2N23A

Nmr structure of the complex between the ph domain of the tfb1 subunit from tfiih and the n-terminal activation domain of eklf (tad1)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
115
structure length
115
Chain Sequence
PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords RNA polymerase II transcription factor B subunit 1
publication title Structural Characterization of the Complex between the N-terminal Transactivation Domain of EKLF and the p62/Tfb1 subunit of TFIIH
rcsb
source organism Saccharomyces cerevisiae s288c
total genus 24
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2n23A00
1PFJA 4GMXB 5D3VA 4GN1A 3SUZA 4TYZA 2UZRA 1BTKA 1ZSQA 2DKPA 2IFSA 2V76A 2CY4A 5C79A 5DIFB 2YS1A 1W1DA 2P0FA 4HB4B 1WJMA 1FAOA 4HDQA 5C6RA 2Z0QA 2I1KA 1AWEA 2DHIA 4CHMA 5DHFB 3ULCA 5J3TA 1X05A 1MK7B 2COAA 2MDXA 3KRXA 4YONA 4CYEA 2RVBB 4GXBA 2DHKA 4KAXB 3NSUA 1UPRA 5D27A 1U29A 1WVHA 4MK0A 1V5UA 1MIZB 5HE1A 3TW1A 1DDWA 2NMBA 2ROZB 5DHAB 1MAIA 2GCJA 5LOPB 1XCGA 3N7CA 2Y8FA 4HAVB 1NI2A 3AU4A 2LKOA 1DDMA 1X11A 2K2JA 1ZM0A 1DYNA 1J0WA 1DBHA 3CIKA 1KI1B 5D3WA 2KGXB 2D10A 5KQ4A 1H4RA 3KZ1A 1Z87A 3QBVB 4A5KA 2E2XA 4HAYB 2ELAA 2D9YA 3PZDA 4L6EA 1ZC4B 3BINA 3TVVA 5LONB 1OQNA 2UZSA 2DTCA 5D3XA 4PNKA 1M7RA 1WGUA 2H7DA 3IVFA 4ZRJA 3BJIA 2EMTA 2ROVA 4EJNA 2YS5A 2CODA 3DXCA 2AL6A 2G35A 1XD4A 1I7AA 5FI0A 3F5RA 3FM8C 2W2XD 1K5DB 5HE2A 1XKEA 2CY5A 4KHBB 1DDVA 1Q67A 1W1HA 4KHOA 4Z2NA 2CRFA 5KCVA 3SO6A 1ISNA 2HTHB 2XQNM 1X1GA 3T06A 2X18A 2RLOA 1PMSA 4HDOA 2VSZA 1EF1A 2GJYA 4A6FA 3MPXA 3HK0A 2DYNA 2LOXA 5JHGA 1W1GA 2COFA 1FHOA 1AQCA 3D8DA 2YS3A 1FHWA 1U27A 2W2XC 5CLQB 3FSSA 5EFXA 1RJ2A 2D2QA 2EMSA 3TCAA 4HAXB 4HHVA 3P7ZA 4F7UP 1IRSA 2IYBA 2YT0A 5J3QA 2J59M 4H8SA 