2N23A

Nmr structure of the complex between the ph domain of the tfb1 subunit from tfiih and the n-terminal activation domain of eklf (tad1)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
115
structure length
115
Chain Sequence
b'PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase II transcription factor B subunit 1
publication title Structural Characterization of the Complex between the N-terminal Transactivation Domain of EKLF and the p62/Tfb1 subunit of TFIIH
rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Transcription
total genus 24
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2n23A00
4NY0A 3KRXA 2DYNA 2L2IA 3U7DA 4CHMA 2P8VA 2D9ZA 2D9WA 3M1IB 3MPXA 4A6HA 4HB4B 1WGQA 4MY6A 2RVBB 4TKNA 1P6SA 3A98B 1H10A 5C6RA 1FAOA 1UPRA 3PVWA 1ZVRA 3VIAA 5J3YA 4EJNA 1H4RA 5D3XA 4CYEA 4EKUA 2DYQA 4Z2MB 3KZ1A 2DLWA 1EF1A 5FI0A 1DDWA 1ZSQA 1X1GA 2CRFA 2D4QA 2DN6A 3GYPA 1NU2A 3SO6A 2COAA 1X05A 4K2OA 5DIFB 5KQ1A 4K2PA 3QBVB 2KGXB 2Q13A 2Y7BA 5CLLB 1X11A 4D0NB 2EC1A 5J3TA 2AEHA 1I2HA 1KZGA 3GYOA 1RRPB 1GC6A 3KRWA 2KCJA 2QKMA 2D10A 5L81A 1B55A 5DI9B 5HE1A 3MDBC 3FEHA 4HAYB 3F0WA 3SV1A 1UNPA 1MPHA 1BTKA 1MK7B 2CY5A 1V61A 1FGYA 1X1FA 2E2XA 2DFKA 2COFA 2H7DA 2W2XD 2K00A 2IYBA 3O96A 4A6FA 5C16A 3WYFB 2ELAA 1WJMA 1PFJA 1W1HA 1DDMA 1WG7A 4YL8A 4BBKA 4XWXA 4KHAA 2D9XA 1FHOA 1M7EA 4HB3B 2MDXA 5LONB 4GXBA 5D3VA 3KY9A 1BAKA 3LJUX 4CHJA 2RLOA 2P0DA 3D8EA 1FGZA 1LB1A 2HTHB 1P3RA 2LKOA 1EAZA 1KI1B 2VSZA 5JHGA 5JLJB 3N7CA 2RSGA 1BWNA 3QWMA 4F7HA 4HB2B 5KQ4A 1Z87A 1Y5OA 1U5EA 3A8QA 1DBHA 1U5DA 3D8FA 2KUPA 5HE2A 3NSUA 5D3WA 1TQZA 4KHBB 3TO1A 3DXDA 2G35A 1FHXA 2L1CA 2CAYA 2RUKB 1U27A 1PMSA 2M14A 1XCGA 4IAPA 4DBBA 2ZPYA 3AJ4A 4NSWA 2I5FA 1Q67A 1E5WA 2GJYA 1MK9B 5DH9B 4PQ0A 2OQBA 2LYDA 2J0MA 1QQGA 2YT0A 1FHWA 1RJ2A 4Y94A 2Y8FA 5C79A 2LG1A 2R09A 2M38A 5LOPB 1V88A 1TXDA 5HE0A 1WJ1A 1AQCA 3P6AA 3ULBA 1N3HA 1MIZB 5J3QA 1EGXA 1WVHA 1IRSA 3ODOA 1DDVA 3BJIA 1GG3A 5DHAB 2GS0A 1U5GA 4KVGB 2FJLA 3PP2A 1DROA 2ADZA 4WSFA 1U5FA 1U2BA 3G9WA 5FI1A 5C5BA 1MIXA 1QC6A 1FOEA 1OY2A 5HE3A 1UEFA 2J0KA 3KSYA 1NTYA 3HQCA 4PNKA 2K2JA 4HAVB 2ROVA 2DHIA 1SHCA 3TCAA 2V76A 3ML4A 2VRWB 1WGUA 2BCJA 1M7RA 3U8ZA 1EVHA 3SNHA 3FM8C 4Z2NA 2LOZA 4WJ7A 2Z0OA 1X86A 1V5UA 4KHOA 3CXBB 2UVMA 4HHVA 3SUZA 1NI2A 2Y8GA 5JP4A 2R0DA 2NZ8B 3PG7A 1W1DA 4EMOA 2D9YA 1J0WA 2JP2A 4ZRJA 2PZ1A 2MFQA 2AL6A 4HAUB 2I1KA 2COCA 2MWNB 1SGHA 2XQNM 2W2WA 1K5GB 2CY4A 1MAIA 3OANA 2DHJA 4K81A 1XR0B 4DX90 1TJ6A 2GCJA 3CIKA 2H7EA 3TVVA 3PZDA 2YRYA 1XD4A 4B6HA 5EFXA 2YS5A 4K17A 1WI1A 1BTNA 2K2UA 2YT1A 4YONA 2P0HA 2DX1A 2EMSA 2DKPA 3HW2B 2HE7A 4A6KA 3P7ZA 2IFSA 2YSZA 1OMWA 2I1JA 1UNRA 3PVLA 3T06A 1U29A 4HDQA 4F7GA 1Y19B 5CLQB 2CODA 4A6FB 1XX0A 3RCPA 2DX5A 2YF0A 3FSSA 2EJ8A 3D8DA 1GC7A 2D11A 3BINA 3UZTA 2ELBA 2QKLA 3AU4A 1K5DB 1LW3A 4L6EA 2DHKA 4GMVA 1W1GA 4KAXB 1FB8A 2J0JA 3ODXA 3IVFA 2YS3A 2OTXA 4ZRIA 4GPTB 2RGNB 2RNRB 1AWEA 