A 1H10A 1Q67A 1BAKA 3G9WA 3DN4A 5LOPB 255LA 4KVGB 1L48A 129LA 3HUQA 1L93A 1L43A 232LA 2CUUA 1D3MA 1KS3A 4I7KA 1XD4A 3HTFA 170LA 1L32A 3CXBB 1WI1A 109LA 3QAKA 3HTGA 2ANXA 3OE9A 4NY0A 125LA 4HAWB 1QTDA 2UZSA 1L06A 3NY8A 5HE0A 3VOQA 1L13A 143LA 258LA 2J59M 3QIJA 1C6IA 149LA 3SN6R 4BBKA 1L12A 172LA 1EAZA 1QT8A 3JR6A 2VSZA 3WA0A 3PP2A 5J3YA 3FA0A 139LA 2J0KA 3DXCA 3CDRA 178LA 4K2PA 3GUJA 1P64A 158LA 1L11A 148LE 2J0MA 115LA 1L47A 2B6TA 3CDQA 1D3NA 1OVHA 1RJ2A 3ZDTA 1C6MA 5D3XA 2B72A 1C6JA 1C6AA 1CUPA 2P0FA 5LZMA 3PVUA 2OTZX 3G3XA 159LA 2R09A 1DYAA 1L23A 4DBBA 1X86A 3A98B 2LULA 2E2XA 1XR0B 2B75A 1G06A 108LA 2RB2X 1QC6A 4L6EA 3HK0A 5D27A 3GUKA 1V5UA 1L80A 1PQOA 3SUZA 1FAOA 1L90A 3HT8A 1XODA 4CHMA 259LA 2AEHA 3ML4A 187LA 2G35A 1XCGA 2RNRB 1CV0A 2K2JA 3FADA 2LCBA 1C6NA 1L83A 3LZMA 4YONA 1UEFA 2COCA 4K81A 1BWNA 2I1JA 4W59A 1B55A 2UZRA 5J3QA 1L94A 169LA 5JP4A 2D10A 2RAZX 1WJ1A 205LA 1LB1A 212LA 7LZMA 1T8FA 1L66A 1U5GA 1L18A 2D9VA 131LA 3HWLA 177LA 2L78A 1L33A 4HHVA 1NTVA 175LA 1SX2A 2B6YA 1T6HA 113LA 1P2LA 171LA 112LA 5DH9B 1P36A 3O96A 1XJUA 1GC6A 1GG3A 2NMBA 5DI9B 3HUAA 1L0JA 1L59A 3M1IB 1AQCA 1DDVA 4W57A 4ARMA 1E5WA 4A6FB 1L41A 3HDEA 200LA 3MPXA 4PJZA 4Z2MB 1L85A 1DBHA 3SYXA 195LA 2DHKA 1L04A 4HAZB 3FI5A 3UONA 2CY5A 2EMSA 182LA 1FOEA 4K17A 1G0MA 1L31A 1WGQA 5HE3A 3HQCA 245LA 1EVHA 1LWGA 240LA 227LA 2DA0A 1LI6A 2L1CA 1CU3A 2OTXA 4A6KA 3AU5A 4A6FA 1P2RA 4W54A 4LZMA 3SB6A 2ELBA 2Y8GA 1U29A 1G0PA 1L10A 1L56A 2EJ8A 3GUNA 1C69A 3C81A 3FM8C 1OVJA 2OEAX 4PNKA 107LA 167LA 2D9XA 3BINA 5C6RA 1L45A 1OV5A 2W2XD 4MK0A 1LW3A 4MT7A 1TJ6A 1W1GA 4DKLA 2GCJA 244LA 2X18A 2LC9A 1K28A 2OE9X 1WVHA 2V76A 1L61A 218LA 3HH3A 180LA 4EKPA 1AWEA 122LA 1KY1A 4HB2B 1C6LA 1W1HA 183LA 4GMXB 1L72A 1OWZA 2HUKA 3DN3A 1L30A 1T97A 2ANVA 3GUOA 4ARJA 1C6DA 256LA 2R0DA 3GUPA 4Z2NA 1OVKA 4CYEA 188LA 2YS3A 4EMOA 1JQUA 1QTCA 1C67A 4K5YA 4EPFA 1L91A 2RBSA 2DHIA 4YX7C 215LA 1C63A 1L39A 1L19A 4W58A 1P3RA 1J0WA 1WJMA 1X1FA 3A8PA 2RBRA 2UVMA 1QUDA 3KSYA 3DMXA 4DX8A 3L64A 2Z0QA 3HH6A 3SO6A 1L52A 3SV1A 236LA 238LA 2I5CA 1C64A 1CV5A 4PK0A 2ROZB 1LLHA 185LA 3C7YA 225LA 2HUMA 3DXDA 2D9WA 4I7SA 192LA 1L58A 222LA 2RUKB 151LA 1P6YA 2QB0B 4DXAB 4IOYX 1L98A 3X23A 4ZRKA 4HAXB 4EPIA 1X05A 3C7WA 4I7OA 4DAJA 1L50A 1CV1A 1P7SA 3GYPA 216LA 3DN2A 1C6PA 209LA 220LA 1IRSA 1PMSA 3LJUX 219LA 2K00A 4W53A 2HULA 2CRFA 261LA 1L67A 1QT5A 3F5RA 3QBVB 4F7HA 1C6QA 1L44A 1C6FA 2IYBA 4EJNA 3F9LA 1LYDA 146LA 1V5PA 1L97A 1L60A 4HB0B 1OYUA 2CY4A 2OU8A 3L2XA 1U2BA 1QT4A 3U8ZA 2L2IA 2Q9DA 2RBNA 1L26A 2CAYA 3SNHA 1L81A 4I7NA 118LA 3VIAA 5JLJB 3UZTA 1OY2A 4S0WA 1L0KA 4I7QA 4MY6A 160LA 186LA 228LA 2D9YA 4ZRJA 4PQ0A 1DYBA 1L42A 1EF1A 1Y19B 2RGNB 152LA 165LA 2JP2A 168LA 3HUKA 4W56A 1DROA 1KW7A 2LKOA 1L15A 1CX7A 3DN0A 3HH5A 2IGCA 4I7RA 4HAUB 1QTHA 1G0LA 3HT9A 2B70A 1L05A 2MDXA 1U5FA 3SB8A 3C7ZA 4B6HA 5KQ4A 4HB3B 1M7EA 1I7AA 1I6SA 1UPRA 4I7MA 1X1GA 2DTCA 1L73A 5LONB 1QT7A 1CU0A 3TW1A 126LA 1WG7A 1C6HA 1L68A 123LA 1C6BA 1FGYA 233LA 2F32A 2Z0OA 1KNIA 1C6CA 252LA 104LA 1LYFA 1L22A 119LA 162LA 1UNRA 1LW9A 1FHOA 128LA 2RB0X 1D2WA 211LA 1DYEA 2M38A 1NI2A 1L21A 3RZEA 2MFQA 3ULBA 1L01A 1L27A 3NYAA 2N0YA 2YVCA 4YXAC 5GOWB 2Q9EA 217LA 4E97A 2LOXA 1PFJA 3A8QA 4KAXB 1L16A 5DIFB 3U7DA 2B6WA 4EKUA 2DYQA 1XX0A 199LA 1ZWNA 164LA 3G3WA 1ZYTA 221LA 4ARQA 1GC7A 2DYNA 138LA 5C5BB 2QKLA 1QUHA 137LA 2HTHB 2DKQA 1C6KA 1ZC3B 1L71A 213LA 254LA 3T06A 4P7IA 3DN1A 3DNAA 3C8SA 1M7RA 1K5GB 1CX6A 1G0JA 1MK7B 142LA 4HATB 3TCAA 2NZ8B 1G07A 1L63A 2Y7BA 1CU5A 2XQNM 253LA 2H7DA 3PG7A 1X11A 3D8FA 4GN1A 2YT0A 1OQNA 2ELAA 111LA 1C6GA 3D8DA 4ZRIA 1SX7A 4HAVB 2N23A 2QKMA 4W55A 2D2QA 1CU6A 3KRWA 3ODOA 3DMVA 1KW5A 1L14A 1FGZA 2H7EA 3PVWA 3RCPA 6LZMA 3PZDA 3WYFB 1L82A 3AJ4A 155LA 5DHFB 1G0QA 110LA 1V88A 1W1DA 1L46A 4K2OA 1G1WA 1L96A 1CU2A 1ZC4B 1DYFA 1C65A 1G0GA 3C8QA 1PQJA 5JHGA 5D3YA 1SSYA 3HU8A 1LYJA 1P6SA 2F47A 173LA 1L75A 4I7TA 1DYNA 2DX5A 4I7PA 2COAA 1K5DB 1L20A 3FEHA 3NSUA 1MKEA 2B6ZA 1C66A 4WSFA 234LA 1L77A 2Y8FA 2I1KA 1L57A 1N3HA 1L08A 1QTBA 4LDOA 166LA 1L35A 1LGXA 114LA 1L24A 1KZ7A 2GJYA 210LA 3HTBA 4GRVA 1LWKA 2OU0X 2MKRA 2YS5A 3GYOA 4WVFB 5D3VA 3C83A 1UNQA 1G1VA 1L37A 2CODA 3DN6A 1ISNA 230LA 1V61A 1U5EA 3HDFA 3HW2B 2I5FA 1L25A 224LA 2RBQA 156LA 176LA 1P3NA 1L95A 1ZURA 5JHHA 206LA 1LYGA 130LA 1PQDA 147LA 1SSWA 2BCJA 3G3VA 3OE6A 5DHAB 4F7GA 144LA 1OMWA 2EC1A 214LA 2RLOA 2B74A 1ZM0A 4A6HA 1MIXA 3MDBC 3TVVA 246LA 1D3JA 4OO9A 2P0HA 1OV7A 1SWZA 3PBLA 1V5MA 1QUOA 1CV3A 3PEGA 4EJ4A 4HDOA 5J3TA 2LOZA 4ARQB 2D11A 5KCVA 262LA 2RBPA 3C80A 190LA 242LA 4HAYB 3HT7A 4ARPA 2AL6A 191LA 2RVBB 3ZVRA 2PZ1A 2P0DA 3CDOA 5CLQB 1MPHA 1L40A 1SHCA 4GBRB 2VRWB 1CUQA 3GUMA 1I2HA 1L09A 1XJTA 1L62A 1UNPA 2VKIA 5C16A 1MAIA 102LA 2DX1A 4TKNA 5L81A 1KI1B 2YT1A 1L38A 1EGXA 1L69A 2NTHA 2GS0A 2RB1X 3SB5A 3SB7A 1DDWA 4IAPA 2K2UA 174LA 2RH1A 1LPYA 2Z6BA 2YS1A 2OE7X 3K2RA 1QT6A 1G0KA 1KZGA 1L51A 2A4TA 5C79A 2M14A 1C6EA 1L92A 248LA 231LA 1D9WA 1L49A 2LG1A 5EFXA 3C8RA 1P46A 1QS5A 247LA 260LA 4EXMA 2OE4X 1CTWA 2Q13A 4WJ7A 1C61A 1RRPB 1J19A 201LA 249LA 3QWMA 2KGXB 150LA 196LA 1D2YA 4YL8A 3CDTA 3D4SA 127LA 3GUIA 1DYGA 2J0JA 4CHJA 3F0WA 3NY9A 3OANA 3EMLA 3KRXA 1P37A 189LA 1XEPA 4I7LA 2DKPA 1ZSQA 1L54A 3TFMA 3C82A 2LYDA 2O7AA 4W51A 4DX90 2OQBA 1P5TA 4C0AA 4KHOA 4ARLA 229LA 3SBBC 2OU9A 1TQZA 1MK9B 1XKEA 1NTYA 1QTZA 2RAYX 1QS9A 157LA 3HH4A 2Z0PA 3ODXA 161LA 257LA 3TO1A 226LA 1ZVRA 5CLLB 1L29A 237LA 1QQGA 3KY9A 235LA 5HE2A 2NTGA 1QT3A 4EKRA 2W2XC 103LA 1Y5OA 2ZPYA 4HB4B 120LA 1L65A 1TXDA 3P7ZA 3V2WA 163LA 1DYDA 1C68A 3IVFA 1WTHA 3DMZA 2F2QA 1L64A 1L84A 198LA 3FSSA 141LA 3SB9A 4GXBA 4GPTB 4AQNA 1QSQA 3RUNA 1FHWA 5D3WA 2DN6A 3OE0A 2DHJA 1L70A 2B73A 1Z87A 1C62A 1L99A 3ODUA 4ARMB 3KZ1A 3ODWA 223LA 3HU9A 3F8VA 1LI2A 2DLWA 1L03A 4LDLA 2RSGA 4LDEA 2KCJA 4H8SA 1NHBA 1TLAA 1UPQA 1L74A 1LYEA 3HTDA 1NU2A 4DJHA 2COFA 4TYZA 2FJLA 2B6XA 4NSWA 3ULCA 1L55A 1MIZB 4EKQA 1CV6A 1V89A 1L86A 2D4QA 3V2YA 5FI0A 2RBOA 2O79A 4EKSA 3N7CA 2DFKA 1KY0A 2EMTA 3GULA 1PQIA 2LZMA 1SGHA 1L17A 1L28A 1PLSA 4HDQA 5C5BA 2YRYA 1C6TA 2IFSA 3CIKA 2O4WA 3V5WA 4YXCA 145LA 1L76A 1LGWA 4D0NB 1DDMA 4GMVA 1B6IA 1EPYA 1PQKA 1JTMA 1LGUA 239LA 3DN8A 1OWYA 3D8EA 1PQMA 1FHXA 2W2WA 2YF0A 1L00A 2YSZA 4F7UP 1LYIA 5KQ1A 1L89A 4ZPUA 4Y94A 1SWYA 1P5CA 197LA 2D9ZA 1P56A 4XWXA 181LA 1CVKA 1QTVA 4IFSA 1L88A 1D3FA 1L87A 1U27A 2HE7A 1JTNA 1L07A 1L36A 2B7XA 1U5DA 2KUPA 1CV4A 3CDVA 1T8AA 3OE8A 4GZUA 4KHAA 5HE1A 3SBAA 1H4RA 140LA 2ADZA 251LA 2QARC 3VW7A 1QUGA 2MWNB 3PDSA 1LI3A 1L53A 3HT6A 3P6AA 4KHBB 1QSBA 1WGUA 3BJIA 2P8VA 2ROVA 1BTKA 243LA 3PVLA 5FI1A 1C60A 250LA 4I7JA 1DYCA 5I14A 1T8GA
chains in the Genus database with same CATH superfamily
4W52A 1LYHA 3P4ZA 3DXEA 241LA 1WTMA 1FDLY 1L02A 1JPOA 1Q67A 5F81A 1MELL 3G9WA 129LA 2BLXA 1LHHA 3A34A 4RLMA 1KS3A 1L32A 1WI1A 3HBEX 109LA 2ANXA 4RW2A 2J59M 143LA 258LA 3BKHA 1DI5A 3RZ4A 1L12A 3IWRA 2VSZA 3ATNA 139LA 1WQNA 3WH1A 115LA 1GB5A 1OVHA 5KXZA 1C6MA 1UIFA 2B72A 4HV2A 1B7NA 193LA 1FLUA 4LYTA 1XR0B 4OOTA 108LA 4HJZA 3HK0A 1DKJA 2LZTA 4B4EA 2K49A 2MEEA 1GB0A 4HPIA 1XCGA 3B0OA 1YAPA 3FADA 1JISA 2LCBA 4YONA 1UEFA 1N4FA 2BQEA 2RRFA 4ETAA 3P66A 5APFA 4H8XA 205LA 5KKIA 7LZMA 3CXBB 1L18A 2L78A 4HHVA 1CKGA 113LA 4LYZA 1P36A 1GG3A 4WM1A 1AQCA 1DDVA 4A6FB 3NWDA 1L85A 1B7MA 195LA 2DKVA 2ZKMX 4HAZB 2EMSA 2DQDY 1GB8A 1KXWA 1B5ZA 5FEKA 1ALCA 1EVHA 1NHEA 2BQNA 1LI6A 2OTXA 2W1MA 3W6CA 3SB6A 2Y8GA 2EJ8A 3C81A 3NWAA 1OVJA 167LA 4B49A 3BINA 3WXTA 2A7DA 1OP9B 1LW3A 5KXSA 4TWSA 1RI8B 2LC9A 1WVHA 2V76A 3HH3A 4HSFA 4EKPA 1LHKA 3NW8A 183LA 1L72A 2HUKA 1VDTA 1T97A 256LA 1SLYA 3LZ2A 1IC4Y 4Z2NA 2YSSC 2YS3A 1JQUA 5FCPA 1QTCA 1C67A 4K5YA 5LVJA 1IR7A 1L91A 2DHIA 4WM5A 1C63A 4W58A 1J0WA 1X1FA 2RBRA 4DX8A 3DMXA 1SQ2L 3L64A 3SV1A 236LA 3AZ5A 1GAYA 3C7YA 1VATA 5DN4A 1L58A 222LA 4H8YA 1P6YA 4IOYX 208LA 4CHXA 1OUBA 2Z38A 1TDYA 1X05A 4DAJA 1P7SA 1IRSA 4ETDA 2CRFA 4Z3MA 1B7LA 4J7VA 2IYBA 4EJNA 4HP0A 4RW1A 1L97A 2CY4A 1NDMC 1A2YC 4I7NA 1OY2A 4Z41A 1L42A 3TMXA 2A7FA 2HEBA 3HH5A 1YKYX 2B70A 1L05A 2DQFC 3C7ZA 4H9EA 1IWWA 1I6SA 4I7MA 2DTCA 1L73A 1QT7A 1CU0A 123LA 1FGYA 4TSBA 1BHZA 4XJBA 1L22A 2BQKA 1FHOA 1LW9A 1F10A 2RB0X 1DYEA 1L21A 3RW8A 5LAGA 2YVBA 2Q9EA 4QY9A 4E97A 2LOXA 3A8QA 5DIFB 3G3WA 221LA 4KHBA 1GC7A 1D0MA 137LA 2DKQA 2HECA 4NGLA 4Z46A 3DNAA 1G0JA 3TCAA 3A90A 3FI7A 253LA 2H7DA 1LZGA 2R2YA 153LA 3D8FA 2I25L 4GN1A 1OUDA 1JIYA 111LA 3D8DA 4ZRIA 2QKMA 2D2QA 1CU6A 2Z18A 5D5CA 1KW5A 1FGZA 3PVWA 3PZDA 1L82A 2AUBA 2F4GA 1L96A 4KT3A 1NWGA 3C8QA 4LFXA 1SSYA 5L3IA 1LYJA 4LT3A 2F47A 1MLCE 1XGRC 1DYNA 207LA 1LHIA 3FEHA 1HEQA 1LMQA 4Z98A 2B6ZA 1C66A 2Y8FA 4NGWA 1L08A 1AKIA 3QNGA 4IJ4A 1LWKA 2YS5A 1UIHA 2CODA 1WQMA 1ISNA 4HJVA 3HW2B 3HDFA 3WMKA 156LA 2G4QA 3WYHA 2BCJA 4F7GA 3OE6A 1QSWA 1OMWA 3WU7A 1GF9A 2B74A 1C45A 1GEZA 1YL0X 1OUEA 1RE2A 1MIXA 246LA 2RSCA 1D3JA 5DN5A 4OO9A 1OV7A 5KY1A 3PEGA 1C7PA 5J3TA 4ARQB 4LZTA 2EQLA 2D11A 262LA 2RBPA 3C80A 2DBTA 4CJ2A 242LA 4HAYB 1LJFA 4MSTA 191LA 3FVCA 1SHCA 1LJKA 2FJUB 102LA 1OUAA 1KI1B 1L69A 2NTHA 2RB1X 3SB5A 1DDWA 3AGGG 1HEMA 3K2RA 4DIXA 5C79A 1C6EA 248LA 1BVKC 1L49A 4NSHA 5EFXA 1FN5A 3N9EA 5FSTA 4EXMA 4N1EI 4GLVA 2W1LA 1C61A 2Z2FA 249LA 1B9OA 196LA 3W6BA 2J0JA 1LMPA 3OANA 4H9BA 189LA 4I7LA 5LIOA 3TFMA 3C82A 2HEDA 4W51A 1IVMA 1GXV2 5LYZA 4C0AA 3SBBC 1MK9B 1XKEA 4LYMA 3GXKA 1BWIA 2Z0PA 257LA 3TO1A 1ZVRA 1LJIA 3EXDA 4H91A 1QT3A 4WMGA 2W2XC 120LA 1L65A 3WW6A 1C68A 1IWZA 1L84A 198LA 1KXYA 4GXBA 1QQYA 1YAMA 2DN6A 1LSBA 1IWVA 1Z87A 1XGPC 1JITA 4ARMB 5B05A 223LA 1LZEA 2KCJA 1B5UA 1LYEA 1YAQA 1LZNA 4DJHA 2FJLA 1GF8A 1MIZB 1V89A 1CV6A 1L86A 1YQVY 4II8A 4DD3A 2RBOA 4EKSA 4G9SA 154LA 1KY0A 2DFKA 4NHTA 1SGHA 1L28A 5C5BA 2IFSA 2O4WA 1LZSA 1GFKA 1LGUA 1JKBA 239LA 1OUIA 4WL7A 1FHXA 1L00A 2XTHA 1I1ZA 4GCFA 5KQ1A 4A7DA 1P5CA 3CSZA 181LA 1CVKA 5APDA 4IFSA 1EQEA 1HFZA 2HE7A 1L36A 2B7XA 5LA5A 1B5YA 4KHAA 5C6JA 1LOZA 5K7OA 140LA 3LYZA 2ADZA 3M3UA 2ZILA 1QUTA 3P68A 4KHBB 1QSBA 2ROVA 3A96A 4H1PA 3OHMB 3DKEX 1L34A 4G49A 4NSJA 1L79A 1BB3A 1BAKA 1UIAA 3DN4A 1BVXA 255LA 2CWIA 4PPOA 4WOAA 1J1PY 2LHMA 1HERA 4J0LA 1D3MA 3HTFA 194LA 4XJHA 3QAKA 1QTDA 2UZSA 1L06A 3VOQA 1L13A 1TBYA 3SN6R 1LHJA 4QDNA 4BBKA 2Z19A 1EAZA 5ILCA 3JR6A 3WA0A 4DD9A 1LZ4A 1LZ5A 4WL6A 4GCCA 1LHMA 3FA0A 3LN2A 178LA 4NGYA 5KXNA 1OUGA 1IP1A 2FBDA 4GOUA 5LYMA 3MGWA 4N9RA 3AGIA 3CDQA 3ZDTA 5D3XA 4J1BA 4WLDA 1C6AA 1CUPA 2P0FA 2Z59A 3G3XA 159LA 5KJ9A 2R09A 1DYAA 1L23A 1X86A 2YBMA 2E2XA 1XEKA 1G06A 4HTQA 1F0WA 3GUKA 1DXJA 3DCXA 1FAOA 1L90A 3HT8A 4CHMA 1IC5Y 5F14A 1JKDA 5JENB 3BKVA 5AMYA 