1UNQA 2UVMA 2YF0A 4MY6A 2HE7A 3MDBC 2D9ZA 1E5WA 3ODXA 4YL8A 3SNHA 1BWNA 2D9WA 2Z0PA 1EAZA 2RGNB 4K81A 3ULBA 5C5BB 1UNPA 3U7DA 2LULA 1EVHA 2YVCA 4BBKA 3ZVRA 1B55A 2BCJA 3ODWA 2NZ8B 5HE3A 1UEFA 4EKUA 3PVWA 3HQCA 2MFQA 3WA0A 1MPHA 3PP2A 4GMVA 1V5MA 3AU5A 2RSGA 1U5GA 2Q13A 4HB3B 1FGYA 1X86A 2OTXA 2LG1A 2ADZA 1XR0B 2D11A 3GYPA 5C16A 3FEHA 2DX1A 3KRWA 3RCPA 5DI9B 4MT7A 2J0JA 5JP4A 1FGZA 3A8QA 2RUKB 1ZC3B 2Z0OA 1WGQA 2DKQA 3P6AA 1U5EA 3QWMA 1NTYA 3VIAA 4GZUA 1BTNA 2P0HA 5KQ1A 2M14A 3QIJA 1DROA 2DA0A 5HE0A 4HATB 2K2UA 2N23A 1P5TA 4A6HA 4WJ7A 1K5GB 2H7EA 4ZRKA 2KUPA 1MK9B 4HAWB 1LW3A 1OMWA 1M7EA 4NSWA 1GC6A 1U5DA 1UPQA 4KHAA 1PLSA 1J19A 2ELBA 4PQ0A 3A8PA 4Y94A 1ZVRA 3M1IB 1XODA 1UNRA 3ZDTA 1FB8A 2LYDA 5FI1A 3ML4A 2W2WA 2R0DA 2GCLA 4NY0A 1TJ6A 1GC7A 2VKIA 3HW2B 2EC1A 1LB1A 1OY2A 2P0DA 3O96A 3X23A 4ZRIA 4F7GA 4GPTB 2MWNB 2YRYA 1KZ7A 1P6SA 3TO1A 5JHHA 3CXBB 3KY9A 1WJ1A 2DX5A 4HAUB 3LJUX 4A6FB 4IFSA 1MIXA 2L2IA 2LOZA 3SYXA 2DHJA 3PG7A 5J3YA 4EMOA 1QC6A 2I5FA 4DBBA 2YT1A 3VOQA 4TKNA 2JP2A 2R09A 2Y7BA 3D8EA 3GYOA 2N0YA 1N3HA 2OQBA 2MKRA 1Y19B 5CLLB 2DN6A 3PEGA 1XX0A 3OANA 4HB2B 2QKLA 1P3RA 1KZGA 1NTVA 3SV1A 4Z2MB 5GOWB 2YSZA 4WSFA 4DXAB 3ODOA 3F0WA 2GS0A 3D8FA 2I1JA 2FJLA 2AEHA 4B6HA 4HB0B 1I2HA 2L1CA 2QKMA 5D3YA 3TFMA 1EGXA 1V89A 1FOEA 4K2PA 3A98B 1V5PA 2K00A 2J0MA 2Y8GA 3V5WA 4IAPA 3KSYA 3DXDA 4K2OA 1WI1A 4K17A 1TXDA 3PVLA 1U5FA 4HAZB 2VRWB 1SGHA 4P7IA 2DLWA 4DX90 2DYQA 2P8VA 2D9XA 4XWXA 2D4QA 1Y5OA 3WYFB 1RRPB 3DXEA 3G9WA 4IOYX 2EJ8A 5DH9B 3UZTA 3AJ4A 2ZPYA 3PSCA 4WVFB 1X1FA 2D9VA 4CHJA 1BAKA 1NU2A 2KCJA 1H10A 1GG3A 1U2BA 3U8ZA 4KVGB 2J0KA 5L81A 2CAYA 1SHCA 1WG7A 5JLJB 2RNRB 4C0AA 1V61A 1V88A 2M38A 1MKEA 4A6KA 1FHXA 4DX8A 2COCA 5C5BA 1QQGA 2PZ1A 3PVUA 2I5CA 4D0NB 1TQZA 2DFKA 4F7HA