2D9VA 3DXEA 2DTCA 3PSCA 3ZDTA 3V5WA 2UZRA 3QIJA 1XODA 2N23A 1DYNA 5JHHA 4GZUA 3SYXA 2UZSA 1P5TA 4HB0B 1UNQA 3PEGA 4MK0A 4C0AA 1V89A 3WA0A 3TW1A 2LOXA 1KZ7A 1ZC3B 2DA0A 2Z0QA 4WVFB 1OQNA 3X23A 2D2QA 1ZC4B 1ISNA 3F5RA 4DX8A 3VOQA 2GCLA 4A5KA 2LULA 2MKRA 1MKEA 2ROZB 2N0YA 1XKEA 3ZVRA 5D27A 4HDOA 4F7UP 2P0FA 1J19A 3A8PA 3HK0A 4MT7A 3AU5A 4HAXB 2EMTA 4HATB 3DXCA 4P7IA 3PVUA 4DXAB 2X18A 2Z0PA 1ZM0A 5D3YA 2I5CA 1V5MA 4IFSA 1V5PA 1PLSA 5DHFB 2YVCA 4ZRKA 2J59M 2YS1A 3ODWA 3TFMA 2VKIA 2DKQA 4HAWB 4IOYX 5C5BB 4GMXB 1UPQA 1NTVA 4HAZB 1I7AA 2W2XC 3ULCA 4H8SA 5GOWB 2NMBA 5KCVA 4GN1A 4TYZA
chains in the Genus database with same CATH superfamily
4NY0A 5LG4B 3KRXA 2DYNA 2L2IA 3U7DA 4CHMA 2P8VA 2D9ZA 2D9WA 3M1IB 3MPXA 4A6HA 4HB4B 1WGQA 4MY6A 2FJUB 2RVBB 4TKNA 1P6SA 3A98B 1H10A 5C6RA 1FAOA 1UPRA 3PVWA 1ZVRA 3VIAA 5J3YA 4EJNA 3B77A 2Z4DA 1H4RA 4GOUA 5D3XA 4CYEA 2DYQA 4Z2MB 4EKUA 4OSNA 3KZ1A 2DLWA 4D6WA 1EF1A 5FI0A 1DDWA 1ZSQA 1X1GA 2CRFA 2ZKMX 2D4QA 2DN6A 3GYPA 1NU2A 3SO6A 2COAA 1X05A 4K2OA 5DIFB 5KQ1A 4K2PA 3QBVB 2KGXB 2Q13A 2Y7BA 5CLLB 1X11A 4D0NB 2EC1A 5J3TA 2AEHA 1I2HA 1KZGA 3GYOA 1ZYIA 1RRPB 1GC6A 3KRWA 2KCJA 2QKMA 2D10A 5L81A 2Z14A 2GUMA 1B55A 5DI9B 5HE1A 2K8EA 3MDBC 5I2MA 3FEHA 4HAYB 3F0WA 3SV1A 1UNPA 1MPHA 1BTKA 1MK7B 2CY5A 1V61A 1FGYA 1X1FA 2E2XA 2YT2A 2DFKA 2COFA 2H7DA 2W2XD 2K00A 2IYBA 3O96A 4A6FA 5C16A 3WYFB 2ELAA 3DCXA 1WJMA 1PFJA 1W1HA 1DDMA 1WG7A 4YL8A 4BBKA 4XWXA 4KHAA 2D9XA 1FHOA 1M7EA 4HB3B 2MDXA 5LONB 4GXBA 5D3VA 3KY9A 1BAKA 3LJUX 3A58A 4L1RA 4CHJA 2RLOA 2P0DA 3D8EA 1FGZA 1LB1A 2HTHB 1P3RA 2LKOA 1EAZA 1KI1B 2VSZA 5JHGA 5JLJB 3OHMB 5M4YB 3N7CA 2RSGA 1BWNA 3QWMA 4F7HA 4HB2B 5KQ4A 1Z87A 1Y5OA 1U5EA 3A8QA 5IRSA 1DBHA 1U5DA 3D8FA 2KUPA 5HE2A 3NSUA 5D3WA 1TQZA 4KHBB 3TO1A 3DXDA 2G35A 1FHXA 2L1CA 2CAYA 2RUKB 1U27A 1PMSA 2M14A 1XCGA 4DIXA 4IAPA 4DBBA 2ZPYA 3AJ4A 4NSWA 2I5FA 1Q67A 1E5WA 2GJYA 3NW8A 1MK9B 5DH9B 4PQ0A 2OQBA 2LYDA 2J0MA 2YT0A 1QQGA 1FHWA 1RJ2A 4Y94A 2Y8FA 2R2YA 5C79A 2LG1A 2R09A 1MI1A 2M38A 1V88A 1TXDA 5LOPB 5HE0A 1WJ1A 1AQCA 3P6AA 3ULBA 1N3HA 1MIZB 5J3QA 1EGXA 1WVHA 1IRSA 3ODOA 1DDVA 3BJIA 1GG3A 5DHAB 2GS0A 1U5GA 4KVGB 2FJLA 3PP2A 1DROA 2ADZA 4WSFA 1U5FA 1U2BA 3G9WA 4QJ4B 2KR0A 5FI1A 5C5BA 1MIXA 1QC6A 1FOEA 1OY2A 5HE3A 1UEFA 2J0KA 3KSYA 1NTYA 3HQCA 4PNKA 2K2JA 4HAVB 2ROVA 2DHIA 1SHCA 3NWFA 3TCAA 2V76A 3ML4A 2VRWB 1WGUA 2BCJA 3FVCA 1M7RA 2RRFA 3U8ZA 1EVHA 3SNHA 3FM8C 4Z2NA 2LOZA 4WJ7A 2Z0OA 1X86A 1V5UA 4KHOA 3CXBB 3NWAA 2UVMA 4HHVA 4OT1A 1NI2A 2Y8GA 3SUZA 5JP4A 2R0DA 2NZ8B 3PG7A 1W1DA 4EMOA 2D9YA 1J0WA 2JP2A 4ZRJA 2PZ1A 2MFQA 2AL6A 4HAUB 2I1KA 2COCA 2MWNB 1SGHA 2XQNM 2W2WA 1K5GB 2CY4A 1MAIA 3OANA 2DHJA 1T77A 4K81A 1XR0B 4DX90 1TJ6A 4GNKB 4QJ5B 2GCJA 3CIKA 2H7EA 3TVVA 3PZDA 2YRYA 1XD4A 4B6HA 2K49A 5EFXA 2YS5A 4K17A 1WI1A 1BTNA 2K2UA 2YT1A 4YONA 2P0HA 2DX1A 2EMSA 2DKPA 3HW2B 2HE7A 4A6KA 3P7ZA 3HIEA 2IFSA 2YSZA 3NWDA 1OMWA 2I1JA 1UNRA 3PVLA 3T06A 