2COCA 5J3QA 2UZRA 1GBSA 5JP4A 1QDRA 1CJ9A 1LB1A 1Z55A 1L66A 4OWHA 1U5GA 131LA 1T6HA 1GE2A 5DH9B 4WLXA 1GB6A 2NMBA 1H87A 1L0JA 4L41A 1L59A 3M1IB 4W94A 4W57A 1E5WA 1L41A 2VB1A 4Z2MB 3WW5A 2BQLA 2DHKA 1L04A 5B06A 3UONA 182LA 1L31A 5HE3A 1B5WA 3HQCA 245LA 2L1CA 1BB4A 1CU3A 1UA6Y 3AU5A 4IASA 1P2RA 1LJHA 1U29A 1B7SA 3ZVQB 3AB6A 1GFVA 1L45A 4AGAA 2BQIA 1G7IC 3WL2A 4MT7A 1DPXA 1W1GA 2KIEA 2GCJA 1ZVYB 1D0LA 1JJ0A 2X18A 2OE9X 3A58A 218LA 2XJWA 4HB2B 1C6LA 1W1HA 1JKAA 2MECA 5APEA 1LAAA 3GUOA 1C6DA 2R0DA 3GUPA 3AJNA 134LA 4C5FA 2BQJA 188LA 1O23A 3CSQA 1B7QA 2G4NA 3IJVA 4HPEA 3A8ZA 1QUDA 1IOSA 2BQFA 238LA 1E8LA 1CV5A 4PK0A 2ROZB 1LMNA 225LA 192LA 2RUKB 4OWBA 4DXAB 4HAXB 2N5ZA 4EPIA 1PS5A 5HMJA 1L50A 1CV1A 3GYPA 4HSIA 209LA 3LJUX 5KXMA 2HULA 261LA 1L67A 2DQHY 1C6QA 1C6FA 1V5PA 4HB0B 1HNLA 1QT4A 1YAOA 1YKZX 1IIZA 1AT5A 2RBNA 1DI4A 5I53A 4I7QA 160LA 2D9YA 4NEBA 1Y19B 165LA 1B0DA 1DROA 4DDBA 2IGCA 4HAUB 3HT9A 5I54A 4B6HA 2YBJA 3CT5A 2K8EA 1I7AA 1JSFA 1X1GA 1QIOA 1KNIA 4TSCA 2BQGA 1LYFA 5KXWA 162LA 1UNRA 4XYYA 1D2WA 1NI2A 3RZEA 4B4IA 3ULBA 2YVCA 4YXAC 2IHLA 2HU1A 4QJ5B 2ZYPA 1PFJA 4KAXB 4OT1A 1XX0A 199LA 3QY4A 1GF5A 1QUSA 1ZWNA 164LA 1LSCA 5I2MA 4D9ZA 2HTHB 2F2NA 1ZC3B 1INUA 4P7IA 1M7RA 1CX6A 4B0DA 4WM2A 5FELA 4LT1A 2Y7BA 1IOCA 3PG7A 2YT0A 2ELAA 2IFFY 3ATOA 4HTKA 3B0KA 4TTDA 2BQAA 4CFOA 6LZMA 3EMSA 5DHFB 1G1WA 1ZC4B 1C65A 1PQJA 5FHWA 3HU8A 1LMCA 2KIGA 1KIRC 1GD6A 4I7PA 1L20A 1MKEA 2BQDA 4WSFA 234LA 2I1KA 1QTBA 3WPLA 4GRVA 3GYOA 2MKRA 1LSEA 4GCDA 4MCKA 3C83A 1G1VA 1FKVA 3DN6A 1V61A 1U5EA 4ET9A 4HV1A 2I5FA 1VDQA 1L25A 4NSGA 2CDSA 2D4IA 1ZURA 130LA 147LA 1SSWA 144LA 1HFXA 3W6FA 2EC1A 2Z13A 1ZM0A 1JUGA 3TVVA 3A94A 3PBLA 1HC0A 1V5MA 1QUOA 2BQMA 4EJ4A 3RNXA 4KXIA 3A6CY 5KCVA 2ZQ4A 3TXEA 3ZVRA 1CKDA 2P0DA 2VRWB 1CUQA 1I2HA 1L09A 1L62A 2DX1A 5L81A 4ET8A 174LA 4HTNA 2YS1A 1JTTL 1GFJA 1QT6A 2M14A 1L92A 1D9WA 5B07A 4R0FA 1QS5A 4ZFPA 1IEEA 2OE4X 4NG1A 8LYZA 2EKSC 1LZ6A 1RJCB 4OOOA 1YANA 4YL8A 1IWXA 127LA 3F0WA 3KRXA 1GB2A 2DKPA 1BB6A 4QJ3B 1L54A 2LYDA 5FDJA 2OQBA 4KHOA 1C10A 1QS9A 3HH4A 2B5ZA 161LA 226LA 3WU9A 5LAFA 237LA 2NTGA 4EKRA 103LA 3LYMA 1TXDA 4DD1A 1DYDA 4ETBA 2F2QA 1PZYA 141LA 2ZNWY 4GPTB 1QSQA 1FHWA 2Z12A 3TMUA 3AW7A 2DHJA 1C62A 3TMVA 3HU9A 1LI2A 1L03A 4LDLA 1LYYA 2XBSA 1D0KA 4DD7A 1JTOL 1XEIA 1RFPA 1J1XY 2MEAA 3N9AA 2YBNA 4RDSA 4NSWA 1IP2A 5FI0A 3GXRA 5LINA 2D4QA 2W1XA 1LYZA 3N7CA 2Q0MX 1FBIX 7LYZA 1L17A 3CIKA 5I4YA 1GF7A 4DDCA 1LKRA 145LA 4D0NB 4NG8A 4XJGA 2KUQA 1B6IA 1EPYA 1LSNA 4YENA 3D8EA 1OWYA 3P65A 1PQMA 1QTKA 2YF0A 2D4JA 5EBHA 4F7UP 1LSMA 2FYDA 1HENA 1L89A 1LYOA 3AYQA 1VAUA 197LA 1ZMYL 1G7HC 1LJNA 1L87A 4LT2A 1LTMA 1U5DA 3OE8A 3CDVA 3SBAA 4RLNA 4ETCA 3TXHA 3VW7A 1WVVA 4LYCA 4B4JA 4I8SA 4ETEA 1BTKA 1T77A 3ZEKA 1DYCA 3T06A 4U3XB 1HSXA 1B2KA 3HUQA 1L43A 1AZFA 4UWNA 232LA 2MEFA 1UBZA 1XD4A 4PHIA 4I7KA 170LA 1GF4A 4NFVA 4LGKA 1LJ4A 3OE9A 4NY0A 125LA 2G4PA 1DI3A 1OUCA 1ZVHL 1C6IA 149LA 4NY5A 1QT8A 2NBVA 3AW6A 4WO6A 3DXCA 2J0KA 1I20A 1NBZC 3GUJA 1P64A 5LXWA 158LA 1L11A 2J0MA 4OSNA 1DPWA 1L47A 1UCOA 4UWUA 1RJ2A 3TXJA 1C6JA 3PVUA 2OTZX 4DBBA 3A98B 1GB9A 2LULA 4TX7A 4L6EA 1LCNA 2RB2X 5D27A 3LZTA 3VWOA 1V5UA 1L80A 1PQOA 3SUZA 1XODA 259LA 2AEHA 3ML4A 187LA 3WVYA 1CV0A 2K2JA 3T6UA 4BS7A 1XGQC 1C6NA 1L83A 3LZMA 1OUFA 4K81A 1BWNA 2I1JA 1UUZC 2BQHA 2D10A 2RAZX 1WJ1A 1IOQA 212LA 1GBZA 3HWLA 177LA 4GN5C 1CJ8A 1L33A 1GBWA 1MI1A 1EQ5A 175LA 1SX2A 1JHLA 2NWDX 4WLTA 1P2LA 5KXOA 2Z37A 1FLWA 3HUAA 1BB7A 4ARMA 3HDEA 200LA 3MPXA 4PJZA 1IY4A 3SYXA 2LYMA 3FI5A 4M6DA 3WUNA 1FOEA 1G0MA 1W6ZA 2H9JA 1RCMA 4N5RA 2HUBA 4DT3A 2DA0A 4A6KA 4A6FA 4NWEA 4W54A 3M18B 4LZMA 5L3HA 1HEOA 2ELBA 1G0PA 3GUNA 3FM8C 4NIJA 1T3PA 1LSZA 4PNKA 107LA 2D9XA 1F6RA 1OV5A 2W2XD 4MK0A 1HSWA 5A3EA 3WULA 1TJ6A 4DKLA 244LA 1GFTA 1OUJA 2HEEA 4LFPA 1AWEA 3CSRA 3QE8A 4GMXB 4NGIA 4NGKA 3DN3A 1L30A 2ANVA 4ARJA 4GN3A 1B5VA 1C43A 1GXXA 4D6WA 5A3ZA 4H9AA 2LYOA 2RBSA 3OJPA 215LA 5D5FA 4H9CA 1L39A 2UVMA 3KSYA 3LHMA 4XN6A 5I4WA 1G7JC 1L52A 1C64A 1LLHA 2HUMA 3DXDA 2D9WA 4I7SA 1B7OA 2D6BA 2BLYA 2QB0B 2YBHA 3X23A 1L98A 3C7WA 4I7OA 1CKFA 4WM4A 5KXXA 216LA 3DN2A 220LA 1GF6A 219LA 3D3DA 3QBVB 3WPJA 1L44A 2PC2A 2MEDA 146LA 2OU8A 1U2BA 2L2IA 2Q9DA 1L26A 2CAYA 1GFEA 3UZTA 1GE1A 4S0WA 4MY6A 2EPEA 4G4HA 4PQ0A 1DYBA 1EF1A 2JP2A 168LA 3HUKA 1UIDA 2ZNXY 4W56A 1KW7A 1L15A 1CX7A 1WTNA 2Z14A 4LT0A 4N0JA 1G0LA 1JWRA 3B0IA 2MDXA 5KXPA 4H92A 1M7EA 3A91A 1IP7A 2C8PA 1WG7A 1C6HA 1IWYA 4LYOA 1J1OY 1UC0A 2F32A 1C6CA 6LYTA 128LA 1BB5A 1P2CC 211LA 2M38A 1NF5A 1D9UA 1CKCA 2MFQA 5LG4B 3NYAA 1L27A 2N0YA 5GOWB 4EKUA 1GB3A 3U7DA 4B1AA 2DYQA 1XSFA 4DC4A 3A95A 1IC7Y 1ZYTA 4ARQA 4KPMA 133LA 1C6KA 4PGJB 213LA 2ZIKA 3B72A 3DN1A 1K5GB 4HATB 142LA 5HQ1A 4M4OA 1CKHA 1L63A 1B7PA 2XQNM 4NGZA 4W96A 1YROA 1X11A 1NQIA 3J4GA 1C6GA 4HAVB 1LJEA 4W55A 1BQLY 3ODOA 4WM6A 1L14A 2H7EA 2MEBA 3RCPA 2YT2A 3WYFB 3AJ4A 155LA 110LA 1W1DA 1L46A 1CU2A 1DYFA 2BQOA 4AXTA 1P6SA 2DX5A 173LA 4I7TA 2GV0A 1G7MC 4XJDA 1K5DB 3NSUA 5C6LA 1L57A 4LDOA 1L35A 1T6VL 114LA 1UIGA 3B6LA 1IY3A 210LA 3HTBA 5DLAA 4GNKB 4WVFB 5D3VA 1GEVA 1L37A 3WVXA 230LA 2DQEY 224LA 1LYGA 4ZIXA 5LVHA 3G3VA 2H5ZA 214LA 2RLOA 4CGEA 3MDBC 1LSYA 2P0HA 1LZDA 3HFMY 3AGHA 4HDOA 190LA 3TXBA 1W08A 3HT7A 2BAAA 2AL6A 2DQIY 2RVBB 3TXFA 1NKHA 4DDAA 2PZ1A 3CDOA 4DWXA 4GBRB 3GUMA 4H94A 1IX0A 1MAIA 5HNCA 4NGOA 3SB7A 1IP5A 4IAPA 2K2UA 1GE0A 2RH1A 4P2EA 1LPYA 2Z6BA 1KZGA 2LG1A 2H9KA 4QGZA 3AZ7A 4NHPA 1GBYA 1CTWA 2Q13A 1GAZA 1J19A 3QWMA 5KXKA 1WQRA 1EL1A 1LHLA 1DYGA 4CHJA 1LZ1A 4ML7A 4NHIA 4WG7A 3EMLA 4QXAB 1P37A 1XEPA 3SP3A 1ZSQA 2O7AA 6LYZA 1QTEA 2DQAA 5B1GA 4ARLA 4DQ5A 1C46A 2OU9A 1TQZA 1JSEA 1QTZA 1JEFA 1JJ3A 1HF4A 5IHGA 3ODXA 4OWCA 2BQBA 1FLQA 1UICA 235LA 3P7ZA 163LA 3W6DA 1WTHA 3FSSA 1XGUC 1NMMA 2X0AA 1WVUA 4OW1A 3OE0A 3J6KA 1L70A 1L99A 3ODUA 1GF3A 3KZ1A 3P64A 2CJLA 2RSGA 5II3A 1TLAA 1UPQA 1LZ9A 3HTDA 1LZAA 2COFA 2B6XA 3ULCA 1DKKA 4XJIA 2O79A 3GULA 2LZMA 4O34A 1UIBA 3G3AB 3V5WA 1REZA 4YXCA 1LGWA 1L76A 1DDMA 2HEFA 3G3BB 4GMVA 4R6CA 5M1YA 1LPIA 1PQKA 4NHSA 4XENA 3DN8A 2W2WA 1V7TA 2YSZA 2Z4DA 4FJRA 3TXGA 3F6ZA 4G4BA 4Y94A 1SWYA 132LA 2D9ZA 1P56A 1D6QA 1LZ8A 1QTVA 1L88A 1U27A 2KUPA 1VDSA 3RT5X 1GFUA 4HJYA 1CV4A 4GZUA 1T8AA 5HE1A 1LSPA 4DYGA 251LA 2QARC 1LSDA 1QUGA 4NWHA 2WARA 3PDSA 3HT6A 3NWFA 3P6AA 2DQGY 3BJIA 2P8VA 3PVLA 243LA 1FKQA 5FI1A 1CJ7A 3D9AC 250LA 2OTYX 1FB8A 3W3EA 4A5KA 184LA 1BTNA 2GCLA 3AU4A 2CGIA 3PSCA 3ZVQA 1IO5A 1H10A 1LYSA 1UIEA 5T3FA 5LOPB 4KVGB 1L48A 1L93A 1LMOA 1VEDA 1WQQA 2CUUA 1IWTA 2FBBA 4YF2A 4YOPA 2I6ZA 1AM7A 3HTGA 4NGVA 3W6AA 2BQCA 4HAWB 9LYZA 3NY8A 4I0CA 5HE0A 4F7HA 1EQ4A 3QIJA 172LA 2F30A 4WLYA 2MEIA 3PP2A 5J3YA 3CDRA 5KXTA 4K2PA 4CSQA 148LE 5LYTA 1OQMA 2B6TA 2EIZC 1D3NA 3LYTA 1NDGC 1QSAA 5LZMA 2LYZA 1LZCA 1CJ6A 5LVGA 1HFYA 4OWAA 4YEOA 1I56A 1QDTA 2B75A 4NHQA 1QC6A 5F9XA 4E3UA 1GPQC 3WXUA 2G35A 2RNRB 4L1RA 1D6PA 1KIPC 4W59A 1B55A 1L94A 169LA 1JKCA 2Z2EA 1REXA 2D9VA 1T8FA 3TXDA 1LZTA 2ZQ3A 1NTVA 2B6YA 4ANRA 3TMWA 171LA 112LA 4WG1A 3O96A 5DI9B 1XJUA 1GC6A 1YIKA 1GE4A 1LMTA 3RU5A 3FE0A 5M4YB 5I4XA 1LSAA 5IDDA 2I26L 1HMKA 1DBHA 1AT6A 5E4PA 2CY5A 4K17A 1WGQA 1IOTA 5L9JA 3HIEA 3B77A 1LWGA 240LA 227LA 4DD2A 1BWJA 4C3WA 4GCBA 4BAPA 1GE3A 4LYBA 1L56A 1L10A 1YILA 1C69A 5B59A 1XFPL 1IR8A 1IP3A 2OEAX 5C6RA 2DQJY 4QEQA 3AZ6A 4EOFA 1V7SA 1REYA 1XGTC 4H93A 1A4VA 1K28A 2MEGA 1L61A 180LA 122LA 1KY1A 3AZ4A 2D91A 1OWZA 2XBRA 3E3DA 1OVKA 4CYEA 2ZIJA 4EMOA 2Y8PA 4EPFA 4GN4A 4YX7C 1LJGA 1L19A 1P3RA 1WJMA 3A8PA 2Z0QA 3HH6A 3SO6A 1LJJA 2HEAA 2I5CA 4OWEA 185LA 3OK0A 151LA 1IWUA 1TEWA 4ZRKA 4XADA 4BAFA 1C6PA 1PMSA 1B7RA 2K00A 4W53A 3F5RA 4NGJA 1QT5A 4MR1A 2KR0A 3F9LA 1LYDA 3W6EA 1L60A 1OYUA 3L2XA 3U8ZA 1IP4A 1JJ1A 3SNHA 1L81A 5JLJB 118LA 3VIAA 2ZYCA 1L0KA 186LA 228LA 4CFPA 4ZRJA 2RGNB 152LA 3WU8A 2LKOA 3DN0A 4I7RA 1QTHA 5DM9A 1U5FA 1GFAA 3SB8A 4IATA 5KQ4A 4HB3B 1UPRA 1GF0A 5LONB 2C8OA 5E9RA 3TW1A 126LA 1GHLA 1L68A 3CT0A 1C6BA 3HBDA 1IP6A 233LA 5DL9A 2Z0OA 252LA 1GBOA 104LA 119LA 5B1FA 1YL1X 1L01A 3ULRA 3IJUA 3A93A 5KKJA 217LA 2ZWBA 1L16A 1GDXA 2B6WA 1LSFA 3U12A 1LZRA 2DYNA 138LA 5C5BB 2QKLA 1QUHA 1ZV5L 1L71A 4GCEA 2LZ2A 254LA 4GLAA 3KAMA 3C8SA 1MK7B 1F6SA 2NZ8B 5F16A 1G07A 4H9FA 5IRSA 1YKXX 1CU5A 1DQJC 3WUMA 5LVKA 1OQNA 4WO9A 3A3QA 4NSIA 1SX7A 2N23A 3CQLA 3KRWA 3DMVA 1REMA 1IR9A 1G0QA 4ZEEA 1V88A 4K2OA 4G4CA 5LA8A 1JTPL 1G0GA 5JHGA 5D3YA 1L75A 1HELA 1VFBC 2COAA 1L77A 1XEJA 2F4AA 5HLLA 1N3HA 166LA 1LGXA 1L24A 1KZ7A 4YM8A 2GJYA 1LSGA 2OU0X 4X3BA 2DQCY 5I5QA 1UNQA 3TXIA 5APCA 1FLYA 1B5XA 2FYCA 4FDYA 2RBQA 176LA 1P3NA 1L95A 1LJ3A 5JHHA 3LYOA 3TXKA 206LA 1PQDA 5DHAB 1ZYIA 5ILFA 3EBAB 5C6IA 4PRUA 4A6HA 1HHLA 1SWZA 1TAYA 4UWVA 1CV3A 2LOZA 1GB7A 4ARPA 1LZBA 3CB7A 3N9CA 1GFHA 3EO5A 1CNSA 5CLQB 1MPHA 1L40A 3A3RX 2ZPYA 1UNPA 3WPKA 1XJTA 2VKIA 5C16A 1EGXA 4EMNA 4TKNA 2YT1A 1L38A 2GS0A 5KXYA 1IORA 5IELA 4QJ4B 2OE7X 3CT1A 1G0KA 5KXLA 1L51A 2A4TA 4N8ZA 1GWDA 1TCYA 231LA 1KXXA 3C8RA 1P46A 247LA 260LA 4H9IA 4WJ7A 1KIQC 1RRPB 4PRQA 201LA 2KGXB 150LA 1D2YA 1NBYC 3CDTA 3D4SA 3GUIA 4DD0A 3HSAA 3NY9A 1LMAA 1BWHA 1DZBX 4DX90 1P5TA 229LA 2GUMA 1NTYA 2RAYX 157LA 1UACY 4H9HA 2MEHA 5CLLB 1L29A 1QQGA 5F9UA 5I2SA 135LA 1GFGA 3WUAA 3KY9A 5HE2A 5HNLA 1BGIA 5HMVA 1Y5OA 4HB4B 3HBHA 3V2WA 2HTXA 3IVFA 3DMZA 1L64A 3SB9A 1HEPA 2D4KA 2Z39A 3RUNA 1WQPA 5D3WA 1VDPA 2B73A 4BADA 4YEMA 3ODWA 2DLWA 3F8VA 4LDEA 4H8SA 1NHBA 1C08C 4TUNA 1L74A 5KXRA 1NU2A 4TYZA 1OUHA 1L55A 4EKQA 4J1AA 3V2YA 1GBXA 3A67Y 2YBIA 2W1YA 2EMTA 1PQIA 1PLSA 4HDQA 2YRYA 1C6TA 4XJFA 1LKSA 1HEWA 4KL7A 1JTMA 4DQJA 4WM3A 1GDWA 1LYIA 1H6MA 2HU3A 4H8ZA 4ZPUA 1HMLA 4XWXA 1GFRA 3T36A 4N1CC 1D3FA 1JTNA 1L07A 4PJ2C 1G7LC 1WQOA 5J7CA 1H4RA 2YDGA 5LVIA 1LZYA 2XQOA 2MWNB 3A92A 4H90A 1LI3A 1L53A 4DQ7A 1WGUA 2YBLA 2BPUA 3K3TA 1C60A 5I14A 4I7JA 4AQNA 1T8GA 3A6BY
chains in the Genus database with same CATH topology