chains in the Genus database with same CATH superfamily
1PFJA 4GMXB 3U12A 5D3VA 4GN1A 3SUZA 4TYZA 2UZRA 1BTKA 1ZSQA 2DKPA 2IFSA 5LG4B 2V76A 2CY4A 5C79A 5DIFB 2YS1A 1W1DA 2P0FA 4HB4B 1WJMA 1FAOA 4HDQA 5C6RA 2Z0QA 3OHMB 2I1KA 1AWEA 2DHIA 4CHMA 5DHFB 3ULCA 5J3TA 1X05A 1T77A 1MK7B 2COAA 2MDXA 3KRXA 4YONA 2K49A 4CYEA 2RVBB 4GXBA 2DHKA 4KAXB 3NSUA 1UPRA 2Z59A 5D27A 1U29A 1WVHA 4MK0A 1V5UA 1MIZB 5HE1A 3TW1A 1DDWA 2Z4DA 2NMBA 5M4YB 2ROZB 5DHAB 1MAIA 2GCJA 5LOPB 1XCGA 3N7CA 2Y8FA 4HAVB 1NI2A 3AU4A 2LKOA 1DDMA 1X11A 2K2JA 1ZM0A 4DIXA 1DYNA 1J0WA 1DBHA 3CIKA 1KI1B 4OSNA 5D3WA 2KGXB 2D10A 5KQ4A 1H4RA 3KZ1A 1Z87A 3QBVB 4A5KA 2E2XA 4HAYB 2ELAA 2D9YA 3PZDA 4L6EA 1ZC4B 3BINA 3TVVA 5LONB 1OQNA 2UZSA 2DTCA 5D3XA 4PNKA 1M7RA 1WGUA 2H7DA 3IVFA 4ZRJA 3BJIA 2EMTA 2ROVA 4EJNA 2YS5A 2CODA 3DXCA 2AL6A 3DCXA 2G35A 3NWAA 1XD4A 1I7AA 5FI0A 3F5RA 3FM8C 2W2XD 1K5DB 5HE2A 1XKEA 2CY5A 4KHBB 1DDVA 1Q67A 1W1HA 4KHOA 2KUQA 4Z2NA 2CRFA 5KCVA 3SO6A 1ISNA 2HTHB 2XQNM 1X1GA 3A58A 3T06A 2X18A 2RLOA 1PMSA 5IRSA 4HDOA 2VSZA 1EF1A 1ZYIA 2GJYA 4A6FA 3MPXA 3HK0A 2DYNA 2ZKMX 2LOXA 5JHGA 1W1GA 2COFA 1FHOA 1AQCA 3D8DA 2YS3A 1FHWA 1U27A 2W2XC 5CLQB 3FSSA 5EFXA 1RJ2A 2D2QA 2EMSA 3TCAA 4HAXB 2GUMA 4HHVA 3P7ZA 4F7UP 1IRSA 2IYBA 2YT0A 5J3QA 2J59M 4H8SA 1UNQA 2UVMA 4QJ3B 2YF0A 4MY6A 2HE7A 3MDBC 2D9ZA 1E5WA 3ODXA 4YL8A 3SNHA 1BWNA 2D9WA 2Z0PA 1EAZA 2RGNB 4K81A 3ULBA 5C5BB 1UNPA 3U7DA 2LULA 2KIEA 1EVHA 2YVCA 4BBKA 3ZVRA 1B55A 2BCJA 3ODWA 2NZ8B 5HE3A 1UEFA 4EKUA 3PVWA 3B77A 3HQCA 2MFQA 3WA0A 1MPHA 3PP2A 4GMVA 1V5MA 3AU5A 2RSGA 1U5GA 2Q13A 4HB3B 1FGYA 1X86A 2OTXA 2LG1A 2ADZA 1XR0B 2D11A 3GYPA 5C16A 3FEHA 4HSIA 2DX1A 2KR0A 3KRWA 3RCPA 5DI9B 4D6WA 3HIEA 4MT7A 2J0JA 5JP4A 1FGZA 3A8QA 2RUKB 1ZC3B 