1U29A 4HDQA 4F7GA 1Y19B 5CLQB 2CODA 4A6FB 1XX0A 3RCPA 2DX5A 2YF0A 3FSSA 2EJ8A 3D8DA 5I2SA 1GC7A 2D11A 3BINA 3UZTA 2ELBA 2QKLA 3AU4A 1K5DB 1LW3A 4L6EA 2DHKA 4GMVA 1W1GA 4KAXB 1FB8A 2J0JA 3ODXA 3IVFA 2YS3A 2OTXA 4ZRIA 4GPTB 2RGNB 2RNRB 1AWEA 2D9VA 3DXEA 2DTCA 3PSCA 3ZDTA 3V5WA 2UZRA 3QIJA 1XODA 2N23A 1DYNA 5JHHA 4GZUA 3SYXA 2UZSA 1P5TA 4HB0B 1UNQA 3PEGA 2KUQA 4MK0A 4C0AA 1V89A 3WA0A 3TW1A 2LOXA 1KZ7A 1ZC3B 2DA0A 2Z0QA 4WVFB 1OQNA 4KHBA 3X23A 4CSQA 2D2QA 1ZC4B 1ISNA 3F5RA 4DX8A 3VOQA 2GCLA 4HSIA 4A5KA 2KIEA 2LULA 2Z59A 2MKRA 1MKEA 2ROZB 2N0YA 1XKEA 3ZVRA 5D27A 4HDOA 4F7UP 2P0FA 1J19A 3A8PA 3HK0A 4MT7A 3AU5A 2Z13A 4HAXB 2EMTA 4HATB 3DXCA 4P7IA 3PVUA 4DXAB 2X18A 2Z0PA 1ZM0A 4QJ3B 4QXAB 5D3YA 2KIGA 2I5CA 1V5MA 4IFSA 1V5PA 3HSAA 1PLSA 5DHFB 2YVCA 4ZRKA 2J59M 2YS1A 3ODWA 3TFMA 2VKIA 2DKQA 4HAWB 4IOYX 5C5BB 4GMXB 1UPQA 3U12A 2NBVA 1NTVA 4HAZB 1I7AA 2W2XC 3ULCA 4H8SA 5GOWB 2NMBA 5KCVA 4GN1A 4TYZA
chains in the Genus database with same CATH topology
4NY0A 3KRXA 2DYNA 2L2IA 3U7DA 4CHMA 2P8VA 2D9ZA 2D9WA 3M1IB 3MPXA 4A6HA 4HB4B 1WGQA 4MY6A 2RVBB 4TKNA 1P6SA 3A98B 1H10A 5C6RA 1FAOA 1UPRA 3PVWA 1ZVRA 3VIAA 5J3YA 4EJNA 1H4RA 5D3XA 4CYEA 4EKUA 2DYQA 4Z2MB 3KZ1A 2DLWA 1EF1A 5FI0A 1DDWA 1ZSQA 1X1GA 2CRFA 2D4QA 2DN6A 3GYPA 1NU2A 3SO6A 2COAA 1X05A 4K2OA 5DIFB 5KQ1A 4K2PA 3QBVB 2KGXB 2Q13A 2Y7BA 5CLLB 1X11A 4D0NB 2EC1A 5J3TA 2AEHA 1I2HA 1KZGA 3GYOA 1RRPB 1GC6A 3KRWA 2KCJA 2QKMA 2D10A 5L81A 1B55A 5DI9B 5HE1A 3MDBC 3FEHA 4HAYB 3F0WA 3SV1A 1UNPA 1MPHA 1BTKA 1MK7B 2CY5A 1V61A 1FGYA 1X1FA 2E2XA 2DFKA 2COFA 2H7DA 2W2XD 2K00A 2IYBA 3O96A 4A6FA 5C16A 3WYFB 2ELAA 1WJMA 1PFJA 1W1HA 1DDMA 1WG7A 4YL8A 4BBKA 4XWXA 4KHAA 2D9XA 1FHOA 1M7EA 4HB3B 2MDXA 5LONB 4GXBA 5D3VA 3KY9A 1BAKA 3LJUX 4CHJA 2RLOA 2P0DA 3D8EA 1FGZA 1LB1A 2HTHB 1P3RA 2LKOA 1EAZA 1KI1B 2VSZA 5JHGA 5JLJB 3N7CA 2RSGA 1BWNA 3QWMA 4F7HA 4HB2B 5KQ4A 1Z87A 1Y5OA 1U5EA 3A8QA 1DBHA 1U5DA 3D8FA 2KUPA 5HE2A 3NSUA 5D3WA 1TQZA 4KHBB 3TO1A 3DXDA 2G35A 1FHXA 2L1CA 2CAYA 2RUKB 1U27A 1PMSA 2M14A 1XCGA 4IAPA 4DBBA 2ZPYA 3AJ4A 4NSWA 2I5FA 1Q67A 1E5WA 2GJYA 1MK9B 5DH9B 4PQ0A 2OQBA 2LYDA 2J0MA 1QQGA 2YT0A 1FHWA 1RJ2A 4Y94A 2Y8FA 5C79A 2LG1A 2R09A 2M38A 5LOPB 1V88A 1TXDA 5HE0A 1WJ1A 1AQCA 3P6AA 3ULBA 1N3HA 1MIZB 5J3QA 1EGXA 1WVHA 1IRSA 3ODOA 1DDVA 3BJIA 1GG3A 5DHAB 2GS0A 1U5GA 4KVGB 2FJLA 3PP2A 1DROA 2ADZA 4WSFA 1U5FA 1U2BA 3G9WA 5FI1A 5C5BA 1MIXA 1QC6A 1FOEA 1OY2A 5HE3A 1UEFA 2J0KA 3KSYA 1NTYA 3HQCA 4PNKA 2K2JA 4HAVB 2ROVA 2DHIA 1SHCA 3TCAA 2V76A 3ML4A 2VRWB 1WGUA 2BCJA 1M7RA 3U8ZA 1EVHA 3SNHA 3FM8C 4Z2NA 2LOZA 4WJ7A 2Z0OA 1X86A 1V5UA 4KHOA 3CXBB 2UVMA 4HHVA 3SUZA 1NI2A 2Y8GA 5JP4A 2R0DA 2NZ8B 3PG7A 1W1DA 4EMOA 2D9YA 1J0WA 2JP2A 4ZRJA 2PZ1A 2MFQA 2AL6A 4HAUB 2I1KA 2COCA 2MWNB 1SGHA 2XQNM 2W2WA 1K5GB 2CY4A 1MAIA 3OANA 2DHJA 4K81A 1XR0B 4DX90 1TJ6A 2GCJA 3CIKA 2H7EA 3TVVA 3PZDA 2YRYA 1XD4A 4B6HA 5EFXA 2YS5A 4K17A 1WI1A 1BTNA 2K2UA 2YT1A 