4W52A 1LYHA 3P4ZA 3DXEA 241LA 1WTMA 1FDLY 1L02A 1JPOA 1Q67A 5F81A 1MELL 3G9WA 129LA 2BLXA 1LHHA 3A34A 4RLMA 1KS3A 1L32A 1WI1A 3HBEX 109LA 2ANXA 4RW2A 2J59M 143LA 258LA 3BKHA 1DI5A 3RZ4A 1L12A 3IWRA 2VSZA 3ATNA 139LA 1WQNA 3WH1A 115LA 1GB5A 1OVHA 5KXZA 1C6MA 1UIFA 2B72A 4HV2A 1B7NA 193LA 1FLUA 4LYTA 1XR0B 4OOTA 108LA 4HJZA 3HK0A 1DKJA 2LZTA 4B4EA 2MEEA 1GB0A 4HPIA 1XCGA 3B0OA 1YAPA 3FADA 1JISA 2LCBA 4YONA 1UEFA 1N4FA 2BQEA 4ETAA 3P66A 5APFA 4H8XA 205LA 5KKIA 7LZMA 3CXBB 1L18A 2L78A 4HHVA 1CKGA 113LA 4LYZA 1P36A 1GG3A 4WM1A 1AQCA 1DDVA 4A6FB 1L85A 1B7MA 195LA 2DKVA 4HAZB 2EMSA 2DQDY 1GB8A 1KXWA 1B5ZA 5FEKA 1ALCA 1EVHA 1NHEA 2BQNA 1LI6A 2OTXA 2W1MA 3W6CA 3SB6A 2Y8GA 2EJ8A 3C81A 1OVJA 167LA 4B49A 3BINA 3WXTA 2A7DA 1OP9B 1LW3A 5KXSA 4TWSA 1RI8B 2LC9A 1WVHA 2V76A 3HH3A 4HSFA 4EKPA 1LHKA 183LA 1L72A 2HUKA 1VDTA 1T97A 256LA 1SLYA 3LZ2A 1IC4Y 4Z2NA 2YSSC 2YS3A 1JQUA 5FCPA 1QTCA 1C67A 4K5YA 5LVJA 1IR7A 1L91A 2DHIA 4WM5A 1C63A 4W58A 1J0WA 1X1FA 2RBRA 4DX8A 3DMXA 1SQ2L 3L64A 3SV1A 236LA 3AZ5A 1GAYA 3C7YA 1VATA 5DN4A 1L58A 222LA 4H8YA 1P6YA 4IOYX 208LA 4CHXA 1OUBA 2Z38A 1TDYA 1X05A 4DAJA 1P7SA 1IRSA 4ETDA 2CRFA 4Z3MA 1B7LA 4J7VA 2IYBA 4EJNA 4HP0A 4RW1A 1L97A 2CY4A 1NDMC 1A2YC 4I7NA 1OY2A 4Z41A 1L42A 3TMXA 2A7FA 2HEBA 3HH5A 1YKYX 2B70A 1L05A 2DQFC 3C7ZA 4H9EA 1IWWA 1I6SA 4I7MA 2DTCA 1L73A 1QT7A 1CU0A 123LA 1FGYA 4TSBA 1BHZA 4XJBA 1L22A 2BQKA 1FHOA 1LW9A 1F10A 2RB0X 1DYEA 1L21A 3RW8A 5LAGA 2YVBA 2Q9EA 4QY9A 4E97A 2LOXA 3A8QA 5DIFB 3G3WA 221LA 1GC7A 1D0MA 137LA 2DKQA 2HECA 4NGLA 4Z46A 3DNAA 1G0JA 3TCAA 3A90A 3FI7A 253LA 2H7DA 1LZGA 153LA 3D8FA 2I25L 4GN1A 1OUDA 1JIYA 111LA 3D8DA 4ZRIA 2QKMA 2D2QA 1CU6A 2Z18A 5D5CA 1KW5A 1FGZA 3PVWA 3PZDA 1L82A 2AUBA 2F4GA 1L96A 4KT3A 1NWGA 3C8QA 4LFXA 1SSYA 5L3IA 1LYJA 4LT3A 2F47A 1MLCE 1XGRC 1DYNA 207LA 1LHIA 3FEHA 1HEQA 1LMQA 4Z98A 2B6ZA 1C66A 2Y8FA 4NGWA 1L08A 1AKIA 3QNGA 4IJ4A 1LWKA 2YS5A 1UIHA 2CODA 1WQMA 1ISNA 4HJVA 3HW2B 3HDFA 3WMKA 156LA 2G4QA 3WYHA 2BCJA 4F7GA 3OE6A 1QSWA 1OMWA 3WU7A 1GF9A 2B74A 1C45A 1GEZA 1YL0X 1OUEA 1RE2A 1MIXA 246LA 2RSCA 1D3JA 5DN5A 4OO9A 1OV7A 5KY1A 3PEGA 1C7PA 5J3TA 4ARQB 4LZTA 2EQLA 2D11A 262LA 2RBPA 3C80A 2DBTA 4CJ2A 242LA 4HAYB 1LJFA 4MSTA 191LA 1SHCA 1LJKA 102LA 1OUAA 1KI1B 1L69A 2NTHA 2RB1X 3SB5A 1DDWA 3AGGG 1HEMA 3K2RA 5C79A 1C6EA 248LA 1BVKC 1L49A 4NSHA 5EFXA 1FN5A 3N9EA 5FSTA 4EXMA 4N1EI 4GLVA 2W1LA 1C61A 2Z2FA 249LA 1B9OA 196LA 3W6BA 2J0JA 1LMPA 3OANA 4H9BA 189LA 4I7LA 5LIOA 3TFMA 3C82A 2HEDA 4W51A 1IVMA 1GXV2 5LYZA 4C0AA 3SBBC 1MK9B 1XKEA 4LYMA 3GXKA 1BWIA 2Z0PA 257LA 3TO1A 1ZVRA 1LJIA 3EXDA 4H91A 1QT3A 4WMGA 2W2XC 120LA 1L65A 3WW6A 1C68A 1IWZA 1L84A 198LA 1KXYA 4GXBA 1QQYA 1YAMA 2DN6A 1LSBA 1IWVA 1Z87A 1XGPC 1JITA 4ARMB 5B05A 223LA 1LZEA 2KCJA 1B5UA 1LYEA 1YAQA 1LZNA 4DJHA 2FJLA 1GF8A 1MIZB 1V89A 1CV6A 1L86A 1YQVY 4II8A 4DD3A 2RBOA 4EKSA 4G9SA 154LA 1KY0A 2DFKA 4NHTA 1SGHA 1L28A 5C5BA 2IFSA 2O4WA 1LZSA 1GFKA 1LGUA 1JKBA 239LA 1OUIA 4WL7A 1FHXA 1L00A 2XTHA 1I1ZA 4GCFA 5KQ1A 4A7DA 1P5CA 3CSZA 181LA 1CVKA 5APDA 4IFSA 1EQEA 1HFZA 2HE7A 1L36A 2B7XA 5LA5A 1B5YA 4KHAA 5C6JA 1LOZA 5K7OA 140LA 3LYZA 2ADZA 3M3UA 2ZILA 1QUTA 3P68A 4KHBB 1QSBA 2ROVA 3A96A 4H1PA 3DKEX 1L34A 4G49A 4NSJA 1L79A 1BB3A 1BAKA 1UIAA 3DN4A 1BVXA 255LA 2CWIA 4PPOA 4WOAA 1J1PY 2LHMA 1HERA 4J0LA 1D3MA 3HTFA 194LA 4XJHA 3QAKA 1QTDA 2UZSA 1L06A 3VOQA 1L13A 1TBYA 3SN6R 1LHJA 4QDNA 4BBKA 2Z19A 1EAZA 5ILCA 3JR6A 3WA0A 4DD9A 1LZ4A 1LZ5A 4WL6A 4GCCA 1LHMA 3FA0A 3LN2A 178LA 4NGYA 5KXNA 1OUGA 1IP1A 2FBDA 5LYMA 3MGWA 4N9RA 3AGIA 3CDQA 3ZDTA 5D3XA 4J1BA 4WLDA 1C6AA 1CUPA 2P0FA 3G3XA 159LA 5KJ9A 2R09A 1DYAA 1L23A 1X86A 2YBMA 2E2XA 1XEKA 1G06A 4HTQA 1F0WA 3GUKA 1DXJA 1FAOA 1L90A 3HT8A 4CHMA 1IC5Y 5F14A 1JKDA 5JENB 3BKVA 5AMYA 2COCA 5J3QA 2UZRA 1GBSA 5JP4A 1QDRA 1CJ9A 1LB1A 1Z55A 1L66A 4OWHA 1U5GA 131LA 1T6HA 1GE2A 5DH9B 4WLXA 1GB6A 2NMBA 1H87A 1L0JA 4L41A 1L59A 3M1IB 4W94A 4W57A 1E5WA 1L41A 2VB1A 4Z2MB 3WW5A 2BQLA 2DHKA 1L04A 5B06A 3UONA 182LA 1L31A 5HE3A 1B5WA 3HQCA 245LA 2L1CA 1BB4A 1CU3A 1UA6Y 3AU5A 4IASA 1P2RA 1LJHA 1U29A 1B7SA 3ZVQB 3AB6A 1GFVA 1L45A 4AGAA 2BQIA 1G7IC 3WL2A 4MT7A 1DPXA 1W1GA 2GCJA 1ZVYB 1D0LA 1JJ0A 2X18A 2OE9X 218LA 2XJWA 4HB2B 1C6LA 1W1HA 1JKAA 2MECA 5APEA 1LAAA 3GUOA 1C6DA 2R0DA 3GUPA 3AJNA 134LA 4C5FA 2BQJA 188LA 1O23A 3CSQA 1B7QA 2G4NA 3IJVA 4HPEA 3A8ZA 1QUDA 1IOSA 2BQFA 238LA 1E8LA 1CV5A 4PK0A 2ROZB 1LMNA 225LA 192LA 2RUKB 4OWBA 4DXAB 4HAXB 2N5ZA 4EPIA 1PS5A 5HMJA 1L50A 1CV1A 3GYPA 209LA 3LJUX 5KXMA 2HULA 261LA 1L67A 2DQHY 1C6QA 1C6FA 1V5PA 4HB0B 1HNLA 1QT4A 1YAOA 1YKZX 1IIZA 1AT5A 2RBNA 1DI4A 5I53A 4I7QA 160LA 2D9YA 4NEBA 1Y19B 165LA 1B0DA 1DROA 4DDBA 2IGCA 4HAUB 3HT9A 5I54A 4B6HA 2YBJA 3CT5A 1I7AA 1JSFA 1X1GA 1QIOA 1KNIA 4TSCA 2BQGA 1LYFA 5KXWA 162LA 1UNRA 4XYYA 1D2WA 1NI2A 3RZEA 4B4IA 3ULBA 2YVCA 4YXAC 2IHLA 2HU1A 2ZYPA 1PFJA 4KAXB 1XX0A 199LA 3QY4A 1GF5A 1QUSA 1ZWNA 164LA 1LSCA 4D9ZA 2HTHB 2F2NA 1ZC3B 1INUA 4P7IA 1M7RA 1CX6A 4B0DA 4WM2A 5FELA 4LT1A 2Y7BA 1IOCA 3PG7A 2YT0A 2ELAA 2IFFY 3ATOA 4HTKA 3B0KA 4TTDA 2BQAA 4CFOA 6LZMA 3EMSA 5DHFB 1G1WA 1ZC4B 1C65A 1PQJA 5FHWA 3HU8A 1LMCA 1KIRC 1GD6A 4I7PA 1L20A 1MKEA 2BQDA 4WSFA 234LA 2I1KA 1QTBA 3WPLA 4GRVA 3GYOA 2MKRA 1LSEA 4GCDA 4MCKA 3C83A 1G1VA 1FKVA 3DN6A 1V61A 1U5EA 4ET9A 4HV1A 2I5FA 1VDQA 1L25A 4NSGA 2CDSA 2D4IA 1ZURA 130LA 147LA 1SSWA 144LA 1HFXA 3W6FA 2EC1A 1ZM0A 1JUGA 3TVVA 3A94A 3PBLA 1HC0A 1V5MA 1QUOA 2BQMA 4EJ4A 3RNXA 4KXIA 3A6CY 5KCVA 2ZQ4A 3TXEA 3ZVRA 1CKDA 2P0DA 2VRWB 1CUQA 1I2HA 1L09A 1L62A 2DX1A 5L81A 4ET8A 174LA 4HTNA 2YS1A 1JTTL 1GFJA 1QT6A 2M14A 1L92A 1D9WA 5B07A 4R0FA 1QS5A 4ZFPA 1IEEA 2OE4X 4NG1A 8LYZA 2EKSC 1LZ6A 1RJCB 4OOOA 1YANA 4YL8A 1IWXA 127LA 3F0WA 3KRXA 1GB2A 2DKPA 1BB6A 1L54A 2LYDA 5FDJA 2OQBA 4KHOA 1C10A 1QS9A 3HH4A 2B5ZA 161LA 226LA 3WU9A 5LAFA 237LA 2NTGA 4EKRA 103LA 3LYMA 1TXDA 4DD1A 1DYDA 4ETBA 2F2QA 1PZYA 141LA 2ZNWY 4GPTB 1QSQA 1FHWA 2Z12A 3TMUA 3AW7A 2DHJA 1C62A 3TMVA 3HU9A 1LI2A 1L03A 4LDLA 1LYYA 2XBSA 1D0KA 4DD7A 1JTOL 1XEIA 1RFPA 1J1XY 2MEAA 3N9AA 2YBNA 4RDSA 4NSWA 1IP2A 5FI0A 3GXRA 5LINA 2D4QA 2W1XA 1LYZA 3N7CA 2Q0MX 1FBIX 7LYZA 1L17A 3CIKA 5I4YA 1GF7A 4DDCA 1LKRA 145LA 4D0NB 4NG8A 4XJGA 1B6IA 1EPYA 1LSNA 4YENA 3D8EA 1OWYA 3P65A 1PQMA 1QTKA 2YF0A 2D4JA 5EBHA 4F7UP 1LSMA 2FYDA 1HENA 1L89A 1LYOA 3AYQA 1VAUA 197LA 1ZMYL 1G7HC 1LJNA 1L87A 4LT2A 1LTMA 1U5DA 3OE8A 3CDVA 3SBAA 4RLNA 4ETCA 3TXHA 3VW7A 1WVVA 4LYCA 4B4JA 4I8SA 4ETEA 1BTKA 3ZEKA 1DYCA 3T06A 4U3XB 1HSXA 1B2KA 3HUQA 1L43A 1AZFA 4UWNA 232LA 2MEFA 1UBZA 1XD4A 4PHIA 4I7KA 170LA 1GF4A 4NFVA 4LGKA 1LJ4A 3OE9A 4NY0A 125LA 2G4PA 1DI3A 1OUCA 1ZVHL 1C6IA 149LA 4NY5A 1QT8A 3AW6A 4WO6A 3DXCA 2J0KA 1I20A 1NBZC 3GUJA 1P64A 5LXWA 158LA 1L11A 2J0MA 1DPWA 1L47A 1UCOA 4UWUA 1RJ2A 3TXJA 1C6JA 3PVUA 2OTZX 4DBBA 3A98B 1GB9A 2LULA 4TX7A 4L6EA 1LCNA 2RB2X 5D27A 3LZTA 3VWOA 1V5UA 1L80A 1PQOA 3SUZA 1XODA 259LA 2AEHA 3ML4A 187LA 3WVYA 1CV0A 2K2JA 3T6UA 4BS7A 1XGQC 1C6NA 1L83A 3LZMA 1OUFA 4K81A 1BWNA 2I1JA 1UUZC 2BQHA 2D10A 2RAZX 1WJ1A 1IOQA 212LA 1GBZA 3HWLA 177LA 4GN5C 1CJ8A 1L33A 1GBWA 1EQ5A 175LA 1SX2A 1JHLA 2NWDX 4WLTA 1P2LA 5KXOA 2Z37A 1FLWA 3HUAA 1BB7A 4ARMA 3HDEA 200LA 3MPXA 4PJZA 1IY4A 3SYXA 2LYMA 3FI5A 4M6DA 3WUNA 1FOEA 1G0MA 1W6ZA 2H9JA 1RCMA 4N5RA 2HUBA 4DT3A 2DA0A 4A6KA 4A6FA 4NWEA 4W54A 3M18B 4LZMA 5L3HA 1HEOA 2ELBA 1G0PA 3GUNA 3FM8C 4NIJA 1T3PA 1LSZA 4PNKA 107LA 2D9XA 1F6RA 1OV5A 2W2XD 4MK0A 1HSWA 5A3EA 3WULA 1TJ6A 4DKLA 244LA 1GFTA 1OUJA 2HEEA 4LFPA 1AWEA 3CSRA 3QE8A 4GMXB 4NGIA 4NGKA 3DN3A 1L30A 2ANVA 4ARJA 4GN3A 1B5VA 1C43A 1GXXA 5A3ZA 4H9AA 2LYOA 2RBSA 3OJPA 215LA 5D5FA 4H9CA 1L39A 2UVMA 3KSYA 3LHMA 4XN6A 5I4WA 1G7JC 1L52A 1C64A 1LLHA 2HUMA 3DXDA 2D9WA 4I7SA 1B7OA 2D6BA 2BLYA 2QB0B 2YBHA 3X23A 1L98A 3C7WA 4I7OA 1CKFA 4WM4A 5KXXA 216LA 3DN2A 220LA 1GF6A 219LA 3D3DA 3QBVB 3WPJA 1L44A 2PC2A 2MEDA 146LA 2OU8A 1U2BA 2L2IA 2Q9DA 1L26A 2CAYA 1GFEA 3UZTA 1GE1A 4S0WA 4MY6A 2EPEA 4G4HA 4PQ0A 1DYBA 1EF1A 2JP2A 168LA 3HUKA 1UIDA 2ZNXY 4W56A 1KW7A 1L15A 1CX7A 1WTNA 4LT0A 4N0JA 1G0LA 1JWRA 3B0IA 2MDXA 5KXPA 4H92A 1M7EA 3A91A 1IP7A 2C8PA 1WG7A 1C6HA 1IWYA 4LYOA 1J1OY 1UC0A 2F32A 1C6CA 6LYTA 128LA 1BB5A 1P2CC 211LA 2M38A 1NF5A 1D9UA 1CKCA 2MFQA 3NYAA 1L27A 2N0YA 5GOWB 4EKUA 1GB3A 3U7DA 4B1AA 2DYQA 1XSFA 4DC4A 3A95A 1IC7Y 1ZYTA 4ARQA 4KPMA 133LA 1C6KA 4PGJB 213LA 2ZIKA 3B72A 3DN1A 1K5GB 4HATB 142LA 5HQ1A 4M4OA 1CKHA 1L63A 1B7PA 2XQNM 4NGZA 4W96A 1YROA 1X11A 1NQIA 3J4GA 1C6GA 4HAVB 1LJEA 4W55A 1BQLY 3ODOA 4WM6A 1L14A 2H7EA 2MEBA 3RCPA 3WYFB 3AJ4A 155LA 110LA 1W1DA 1L46A 1CU2A 1DYFA 2BQOA 4AXTA 1P6SA 2DX5A 173LA 4I7TA 2GV0A 1G7MC 4XJDA 1K5DB 3NSUA 5C6LA 1L57A 4LDOA 1L35A 1T6VL 114LA 1UIGA 3B6LA 1IY3A 210LA 3HTBA 5DLAA 5D3VA 4WVFB 1GEVA 1L37A 3WVXA 230LA 2DQEY 224LA 1LYGA 4ZIXA 5LVHA 3G3VA 2H5ZA 214LA 2RLOA 4CGEA 3MDBC 1LSYA 2P0HA 1LZDA 3HFMY 3AGHA 4HDOA 190LA 3TXBA 1W08A 3HT7A 2BAAA 2AL6A 2DQIY 2RVBB 3TXFA 1NKHA 4DDAA 2PZ1A 3CDOA 4DWXA 4GBRB 3GUMA 4H94A 1IX0A 1MAIA 5HNCA 4NGOA 3SB7A 1IP5A 4IAPA 2K2UA 1GE0A 2RH1A 4P2EA 1LPYA 2Z6BA 1KZGA 2LG1A 2H9KA 4QGZA 3AZ7A 4NHPA 1GBYA 1CTWA 2Q13A 1GAZA 1J19A 3QWMA 5KXKA 1WQRA 1EL1A 1LHLA 1DYGA 4CHJA 1LZ1A 4ML7A 4NHIA 4WG7A 3EMLA 1P37A 1XEPA 3SP3A 1ZSQA 2O7AA 6LYZA 1QTEA 2DQAA 5B1GA 4ARLA 4DQ5A 1C46A 2OU9A 1TQZA 1JSEA 1QTZA 1JEFA 1JJ3A 1HF4A 5IHGA 3ODXA 4OWCA 2BQBA 1FLQA 1UICA 235LA 3P7ZA 163LA 3W6DA 1WTHA 3FSSA 1XGUC 1NMMA 2X0AA 1WVUA 4OW1A 3OE0A 3J6KA 1L70A 1L99A 3ODUA 1GF3A 3KZ1A 3P64A 2CJLA 2RSGA 5II3A 1TLAA 1UPQA 1LZ9A 3HTDA 1LZAA 2COFA 2B6XA 3ULCA 1DKKA 4XJIA 2O79A 3GULA 2LZMA 4O34A 1UIBA 3G3AB 3V5WA 1REZA 4YXCA 1LGWA 1L76A 1DDMA 2HEFA 3G3BB 4GMVA 4R6CA 5M1YA 1LPIA 1PQKA 4NHSA 4XENA 3DN8A 2W2WA 1V7TA 2YSZA 4FJRA 3TXGA 3F6ZA 4G4BA 4Y94A 1SWYA 132LA 2D9ZA 1P56A 1D6QA 1LZ8A 1QTVA 1L88A 1U27A 2KUPA 1VDSA 3RT5X 1GFUA 4HJYA 1CV4A 4GZUA 1T8AA 5HE1A 1LSPA 4DYGA 251LA 2QARC 1LSDA 1QUGA 4NWHA 2WARA 3PDSA 3HT6A 3P6AA 2DQGY 3BJIA 2P8VA 3PVLA 243LA 1FKQA 5FI1A 1CJ7A 3D9AC 250LA 2OTYX 1FB8A 3W3EA 4A5KA 184LA 1BTNA 2GCLA 3AU4A 2CGIA 3PSCA 3ZVQA 1IO5A 1H10A 1LYSA 1UIEA 5T3FA 5LOPB 4KVGB 1L48A 1L93A 1LMOA 1VEDA 1WQQA 2CUUA 1IWTA 2FBBA 4YF2A 4YOPA 2I6ZA 1AM7A 3HTGA 4NGVA 3W6AA 2BQCA 4HAWB 9LYZA 3NY8A 4I0CA 5HE0A 4F7HA 1EQ4A 3QIJA 172LA 2F30A 4WLYA 2MEIA 3PP2A 5J3YA 3CDRA 5KXTA 4K2PA 148LE 5LYTA 1OQMA 2B6TA 2EIZC 1D3NA 3LYTA 1NDGC 1QSAA 5LZMA 2LYZA 1LZCA 1CJ6A 5LVGA 1HFYA 4OWAA 4YEOA 1I56A 1QDTA 2B75A 4NHQA 1QC6A 5F9XA 4E3UA 1GPQC 3WXUA 2G35A 2RNRB 1D6PA 1KIPC 4W59A 1B55A 1L94A 169LA 1JKCA 2Z2EA 1REXA 2D9VA 1T8FA 3TXDA 1LZTA 2ZQ3A 1NTVA 2B6YA 4ANRA 3TMWA 171LA 112LA 4WG1A 3O96A 5DI9B 1XJUA 1GC6A 1YIKA 1GE4A 1LMTA 3RU5A 3FE0A 5I4XA 1LSAA 5IDDA 2I26L 1HMKA 1DBHA 1AT6A 5E4PA 2CY5A 4K17A 1WGQA 1IOTA 5L9JA 1LWGA 240LA 227LA 4DD2A 1BWJA 4C3WA 4GCBA 4BAPA 1GE3A 4LYBA 1L56A 1L10A 1YILA 1C69A 5B59A 1XFPL 1IR8A 1IP3A 2OEAX 5C6RA 2DQJY 4QEQA 3AZ6A 4EOFA 1V7SA 1REYA 1XGTC 4H93A 1A4VA 1K28A 2MEGA 1L61A 180LA 122LA 1KY1A 3AZ4A 2D91A 1OWZA 2XBRA 3E3DA 1OVKA 4CYEA 2ZIJA 4EMOA 2Y8PA 4EPFA 4GN4A 4YX7C 1LJGA 1L19A 1P3RA 1WJMA 3A8PA 2Z0QA 3HH6A 3SO6A 1LJJA 2HEAA 2I5CA 4OWEA 185LA 3OK0A 151LA 1IWUA 1TEWA 4ZRKA 4XADA 4BAFA 1C6PA 1PMSA 1B7RA 2K00A 4W53A 3F5RA 4NGJA 1QT5A 4MR1A 3F9LA 1LYDA 3W6EA 1L60A 1OYUA 3L2XA 3U8ZA 1IP4A 1JJ1A 3SNHA 1L81A 