2Z0OA 1WGQA 2DKQA 3P6AA 4KHBA 1U5EA 3QWMA 1NTYA 5I2SA 3VIAA 4GZUA 1BTNA 2P0HA 5KQ1A 2M14A 3QIJA 1DROA 2DA0A 5HE0A 4L1RA 4HATB 2K2UA 2N23A 1P5TA 4A6HA 4WJ7A 1K5GB 2KIGA 2H7EA 4ZRKA 2KUPA 1MK9B 4HAWB 1LW3A 1OMWA 1M7EA 4NSWA 1GC6A 3NWDA 1U5DA 1UPQA 4KHAA 1PLSA 1J19A 4GOUA 2ELBA 4PQ0A 3A8PA 4Y94A 1ZVRA 3M1IB 3HSAA 1XODA 1UNRA 4GNKB 3ZDTA 1FB8A 2LYDA 5FI1A 3ML4A 2W2WA 2R0DA 2GCLA 4NY0A 1TJ6A 1GC7A 2VKIA 3HW2B 2EC1A 1LB1A 1OY2A 2P0DA 3O96A 3X23A 3FVCA 4ZRIA 4F7GA 4GPTB 2MWNB 2YRYA 1KZ7A 1P6SA 3TO1A 5JHHA 3CXBB 3KY9A 1WJ1A 2DX5A 4HAUB 3LJUX 4A6FB 4IFSA 2Z14A 1MIXA 2L2IA 2Z13A 2LOZA 3SYXA 2DHJA 3PG7A 5J3YA 4EMOA 1QC6A 2I5FA 4DBBA 2YT1A 4OT1A 3VOQA 4TKNA 2JP2A 2R09A 2Y7BA 5I2MA 3D8EA 3GYOA 2N0YA 1N3HA 2OQBA 2MKRA 1Y19B 5CLLB 2DN6A 3PEGA 1XX0A 3OANA 4HB2B 4QJ5B 2QKLA 1P3RA 1KZGA 1NTVA 2K8EA 3SV1A 4Z2MB 5GOWB 4QXAB 4QJ4B 2YSZA 4WSFA 2YT2A 4DXAB 3ODOA 3NWFA 3F0WA 2GS0A 3D8FA 2I1JA 4CSQA 2FJLA 2AEHA 4B6HA 4HB0B 1I2HA 2L1CA 2QKMA 5D3YA 3TFMA 1EGXA 1V89A 1FOEA 4K2PA 3A98B 1V5PA 2K00A 2J0MA 2Y8GA 3V5WA 4IAPA 3KSYA 3DXDA 4K2OA 1WI1A 4K17A 1TXDA 2FJUB 3PVLA 1U5FA 4HAZB 2VRWB 1SGHA 4P7IA 2DLWA 4DX90 2DYQA 2P8VA 1MI1A 2D9XA 4XWXA 2D4QA 1Y5OA 3WYFB 1RRPB 3DXEA 3G9WA 4IOYX 2EJ8A 5DH9B 3UZTA 3AJ4A 2ZPYA 3PSCA 4WVFB 1X1FA 2D9VA 4CHJA 1BAKA 2NBVA 1NU2A 2RRFA 2KCJA 1H10A 1GG3A 1U2BA 3U8ZA 4KVGB 2J0KA 5L81A 2CAYA 1SHCA 1WG7A 5JLJB 2RNRB 4C0AA 3NW8A 1V61A 1V88A 2M38A 1MKEA 4A6KA 1FHXA 4DX8A 2COCA 5C5BA 1QQGA 2PZ1A 3PVUA 2I5CA 4D0NB 1TQZA 2R2YA 2DFKA 4F7HA
chains in the Genus database with same CATH topology