4YONA 2P0HA 2DX1A 2EMSA 2DKPA 3HW2B 2HE7A 4A6KA 3P7ZA 2IFSA 2YSZA 1OMWA 2I1JA 1UNRA 3PVLA 3T06A 1U29A 4HDQA 4F7GA 1Y19B 5CLQB 2CODA 4A6FB 1XX0A 3RCPA 2DX5A 2YF0A 3FSSA 2EJ8A 3D8DA 1GC7A 2D11A 3BINA 3UZTA 2ELBA 2QKLA 3AU4A 1K5DB 1LW3A 4L6EA 2DHKA 4GMVA 1W1GA 4KAXB 1FB8A 2J0JA 3ODXA 3IVFA 2YS3A 2OTXA 4ZRIA 4GPTB 2RGNB 2RNRB 1AWEA 2D9VA 3DXEA 2DTCA 3PSCA 3ZDTA 3V5WA 2UZRA 3QIJA 1XODA 2N23A 1DYNA 5JHHA 4GZUA 3SYXA 2UZSA 1P5TA 4HB0B 1UNQA 3PEGA 4MK0A 4C0AA 1V89A 3WA0A 3TW1A 2LOXA 1KZ7A 1ZC3B 2DA0A 2Z0QA 4WVFB 1OQNA 3X23A 2D2QA 1ZC4B 1ISNA 3F5RA 4DX8A 3VOQA 2GCLA 4A5KA 2LULA 2MKRA 1MKEA 2ROZB 2N0YA 1XKEA 3ZVRA 5D27A 4HDOA 4F7UP 2P0FA 1J19A 3A8PA 3HK0A 4MT7A 3AU5A 4HAXB 2EMTA 4HATB 3DXCA 4P7IA 3PVUA 4DXAB 2X18A 2Z0PA 1ZM0A 5D3YA 2I5CA 1V5MA 4IFSA 1V5PA 1PLSA 5DHFB 2YVCA 4ZRKA 2J59M 2YS1A 3ODWA 3TFMA 2VKIA 2DKQA 4HAWB 4IOYX 5C5BB 4GMXB 1UPQA 1NTVA 4HAZB 1I7AA 2W2XC 3ULCA 4H8SA 5GOWB 2NMBA 5KCVA 4GN1A 4TYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NY0 A;  3KRX A;  2DYN A;  2L2I A;  3U7D A;  4CHM A;  2P8V A;  2D9Z A;  2D9W A;  3M1I B;  3MPX A;  4A6H A;  4HB4 B;  1WGQ A;  4MY6 A;  2RVB B;  4TKN A;  1P6S A;  3A98 B;  1H10 A;  5C6R A;  1FAO A;  1UPR A;  3PVW A;  1ZVR A;  3VIA A;  5J3Y A;  4EJN A;  1H4R A;  5D3X A;  4CYE A;  4EKU A;  2DYQ A;  4Z2M B;  3KZ1 A;  2DLW A;  1EF1 A;  5FI0 A;  1DDW A;  1ZSQ A;  1X1G A;  2CRF A;  2D4Q A;  2DN6 A;  3GYP A;  1NU2 A;  3SO6 A;  2COA A;  1X05 A;  4K2O A;  5DIF B;  5KQ1 A;  4K2P A;  3QBV B;  2KGX B;  2Q13 A;  2Y7B A;  5CLL B;  1X11 A;  4D0N B;  2EC1 A;  5J3T A;  2AEH A;  1I2H A;  1KZG A;  3GYO A;  1RRP B;  1GC6 A;  3KRW A;  2KCJ A;  2QKM A;  2D10 A;  5L81 A;  1B55 A;  5DI9 B;  5HE1 A;  3MDB C;  3FEH A;  4HAY B;  3F0W A;  3SV1 A;  1UNP A;  1MPH A;  1BTK A;  1MK7 B;  2CY5 A;  1V61 A;  1FGY A;  1X1F A;  2E2X A;  2DFK A;  2COF A;  2H7D A;  2W2X D;  2K00 A;  2IYB A;  3O96 A;  4A6F A;  5C16 A;  3WYF B;  2ELA A;  1WJM A;  1PFJ A;  1W1H A;  1DDM A;  1WG7 A;  4YL8 A;  4BBK A;  4XWX A;  4KHA A;  2D9X A;  1FHO A;  1M7E A;  4HB3 B;  2MDX A;  5LON B;  4GXB A;  5D3V A;  3KY9 A;  1BAK A;  3LJU X;  4CHJ A;  2RLO A;  2P0D A;  3D8E A;  1FGZ A;  1LB1 A;  2HTH B;  1P3R A;  2LKO A;  1EAZ A;  1KI1 B;  2VSZ A;  5JHG A;  5JLJ B;  3N7C A;  2RSG A;  1BWN A;  3QWM A;  4F7H A;  4HB2 B;  5KQ4 A;  1Z87 A;  1Y5O A;  1U5E A;  3A8Q A;  1DBH A;  1U5D A;  3D8F A;  2KUP A;  5HE2 A;  3NSU A;  5D3W A;  1TQZ A;  4KHB B;  3TO1 A;  3DXD A;  2G35 A;  1FHX A;  2L1C A;  2CAY A;  2RUK B;  1U27 A;  1PMS A;  2M14 A;  1XCG A;  4IAP A;  4DBB A;  2ZPY A;  3AJ4 A;  4NSW A;  2I5F A;  1Q67 A;  1E5W A;  2GJY A;  1MK9 B;  5DH9 B;  4PQ0 A;  2OQB A;  2LYD A;  2J0M A;  1QQG A;  2YT0 A;  1FHW A;  1RJ2 A;  4Y94 A;  2Y8F A;  5C79 A;  2LG1 A;  2R09 A;  2M38 A;  5LOP B;  1V88 A;  1TXD A;  5HE0 A;  1WJ1 A;  1AQC A;  3P6A A;  3ULB A;  1N3H A;  1MIZ B;  5J3Q A;  1EGX A;  1WVH