5JLJB 118LA 3VIAA 2ZYCA 1L0KA 186LA 228LA 4CFPA 4ZRJA 2RGNB 152LA 3WU8A 2LKOA 3DN0A 4I7RA 1QTHA 5DM9A 1U5FA 1GFAA 3SB8A 4IATA 5KQ4A 4HB3B 1UPRA 1GF0A 5LONB 2C8OA 5E9RA 3TW1A 126LA 1GHLA 1L68A 3CT0A 1C6BA 3HBDA 1IP6A 233LA 5DL9A 2Z0OA 252LA 1GBOA 104LA 119LA 5B1FA 1YL1X 1L01A 3ULRA 3IJUA 3A93A 5KKJA 217LA 2ZWBA 1L16A 1GDXA 2B6WA 1LSFA 1LZRA 2DYNA 138LA 5C5BB 2QKLA 1QUHA 1ZV5L 1L71A 4GCEA 2LZ2A 254LA 4GLAA 3KAMA 3C8SA 1MK7B 1F6SA 2NZ8B 5F16A 1G07A 4H9FA 1YKXX 1CU5A 1DQJC 3WUMA 5LVKA 1OQNA 4WO9A 3A3QA 4NSIA 1SX7A 2N23A 3CQLA 3KRWA 3DMVA 1REMA 1IR9A 1G0QA 4ZEEA 1V88A 4K2OA 4G4CA 5LA8A 1JTPL 1G0GA 5JHGA 5D3YA 1L75A 1HELA 1VFBC 2COAA 1L77A 1XEJA 2F4AA 5HLLA 1N3HA 166LA 1LGXA 1L24A 1KZ7A 4YM8A 2GJYA 1LSGA 2OU0X 4X3BA 2DQCY 5I5QA 1UNQA 3TXIA 5APCA 1FLYA 1B5XA 2FYCA 4FDYA 2RBQA 176LA 1P3NA 1L95A 1LJ3A 5JHHA 3LYOA 3TXKA 206LA 1PQDA 5DHAB 5ILFA 3EBAB 5C6IA 4PRUA 4A6HA 1HHLA 1SWZA 1TAYA 4UWVA 1CV3A 2LOZA 1GB7A 4ARPA 1LZBA 3CB7A 3N9CA 1GFHA 3EO5A 1CNSA 5CLQB 1MPHA 1L40A 3A3RX 2ZPYA 1UNPA 3WPKA 1XJTA 2VKIA 5C16A 1EGXA 4EMNA 4TKNA 2YT1A 1L38A 2GS0A 5KXYA 1IORA 5IELA 2OE7X 3CT1A 1G0KA 5KXLA 1L51A 2A4TA 4N8ZA 1GWDA 1TCYA 231LA 1KXXA 3C8RA 1P46A 247LA 260LA 4H9IA 4WJ7A 1KIQC 1RRPB 4PRQA 201LA 2KGXB 150LA 1D2YA 1NBYC 3CDTA 3D4SA 3GUIA 4DD0A 3NY9A 1LMAA 1BWHA 1DZBX 4DX90 1P5TA 229LA 1NTYA 2RAYX 157LA 1UACY 4H9HA 2MEHA 5CLLB 1L29A 1QQGA 5F9UA 135LA 1GFGA 3WUAA 3KY9A 5HE2A 5HNLA 1BGIA 5HMVA 1Y5OA 4HB4B 3HBHA 3V2WA 2HTXA 3IVFA 3DMZA 1L64A 3SB9A 1HEPA 2D4KA 2Z39A 3RUNA 1WQPA 5D3WA 1VDPA 2B73A 4BADA 4YEMA 3ODWA 2DLWA 3F8VA 4LDEA 4H8SA 1NHBA 1C08C 4TUNA 1L74A 5KXRA 1NU2A 4TYZA 1OUHA 1L55A 4EKQA 4J1AA 3V2YA 1GBXA 3A67Y 2YBIA 2W1YA 2EMTA 1PQIA 1PLSA 4HDQA 2YRYA 1C6TA 4XJFA 1LKSA 1HEWA 4KL7A 1JTMA 4DQJA 4WM3A 1GDWA 1LYIA 1H6MA 2HU3A 4H8ZA 4ZPUA 1HMLA 4XWXA 1GFRA 3T36A 4N1CC 1D3FA 1JTNA 1L07A 4PJ2C 1G7LC 1WQOA 5J7CA 1H4RA 2YDGA 5LVIA 1LZYA 2XQOA 2MWNB 3A92A 4H90A 1LI3A 1L53A 4DQ7A 1WGUA 2YBLA 2BPUA 3K3TA 1C60A 5I14A 4I7JA 4AQNA 1T8GA 3A6BY
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTY X;  3DKE X;  1LYH A;  4W52 A;  1FB8 A;  4A5K A;  1L34 A;  3DXE A;  184L A;  1BTN A;  2GCL A;  3AU4 A;  3PSC A;  241L A;  1L02 A;  1L79 A;  1H10 A;  1Q67 A;  1BAK A;  3G9W A;  3DN4 A;  5LOP B;  255L A;  4KVG B;  1L48 A;  129L A;  3HUQ A;  1L93 A;  1L43 A;  232L A;  2CUU A;  1D3M A;  1KS3 A;  4I7K A;  1XD4 A;  3HTF A;  170L A;  1L32 A;  3CXB B;  1WI1 A;  109L A;  3QAK A;  3HTG A;  2ANX A;  3OE9 A;  4NY0 A;  125L A;  4HAW B;  1QTD A;  2UZS A;  1L06 A;  3NY8 A;  5HE0 A;  3VOQ A;  1L13 A;  143L A;  258L A;  2J59 M;  3QIJ A;  1C6I A;  149L A;  3SN6 R;  4BBK A;  1L12 A;  172L A;  1EAZ A;  1QT8 A;  3JR6 A;  2VSZ A;  3WA0 A;  3PP2 A;  5J3Y A;  3FA0 A;  139L A;  2J0K A;  3DXC A;  3CDR A;  178L A;  4K2P A;  3GUJ A;  1P64 A;  158L A;  1L11 A;  148L E;  2J0M A;  115L A;  1L47 A;  2B6T A;  3CDQ A;  1D3N A;  1OVH A;  1RJ2 A;  3ZDT A;  1C6M A;  5D3X A;  2B72 A;  1C6J A;  1C6A A;  1CUP A;  2P0F A;  5LZM A;  3PVU A;  2OTZ X;  3G3X A;  159L A;  2R09 A;  1DYA A;  1L23 A;  4DBB A;  1X86 A;  3A98 B;  2LUL A;  2E2X A;  1XR0 B;  2B75 A;  1G06 A;  108L A;  2RB2 X;  1QC6 A;  4L6E A;  3HK0 A;  5D27 A;  3GUK A;  1V5U A;  1L80 A;  1PQO A;  3SUZ A;  1FAO A;  1L90 A;  3HT8 A;  1XOD A;  4CHM A;  259L A;  2AEH A;  3ML4 A;  187L A;  2G35 A;  1XCG A;  2RNR B;  1CV0 A;  2K2J A;  3FAD A;  2LCB A;  1C6N A;  1L83 A;  3LZM A;  4YON A;  1UEF A;  2COC A;  4K81 A;  1BWN A;  2I1J A;  4W59 A;  1B55 A;  2UZR A;  5J3Q A;  1L94 A;  169L A;  5JP4 A;  2D10 A;  2RAZ X;  1WJ1 A;  205L A;  1LB1 A;  212L A;  7LZM A;  1T8F A;  1L66 A;  1U5G A;  1L18 A;  2D9V A;  131L A;  3HWL A;  177L A;  2L78 A;  1L33 A;  4HHV A;  1NTV A;  175L A;  1SX2 A;  2B6Y A;  1T6H A;  113L A;  1P2L A;  171L A;  112L A;  5DH9 B;  1P36 A;  3O96 A;  1XJU A;  1GC6 A;  1GG3 A;  2NMB A;  5DI9 B;  3HUA A;  1L0J A;  1L59 A;  3M1I B;  1AQC A;  1DDV A;  4W57 A;  4ARM A;  1E5W A;  4A6F B;  1L41 A;  3HDE A;  200L A;  3MPX A;  4PJZ A;  4Z2M B;  1L85 A;  1DBH A;  3SYX A;  195L A;  2DHK A;  1L04 A;  4HAZ B;  3FI5 A;  3UON A;  2CY5 A;  2EMS A;  182L A;  1FOE A;  4K17 A;  1G0M A;  1L31 A;  1WGQ A;  5HE3 A;  3HQC A;  245L A;  1EVH A;  1LWG A;  240L A;  227L A;  2DA0 A;  1LI6 A;  2L1C A;  1CU3 A;  2OTX A;  4A6K A;  3AU5 A;  4A6F A;  1P2R A;  4W54 A;  4LZM A;  3SB6 A;  2ELB A;  2Y8G A;  1U29 A;  1G0P A;  1L10 A;  1L56 A;  2EJ8 A;  3GUN A;  1C69 A;  3C81 A;  3FM8 C;  1OVJ A;  2OEA X;  4PNK A;  107L A;  167L A;  2D9X A;  3BIN A;  5C6R A;  1L45 A;  1OV5 A;  2W2X D;  4MK0 A;  1LW3 A;  4MT7 A;  1TJ6 A;  1W1G A;  4DKL A;  2GCJ A;  244L A;  2X18 A;  2LC9 A;  1K28 A;  2OE9 X;  1WVH A;  2V76 A;  1L61 A;  218L A;  3HH3 A;  180L A;  4EKP A;  1AWE A;  122L A;  1KY1 A;  4HB2 B;  1C6L A;  1W1H A;  183L A;  4GMX B;  1L72 A;  1OWZ A;  2HUK A;  3DN3 A;  1L30 A;  1T97 A;  2ANV A;  3GUO A;  4ARJ A;  1C6D A;  256L A;  2R0D A;  3GUP A;  4Z2N A;  1OVK A;  4CYE A;  188L A;  2YS3 A;  4EMO A;  1JQU A;  1QTC A;  1C67 A;  4K5Y A;  4EPF A;  1L91 A;  2RBS A;  2DHI A;  4YX7 C;  215L A;  1C63 A;  1L39 A;  1L19 A;  4W58 A;  1P3R A;  1J0W A;  1WJM A;  1X1F A;  3A8P A;  2RBR A;  2UVM A;  1QUD A;  3KSY A;  3DMX A;  4DX8 A;  3L64 A;  2Z0Q A;  3HH6 A;  3SO6 A;  1L52 A;  3SV1 A;  236L A;  238L A;  2I5C A;  1C64 A;  1CV5 A;  4PK0 A;  2ROZ B;  1LLH A;  185L A;  3C7Y A;  225L A;  2HUM A;  3DXD A;  2D9W A;  4I7S A;  192L A;  1L58 A;  222L A;  2RUK B;  151L A;  1P6Y A;  2QB0 B;  4DXA B;  4IOY X;  1L98 A;  3X23 A;  4ZRK A;  4HAX B;  4EPI A;  1X05 A;  3C7W A;  4I7O A;  4DAJ A;  1L50 A;  1CV1 A;  1P7S A;  3GYP A;  216L A;  3DN2 A;  1C6P A;  209L A;  220L A;  1IRS A;  1PMS A;  3LJU X;  219L A;  2K00 A;  4W53 A;  2HUL A;  2CRF A;  261L A;  1L67 A;  1QT5 A;  3F5R A;  3QBV B;  4F7H A;  1C6Q A;  1L44 A;  1C6F A;  2IYB A;  4EJN A;  3F9L A;  1LYD A;  146L A;  1V5P A;  1L97 A;  1L60 A;  4HB0 B;  1OYU A;  2CY4 A;  2OU8 A;  3L2X A;  1U2B A;  1QT4 A;  3U8Z A;  2L2I A;  2Q9D A;  2RBN A;  1L26 A;  2CAY A;  3SNH A;  1L81 A;  4I7N A;  118L A;  3VIA A;  5JLJ B;  3UZT A;  1OY2 A;  4S0W A;  1L0K A;  4I7Q A;  4MY6 A;  160L A;  186L A;  228L A;  2D9Y A;  4ZRJ A;  4PQ0 A;  1DYB A;  1L42 A;  1EF1 A;  1Y19 B;  2RGN B;  152L A;  165L A;  2JP2 A;  168L A;  3HUK A;  4W56 A;  1DRO A;  1KW7 A;  2LKO A;  1L15 A;  1CX7 A;  3DN0 A;  3HH5 A;  2IGC A;  4I7R A;  4HAU B;  1QTH A;  1G0L A;  3HT9 A;  2B70 A;  1L05 A;  2MDX A;  1U5F A;  3SB8 A;  3C7Z A;  4B6H A;  5KQ4 A;  4HB3 B;  1M7E A;  1I7A A;  1I6S A;  1UPR A;  4I7M A;  1X1G A;  2DTC A;  1L73 A;  5LON B;  1QT7 A;  1CU0 A;  3TW1 A;  126L A;  1WG7 A;  1C6H A;  1L68 A;  123L A;  1C6B A;  1FGY A;  233L A;  2F32 A;  2Z0O A;  1KNI A;  1C6C A;  252L A;  104L A;  1LYF A;  1L22 A;  119L A;  162L A;  1UNR A;  1LW9 A;  1FHO A;  128L A;  2RB0 X;  1D2W A;  211L A;  1DYE A;  2M38 A;  1NI2 A;  1L21 A;  3RZE A;  2MFQ A;  3ULB A;  1L01 A;  1L27 A;  3NYA A;  2N0Y A;  2YVC A;  4YXA C;  5GOW B;  2Q9E A;  217L A;  4E97 A;  2LOX A;  1PFJ A;  3A8Q A;  4KAX B;  1L16 A;  5DIF B;  3U7D A;  2B6W A;  4EKU A;  2DYQ A;  1XX0 A;  199L A;  1ZWN A;  164L A;  3G3W A;  1ZYT A;  221L A;  4ARQ A;  1GC7 A;  2DYN A;  138L A;  5C5B B;  2QKL A;  1QUH A;  137L A;  2HTH B;  2DKQ A;  1C6K A;  1ZC3 B;  1L71 A;  213L A;  254L A;  3T06 A;  4P7I A;  3DN1 A;  3DNA A;  3C8S A;  1M7R A;  1K5G B;  1CX6 A;  1G0J A;  1MK7 B;  142L A;  4HAT B;  3TCA A;  2NZ8 B;  1G07 A;  1L63 A;  2Y7B A;  1CU5 A;  2XQN M;  253L A;  2H7D A;  3PG7 A;  1X11 A;  3D8F A;  4GN1 A;  2YT0 A;  1OQN A;  2ELA A;  111L A;  1C6G A;  3D8D A;  4ZRI A;  1SX7 A;  4HAV B;  2N23 A;  2QKM A;  4W55 A;  2D2Q A;  1CU6 A;  3KRW A;  3ODO A;  3DMV A;  1KW5 A;  1L14 A;  1FGZ A;  2H7E A;  3PVW A;  3RCP A;  6LZM A;  3PZD A;  3WYF B;  1L82 A;  3AJ4 A;  155L A;  5DHF B;  1G0Q A;  110L A;  1V88 A;  1W1D A;  1L46 A;  4K2O A;  1G1W A;  1L96 A;  1CU2 A;  1ZC4 B;  1DYF A;  1C65 A;  1G0G A;  3C8Q A;  1PQJ A;  5JHG A;  5D3Y A;  1SSY A;  3HU8 A;  1LYJ A;  1P6S A;  2F47 A;  173L A;  1L75 A;  4I7T A;  1DYN A;  2DX5 A;  4I7P A;  2COA A;  1K5D B;  1L20 A;  3FEH A;  3NSU A;  1MKE A;  2B6Z A;  1C66 A;  4WSF A;  234L A;  1L77 A;  2Y8F A;  2I1K A;  1L57 A;  1N3H A;  1L08 A;  1QTB A;  4LDO A;  166L A;  1L35 A;  1LGX A;  114L A;  1L24 A;  1KZ7 A;  2GJY A;  210L A;  3HTB A;  4GRV A;  1LWK A;  2OU0 X;  2MKR A;  2YS5 A;  3GYO A;  4WVF B;  5D3V A;  3C83 A;  1UNQ A;  1G1V A;  1L37 A;  2COD A;  3DN6 A;  1ISN A;  230L A;  1V61 A;  1U5E A;  3HDF A;  3HW2 B;  2I5F A;  1L25 A;  224L A;  2RBQ A;  156L A;  176L A;  1P3N A;  1L95 A;  1ZUR A;  5JHH A;  206L A;  1LYG A;  130L A;  1PQD A;  147L A;  1SSW A;  2BCJ A;  3G3V A;  3OE6 A;  5DHA B;  4F7G A;  144L A;  1OMW A;  2EC1 A;  214L A;  2RLO A;  2B74 A;  1ZM0 A;  4A6H A;  1MIX A;  3MDB C;  3TVV A;  246L A;  1D3J A;  4OO9 A;  2P0H A;  1OV7 A;  1SWZ A;  3PBL A;  1V5M A;  1QUO A;  1CV3 A;  3PEG A;  4EJ4 A;  4HDO A;  5J3T A;  2LOZ A;  4ARQ B;  2D11 A;  5KCV A;  262L A;  2RBP A;  3C80 A;  190L A;  242L A;  4HAY B;  3HT7 A;  4ARP A;  2AL6 A;  191L A;  2RVB B;  3ZVR A;  2PZ1 A;  2P0D A;  3CDO A;  5CLQ B;  1MPH A;  1L40 A;  1SHC A;  4GBR B;  2VRW B;  1CUQ A;  3GUM A;  1I2H A;  1L09 A;  1XJT A;  1L62 A;  1UNP A;  2VKI A;  5C16 A;  1MAI A;  102L A;  2DX1 A;  4TKN A;  5L81 A;  1KI1 B;  2YT1 A;  1L38 A;  1EGX A;  1L69 A;  2NTH A;  2GS0 A;  2RB1 X;  3SB5 A;  3SB7 A;  1DDW A;  4IAP A;  2K2U A;  174L A;  2RH1 A;  1LPY A;  2Z6B A;  2YS1 A;  2OE7 X;  3K2R A;  1QT6 A;  1G0K A;  1KZG A;  1L51 A;  2A4T A;  5C79 A;  2M14 A;  1C6E A;  1L92 A;  248L A;  231L A;  1D9W A;  1L49 A;  2LG1 A;  5EFX A;  3C8R A;  1P46 A;  1QS5 A;  247L A;  260L A;  4EXM A;  2OE4 X;  1CTW A;  2Q13 A;  4WJ7 A;  1C61 A;  1RRP B;  1J19 A;  201L A;  249L A;  3QWM A;  2KGX B;  150L A;  196L A;  1D2Y A;  4YL8 A;  3CDT A;  3D4S A;  127L A;  3GUI A;  1DYG A;  2J0J A;  4CHJ A;  3F0W A;  3NY9 A;  3OAN A;  3EML A;  3KRX A;  1P37 A;  189L A;  1XEP A;  4I7L A;  2DKP A;  1ZSQ A;  1L54 A;  3TFM A;  3C82 A;  2LYD A;  2O7A A;  4W51 A;  4DX9 0;  2OQB A;  1P5T A;  4C0A A;  4KHO A;  4ARL A;  229L A;  3SBB C;  2OU9 A;  1TQZ A;  1MK9 B;  1XKE A;  1NTY A;  1QTZ A;  2RAY X;  1QS9 A;  157L A;  3HH4 A;  2Z0P A;  3ODX A;  161L A;  257L A;  3TO1 A;  226L A;  1ZVR A;  5CLL B;  1L29 A;  237L A;  1QQG A;  3KY9 A;  235L A;  5HE2 A;  2NTG A;  1QT3 A;  4EKR A;  2W2X C;  103L A;  1Y5O A;  2ZPY A;  4HB4 B;  120L A;  1L65 A;  1TXD A;  3P7Z A;  