1PFJA 4GMXB 5D3VA 4GN1A 3SUZA 4TYZA 2UZRA 1BTKA 1ZSQA 2DKPA 2IFSA 2V76A 2CY4A 5C79A 5DIFB 2YS1A 1W1DA 2P0FA 4HB4B 1WJMA 1FAOA 4HDQA 5C6RA 2Z0QA 2I1KA 1AWEA 2DHIA 4CHMA 5DHFB 3ULCA 5J3TA 1X05A 1MK7B 2COAA 2MDXA 3KRXA 4YONA 4CYEA 2RVBB 4GXBA 2DHKA 4KAXB 3NSUA 1UPRA 5D27A 1U29A 1WVHA 4MK0A 1V5UA 1MIZB 5HE1A 3TW1A 1DDWA 2NMBA 2ROZB 5DHAB 1MAIA 2GCJA 5LOPB 1XCGA 3N7CA 2Y8FA 4HAVB 1NI2A 3AU4A 2LKOA 1DDMA 1X11A 2K2JA 1ZM0A 1DYNA 1J0WA 1DBHA 3CIKA 1KI1B 5D3WA 2KGXB 2D10A 5KQ4A 1H4RA 3KZ1A 1Z87A 3QBVB 4A5KA 2E2XA 4HAYB 2ELAA 2D9YA 3PZDA 4L6EA 1ZC4B 3BINA 3TVVA 5LONB 1OQNA 2UZSA 2DTCA 5D3XA 4PNKA 1M7RA 1WGUA 2H7DA 3IVFA 4ZRJA 3BJIA 2EMTA 2ROVA 4EJNA 2YS5A 2CODA 3DXCA 2AL6A 2G35A 1XD4A 1I7AA 5FI0A 3F5RA 3FM8C 2W2XD 1K5DB 5HE2A 1XKEA 2CY5A 4KHBB 1DDVA 1Q67A 1W1HA 4KHOA 4Z2NA 2CRFA 5KCVA 3SO6A 1ISNA 2HTHB 2XQNM 1X1GA 3T06A 2X18A 2RLOA 1PMSA 4HDOA 2VSZA 1EF1A 2GJYA 4A6FA 3MPXA 3HK0A 2DYNA 2LOXA 5JHGA 1W1GA 2COFA 1FHOA 1AQCA 3D8DA 2YS3A 1FHWA 1U27A 2W2XC 5CLQB 3FSSA 5EFXA 1RJ2A 2D2QA 2EMSA 3TCAA 4HAXB 4HHVA 3P7ZA 4F7UP 1IRSA 2IYBA 2YT0A 5J3QA 2J59M 4H8SA 1UNQA 2UVMA 2YF0A 4MY6A 2HE7A 3MDBC 2D9ZA 1E5WA 3ODXA 4YL8A 3SNHA 1BWNA 2D9WA 2Z0PA 1EAZA 2RGNB 4K81A 3ULBA 5C5BB 1UNPA 3U7DA 2LULA 1EVHA 2YVCA 4BBKA 3ZVRA 1B55A 2BCJA 3ODWA 2NZ8B 5HE3A 1UEFA 4EKUA 3PVWA 3HQCA 2MFQA 3WA0A 1MPHA 3PP2A 4GMVA 1V5MA 3AU5A 2RSGA 1U5GA 2Q13A 4HB3B 1FGYA 1X86A 2OTXA 2LG1A 2ADZA 1XR0B 2D11A 3GYPA 5C16A 3FEHA 2DX1A 3KRWA 3RCPA 5DI9B 4MT7A 2J0JA 5JP4A 1FGZA 3A8QA 2RUKB 1ZC3B 2Z0OA 1WGQA 2DKQA 3P6AA 1U5EA 3QWMA 1NTYA 3VIAA 4GZUA 1BTNA 2P0HA 5KQ1A 2M14A 3QIJA 1DROA 2DA0A 5HE0A 4HATB 2K2UA 2N23A 1P5TA 4A6HA 4WJ7A 1K5GB 2H7EA 4ZRKA 2KUPA 1MK9B 4HAWB 1LW3A 1OMWA 1M7EA 4NSWA 1GC6A 1U5DA 1UPQA 4KHAA 1PLSA 1J19A 2ELBA 4PQ0A 3A8PA 4Y94A 1ZVRA 3M1IB 1XODA 1UNRA 3ZDTA 1FB8A 2LYDA 5FI1A 3ML4A 2W2WA 2R0DA 2GCLA 4NY0A 1TJ6A 1GC7A 2VKIA 3HW2B 2EC1A 1LB1A 1OY2A 2P0DA 3O96A 