A;  1IRS A;  3ODO A;  1DDV A;  3BJI A;  1GG3 A;  5DHA B;  2GS0 A;  1U5G A;  4KVG B;  2FJL A;  3PP2 A;  1DRO A;  2ADZ A;  4WSF A;  1U5F A;  1U2B A;  3G9W A;  5FI1 A;  5C5B A;  1MIX A;  1QC6 A;  1FOE A;  1OY2 A;  5HE3 A;  1UEF A;  2J0K A;  3KSY A;  1NTY A;  3HQC A;  4PNK A;  2K2J A;  4HAV B;  2ROV A;  2DHI A;  1SHC A;  3TCA A;  2V76 A;  3ML4 A;  2VRW B;  1WGU A;  2BCJ A;  1M7R A;  3U8Z A;  1EVH A;  3SNH A;  3FM8 C;  4Z2N A;  2LOZ A;  4WJ7 A;  2Z0O A;  1X86 A;  1V5U A;  4KHO A;  3CXB B;  2UVM A;  4HHV A;  3SUZ A;  1NI2 A;  2Y8G A;  5JP4 A;  2R0D A;  2NZ8 B;  3PG7 A;  1W1D A;  4EMO A;  2D9Y A;  1J0W A;  2JP2 A;  4ZRJ A;  2PZ1 A;  2MFQ A;  2AL6 A;  4HAU B;  2I1K A;  2COC A;  2MWN B;  1SGH A;  2XQN M;  2W2W A;  1K5G B;  2CY4 A;  1MAI A;  3OAN A;  2DHJ A;  4K81 A;  1XR0 B;  4DX9 0;  1TJ6 A;  2GCJ A;  3CIK A;  2H7E A;  3TVV A;  3PZD A;  2YRY A;  1XD4 A;  4B6H A;  5EFX A;  2YS5 A;  4K17 A;  1WI1 A;  1BTN A;  2K2U A;  2YT1 A;  4YON A;  2P0H A;  2DX1 A;  2EMS A;  2DKP A;  3HW2 B;  2HE7 A;  4A6K A;  3P7Z A;  2IFS A;  2YSZ A;  1OMW A;  2I1J A;  1UNR A;  3PVL A;  3T06 A;  1U29 A;  4HDQ A;  4F7G A;  1Y19 B;  5CLQ B;  2COD A;  4A6F B;  1XX0 A;  3RCP A;  2DX5 A;  2YF0 A;  3FSS A;  2EJ8 A;  3D8D A;  1GC7 A;  2D11 A;  3BIN A;  3UZT A;  2ELB A;  2QKL A;  3AU4 A;  1K5D B;  1LW3 A;  4L6E A;  2DHK A;  4GMV A;  1W1G A;  4KAX B;  1FB8 A;  2J0J A;  3ODX A;  3IVF A;  2YS3 A;  2OTX A;  4ZRI A;  4GPT B;  2RGN B;  2RNR B;  1AWE A;  2D9V A;  3DXE A;  2DTC A;  3PSC A;  3ZDT A;  3V5W A;  2UZR A;  3QIJ A;  1XOD A;  2N23 A;  1DYN A;  5JHH A;  4GZU A;  3SYX A;  2UZS A;  1P5T A;  4HB0 B;  1UNQ A;  3PEG A;  4MK0 A;  4C0A A;  1V89 A;  3WA0 A;  3TW1 A;  2LOX A;  1KZ7 A;  1ZC3 B;  2DA0 A;  2Z0Q A;  4WVF B;  1OQN A;  3X23 A;  2D2Q A;  1ZC4 B;  1ISN A;  3F5R A;  4DX8 A;  3VOQ A;  2GCL A;  4A5K A;  2LUL A;  2MKR A;  1MKE A;  2ROZ B;  2N0Y A;  1XKE A;  3ZVR A;  5D27 A;  4HDO A;  4F7U P;  2P0F A;  1J19 A;  3A8P A;  3HK0 A;  4MT7 A;  3AU5 A;  4HAX B;  2EMT A;  4HAT B;  3DXC A;  4P7I A;  3PVU A;  4DXA B;  2X18 A;  2Z0P A;  1ZM0 A;  5D3Y A;  2I5C A;  1V5M A;  4IFS A;  1V5P A;  1PLS A;  5DHF B;  2YVC A;  4ZRK A;  2J59 M;  2YS1 A;  3ODW A;  3TFM A;  2VKI A;  2DKQ A;  4HAW B;  4IOY X;  5C5B B;  4GMX B;  1UPQ A;  1NTV A;  4HAZ B;  1I7A A;  2W2X C;  3ULC A;  4H8S A;  5GOW B;  2NMB A;  5KCV A;  4GN1 A;  4TYZ A; 
#chains in the Genus database with same CATH topology
 4NY0 A;  5LG4 B;  3KRX A;  2DYN A;  2L2I A;  3U7D A;  4CHM A;  2P8V A;  2D9Z A;  2D9W A;  3M1I B;  3MPX A;  4A6H A;  4HB4 B;  1WGQ A;  4MY6 A;  2FJU B;  2RVB B;  4TKN A;  1P6S A;  3A98 B;  1H10 A;  5C6R A;  1FAO A;  1UPR A;  3PVW A;  1ZVR A;  3VIA A;  5J3Y A;  4EJN A;  3B77 A;  2Z4D A;  1H4R A;  4GOU A;  5D3X A;  4CYE A;  2DYQ A;  4Z2M B;  4EKU A;  4OSN A;  3KZ1 A;  2DLW A;  4D6W A;  1EF1 A;  5FI0 A;  1DDW A;  1ZSQ A;  1X1G A;  2CRF A;  