3V2W A;  163L A;  1DYD A;  1C68 A;  3IVF A;  1WTH A;  3DMZ A;  2F2Q A;  1L64 A;  1L84 A;  198L A;  3FSS A;  141L A;  3SB9 A;  4GXB A;  4GPT B;  4AQN A;  1QSQ A;  3RUN A;  1FHW A;  5D3W A;  2DN6 A;  3OE0 A;  2DHJ A;  1L70 A;  2B73 A;  1Z87 A;  1C62 A;  1L99 A;  3ODU A;  4ARM B;  3KZ1 A;  3ODW A;  223L A;  3HU9 A;  3F8V A;  1LI2 A;  2DLW A;  1L03 A;  4LDL A;  2RSG A;  4LDE A;  2KCJ A;  4H8S A;  1NHB A;  1TLA A;  1UPQ A;  1L74 A;  1LYE A;  3HTD A;  1NU2 A;  4DJH A;  2COF A;  4TYZ A;  2FJL A;  2B6X A;  4NSW A;  3ULC A;  1L55 A;  1MIZ B;  4EKQ A;  1CV6 A;  1V89 A;  1L86 A;  2D4Q A;  3V2Y A;  5FI0 A;  2RBO A;  2O79 A;  4EKS A;  3N7C A;  2DFK A;  1KY0 A;  2EMT A;  3GUL A;  1PQI A;  2LZM A;  1SGH A;  1L17 A;  1L28 A;  1PLS A;  4HDQ A;  5C5B A;  2YRY A;  1C6T A;  2IFS A;  3CIK A;  2O4W A;  3V5W A;  4YXC A;  145L A;  1L76 A;  1LGW A;  4D0N B;  1DDM A;  4GMV A;  1B6I A;  1EPY A;  1PQK A;  1JTM A;  1LGU A;  239L A;  3DN8 A;  1OWY A;  3D8E A;  1PQM A;  1FHX A;  2W2W A;  2YF0 A;  1L00 A;  2YSZ A;  4F7U P;  1LYI A;  5KQ1 A;  1L89 A;  4ZPU A;  4Y94 A;  1SWY A;  1P5C A;  197L A;  2D9Z A;  1P56 A;  4XWX A;  181L A;  1CVK A;  1QTV A;  4IFS A;  1L88 A;  1D3F A;  1L87 A;  1U27 A;  2HE7 A;  1JTN A;  1L07 A;  1L36 A;  2B7X A;  1U5D A;  2KUP A;  1CV4 A;  3CDV A;  1T8A A;  3OE8 A;  4GZU A;  4KHA A;  5HE1 A;  3SBA A;  1H4R A;  140L A;  2ADZ A;  251L A;  2QAR C;  3VW7 A;  1QUG A;  2MWN B;  3PDS A;  1LI3 A;  1L53 A;  3HT6 A;  3P6A A;  4KHB B;  1QSB A;  1WGU A;  3BJI A;  2P8V A;  2ROV A;  1BTK A;  243L A;  3PVL A;  5FI1 A;  1C60 A;  250L A;  4I7J A;  1DYC A;  5I14 A;  1T8G A; 
#chains in the Genus database with same CATH topology
 4W52 A;  1LYH A;  3P4Z A;  3DXE A;  241L A;  1WTM A;  1FDL Y;  1L02 A;  1JPO A;  1Q67 A;  5F81 A;  1MEL L;  3G9W A;  129L A;  2BLX A;  1LHH A;  3A34 A;  4RLM A;  1KS3 A;  1L32 A;  1WI1 A;  3HBE X;  109L A;  2ANX A;  4RW2 A;  2J59 M;  143L A;  258L A;  3BKH A;  1DI5 A;  3RZ4 A;  1L12 A;  3IWR A;  2VSZ A;  3ATN A;  139L A;  1WQN A;  3WH1 A;  115L A;  1GB5 A;  1OVH A;  5KXZ A;  1C6M A;  1UIF A;  2B72 A;  4HV2 A;  1B7N A;  193L A;  1FLU A;  4LYT A;  1XR0 B;  4OOT A;  108L A;  4HJZ A;  3HK0 A;  1DKJ A;  2LZT A;  4B4E A;  2K49 A;  2MEE A;  1GB0 A;  4HPI A;  1XCG A;  3B0O A;  1YAP A;  3FAD A;  1JIS A;  2LCB A;  4YON A;  1UEF A;  1N4F A;  2BQE A;  2RRF A;  4ETA A;  3P66 A;  5APF A;  4H8X A;  205L A;  5KKI A;  7LZM A;  3CXB B;  1L18 A;  2L78 A;  4HHV A;  1CKG A;  113L A;  4LYZ A;  1P36 A;  1GG3 A;  4WM1 A;  1AQC A;  1DDV A;  4A6F B;  3NWD A;  1L85 A;  1B7M A;  195L A;  2DKV A;  2ZKM X;  4HAZ B;  2EMS A;  2DQD Y;  1GB8 A;  1KXW A;  1B5Z A;  5FEK A;  1ALC A;  1EVH A;  1NHE A;  2BQN A;  1LI6 A;  2OTX A;  2W1M A;  3W6C A;  3SB6 A;  2Y8G A;  2EJ8 A;  3C81 A;  3NWA A;  1OVJ A;  167L A;  4B49 A;  3BIN A;  3WXT A;  2A7D A;  1OP9 B;  1LW3 A;  5KXS A;  4TWS A;  1RI8 B;  2LC9 A;  1WVH A;  2V76 A;  3HH3 A;  4HSF A;  4EKP A;  1LHK A;  3NW8 A;  183L A;  1L72 A;  2HUK A;  1VDT A;  1T97 A;  256L A;  1SLY A;  3LZ2 A;  1IC4 Y;  4Z2N A;  2YSS C;  2YS3 A;  1JQU A;  5FCP A;  1QTC A;  1C67 A;  4K5Y A;  5LVJ A;  1IR7 A;  1L91 A;  2DHI A;  4WM5 A;  1C63 A;  4W58 A;  1J0W A;  1X1F A;  2RBR A;  4DX8 A;  3DMX A;  1SQ2 L;  3L64 A;  3SV1 A;  236L A;  3AZ5 A;  1GAY A;  3C7Y A;  1VAT A;  5DN4 A;  1L58 A;  222L A;  4H8Y A;  1P6Y A;  4IOY X;  208L A;  4CHX A;  1OUB A;  2Z38 A;  1TDY A;  1X05 A;  4DAJ A;  1P7S A;  1IRS A;  4ETD A;  2CRF A;  4Z3M A;  1B7L A;  4J7V A;  2IYB A;  4EJN A;  4HP0 A;  4RW1 A;  1L97 A;  2CY4 A;  1NDM C;  1A2Y C;  4I7N A;  1OY2 A;  4Z41 A;  1L42 A;  3TMX A;  2A7F A;  2HEB A;  3HH5 A;  1YKY X;  2B70 A;  1L05 A;  2DQF C;  3C7Z A;  4H9E A;  1IWW A;  1I6S A;  4I7M A;  2DTC A;  1L73 A;  1QT7 A;  1CU0 A;  123L A;  1FGY A;  4TSB A;  1BHZ A;  4XJB A;  1L22 A;  2BQK A;  1FHO A;  1LW9 A;  1F10 A;  2RB0 X;  1DYE A;  1L21 A;  3RW8 A;  5LAG A;  2YVB A;  2Q9E A;  4QY9 A;  4E97 A;  2LOX A;  3A8Q A;  5DIF B;  3G3W A;  221L A;  4KHB A;  1GC7 A;  1D0M A;  137L A;  2DKQ A;  2HEC A;  4NGL A;  4Z46 A;  3DNA A;  1G0J A;  3TCA A;  3A90 A;  3FI7 A;  253L A;  2H7D A;  1LZG A;  2R2Y A;  153L A;  3D8F A;  2I25 L;  4GN1 A;  1OUD A;  1JIY A;  111L A;  3D8D A;  4ZRI A;  2QKM A;  2D2Q A;  1CU6 A;  2Z18 A;  5D5C A;  1KW5 A;  1FGZ A;  3PVW A;  3PZD A;  1L82 A;  2AUB A;  2F4G A;  1L96 A;  4KT3 A;  1NWG A;  3C8Q A;  4LFX A;  1SSY A;  5L3I A;  1LYJ A;  4LT3 A;  2F47 A;  1MLC E;  1XGR C;  1DYN A;  207L A;  1LHI A;  3FEH A;  1HEQ A;  1LMQ A;  4Z98 A;  2B6Z A;  1C66 A;  2Y8F A;  4NGW A;  1L08 A;  1AKI A;  3QNG A;  4IJ4 A;  1LWK A;  2YS5 A;  1UIH A;  2COD A;  1WQM A;  1ISN A;  4HJV A;  3HW2 B;  3HDF A;  3WMK A;  156L A;  2G4Q A;  3WYH A;  2BCJ A;  4F7G A;  3OE6 A;  1QSW A;  1OMW A;  3WU7 A;  1GF9 A;  2B74 A;  1C45 A;  1GEZ A;  1YL0 X;  1OUE A;  1RE2 A;  1MIX A;  246L A;  2RSC A;  1D3J A;  5DN5 A;  4OO9 A;  1OV7 A;  5KY1 A;  3PEG A;  1C7P A;  5J3T A;  4ARQ B;  4LZT A;  2EQL A;  2D11 A;  262L A;  2RBP A;  3C80 A;  2DBT A;  4CJ2 A;  242L A;  4HAY B;  1LJF A;  4MST A;  191L A;  3FVC A;  1SHC A;  1LJK A;  2FJU B;  102L A;  1OUA A;  1KI1 B;  1L69 A;  2NTH A;  2RB1 X;  3SB5 A;  1DDW A;  3AGG G;  1HEM A;  3K2R A;  4DIX A;  5C79 A;  1C6E A;  248L A;  1BVK C;  1L49 A;  4NSH A;  5EFX A;  1FN5 A;  3N9E A;  5FST A;  4EXM A;  4N1E I;  4GLV A;  2W1L A;  1C61 A;  2Z2F A;  249L A;  1B9O A;  196L A;  3W6B A;  2J0J A;  1LMP A;  3OAN A;  4H9B A;  189L A;  4I7L A;  5LIO A;  3TFM A;  3C82 A;  2HED A;  4W51 A;  1IVM A;  1GXV 2;  5LYZ A;  4C0A A;  3SBB C;  1MK9 B;  1XKE A;  4LYM A;  3GXK A;  1BWI A;  2Z0P A;  257L A;  3TO1 A;  1ZVR A;  1LJI A;  3EXD A;  4H91 A;  1QT3 A;  4WMG A;  2W2X C;  120L A;  1L65 A;  3WW6 A;  1C68 A;  1IWZ A;  1L84 A;  198L A;  1KXY A;  4GXB A;  1QQY A;  1YAM A;  2DN6 A;  1LSB A;  1IWV A;  1Z87 A;  1XGP C;  1JIT A;  4ARM B;  5B05 A;  223L A;  1LZE A;  2KCJ A;  1B5U A;  1LYE A;  1YAQ A;  1LZN A;  4DJH A;  2FJL A;  1GF8 A;  1MIZ B;  1V89 A;  1CV6 A;  1L86 A;  1YQV Y;  4II8 A;  4DD3 A;  2RBO A;  4EKS A;  4G9S A;  154L A;  1KY0 A;  2DFK A;  4NHT A;  1SGH A;  1L28 A;  5C5B A;  2IFS A;  2O4W A;  1LZS A;  1GFK A;  1LGU A;  1JKB A;  239L A;  1OUI A;  4WL7 A;  1FHX A;  1L00 A;  2XTH A;  1I1Z A;  4GCF A;  5KQ1 A;  4A7D A;  1P5C A;  3CSZ A;  181L A;  1CVK A;  5APD A;  4IFS A;  1EQE A;  1HFZ A;  2HE7 A;  1L36 A;  2B7X A;  5LA5 A;  1B5Y A;  4KHA A;  5C6J A;  1LOZ A;  5K7O A;  140L A;  3LYZ A;  2ADZ A;  3M3U A;  2ZIL A;  1QUT A;  3P68 A;  4KHB B;  1QSB A;  2ROV A;  3A96 A;  4H1P A;  3OHM B;  3DKE X;  1L34 A;  4G49 A;  4NSJ A;  1L79 A;  1BB3 A;  1BAK A;  1UIA A;  3DN4 A;  1BVX A;  255L A;  2CWI A;  4PPO A;  4WOA A;  1J1P Y;  2LHM A;  1HER A;  4J0L A;  1D3M A;  3HTF A;  194L A;  4XJH A;  3QAK A;  1QTD A;  2UZS A;  1L06 A;  3VOQ A;  1L13 A;  1TBY A;  3SN6 R;  1LHJ A;  4QDN A;  4BBK A;  2Z19 A;  1EAZ A;  5ILC A;  3JR6 A;  3WA0 A;  4DD9 A;  1LZ4 A;  1LZ5 A;  4WL6 A;  4GCC A;  1LHM A;  3FA0 A;  3LN2 A;  178L A;  4NGY A;  5KXN A;  1OUG A;  1IP1 A;  2FBD A;  4GOU A;  5LYM A;  3MGW A;  4N9R A;  3AGI A;  3CDQ A;  3ZDT A;  5D3X A;  4J1B A;  4WLD A;  1C6A A;  1CUP A;  2P0F A;  2Z59 A;  3G3X A;  159L A;  5KJ9 A;  2R09 A;  1DYA A;  1L23 A;  1X86 A;  2YBM A;  2E2X A;  1XEK A;  1G06 A;  4HTQ A;  1F0W A;  3GUK A;  1DXJ A;  3DCX A;  1FAO A;  1L90 A;  3HT8 A;  4CHM A;  1IC5 Y;  5F14 A;  1JKD A;  5JEN B;  3BKV A;  5AMY A;  2COC A;  5J3Q A;  2UZR A;  1GBS A;  5JP4 A;  1QDR A;  1CJ9 A;  1LB1 A;  1Z55 A;  1L66 A;  4OWH A;  1U5G A;  131L A;  1T6H A;  1GE2 A;  5DH9 B;  4WLX A;  1GB6 A;  2NMB A;  1H87 A;  1L0J A;  4L41 A;  1L59 A;  3M1I B;  4W94 A;  4W57 A;  1E5W A;  1L41 A;  2VB1 A;  4Z2M B;  3WW5 A;  2BQL A;  2DHK A;  1L04 A;  5B06 A;  3UON A;  182L A;  1L31 A;  5HE3 A;  1B5W A;  3HQC A;  245L A;  2L1C A;  1BB4 A;  1CU3 A;  1UA6 Y;  3AU5 A;  4IAS A;  1P2R A;  1LJH A;  1U29 A;  1B7S A;  3ZVQ B;  3AB6 A;  1GFV A;  1L45 A;  4AGA A;  2BQI A;  1G7I C;  3WL2 A;  4MT7 A;  1DPX A;  1W1G A;  2KIE A;  2GCJ A;  1ZVY B;  1D0L A;  1JJ0 A;  2X18 A;  2OE9 X;  3A58 A;  218L A;  2XJW A;  4HB2 B;  1C6L A;  1W1H A;  1JKA A;  2MEC A;  5APE A;  1LAA A;  3GUO A;  1C6D A;  2R0D A;  3GUP A;  3AJN A;  134L A;  4C5F A;  2BQJ A;  188L A;  1O23 A;  3CSQ A;  1B7Q A;  2G4N A;  3IJV A;  4HPE A;  3A8Z A;  1QUD A;  1IOS A;  2BQF A;  238L A;  1E8L A;  1CV5 A;  4PK0 A;  2ROZ B;  1LMN A;  225L A;  192L A;  2RUK B;  4OWB A;  4DXA B;  4HAX B;  2N5Z A;  4EPI A;  1PS5 A;  5HMJ A;  1L50 A;  1CV1 A;  3GYP A;  4HSI A;  209L A;  3LJU X;  5KXM A;  2HUL A;  261L A;  1L67 A;  2DQH Y;  1C6Q A;  1C6F A;  1V5P A;  4HB0 B;  1HNL A;  1QT4 A;  1YAO A;  1YKZ X;  1IIZ A;  1AT5 A;  2RBN A;  1DI4 A;  5I53 A;  4I7Q A;  160L A;  2D9Y A;  4NEB A;  1Y19 B;  165L A;  1B0D A;  1DRO A;  4DDB A;  2IGC A;  4HAU B;  3HT9 A;  5I54 A;  4B6H A;  2YBJ A;  3CT5 A;  2K8E A;  1I7A A;  1JSF A;  1X1G A;  1QIO A;  1KNI A;  4TSC A;  2BQG A;  1LYF A;  5KXW A;  162L A;  1UNR A;  4XYY A;  1D2W A;  1NI2 A;  3RZE A;  4B4I A;  3ULB A;  2YVC A;  4YXA C;  2IHL A;  2HU1 A;  4QJ5 B;  2ZYP A;  1PFJ A;  4KAX B;  4OT1 A;  1XX0 A;  199L A;  3QY4 A;  1GF5 A;  1QUS A;  1ZWN A;  164L A;  1LSC A;  5I2M A;  4D9Z A;  2HTH B;  2F2N A;  1ZC3 B;  1INU A;  4P7I A;  1M7R A;  1CX6 A;  4B0D A;  4WM2 A;  5FEL A;  4LT1 A;  2Y7B A;  1IOC A;  3PG7 A;  2YT0 A;  2ELA A;  2IFF Y;  3ATO A;  4HTK A;  3B0K A;  4TTD A;  2BQA A;  4CFO A;  6LZM A;  3EMS A;  5DHF B;  1G1W A;  1ZC4 B;  1C65 A;  1PQJ A;  5FHW A;  3HU8 A;  1LMC A;  2KIG A;  1KIR C;  1GD6 A;  4I7P A;  1L20 A;  1MKE A;  2BQD A;  4WSF A;  234L A;  2I1K A;  1QTB A;  3WPL A;  4GRV A;  3GYO A;  2MKR A;  1LSE A;  4GCD A;  4MCK A;  3C83 A;  1G1V A;  1FKV A;  3DN6 A;  1V61 A;  1U5E A;  4ET9 A;  4HV1 A;  2I5F A;  1VDQ A;  1L25 A;  4NSG A;  2CDS A;  2D4I A;  1ZUR A;  130L A;  147L A;  1SSW A;  144L A;  1HFX A;  3W6F A;  2EC1 A;  2Z13 A;  1ZM0 A;  1JUG A;  3TVV A;  3A94 A;  3PBL A;  1HC0 A;  1V5M A;  1QUO A;  2BQM A;  4EJ4 A;  3RNX A;  4KXI A;  3A6C Y;  5KCV A;  2ZQ4 A;  3TXE A;  3ZVR A;  1CKD A;  2P0D A;  2VRW B;  1CUQ A;  1I2H A;  1L09 A;  1L62 A;  2DX1 A;  5L81 A;  4ET8 A;  174L A;  4HTN A;  2YS1 A;  1JTT L;  1GFJ A;  1QT6 A;  2M14 A;  1L92 A;  1D9W A;  5B07 A;  4R0F A;  1QS5 A;  4ZFP A;  1IEE A;  2OE4 X;  4NG1 A;  8LYZ A;  2EKS C;  1LZ6 A;  1RJC B;  4OOO A;  1YAN A;  4YL8 A;  1IWX A;  127L A;  3F0W A;  3KRX A;  1GB2 A;  2DKP A;  1BB6 A;  4QJ3 B;  1L54 A;  2LYD A;  5FDJ A;  2OQB A;  4KHO A;  1C10 A;  1QS9 A;  3HH4 A;  2B5Z A;  161L A;  226L A;  3WU9 A;  5LAF A;  237L A;  2NTG A;  4EKR A;  103L A;  3LYM A;  1TXD A;  4DD1 A;  1DYD A;  4ETB A;  2F2Q A;  1PZY A;  141L A;  2ZNW Y;  4GPT B;  1QSQ A;  1FHW A;  2Z12 A;  3TMU A;  3AW7 A;  2DHJ A;  1C62 A;  3TMV A;  3HU9 A;  1LI2 A;  1L03 A;  4LDL A;  1LYY A;  2XBS A;  1D0K A;  4DD7 A;  1JTO L;  1XEI A;  1RFP A;  1J1X Y;  2MEA A;  3N9A A;  2YBN A;  4RDS A;  4NSW A;  1IP2 A;  5FI0 A;  3GXR A;  5LIN A;  2D4Q A;  2W1X A;  1LYZ A;  3N7C A;  2Q0M X;  1FBI X;  7LYZ A;  1L17 A;  3CIK A;  5I4Y A;  1GF7 A;  4DDC A;  1LKR A;  145L A;  4D0N B;  4NG8 A;  4XJG A;  2KUQ A;  1B6I A;  1EPY A;  1LSN A;  4YEN A;  3D8E A;  1OWY A;  3P65 A;  1PQM A;  1QTK A;  2YF0 A;  2D4J A;  5EBH A;  4F7U P;  1LSM A;  2FYD A;  1HEN A;  1L89 A;  1LYO A;  3AYQ A;  1VAU A;  197L A;  1ZMY L;  1G7H C;  1LJN A;  1L87 A;  4LT2 A;  1LTM A;  1U5D A;  3OE8 A;  3CDV A;  3SBA A;  4RLN A;  4ETC A;  3TXH A;  3VW7 A;  1WVV A;  4LYC A;  4B4J A;  4I8S A;  4ETE A;  1BTK A;  1T77 A;  3ZEK A;  1DYC A;  3T06 A;  4U3X B;  1HSX A;  1B2K A;  3HUQ A;  1L43 A;  1AZF A;  4UWN A;  232L A;  2MEF A;  1UBZ A;  1XD4 A;  4PHI A;  4I7K A;  170L A;  1GF4 A;  4NFV A;  4LGK A;  1LJ4 A;  3OE9 A;  4NY0 A;  125L A;  2G4P A;  1DI3 A;  1OUC A;  1ZVH L;  1C6I A;  149L A;  4NY5 A;  1QT8 A;  2NBV A;  3AW6 A;  4WO6 A;  3DXC A;  2J0K A;  1I20 A;  1NBZ C;  3GUJ A;  1P64 A;  5LXW A;  158L A;  1L11 A;  2J0M A;  4OSN A;  1DPW A;  1L47 A;  1UCO A;  4UWU A;  1RJ2 A;  3TXJ A;  1C6J A;  3PVU A;  2OTZ X;  4DBB A;  3A98 B;  1GB9 A;  2LUL A;  4TX7 A;  4L6E A;  1LCN A;  2RB2 X;  5D27 A;  3LZT A;  3VWO A;  1V5U A;  1L80 A;  1PQO A;  3SUZ A;  1XOD A;  259L A;  2AEH A;  3ML4 A;  187L A;  3WVY A;  1CV0 A;  2K2J A;  3T6U A;  4BS7 A;  1XGQ C;  1C6N A;  1L83 A;  3LZM A;  1OUF A;  4K81 A;  1BWN A;  2I1J A;  1UUZ C;  2BQH A;  2D10 A;  2RAZ X;  1WJ1 A;  1IOQ A;  212L A;  1GBZ A;  3HWL A;  177L A;  4GN5 C;  1CJ8 A;  1L33 A;  1GBW A;  1MI1 A;  1EQ5 A;  175L A;  1SX2 A;  1JHL A;  2NWD X;  4WLT A;  1P2L A;  5KXO A;  2Z37 A;  1FLW A;  3HUA A;  1BB7 A;  4ARM A;  3HDE A;  200L A;  3MPX A;  4PJZ A;  1IY4 A;  3SYX A;  2LYM A;  3FI5 A;  4M6D A;  3WUN A;  1FOE A;  1G0M A;  1W6Z A;  2H9J A;  1RCM A;  4N5R A;  2HUB A;  4DT3 A;  2DA0 A;  4A6K A;  4A6F A;  4NWE A;  4W54 A;  3M18 B;  4LZM A;  5L3H A;  1HEO A;  2ELB A;  1G0P A;  3GUN A;  3FM8 C;  4NIJ A;  1T3P A;  1LSZ A;  4PNK A;  107L A;  2D9X A;  1F6R A;  1OV5 A;  2W2X D;  4MK0 A;  1HSW A;  5A3E A;  3WUL A;  1TJ6 A;  4DKL A;  244L A;  1GFT A;  1OUJ A;  2HEE A;  4LFP A;  1AWE A;  3CSR A;  3QE8 A;  4GMX B;  4NGI A;  4NGK A;  3DN3 A;  1L30 A;  2ANV A;  4ARJ A;  4GN3 A;  1B5V A;  1C43 A;  1GXX A;  4D6W A;  5A3Z A;  4H9A A;  2LYO A;  2RBS A;  3OJP A;  215L A;  5D5F A;  4H9C A;  1L39 A;  2UVM A;  3KSY A;  3LHM A;  4XN6 A;  5I4W A;  1G7J C;  1L52 A;  1C64 A;  1LLH A;  2HUM A;  3DXD A;  2D9W A;  4I7S A;  1B7O A;  2D6B A;  2BLY A;  2QB0 B;  2YBH A;  3X23 A;  1L98 A;  3C7W A;  4I7O A;  1CKF A;  4WM4 A;  5KXX A;  216L A;  3DN2 A;  220L A;  1GF6 A;  219L A;  3D3D A;  3QBV B;  3WPJ A;  1L44 A;  2PC2 A;  2MED A;  146L A;  2OU8 A;  1U2B A;  2L2I A;  2Q9D A;  1L26 A;  2CAY A;  1GFE A;  3UZT A;  1GE1 A;  4S0W A;  4MY6 A;  2EPE A;  4G4H A;  4PQ0 A;  1DYB A;  1EF1 A;  2JP2 A;  168L A;  3HUK A;  1UID A;  2ZNX Y;  4W56 A;  1KW7 A;  1L15 A;  1CX7 A;  1WTN A;  2Z14 A;  4LT0 A;  4N0J A;  1G0L A;  1JWR A;  3B0I A;  2MDX A;  5KXP A;  4H92 A;  1M7E A;  3A91 A;  1IP7 A;  2C8P A;  1WG7 A;  1C6H A;  1IWY A;  4LYO A;  1J1O Y;  1UC0 A;  2F32 A;  1C6C A;  6LYT A;  128L A;  1BB5 A;  1P2C C;  211L A;  2M38 A;  1NF5 A;  1D9U A;  1CKC A;  2MFQ A;  5LG4 B;  3NYA A;  1L27 A;  2N0Y A;  5GOW B;  4EKU A;  1GB3 A;  3U7D A;  4B1A A;  2DYQ A;  1XSF A;  4DC4 A;  3A95 A;  1IC7 Y;  1ZYT A;  4ARQ A;  4KPM A;  133L A;  1C6K A;  4PGJ B;  213L A;  2ZIK A;  3B72 A;  3DN1 A;  1K5G B;  4HAT B;  142L A;  5HQ1 A;  4M4O A;  1CKH A;  1L63 A;  1B7P A;  2XQN M;  4NGZ A;  4W96 A;  1YRO A;  1X11 A;  1NQI A;  3J4G A;  1C6G A;  4HAV B;  1LJE A;  4W55 A;  1BQL Y;  3ODO A;  4WM6 A;  1L14 A;  2H7E A;  2MEB A;  3RCP A;  2YT2 A;  3WYF B;  3AJ4 A;  155L A;  110L A;  1W1D A;  1L46 A;  1CU2 A;  1DYF A;  2BQO A;  4AXT A;  1P6S A;  2DX5 A;  173L A;  4I7T A;  2GV0 A;  1G7M C;  4XJD A;  1K5D B;  3NSU A;  5C6L A;  1L57 A;  4LDO A;  1L35 A;  1T6V L;  114L A;  1UIG A;  3B6L A;  1IY3 A;  210L A;  3HTB A;  5DLA A;  4GNK B;  4WVF B;  5D3V A;  1GEV A;  1L37 A;  3WVX A;  230L A;  2DQE Y;  224L A;  1LYG A;  4ZIX A;  5LVH A;  3G3V A;  2H5Z A;  214L A;  2RLO A;  4CGE A;  3MDB C;  1LSY A;  2P0H A;  1LZD A;  3HFM Y;  3AGH A;  4HDO A;  190L A;  3TXB A;  1W08 A;  3HT7 A;  2BAA A;  2AL6 A;  2DQI Y;  2RVB B;  3TXF A;  1NKH A;  4DDA A;  2PZ1 A;  3CDO A;  4DWX A;  4GBR B;  3GUM A;  4H94 A;  1IX0 A;  1MAI A;  5HNC A;  4NGO A;  3SB7 A;  1IP5 A;  4IAP A;  2K2U A;  1GE0 A;  2RH1 A;  4P2E A;  1LPY A;  2Z6B A;  1KZG A;  2LG1 A;  2H9K A;  4QGZ A;  3AZ7 A;  4NHP A;  1GBY A;  1CTW A;  2Q13 A;  1GAZ A;  1J19 A;  3QWM A;  5KXK A;  1WQR A;  1EL1 A;  1LHL A;  1DYG A;  4CHJ A;  1LZ1 A;  4ML7 A;  4NHI A;  4WG7 A;  3EML A;  4QXA B;  1P37 A;  1XEP A;  3SP3 A;  1ZSQ A;  2O7A A;  6LYZ A;  1QTE A;  2DQA A;  5B1G A;  4ARL A;  4DQ5 A;  1C46 A;  2OU9 A;  1TQZ A;  1JSE A;  1QTZ A;  1JEF A;  1JJ3 A;  1HF4 A;  5IHG A;  3ODX A;  4OWC A;  2BQB A;  1FLQ A;  1UIC A;  235L A;  3P7Z A;  163L A;  3W6D A;  1WTH A;  3FSS A;  1XGU C;  1NMM A;  2X0A A;  1WVU A;  4OW1 A;  3OE0 A;  3J6K A;  1L70 A;  1L99 A;  3ODU A;  1GF3 A;  3KZ1 A;  3P64 A;  2CJL A;  2RSG A;  5II3 A;  1TLA A;  1UPQ A;  1LZ9 A;  3HTD A;  1LZA A;  2COF A;  2B6X A;  3ULC A;  1DKK A;  4XJI A;  2O79 A;  3GUL A;  2LZM A;  4O34 A;  1UIB A;  3G3A B;  3V5W A;  1REZ A;  4YXC A;  1LGW A;  1L76 A;  1DDM A;  2HEF A;  3G3B B;  4GMV A;  4R6C A;  5M1Y A;  1LPI A;  1PQK A;  4NHS A;  4XEN A;  3DN8 A;  2W2W A;  1V7T A;  2YSZ A;  2Z4D A;  4FJR A;  3TXG A;  3F6Z A;  4G4B A;  4Y94 A;  1SWY A;  132L A;  2D9Z A;  1P56 A;  1D6Q A;  1LZ8 A;  1QTV A;  1L88 A;  1U27 A;  2KUP A;  1VDS A;  3RT5 X;  1GFU A;  4HJY A;  1CV4 A;  4GZU A;  1T8A A;  5HE1 A;  1LSP A;  4DYG A;  251L A;  2QAR C;  1LSD A;  1QUG A;  4NWH A;  2WAR A;  3PDS A;  3HT6 A;  3NWF A;  3P6A A;  2DQG Y;  3BJI A;  2P8V A;  3PVL A;  243L A;  1FKQ A;  5FI1 A;  1CJ7 A;  3D9A C;  250L A;  2OTY X;  1FB8 A;  3W3E A;  4A5K A;  184L A;  1BTN A;  2GCL A;  3AU4 A;  2CGI A;  3PSC A;  3ZVQ A;  1IO5 A;  1H10 A;  1LYS A;  1UIE A;  5T3F A;  5LOP B;  4KVG B;  1L48 A;  1L93 A;  1LMO A;  1VED A;  1WQQ A;  2CUU A;  1IWT A;  2FBB A;  4YF2 A;  4YOP A;  2I6Z A;  1AM7 A;  3HTG A;  4NGV A;  3W6A A;  2BQC A;  4HAW B;  9LYZ A;  3NY8 A;  4I0C A;  5HE0 A;  4F7H A;  1EQ4 A;  3QIJ A;  172L A;  2F30 A;  4WLY A;  2MEI A;  3PP2 A;  5J3Y A;  3CDR A;  5KXT A;  4K2P A;  4CSQ A;  148L E;  5LYT A;  1OQM A;  2B6T A;  2EIZ C;  1D3N A;  3LYT A;  1NDG C;  1QSA A;  5LZM A;  2LYZ A;  1LZC A;  1CJ6 A;  5LVG A;  1HFY A;  4OWA A;  4YEO A;  1I56 A;  1QDT A;  2B75 A;  4NHQ A;  1QC6 A;  5F9X A;  4E3U A;  1GPQ C;  3WXU A;  2G35 A;  2RNR B;  4L1R A;  1D6P A;  1KIP C;  4W59 A;  1B55 A;  1L94 A;  169L A;  1JKC A;  2Z2E A;  1REX A;  2D9V A;  1T8F A;  3TXD A;  1LZT A;  2ZQ3 A;  1NTV A;  2B6Y A;  4ANR A;  3TMW A;  171L A;  112L A;  4WG1 A;  3O96 A;  5DI9 B;  1XJU A;  1GC6 A;  1YIK A;  1GE4 A;  1LMT A;  3RU5 A;  3FE0 A;  5M4Y B;  5I4X A;  1LSA A;  5IDD A;  2I26 L;  1HMK A;  1DBH A;  1AT6 A;  5E4P A;  2CY5 A;  4K17 A;  1WGQ A;  1IOT A;  5L9J A;  3HIE A;  3B77 A;  1LWG A;  240L A;  227L A;  4DD2 A;  1BWJ A;  4C3W A;  4GCB A;  4BAP A;  1GE3 A;  4LYB A;  1L56 A;  1L10 A;  1YIL A;  1C69 A;  5B59 A;  1XFP L;  1IR8 A;  1IP3 A;  2OEA X;  5C6R A;  2DQJ Y;  4QEQ A;  3AZ6 A;  4EOF A;  1V7S A;  1REY A;  1XGT C;  4H93 A;  1A4V A;  1K28 A;  2MEG A;  1L61 A;  180L A;  122L A;  1KY1 A;  3AZ4 A;  2D91 A;  1OWZ A;  2XBR A;  3E3D A;  1OVK A;  4CYE A;  2ZIJ A;  4EMO A;  2Y8P A;  4EPF A;  4GN4 A;  4YX7 C;  1LJG A;  1L19 A;  1P3R A;  1WJM A;  3A8P A;  2Z0Q A;  3HH6 A;  3SO6 A;  1LJJ A;  2HEA A;  2I5C A;  4OWE A;  185L A;  3OK0 A;  151L A;  1IWU A;  1TEW A;  4ZRK A;  4XAD A;  4BAF A;  1C6P A;  1PMS A;  1B7R A;  2K00 A;  4W53 A;  3F5R A;  4NGJ A;  1QT5 A;  4MR1 A;  2KR0 A;  3F9L A;  1LYD A;  3W6E A;  1L60 A;  1OYU A;  3L2X A;  3U8Z A;  1IP4 A;  1JJ1 A;  3SNH A;  1L81 A;  5JLJ B;  118L A;  3VIA A;  2ZYC A;  1L0K A;  186L A;  228L A;  4CFP A;  4ZRJ A;  2RGN B;  152L A;  3WU8 A;  2LKO A;  3DN0 A;  4I7R A;  1QTH A;  5DM9 A;  1U5F A;  1GFA A;  3SB8 A;  4IAT A;  5KQ4 A;  4HB3 B;  1UPR A;  1GF0 A;  5LON B;  2C8O A;  5E9R A;  3TW1 A;  126L A;  1GHL A;  1L68 A;  3CT0 A;  1C6B A;  3HBD A;  1IP6 A;  233L A;  5DL9 A;  2Z0O A;  252L A;  1GBO A;  104L A;  119L A;  5B1F A;  1YL1 X;  1L01 A;  3ULR A;  3IJU A;  3A93 A;  5KKJ A;  217L A;  2ZWB A;  1L16 A;  1GDX A;  2B6W A;  1LSF A;  3U12 A;  1LZR A;  2DYN A;  138L A;  5C5B B;  2QKL A;  1QUH A;  1ZV5 L;  1L71 A;  4GCE A;  2LZ2 A;  254L A;  4GLA A;  3KAM A;  3C8S A;  1MK7 B;  1F6S A;  2NZ8 B;  5F16 A;  1G07 A;  4H9F A;  5IRS A;  1YKX X;  1CU5 A;  1DQJ C;  3WUM A;  5LVK A;  1OQN A;  4WO9 A;  3A3Q A;  4NSI A;  1SX7 A;  2N23 A;  3CQL A;  3KRW A;  3DMV A;  1REM A;  1IR9 A;  1G0Q A;  4ZEE A;  1V88 A;  4K2O A;  4G4C A;  5LA8 A;  1JTP L;  1G0G A;  5JHG A;  5D3Y A;  1L75 A;  1HEL A;  1VFB C;  2COA A;  1L77 A;  1XEJ A;  2F4A A;  5HLL A;  1N3H A;  166L A;  1LGX A;  1L24 A;  1KZ7 A;  4YM8 A;  2GJY A;  1LSG A;  2OU0 X;  4X3B A;  2DQC Y;  5I5Q A;  1UNQ A;  3TXI A;  5APC A;  1FLY A;  1B5X A;  2FYC A;  4FDY A;  2RBQ A;  176L A;  1P3N A;  1L95 A;  1LJ3 A;  5JHH A;  3LYO A;  3TXK A;  206L A;  1PQD A;  5DHA B;  1ZYI A;  5ILF A;  3EBA B;  5C6I A;  4PRU A;  4A6H A;  1HHL A;  1SWZ A;  1TAY A;  4UWV A;  1CV3 A;  2LOZ A;  1GB7 A;  4ARP A;  1LZB A;  3CB7 A;  3N9C A;  1GFH A;  3EO5 A;  1CNS A;  5CLQ B;  1MPH A;  1L40 A;  3A3R X;  2ZPY A;  1UNP A;  3WPK A;  1XJT A;  2VKI A;  5C16 A;  1EGX A;  4EMN A;  4TKN A;  2YT1 A;  1L38 A;  2GS0 A;  5KXY A;  1IOR A;  5IEL A;  4QJ4 B;  2OE7 X;  3CT1 A;  1G0K A;  5KXL A;  1L51 A;  2A4T A;  4N8Z A;  1GWD A;  1TCY A;  231L A;  1KXX A;  3C8R A;  1P46 A;  247L A;  260L A;  4H9I A;  4WJ7 A;  1KIQ C;  1RRP B;  4PRQ A;  201L A;  2KGX B;  150L A;  1D2Y A;  1NBY C;  3CDT A;  3D4S A;  3GUI A;  4DD0 A;  3HSA A;  3NY9 A;  1LMA A;  1BWH A;  1DZB X;  4DX9 0;  1P5T A;  229L A;  2GUM A;  1NTY A;  2RAY X;  157L A;  1UAC Y;  4H9H A;  2MEH A;  5CLL B;  1L29 A;  1QQG A;  5F9U A;  5I2S A;  135L A;  1GFG A;  3WUA A;  3KY9 A;  5HE2 A;  5HNL A;  1BGI A;  5HMV A;  1Y5O A;  4HB4 B;  3HBH A;  3V2W A;  2HTX A;  3IVF A;  3DMZ A;  1L64 A;  3SB9 A;  1HEP A;  2D4K A;  2Z39 A;  3RUN A;  1WQP A;  5D3W A;  1VDP A;  2B73 A;  4BAD A;  4YEM A;  3ODW A;  2DLW A;  3F8V A;  4LDE A;  4H8S A;  1NHB A;  1C08 C;  4TUN A;  1L74 A;  5KXR A;  1NU2 A;  4TYZ A;  1OUH A;  1L55 A;  4EKQ A;  4J1A A;  3V2Y A;  1GBX A;  3A67 Y;  2YBI A;  2W1Y A;  2EMT A;  1PQI A;  1PLS A;  4HDQ A;  2YRY A;  1C6T A;  4XJF A;  1LKS A;  1HEW A;  4KL7 A;  1JTM A;  4DQJ A;  4WM3 A;  1GDW A;  1LYI A;  1H6M A;  2HU3 A;  4H8Z A;  4ZPU A;  1HML A;  4XWX A;  1GFR A;  3T36 A;  4N1C C;  1D3F A;  1JTN A;  1L07 A;  4PJ2 C;  1G7L C;  1WQO A;  5J7C A;  1H4R A;  2YDG A;  5LVI A;  1LZY A;  2XQO A;  2MWN B;  3A92 A;  4H90 A;  1LI3 A;  1L53 A;  4DQ7 A;  1WGU A;  2YBL A;  2BPU A;  3K3T A;  1C60 A;  5I14 A;  4I7J A;  4AQN A;  1T8G A;  3A6B Y; 