2ZKM X;  2D4Q A;  2DN6 A;  3GYP A;  1NU2 A;  3SO6 A;  2COA A;  1X05 A;  4K2O A;  5DIF B;  5KQ1 A;  4K2P A;  3QBV B;  2KGX B;  2Q13 A;  2Y7B A;  5CLL B;  1X11 A;  4D0N B;  2EC1 A;  5J3T A;  2AEH A;  1I2H A;  1KZG A;  3GYO A;  1ZYI A;  1RRP B;  1GC6 A;  3KRW A;  2KCJ A;  2QKM A;  2D10 A;  5L81 A;  2Z14 A;  2GUM A;  1B55 A;  5DI9 B;  5HE1 A;  2K8E A;  3MDB C;  5I2M A;  3FEH A;  4HAY B;  3F0W A;  3SV1 A;  1UNP A;  1MPH A;  1BTK A;  1MK7 B;  2CY5 A;  1V61 A;  1FGY A;  1X1F A;  2E2X A;  2YT2 A;  2DFK A;  2COF A;  2H7D A;  2W2X D;  2K00 A;  2IYB A;  3O96 A;  4A6F A;  5C16 A;  3WYF B;  2ELA A;  3DCX A;  1WJM A;  1PFJ A;  1W1H A;  1DDM A;  1WG7 A;  4YL8 A;  4BBK A;  4XWX A;  4KHA A;  2D9X A;  1FHO A;  1M7E A;  4HB3 B;  2MDX A;  5LON B;  4GXB A;  5D3V A;  3KY9 A;  1BAK A;  3LJU X;  3A58 A;  4L1R A;  4CHJ A;  2RLO A;  2P0D A;  3D8E A;  1FGZ A;  1LB1 A;  2HTH B;  1P3R A;  2LKO A;  1EAZ A;  1KI1 B;  2VSZ A;  5JHG A;  5JLJ B;  3OHM B;  5M4Y B;  3N7C A;  2RSG A;  1BWN A;  3QWM A;  4F7H A;  4HB2 B;  5KQ4 A;  1Z87 A;  1Y5O A;  1U5E A;  3A8Q A;  5IRS A;  1DBH A;  1U5D A;  3D8F A;  2KUP A;  5HE2 A;  3NSU A;  5D3W A;  1TQZ A;  4KHB B;  3TO1 A;  3DXD A;  2G35 A;  1FHX A;  2L1C A;  2CAY A;  2RUK B;  1U27 A;  1PMS A;  2M14 A;  1XCG A;  4DIX A;  4IAP A;  4DBB A;  2ZPY A;  3AJ4 A;  4NSW A;  2I5F A;  1Q67 A;  1E5W A;  2GJY A;  3NW8 A;  1MK9 B;  5DH9 B;  4PQ0 A;  2OQB A;  2LYD A;  2J0M A;  2YT0 A;  1QQG A;  1FHW A;  1RJ2 A;  4Y94 A;  2Y8F A;  2R2Y A;  5C79 A;  2LG1 A;  2R09 A;  1MI1 A;  2M38 A;  1V88 A;  1TXD A;  5LOP B;  5HE0 A;  1WJ1 A;  1AQC A;  3P6A A;  3ULB A;  1N3H A;  1MIZ B;  5J3Q A;  1EGX A;  1WVH A;  1IRS A;  3ODO A;  1DDV A;  3BJI A;  1GG3 A;  5DHA B;  2GS0 A;  1U5G A;  4KVG B;  2FJL A;  3PP2 A;  1DRO A;  2ADZ A;  4WSF A;  1U5F A;  1U2B A;  3G9W A;  4QJ4 B;  2KR0 A;  5FI1 A;  5C5B A;  1MIX A;  1QC6 A;  1FOE A;  1OY2 A;  5HE3 A;  1UEF A;  2J0K A;  3KSY A;  1NTY A;  3HQC A;  4PNK A;  2K2J A;  4HAV B;  2ROV A;  2DHI A;  1SHC A;  3NWF A;  3TCA A;  2V76 A;  3ML4 A;  2VRW B;  1WGU A;  2BCJ A;  3FVC A;  1M7R A;  2RRF A;  3U8Z A;  1EVH A;  3SNH A;  3FM8 C;  4Z2N A;  2LOZ A;  4WJ7 A;  2Z0O A;  1X86 A;  1V5U A;  4KHO A;  3CXB B;  3NWA A;  2UVM A;  4HHV A;  4OT1 A;  1NI2 A;  2Y8G A;  3SUZ A;  5JP4 A;  2R0D A;  2NZ8 B;  3PG7 A;  1W1D A;  4EMO A;  2D9Y A;  1J0W A;  2JP2 A;  4ZRJ A;  2PZ1 A;  2MFQ A;  2AL6 A;  4HAU B;  2I1K A;  2COC A;  2MWN B;  1SGH A;  2XQN M;  2W2W A;  1K5G B;  2CY4 A;  1MAI A;  3OAN A;  2DHJ A;  1T77 A;  4K81 A;  1XR0 B;  4DX9 0;  1TJ6 A;  4GNK B;  4QJ5 B;  2GCJ A;  3CIK A;  2H7E A;  3TVV A;  3PZD A;  2YRY A;  1XD4 A;  4B6H A;  2K49 A;  5EFX A;  2YS5 A;  4K17 A;  1WI1 A;  1BTN A;  2K2U A;  2YT1 A;  4YON A;  2P0H A;  2DX1 A;  2EMS A;  2DKP A;  3HW2 B;  2HE7 A;  4A6K A;  3P7Z A;  3HIE A;  2IFS A;  2YSZ A;  3NWD A;  1OMW A;  2I1J A;  1UNR A;  3PVL A;  3T06 