#chains in the Genus database with same CATH homology
 4W52 A;  1LYH A;  3P4Z A;  3DXE A;  241L A;  1WTM A;  1FDL Y;  1L02 A;  1JPO A;  1Q67 A;  5F81 A;  1MEL L;  3G9W A;  129L A;  2BLX A;  1LHH A;  3A34 A;  4RLM A;  1KS3 A;  1L32 A;  1WI1 A;  3HBE X;  109L A;  2ANX A;  4RW2 A;  2J59 M;  143L A;  258L A;  3BKH A;  1DI5 A;  3RZ4 A;  1L12 A;  3IWR A;  2VSZ A;  3ATN A;  139L A;  1WQN A;  3WH1 A;  115L A;  1GB5 A;  1OVH A;  5KXZ A;  1C6M A;  1UIF A;  2B72 A;  4HV2 A;  1B7N A;  193L A;  1FLU A;  4LYT A;  1XR0 B;  4OOT A;  108L A;  4HJZ A;  3HK0 A;  1DKJ A;  2LZT A;  4B4E A;  2MEE A;  1GB0 A;  4HPI A;  1XCG A;  3B0O A;  1YAP A;  3FAD A;  1JIS A;  2LCB A;  4YON A;  1UEF A;  1N4F A;  2BQE A;  4ETA A;  3P66 A;  5APF A;  4H8X A;  205L A;  5KKI A;  7LZM A;  3CXB B;  1L18 A;  2L78 A;  4HHV A;  1CKG A;  113L A;  4LYZ A;  1P36 A;  1GG3 A;  4WM1 A;  1AQC A;  1DDV A;  4A6F B;  1L85 A;  1B7M A;  195L A;  2DKV A;  4HAZ B;  2EMS A;  2DQD Y;  1GB8 A;  1KXW A;  1B5Z A;  5FEK A;  1ALC A;  1EVH A;  1NHE A;  2BQN A;  1LI6 A;  2OTX A;  2W1M A;  3W6C A;  3SB6 A;  2Y8G A;  2EJ8 A;  3C81 A;  1OVJ A;  167L A;  4B49 A;  3BIN A;  3WXT A;  2A7D A;  1OP9 B;  1LW3 A;  5KXS A;  4TWS A;  1RI8 B;  2LC9 A;  1WVH A;  2V76 A;  3HH3 A;  4HSF A;  4EKP A;  1LHK A;  183L A;  1L72 A;  2HUK A;  1VDT A;  1T97 A;  256L A;  1SLY A;  3LZ2 A;  1IC4 Y;  4Z2N A;  2YSS C;  2YS3 A;  1JQU A;  5FCP A;  1QTC A;  1C67 A;  4K5Y A;  5LVJ A;  1IR7 A;  1L91 A;  2DHI A;  4WM5 A;  1C63 A;  4W58 A;  1J0W A;  1X1F A;  2RBR A;  4DX8 A;  3DMX A;  1SQ2 L;  3L64 A;  3SV1 A;  236L A;  3AZ5 A;  1GAY A;  3C7Y A;  1VAT A;  5DN4 A;  1L58 A;  222L A;  4H8Y A;  1P6Y A;  4IOY X;  208L A;  4CHX A;  1OUB A;  2Z38 A;  1TDY A;  1X05 A;  4DAJ A;  1P7S A;  1IRS A;  4ETD A;  2CRF A;  4Z3M A;  1B7L A;  4J7V A;  2IYB A;  4EJN A;  4HP0 A;  4RW1 A;  1L97 A;  2CY4 A;  1NDM C;  1A2Y C;  4I7N A;  1OY2 A;  4Z41 A;  1L42 A;  3TMX A;  2A7F A;  2HEB A;  3HH5 A;  1YKY X;  2B70 A;  1L05 A;  2DQF C;  3C7Z A;  4H9E A;  1IWW A;  1I6S A;  4I7M A;  2DTC A;  1L73 A;  1QT7 A;  1CU0 A;  123L A;  1FGY A;  4TSB A;  1BHZ A;  4XJB A;  1L22 A;  2BQK A;  1FHO A;  1LW9 A;  1F10 A;  2RB0 X;  1DYE A;  1L21 A;  3RW8 A;  5LAG A;  2YVB A;  2Q9E A;  4QY9 A;  4E97 A;  2LOX A;  3A8Q A;  5DIF B;  3G3W A;  221L A;  1GC7 A;  1D0M A;  137L A;  2DKQ A;  2HEC A;  4NGL A;  4Z46 A;  3DNA A;  1G0J A;  3TCA A;  3A90 A;  3FI7 A;  253L A;  2H7D A;  1LZG A;  153L A;  3D8F A;  2I25 L;  4GN1 A;  1OUD A;  1JIY A;  111L A;  3D8D A;  4ZRI A;  2QKM A;  2D2Q A;  1CU6 A;  2Z18 A;  5D5C A;  1KW5 A;  1FGZ A;  3PVW A;  3PZD A;  1L82 A;  2AUB A;  2F4G A;  1L96 A;  4KT3 A;  1NWG A;  3C8Q A;  4LFX A;  1SSY A;  5L3I A;  1LYJ A;  4LT3 A;  2F47 A;  1MLC E;  1XGR C;  1DYN A;  207L A;  1LHI A;  3FEH A;  1HEQ A;  1LMQ A;  4Z98 A;  2B6Z A;  1C66 A;  2Y8F A;  4NGW A;  1L08 A;  1AKI A;  3QNG A;  4IJ4 A;  1LWK A;  2YS5 A;  1UIH A;  2COD A;  1WQM A;  1ISN A;  4HJV A;  3HW2 B;  3HDF A;  3WMK A;  156L A;  2G4Q A;  3WYH A;  2BCJ A;  4F7G A;  3OE6 A;  1QSW A;  1OMW A;  3WU7 A;  1GF9 A;  2B74 A;  1C45 A;  1GEZ A;  1YL0 X;  1OUE A;  1RE2 A;  1MIX A;  246L A;  2RSC A;  1D3J A;  5DN5 A;  4OO9 A;  1OV7 A;  5KY1 A;  3PEG A;  1C7P A;  5J3T A;  4ARQ B;  4LZT A;  2EQL A;  2D11 A;  262L A;  2RBP A;  3C80 A;  2DBT A;  4CJ2 A;  242L A;  4HAY B;  1LJF A;  4MST A;  191L A;  1SHC A;  1LJK A;  102L A;  1OUA A;  1KI1 B;  1L69 A;  2NTH A;  2RB1 X;  3SB5 A;  1DDW A;  3AGG G;  1HEM A;  3K2R A;  5C79 A;  1C6E A;  248L A;  1BVK C;  1L49 A;  4NSH A;  5EFX A;  1FN5 A;  3N9E A;  5FST A;  4EXM A;  4N1E I;  4GLV A;  2W1L A;  1C61 A;  2Z2F A;  249L A;  1B9O A;  196L A;  3W6B A;  2J0J A;  1LMP A;  3OAN A;  4H9B A;  189L A;  4I7L A;  5LIO A;  3TFM A;  3C82 A;  2HED A;  4W51 A;  1IVM A;  1GXV 2;  5LYZ A;  4C0A A;  3SBB C;  1MK9 B;  1XKE A;  4LYM A;  3GXK A;  1BWI A;  2Z0P A;  257L A;  3TO1 A;  1ZVR A;  1LJI A;  3EXD A;  4H91 A;  1QT3 A;  4WMG A;  2W2X C;  120L A;  1L65 A;  3WW6 A;  1C68 A;  1IWZ A;  1L84 A;  198L A;  1KXY A;  4GXB A;  1QQY A;  1YAM A;  2DN6 A;  1LSB A;  1IWV A;  1Z87 A;  1XGP C;  1JIT A;  4ARM B;  5B05 A;  223L A;  1LZE A;  2KCJ A;  1B5U A;  1LYE A;  1YAQ A;  1LZN A;  4DJH A;  2FJL A;  1GF8 A;  1MIZ B;  1V89 A;  1CV6 A;  1L86 A;  1YQV Y;  4II8 A;  4DD3 A;  2RBO A;  4EKS A;  4G9S A;  154L A;  1KY0 A;  2DFK A;  4NHT A;  1SGH A;  1L28 A;  5C5B A;  2IFS A;  2O4W A;  1LZS A;  1GFK A;  1LGU A;  1JKB A;  239L A;  1OUI A;  4WL7 A;  1FHX A;  1L00 A;  2XTH A;  1I1Z A;  4GCF A;  5KQ1 A;  4A7D A;  1P5C A;  3CSZ A;  181L A;  1CVK A;  5APD A;  4IFS A;  1EQE A;  1HFZ A;  2HE7 A;  1L36 A;  2B7X A;  5LA5 A;  1B5Y A;  4KHA A;  5C6J A;  1LOZ A;  5K7O A;  140L A;  3LYZ A;  2ADZ A;  3M3U A;  2ZIL A;  1QUT A;  3P68 A;  4KHB B;  1QSB A;  2ROV A;  3A96 A;  4H1P A;  3DKE X;  1L34 A;  4G49 A;  4NSJ A;  1L79 A;  1BB3 A;  1BAK A;  1UIA A;  3DN4 A;  1BVX A;  255L A;  2CWI A;  4PPO A;  4WOA A;  1J1P Y;  2LHM A;  1HER A;  4J0L A;  1D3M A;  3HTF A;  194L A;  4XJH A;  3QAK A;  1QTD A;  2UZS A;  1L06 A;  3VOQ A;  1L13 A;  1TBY A;  3SN6 R;  1LHJ A;  4QDN A;  4BBK A;  2Z19 A;  1EAZ A;  5ILC A;  3JR6 A;  3WA0 A;  4DD9 A;  1LZ4 A;  1LZ5 A;  4WL6 A;  4GCC A;  1LHM A;  3FA0 A;  3LN2 A;  178L A;  4NGY A;  5KXN A;  1OUG A;  1IP1 A;  2FBD A;  5LYM A;  3MGW A;  4N9R A;  3AGI A;  3CDQ A;  3ZDT A;  5D3X A;  4J1B A;  4WLD A;  1C6A A;  1CUP A;  2P0F A;  3G3X A;  159L A;  5KJ9 A;  2R09 A;  1DYA A;  1L23 A;  1X86 A;  2YBM A;  2E2X A;  1XEK A;  1G06 A;  4HTQ A;  1F0W A;  3GUK A;  1DXJ A;  1FAO A;  1L90 A;  3HT8 A;  4CHM A;  1IC5 Y;  5F14 A;  1JKD A;  5JEN B;  3BKV A;  5AMY A;  2COC A;  5J3Q A;  2UZR A;  1GBS A;  5JP4 A;  1QDR A;  1CJ9 A;  1LB1 A;  1Z55 A;  1L66 A;  4OWH A;  1U5G A;  131L A;  1T6H A;  1GE2 A;  5DH9 B;  4WLX A;  1GB6 A;  2NMB A;  1H87 A;  1L0J A;  4L41 A;  1L59 A;  3M1I B;  4W94 A;  4W57 A;  1E5W A;  1L41 A;  2VB1 A;  4Z2M B;  3WW5 A;  2BQL A;  2DHK A;  1L04 A;  5B06 A;  3UON A;  182L A;  1L31 A;  5HE3 A;  1B5W A;  3HQC A;  245L A;  2L1C A;  1BB4 A;  1CU3 A;  1UA6 Y;  3AU5 A;  4IAS A;  1P2R A;  1LJH A;  1U29 A;  1B7S A;  3ZVQ B;  3AB6 A;  1GFV A;  1L45 A;  4AGA A;  2BQI A;  1G7I C;  3WL2 A;  4MT7 A;  1DPX A;  1W1G A;  2GCJ A;  1ZVY B;  1D0L A;  1JJ0 A;  2X18 A;  2OE9 X;  218L A;  2XJW A;  4HB2 B;  1C6L A;  1W1H A;  1JKA A;  2MEC A;  5APE A;  1LAA A;  3GUO A;  1C6D A;  2R0D A;  3GUP A;  3AJN A;  134L A;  4C5F A;  2BQJ A;  188L A;  1O23 A;  3CSQ A;  1B7Q A;  2G4N A;  3IJV A;  4HPE A;  3A8Z A;  1QUD A;  1IOS A;  2BQF A;  238L A;  1E8L A;  1CV5 A;  4PK0 A;  2ROZ B;  1LMN A;  225L A;  192L A;  2RUK B;  4OWB A;  4DXA B;  4HAX B;  2N5Z A;  4EPI A;  1PS5 A;  5HMJ A;  1L50 A;  1CV1 A;  3GYP A;  209L A;  3LJU X;  5KXM A;  2HUL A;  261L A;  1L67 A;  2DQH Y;  1C6Q A;  1C6F A;  1V5P A;  4HB0 B;  1HNL A;  1QT4 A;  1YAO A;  1YKZ X;  1IIZ A;  1AT5 A;  2RBN A;  1DI4 A;  5I53 A;  4I7Q A;  160L A;  2D9Y A;  4NEB A;  1Y19 B;  165L A;  1B0D A;  1DRO A;  4DDB A;  2IGC A;  4HAU B;  3HT9 A;  5I54 A;  4B6H A;  2YBJ A;  3CT5 A;  1I7A A;  1JSF A;  1X1G A;  1QIO A;  1KNI A;  4TSC A;  2BQG A;  1LYF A;  5KXW A;  162L A;  1UNR A;  4XYY A;  1D2W A;  1NI2 A;  3RZE A;  4B4I A;  3ULB A;  2YVC A;  4YXA C;  2IHL A;  2HU1 A;  2ZYP A;  1PFJ A;  4KAX B;  1XX0 A;  199L A;  3QY4 A;  1GF5 A;  1QUS A;  1ZWN A;  164L A;  1LSC A;  4D9Z A;  2HTH B;  2F2N A;  1ZC3 B;  1INU A;  4P7I A;  1M7R A;  1CX6 A;  4B0D A;  4WM2 A;  5FEL A;  4LT1 A;  2Y7B A;  1IOC A;  3PG7 A;  2YT0 A;  2ELA A;  2IFF Y;  3ATO A;  4HTK A;  3B0K A;  4TTD A;  2BQA A;  4CFO A;  6LZM A;  3EMS A;  5DHF B;  1G1W A;  1ZC4 B;  1C65 A;  1PQJ A;  5FHW A;  3HU8 A;  1LMC A;  1KIR C;  1GD6 A;  4I7P A;  1L20 A;  1MKE A;  2BQD A;  4WSF A;  234L A;  2I1K A;  1QTB A;  3WPL A;  4GRV A;  3GYO A;  2MKR A;  1LSE A;  4GCD A;  4MCK A;  3C83 A;  1G1V A;  1FKV A;  3DN6 A;  1V61 A;  1U5E A;  4ET9 A;  4HV1 A;  2I5F A;  1VDQ A;  1L25 A;  4NSG A;  2CDS A;  2D4I A;  1ZUR A;  130L A;  147L A;  1SSW A;  144L A;  1HFX A;  3W6F A;  2EC1 A;  1ZM0 A;  1JUG A;  3TVV A;  3A94 A;  3PBL A;  1HC0 A;  1V5M A;  1QUO A;  2BQM A;  4EJ4 A;  3RNX A;  4KXI A;  3A6C Y;  5KCV A;  2ZQ4 A;  3TXE A;  3ZVR A;  1CKD A;  2P0D A;  2VRW B;  1CUQ A;  1I2H A;  1L09 A;  1L62 A;  2DX1 A;  5L81 A;  4ET8 A;  174L A;  4HTN A;  2YS1 A;  1JTT L;  1GFJ A;  1QT6 A;  2M14 A;  1L92 A;  1D9W A;  5B07 A;  4R0F A;  1QS5 A;  4ZFP A;  1IEE A;  2OE4 X;  4NG1 A;  8LYZ A;  2EKS C;  1LZ6 A;  1RJC B;  4OOO A;  1YAN A;  4YL8 A;  1IWX A;  127L A;  3F0W A;  3KRX A;  1GB2 A;  2DKP A;  1BB6 A;  1L54 A;  2LYD A;  5FDJ A;  2OQB A;  4KHO A;  1C10 A;  1QS9 A;  3HH4 A;  2B5Z A;  161L A;  226L A;  3WU9 A;  5LAF A;  237L A;  2NTG A;  4EKR A;  103L A;  3LYM A;  1TXD A;  4DD1 A;  1DYD A;  4ETB A;  2F2Q A;  1PZY A;  141L A;  2ZNW Y;  4GPT B;  1QSQ A;  1FHW A;  2Z12 A;  3TMU A;  3AW7 A;  2DHJ A;  1C62 A;  3TMV A;  3HU9 A;  1LI2 A;  1L03 A;  4LDL A;  1LYY A;  2XBS A;  1D0K A;  4DD7 A;  1JTO L;  1XEI A;  1RFP A;  1J1X Y;  2MEA A;  3N9A A;  2YBN A;  4RDS A;  4NSW A;  1IP2 A;  5FI0 A;  3GXR A;  5LIN A;  2D4Q A;  2W1X A;  1LYZ A;  3N7C A;  2Q0M X;  1FBI X;  7LYZ A;  1L17 A;  3CIK A;  5I4Y A;  1GF7 A;  4DDC A;  1LKR A;  145L A;  4D0N B;  4NG8 A;  4XJG A;  1B6I A;  1EPY A;  1LSN A;  4YEN A;  3D8E A;  1OWY A;  3P65 A;  1PQM A;  1QTK A;  2YF0 A;  2D4J A;  5EBH A;  4F7U P;  1LSM A;  2FYD A;  1HEN A;  1L89 A;  1LYO A;  3AYQ A;  1VAU A;  197L A;  1ZMY L;  1G7H C;  1LJN A;  1L87 A;  4LT2 A;  1LTM A;  1U5D A;  3OE8 A;  3CDV A;  3SBA A;  4RLN A;  4ETC A;  3TXH A;  3VW7 A;  1WVV A;  4LYC A;  4B4J A;  4I8S A;  4ETE A;  1BTK A;  3ZEK A;  1DYC A;  3T06 A;  4U3X B;  1HSX A;  1B2K A;  3HUQ A;  1L43 A;  1AZF A;  4UWN A;  232L A;  2MEF A;  1UBZ A;  1XD4 A;  4PHI A;  4I7K A;  170L A;  1GF4 A;  4NFV A;  4LGK A;  1LJ4 A;  3OE9 A;  4NY0 A;  125L A;  2G4P A;  1DI3 A;  1OUC A;  1ZVH L;  1C6I A;  149L A;  4NY5 A;  1QT8 A;  3AW6 A;  4WO6 A;  3DXC A;  2J0K A;  1I20 A;  1NBZ C;  3GUJ A;  1P64 A;  5LXW A;  158L A;  1L11 A;  2J0M A;  1DPW A;  1L47 A;  1UCO A;  4UWU A;  1RJ2 A;  3TXJ A;  1C6J A;  3PVU A;  2OTZ X;  4DBB A;  3A98 B;  1GB9 A;  2LUL A;  4TX7 A;  4L6E A;  1LCN A;  2RB2 X;  5D27 A;  3LZT A;  3VWO A;  1V5U A;  1L80 A;  1PQO A;  3SUZ A;  1XOD A;  259L A;  2AEH A;  3ML4 A;  187L A;  3WVY A;  1CV0 A;  2K2J A;  3T6U A;  4BS7 A;  1XGQ C;  1C6N A;  1L83 A;  3LZM A;  1OUF A;  4K81 A;  1BWN A;  2I1J A;  1UUZ C;  2BQH A;  2D10 A;  2RAZ X;  1WJ1 A;  1IOQ A;  212L A;  1GBZ A;  3HWL A;  177L A;  4GN5 C;  1CJ8 A;  1L33 A;  1GBW A;  1EQ5 A;  175L A;  1SX2 A;  1JHL A;  2NWD X;  4WLT A;  1P2L A;  5KXO A;  2Z37 A;  1FLW A;  3HUA A;  1BB7 A;  4ARM A;  3HDE A;  200L A;  3MPX A;  4PJZ A;  1IY4 A;  3SYX A;  2LYM A;  3FI5 A;  4M6D A;  3WUN A;  1FOE A;  1G0M A;  1W6Z A;  2H9J A;  1RCM A;  4N5R A;  2HUB A;  4DT3 A;  2DA0 A;  4A6K A;  4A6F A;  4NWE A;  4W54 A;  3M18 B;  4LZM A;  5L3H A;  1HEO A;  2ELB A;  1G0P A;  3GUN A;  3FM8 C;  4NIJ A;  1T3P A;  1LSZ A;  4PNK A;  107L A;  2D9X A;  1F6R A;  1OV5 A;  2W2X D;  4MK0 A;  1HSW A;  5A3E A;  3WUL A;  1TJ6 A;  4DKL A;  244L A;  1GFT A;  1OUJ A;  2HEE A;  4LFP A;  1AWE A;  3CSR A;  3QE8 A;  4GMX B;  4NGI A;  4NGK A;  3DN3 A;  1L30 A;  2ANV A;  4ARJ A;  4GN3 A;  1B5V A;  1C43 A;  1GXX A;  5A3Z A;  4H9A A;  2LYO A;  2RBS A;  3OJP A;  215L A;  5D5F A;  4H9C A;  1L39 A;  2UVM A;  3KSY A;  3LHM A;  4XN6 A;  5I4W A;  1G7J C;  1L52 A;  1C64 A;  1LLH A;  2HUM A;  3DXD A;  2D9W A;  4I7S A;  1B7O A;  2D6B A;  2BLY A;  2QB0 B;  2YBH A;  3X23 A;  1L98 A;  3C7W A;  4I7O A;  1CKF A;  4WM4 A;  5KXX A;  216L A;  3DN2 A;  220L A;  1GF6 A;  219L A;  3D3D A;  3QBV B;  3WPJ A;  1L44 A;  2PC2 A;  2MED A;  146L A;  2OU8 A;  1U2B A;  2L2I A;  2Q9D A;  1L26 A;  2CAY A;  1GFE A;  3UZT A;  1GE1 A;  4S0W A;  4MY6 A;  2EPE A;  4G4H A;  4PQ0 A;  1DYB A;  1EF1 A;  2JP2 A;  168L A;  3HUK A;  1UID A;  2ZNX Y;  4W56 A;  1KW7 A;  1L15 A;  1CX7 A;  1WTN A;  4LT0 A;  4N0J A;  1G0L A;  1JWR A;  3B0I A;  2MDX A;  5KXP A;  4H92 A;  1M7E A;  3A91 A;  1IP7 A;  2C8P A;  1WG7 A;  1C6H A;  1IWY A;  4LYO A;  1J1O Y;  1UC0 A;  2F32 A;  1C6C A;  6LYT A;  128L A;  1BB5 A;  1P2C C;  211L A;  2M38 A;  1NF5 A;  1D9U A;  1CKC A;  2MFQ A;  3NYA A;  1L27 A;  2N0Y A;  5GOW B;  4EKU A;  1GB3 A;  3U7D A;  4B1A A;  2DYQ A;  1XSF A;  4DC4 A;  3A95 A;  1IC7 Y;  1ZYT A;  4ARQ A;  4KPM A;  133L A;  1C6K A;  4PGJ B;  213L A;  2ZIK A;  3B72 A;  3DN1 A;  1K5G B;  4HAT B;  142L A;  5HQ1 A;  4M4O A;  1CKH A;  1L63 A;  1B7P A;  2XQN M;  4NGZ A;  4W96 A;  1YRO A;  1X11 A;  1NQI A;  3J4G A;  1C6G A;  4HAV B;  1LJE A;  4W55 A;  1BQL Y;  3ODO A;  4WM6 A;  1L14 A;  2H7E A;  2MEB A;  3RCP A;  3WYF B;  3AJ4 A;  155L A;  110L A;  1W1D A;  1L46 A;  1CU2 A;  1DYF A;  2BQO A;  4AXT A;  1P6S A;  2DX5 A;  173L A;  4I7T A;  2GV0 A;  1G7M C;  4XJD A;  1K5D B;  3NSU A;  5C6L A;  1L57 A;  4LDO A;  1L35 A;  1T6V L;  114L A;  1UIG A;  3B6L A;  1IY3 A;  210L A;  3HTB A;  5DLA A;  5D3V A;  4WVF B;  1GEV A;  1L37 A;  3WVX A;  230L A;  2DQE Y;  224L A;  1LYG A;  4ZIX A;  5LVH A;  3G3V A;  2H5Z A;  214L A;  2RLO A;  4CGE A;  3MDB C;  1LSY A;  2P0H A;  1LZD A;  3HFM Y;  3AGH A;  4HDO A;  190L A;  3TXB A;  1W08 A;  3HT7 A;  2BAA A;  2AL6 A;  2DQI Y;  2RVB B;  3TXF A;  1NKH A;  4DDA A;  2PZ1 A;  3CDO A;  4DWX A;  4GBR B;  3GUM A;  4H94 A;  1IX0 A;  1MAI A;  5HNC A;  4NGO A;  3SB7 A;  1IP5 A;  4IAP A;  2K2U A;  1GE0 A;  2RH1 A;  4P2E A;  1LPY A;  2Z6B A;  1KZG A;  2LG1 A;  2H9K A;  4QGZ A;  3AZ7 A;  4NHP A;  1GBY A;  1CTW A;  2Q13 A;  1GAZ A;  1J19 A;  3QWM A;  5KXK A;  1WQR A;  1EL1 A;  1LHL A;  1DYG A;  4CHJ A;  1LZ1 A;  4ML7 A;  4NHI A;  4WG7 A;  3EML A;  1P37 A;  1XEP A;  3SP3 A;  1ZSQ A;  2O7A A;  6LYZ A;  1QTE A;  2DQA A;  5B1G A;  4ARL A;  4DQ5 A;  1C46 A;  2OU9 A;  1TQZ A;  1JSE A;  1QTZ A;  1JEF A;  1JJ3 A;  1HF4 A;  5IHG A;  3ODX A;  4OWC A;  2BQB A;  1FLQ A;  1UIC A;  235L A;  3P7Z A;  163L A;  3W6D A;  1WTH A;  3FSS A;  1XGU C;  1NMM A;  2X0A A;  1WVU A;  4OW1 A;  3OE0 A;  3J6K A;  1L70 A;  1L99 A;  3ODU A;  1GF3 A;  3KZ1 A;  3P64 A;  2CJL A;  2RSG A;  5II3 A;  1TLA A;  1UPQ A;  1LZ9 A;  3HTD A;  1LZA A;  2COF A;  2B6X A;  3ULC A;  1DKK A;  4XJI A;  2O79 A;  3GUL A;  2LZM A;  4O34 A;  1UIB A;  3G3A B;  3V5W A;  1REZ A;  4YXC A;  1LGW A;  1L76 A;  1DDM A;  2HEF A;  3G3B B;  4GMV A;  4R6C A;  5M1Y A;  1LPI A;  1PQK A;  4NHS A;  4XEN A;  3DN8 A;  2W2W A;  1V7T A;  2YSZ A;  4FJR A;  3TXG A;  3F6Z A;  4G4B A;  4Y94 A;  1SWY A;  132L A;  2D9Z A;  1P56 A;  1D6Q A;  1LZ8 A;  1QTV A;  1L88 A;  1U27 A;  2KUP A;  1VDS A;  3RT5 X;  1GFU A;  4HJY A;  1CV4 A;  4GZU A;  1T8A A;  5HE1 A;  1LSP A;  4DYG A;  251L A;  2QAR C;  1LSD A;  1QUG A;  4NWH A;  2WAR A;  3PDS A;  3HT6 A;  3P6A A;  2DQG Y;  3BJI A;  2P8V A;  3PVL A;  243L A;  1FKQ A;  5FI1 A;  1CJ7 A;  3D9A C;  250L A;  2OTY X;  1FB8 A;  3W3E A;  4A5K A;  184L A;  1BTN A;  2GCL A;  3AU4 A;  2CGI A;  3PSC A;  3ZVQ A;  1IO5 A;  1H10 A;  1LYS A;  1UIE A;  5T3F A;  5LOP B;  4KVG B;  1L48 A;  1L93 A;  1LMO A;  1VED A;  1WQQ A;  2CUU A;  1IWT A;  2FBB A;  4YF2 A;  4YOP A;  2I6Z A;  1AM7 A;  3HTG A;  4NGV A;  3W6A A;  2BQC A;  4HAW B;  9LYZ A;  3NY8 A;  4I0C A;  5HE0 A;  4F7H A;  1EQ4 A;  3QIJ A;  172L A;  2F30 A;  4WLY A;  2MEI A;  3PP2 A;  5J3Y A;  3CDR A;  5KXT A;  4K2P A;  148L E;  5LYT A;  1OQM A;  2B6T A;  2EIZ C;  1D3N A;  3LYT A;  1NDG C;  1QSA A;  5LZM A;  2LYZ A;  1LZC A;  1CJ6 A;  5LVG A;  1HFY A;  4OWA A;  4YEO A;  1I56 A;  1QDT A;  2B75 A;  4NHQ A;  1QC6 A;  5F9X A;  4E3U A;  1GPQ C;  3WXU A;  2G35 A;  2RNR B;  1D6P A;  1KIP C;  4W59 A;  1B55 A;  1L94 A;  169L A;  1JKC A;  2Z2E A;  1REX A;  2D9V A;  1T8F A;  3TXD A;  1LZT A;  2ZQ3 A;  1NTV A;  2B6Y A;  4ANR A;  3TMW A;  171L A;  112L A;  4WG1 A;  3O96 A;  5DI9 B;  1XJU A;  1GC6 A;  1YIK A;  1GE4 A;  1LMT A;  3RU5 A;  3FE0 A;  5I4X A;  1LSA A;  5IDD A;  2I26 L;  1HMK A;  1DBH A;  1AT6 A;  5E4P A;  2CY5 A;  4K17 A;  1WGQ A;  1IOT A;  5L9J A;  1LWG A;  240L A;  227L A;  4DD2 A;  1BWJ A;  4C3W A;  4GCB A;  4BAP A;  1GE3 A;  4LYB A;  1L56 A;  1L10 A;  1YIL A;  1C69 A;  5B59 A;  1XFP L;  1IR8 A;  1IP3 A;  2OEA X;  5C6R A;  2DQJ Y;  4QEQ A;  3AZ6 A;  4EOF A;  1V7S A;  1REY A;  1XGT C;  4H93 A;  1A4V A;  1K28 A;  2MEG A;  1L61 A;  180L A;  122L A;  1KY1 A;  3AZ4 A;  2D91 A;  1OWZ A;  2XBR A;  3E3D A;  1OVK A;  4CYE A;  2ZIJ A;  4EMO A;  2Y8P A;  4EPF A;  4GN4 A;  4YX7 C;  1LJG A;  1L19 A;  1P3R A;  1WJM A;  3A8P A;  2Z0Q A;  3HH6 A;  3SO6 A;  1LJJ A;  2HEA A;  2I5C A;  4OWE A;  185L A;  3OK0 A;  151L A;  1IWU A;  1TEW A;  4ZRK A;  4XAD A;  4BAF A;  1C6P A;  1PMS A;  1B7R A;  2K00 A;  4W53 A;  3F5R A;  4NGJ A;  1QT5 A;  4MR1 A;  3F9L A;  1LYD A;  3W6E A;  1L60 A;  1OYU A;  3L2X A;  3U8Z A;  1IP4 A;  1JJ1 A;  3SNH A;  1L81 A;  5JLJ B;  118L A;  3VIA A;  2ZYC A;  1L0K A;  186L A;  228L A;  4CFP A;  4ZRJ A;  2RGN B;  152L A;  3WU8 A;  2LKO A;  3DN0 A;  4I7R A;  1QTH A;  5DM9 A;  1U5F A;  1GFA A;  3SB8 A;  4IAT A;  5KQ4 A;  4HB3 B;  1UPR A;  1GF0 A;  5LON B;  2C8O A;  5E9R A;  3TW1 A;  126L A;  1GHL A;  1L68 A;  3CT0 A;  1C6B A;  3HBD A;  1IP6 A;  233L A;  5DL9 A;  2Z0O A;  252L A;  1GBO A;  104L A;  119L A;  5B1F A;  1YL1 X;  1L01 A;  3ULR A;  3IJU A;  3A93 A;  5KKJ A;  217L A;  2ZWB A;  1L16 A;  1GDX A;  2B6W A;  1LSF A;  1LZR A;  2DYN A;  138L A;  5C5B B;  2QKL A;  1QUH A;  1ZV5 L;  1L71 A;  4GCE A;  2LZ2 A;  254L A;  4GLA A;  3KAM A;  3C8S A;  1MK7 B;  1F6S A;  2NZ8 B;  5F16 A;  1G07 A;  4H9F A;  1YKX X;  1CU5 A;  1DQJ C;  3WUM A;  5LVK A;  1OQN A;  4WO9 A;  3A3Q A;  4NSI A;  1SX7 A;  2N23 A;  3CQL A;  3KRW A;  3DMV A;  1REM A;  1IR9 A;  1G0Q A;  4ZEE A;  1V88 A;  4K2O A;  4G4C A;  5LA8 A;  1JTP L;  1G0G A;  5JHG A;  5D3Y A;  1L75 A;  1HEL A;  1VFB C;  2COA A;  1L77 A;  1XEJ A;  2F4A A;  5HLL A;  1N3H A;  166L A;  1LGX A;  1L24 A;  1KZ7 A;  4YM8 A;  2GJY A;  1LSG A;  2OU0 X;  4X3B A;  2DQC Y;  5I5Q A;  1UNQ A;  3TXI A;  5APC A;  1FLY A;  1B5X A;  2FYC A;  4FDY A;  2RBQ A;  176L A;  1P3N A;  1L95 A;  1LJ3 A;  5JHH A;  3LYO A;  3TXK A;  206L A;  1PQD A;  5DHA B;  5ILF A;  3EBA B;  5C6I A;  4PRU A;  4A6H A;  1HHL A;  1SWZ A;  1TAY A;  4UWV A;  1CV3 A;  2LOZ A;  1GB7 A;  4ARP A;  1LZB A;  3CB7 A;  3N9C A;  1GFH A;  3EO5 A;  1CNS A;  5CLQ B;  1MPH A;  1L40 A;  3A3R X;  2ZPY A;  1UNP A;  3WPK A;  1XJT A;  2VKI A;  5C16 A;  1EGX A;  4EMN A;  4TKN A;  2YT1 A;  1L38 A;  2GS0 A;  5KXY A;  1IOR A;  5IEL A;  2OE7 X;  3CT1 A;  1G0K A;  5KXL A;  1L51 A;  2A4T A;  4N8Z A;  1GWD A;  1TCY A;  231L A;  1KXX A;  3C8R A;  1P46 A;  247L A;  260L A;  4H9I A;  4WJ7 A;  1KIQ C;  1RRP B;  4PRQ A;  201L A;  2KGX B;  150L A;  1D2Y A;  1NBY C;  3CDT A;  3D4S A;  3GUI A;  4DD0 A;  3NY9 A;  1LMA A;  1BWH A;  1DZB X;  4DX9 0;  1P5T A;  229L A;  1NTY A;  2RAY X;  157L A;  1UAC Y;  4H9H A;  2MEH A;  5CLL B;  1L29 A;  1QQG A;  5F9U A;  135L A;  1GFG A;  3WUA A;  3KY9 A;  5HE2 A;  5HNL A;  1BGI A;  5HMV A;  1Y5O A;  4HB4 B;  3HBH A;  3V2W A;  2HTX A;  3IVF A;  3DMZ A;  1L64 A;  3SB9 A;  1HEP A;  2D4K A;  2Z39 A;  3RUN A;  1WQP A;  5D3W A;  1VDP A;  2B73 A;  4BAD A;  4YEM A;  3ODW A;  2DLW A;  3F8V A;  4LDE A;  4H8S A;  1NHB A;  1C08 C;  4TUN A;  1L74 A;  5KXR A;  1NU2 A;  4TYZ A;  1OUH A;  1L55 A;  4EKQ A;  4J1A A;  3V2Y A;  1GBX A;  3A67 Y;  2YBI A;  2W1Y A;  2EMT A;  1PQI A;  1PLS A;  4HDQ A;  2YRY A;  1C6T A;  4XJF A;  1LKS A;  1HEW A;  4KL7 A;  1JTM A;  4DQJ A;  4WM3 A;  1GDW A;  1LYI A;  1H6M A;  2HU3 A;  4H8Z A;  4ZPU A;  1HML A;  4XWX A;  1GFR A;  3T36 A;  4N1C C;  1D3F A;  1JTN A;  1L07 A;  4PJ2 C;  1G7L C;  1WQO A;  5J7C A;  1H4R A;  2YDG A;  5LVI A;  1LZY A;  2XQO A;  2MWN B;  3A92 A;  4H90 A;  1LI3 A;  1L53 A;  4DQ7 A;  1WGU A;  2YBL A;  2BPU A;  3K3T A;  1C60 A;  5I14 A;  4I7J A;  4AQN A;  1T8G A;  3A6B Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...