A;  1U29 A;  4HDQ A;  4F7G A;  1Y19 B;  5CLQ B;  2COD A;  4A6F B;  1XX0 A;  3RCP A;  2DX5 A;  2YF0 A;  3FSS A;  2EJ8 A;  3D8D A;  5I2S A;  1GC7 A;  2D11 A;  3BIN A;  3UZT A;  2ELB A;  2QKL A;  3AU4 A;  1K5D B;  1LW3 A;  4L6E A;  2DHK A;  4GMV A;  1W1G A;  4KAX B;  1FB8 A;  2J0J A;  3ODX A;  3IVF A;  2YS3 A;  2OTX A;  4ZRI A;  4GPT B;  2RGN B;  2RNR B;  1AWE A;  2D9V A;  3DXE A;  2DTC A;  3PSC A;  3ZDT A;  3V5W A;  2UZR A;  3QIJ A;  1XOD A;  2N23 A;  1DYN A;  5JHH A;  4GZU A;  3SYX A;  2UZS A;  1P5T A;  4HB0 B;  1UNQ A;  3PEG A;  2KUQ A;  4MK0 A;  4C0A A;  1V89 A;  3WA0 A;  3TW1 A;  2LOX A;  1KZ7 A;  1ZC3 B;  2DA0 A;  2Z0Q A;  4WVF B;  1OQN A;  4KHB A;  3X23 A;  4CSQ A;  2D2Q A;  1ZC4 B;  1ISN A;  3F5R A;  4DX8 A;  3VOQ A;  2GCL A;  4HSI A;  4A5K A;  2KIE A;  2LUL A;  2Z59 A;  2MKR A;  1MKE A;  2ROZ B;  2N0Y A;  1XKE A;  3ZVR A;  5D27 A;  4HDO A;  4F7U P;  2P0F A;  1J19 A;  3A8P A;  3HK0 A;  4MT7 A;  3AU5 A;  2Z13 A;  4HAX B;  2EMT A;  4HAT B;  3DXC A;  4P7I A;  3PVU A;  4DXA B;  2X18 A;  2Z0P A;  1ZM0 A;  4QJ3 B;  4QXA B;  5D3Y A;  2KIG A;  2I5C A;  1V5M A;  4IFS A;  1V5P A;  3HSA A;  1PLS A;  5DHF B;  2YVC A;  4ZRK A;  2J59 M;  2YS1 A;  3ODW A;  3TFM A;  2VKI A;  2DKQ A;  4HAW B;  4IOY X;  5C5B B;  4GMX B;  1UPQ A;  3U12 A;  2NBV A;  1NTV A;  4HAZ B;  1I7A A;  2W2X C;  3ULC A;  4H8S A;  5GOW B;  2NMB A;  5KCV A;  4GN1 A;  4TYZ A; 
#chains in the Genus database with same CATH homology
 4NY0 A;  3KRX A;  2DYN A;  2L2I A;  3U7D A;  4CHM A;  2P8V A;  2D9Z A;  2D9W A;  3M1I B;  3MPX A;  4A6H A;  4HB4 B;  1WGQ A;  4MY6 A;  2RVB B;  4TKN A;  1P6S A;  3A98 B;  1H10 A;  5C6R A;  1FAO A;  1UPR A;  3PVW A;  1ZVR A;  3VIA A;  5J3Y A;  4EJN A;  1H4R A;  5D3X A;  4CYE A;  4EKU A;  2DYQ A;  4Z2M B;  3KZ1 A;  2DLW A;  1EF1 A;  5FI0 A;  1DDW A;  1ZSQ A;  1X1G A;  2CRF A;  2D4Q A;  2DN6 A;  3GYP A;  1NU2 A;  3SO6 A;  2COA A;  1X05 A;  4K2O A;  5DIF B;  5KQ1 A;  4K2P A;  3QBV B;  2KGX B;  2Q13 A;  2Y7B A;  5CLL B;  1X11 A;  4D0N B;  2EC1 A;  5J3T A;  2AEH A;  1I2H A;  1KZG A;  3GYO A;  1RRP B;  1GC6 A;  3KRW A;  2KCJ A;  2QKM A;  2D10 A;  5L81 A;  1B55 A;  5DI9 B;  5HE1 A;  3MDB C;  3FEH A;  4HAY B;  3F0W A;  3SV1 A;  1UNP A;  1MPH A;  1BTK A;  1MK7 B;  2CY5 A;  1V61 A;  1FGY A;  1X1F A;  2E2X A;  2DFK A;  2COF A;  2H7D A;  2W2X D;  2K00 A;  2IYB A;  3O96 A;  4A6F A;  5C16 A;  3WYF B;  2ELA A;  1WJM A;  1PFJ A;  1W1H A;  1DDM A;  1WG7 A;  4YL8 A;  4BBK A;  4XWX A;  4KHA A;  2D9X A;  1FHO A;  1M7E A;  4HB3 B;  2MDX A;  5LON B;  4GXB A;  5D3V A;  3KY9 A;  1BAK A;  3LJU X;  4CHJ A;  2RLO A;  2P0D A;  3D8E A;  1FGZ A;  1LB1 A;  2HTH B;  1P3R A;  2LKO A;  1EAZ A;  1KI1 B;  2VSZ A;  5JHG A;  5JLJ B;  3N7C A;  2RSG A;  1BWN A;  3QWM A;  4F7H A;  4HB2 B;  5KQ4 A;  1Z87 A;  1Y5O A;  1U5E A;  3A8Q A;  1DBH A;  1U5D A;  3D8F A;  2KUP A;  5HE2 A;  3NSU A;  5D3W A;  1TQZ A;  4KHB B;  3TO1 A;  3DXD A;  2G35 A;  1FHX A;  2L1C A;  2CAY A;  2RUK B;  1U27 A;  1PMS A;  2M14 A;  1XCG A;  4IAP A;  4DBB A;  2ZPY A;  3AJ4 A;  4NSW A;  2I5F A;  1Q67 A;  1E5W A;  2GJY A;  1MK9 B;  5DH9 B;  4PQ0 A;  2OQB A;  2LYD A;  2J0M A;  1QQG A;  2YT0 A;  1FHW A;  1RJ2 A;  4Y94 A;  2Y8F A;  5C79 A;  2LG1 A;  2R09 A;  2M38 A;  5LOP B;  1V88 A;  1TXD A;  5HE0 A;  1WJ1 A;  1AQC A;  3P6A A;  3ULB A;  1N3H A;  1MIZ B;  5J3Q A;  1EGX A;  1WVH A;  1IRS A;  3ODO A;  1DDV A;  3BJI A;  1GG3 A;  5DHA B;  2GS0 A;  1U5G A;  4KVG B;  2FJL A;  3PP2 A;  1DRO A;  2ADZ A;  4WSF A;  1U5F A;  1U2B A;  3G9W A;  5FI1 A;  5C5B A;  1MIX A;  1QC6 A;  1FOE A;  1OY2 A;  5HE3 A;  1UEF A;  2J0K A;  3KSY A;  1NTY A;  3HQC A;  4PNK A;  2K2J A;  4HAV B;  2ROV A;  2DHI A;  1SHC A;  3TCA A;  2V76 A;  3ML4 A;  2VRW B;  1WGU A;  2BCJ A;  1M7R A;  3U8Z A;  1EVH A;  3SNH A;  3FM8 C;  4Z2N A;  2LOZ A;  4WJ7 A;  2Z0O A;  1X86 A;  1V5U A;  4KHO A;  3CXB B;  2UVM A;  4HHV A;  3SUZ A;  1NI2 A;  2Y8G A;  5JP4 A;  2R0D A;  2NZ8 B;  3PG7 A;  1W1D A;  4EMO A;  2D9Y A;  1J0W A;  2JP2 A;  4ZRJ A;  2PZ1 A;  2MFQ A;  2AL6 A;  4HAU B;  2I1K A;  2COC A;  2MWN B;  1SGH A;  2XQN M;  2W2W A;  1K5G B;  2CY4 A;  1MAI A;  3OAN A;  2DHJ A;  4K81 A;  1XR0 B;  4DX9 0;  1TJ6 A;  2GCJ A;  3CIK A;  2H7E A;  3TVV A;  3PZD A;  2YRY A;  1XD4 A;  4B6H A;  5EFX A;  2YS5 A;  4K17 A;  1WI1 A;  1BTN A;  2K2U A;  2YT1 A;  4YON A;  2P0H A;  2DX1 A;  2EMS A;  2DKP A;  3HW2 B;  2HE7 A;  4A6K A;  3P7Z A;  2IFS A;  2YSZ A;  1OMW A;  2I1J A;  1UNR A;  3PVL A;  3T06 A;  1U29 A;  4HDQ A;  4F7G A;  1Y19 B;  5CLQ B;  2COD A;  4A6F B;  1XX0 A;  3RCP A;  2DX5 A;  2YF0 A;  3FSS A;  2EJ8 A;  3D8D A;  1GC7 A;  2D11 A;  3BIN A;  3UZT A;  2ELB A;  2QKL A;  3AU4 A;  1K5D B;  1LW3 A;  4L6E A;  2DHK A;  4GMV A;  1W1G A;  4KAX B;  1FB8 A;  2J0J A;  3ODX A;  3IVF A;  2YS3 A;  2OTX A;  4ZRI A;  4GPT B;  2RGN B;  2RNR B;  1AWE A;  2D9V A;  3DXE A;  2DTC A;  3PSC A;  3ZDT A;  3V5W A;  2UZR A;  3QIJ A;  1XOD A;  2N23 A;  1DYN A;  5JHH A;  4GZU A;  3SYX A;  2UZS A;  1P5T A;  4HB0 B;  1UNQ A;  3PEG A;  4MK0 A;  4C0A A;  1V89 A;  3WA0 A;  3TW1 A;  2LOX A;  1KZ7 A;  1ZC3 B;  2DA0 A;  2Z0Q A;  4WVF B;  1OQN A;  3X23 A;  2D2Q A;  1ZC4 B;  1ISN A;  3F5R A;  4DX8 A;  3VOQ A;  2GCL A;  4A5K A;  2LUL A;  2MKR A;  1MKE A;  2ROZ B;  2N0Y A;  1XKE A;  3ZVR A;  5D27 A;  4HDO A;  4F7U P;  2P0F A;  1J19 A;  3A8P A;  3HK0 A;  4MT7 A;  3AU5 A;  4HAX B;  2EMT A;  4HAT B;  3DXC A;  4P7I A;  3PVU A;  4DXA B;  2X18 A;  2Z0P A;  1ZM0 A;  5D3Y A;  2I5C A;  1V5M A;  4IFS A;  1V5P A;  1PLS A;  5DHF B;  2YVC A;  4ZRK A;  2J59 M;  2YS1 A;  3ODW A;  3TFM A;  2VKI A;  2DKQ A;  4HAW B;  4IOY X;  5C5B B;  4GMX B;  1UPQ A;  1NTV A;  4HAZ B;  1I7A A;  2W2X C;  3ULC A;  4H8S A;  5GOW B;  2NMB A;  5KCV A;  4GN1 A;  4TYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...