3X23A 4ZRIA 4F7GA 4GPTB 2MWNB 2YRYA 1KZ7A 1P6SA 3TO1A 5JHHA 3CXBB 3KY9A 1WJ1A 2DX5A 4HAUB 3LJUX 4A6FB 4IFSA 1MIXA 2L2IA 2LOZA 3SYXA 2DHJA 3PG7A 5J3YA 4EMOA 1QC6A 2I5FA 4DBBA 2YT1A 3VOQA 4TKNA 2JP2A 2R09A 2Y7BA 3D8EA 3GYOA 2N0YA 1N3HA 2OQBA 2MKRA 1Y19B 5CLLB 2DN6A 3PEGA 1XX0A 3OANA 4HB2B 2QKLA 1P3RA 1KZGA 1NTVA 3SV1A 4Z2MB 5GOWB 2YSZA 4WSFA 4DXAB 3ODOA 3F0WA 2GS0A 3D8FA 2I1JA 2FJLA 2AEHA 4B6HA 4HB0B 1I2HA 2L1CA 2QKMA 5D3YA 3TFMA 1EGXA 1V89A 1FOEA 4K2PA 3A98B 1V5PA 2K00A 2J0MA 2Y8GA 3V5WA 4IAPA 3KSYA 3DXDA 4K2OA 1WI1A 4K17A 1TXDA 3PVLA 1U5FA 4HAZB 2VRWB 1SGHA 4P7IA 2DLWA 4DX90 2DYQA 2P8VA 2D9XA 4XWXA 2D4QA 1Y5OA 3WYFB 1RRPB 3DXEA 3G9WA 4IOYX 2EJ8A 5DH9B 3UZTA 3AJ4A 2ZPYA 3PSCA 4WVFB 1X1FA 2D9VA 4CHJA 1BAKA 1NU2A 2KCJA 1H10A 1GG3A 1U2BA 3U8ZA 4KVGB 2J0KA 5L81A 2CAYA 1SHCA 1WG7A 5JLJB 2RNRB 4C0AA 1V61A 1V88A 2M38A 1MKEA 4A6KA 1FHXA 4DX8A 2COCA 5C5BA 1QQGA 2PZ1A 3PVUA 2I5CA 4D0NB 1TQZA 2DFKA 4F7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PFJ A;  4GMX B;  5D3V A;  4GN1 A;  3SUZ A;  4TYZ A;  2UZR A;  1BTK A;  1ZSQ A;  2DKP A;  2IFS A;  2V76 A;  2CY4 A;  5C79 A;  5DIF B;  2YS1 A;  1W1D A;  2P0F A;  4HB4 B;  1WJM A;  1FAO A;  4HDQ A;  5C6R A;  2Z0Q A;  2I1K A;  1AWE A;  2DHI A;  4CHM A;  5DHF B;  3ULC A;  5J3T A;  1X05 A;  1MK7 B;  2COA A;  2MDX A;  3KRX A;  4YON A;  4CYE A;  2RVB B;  4GXB A;  2DHK A;  4KAX B;  3NSU A;  1UPR A;  5D27 A;  1U29 A;  1WVH A;  4MK0 A;  1V5U A;  1MIZ B;  5HE1 A;  3TW1 A;  1DDW A;  2NMB A;  2ROZ B;  5DHA B;  1MAI A;  2GCJ A;  5LOP B;  1XCG A;  3N7C A;  2Y8F A;  4HAV B;  1NI2 A;  3AU4 A;  2LKO A;  1DDM A;  1X11 A;  2K2J A;  1ZM0 A;  1DYN A;  1J0W A;  1DBH A;  3CIK A;  1KI1 B;  5D3W A;  2KGX B;  2D10 A;  5KQ4 A;  1H4R A;  3KZ1 A;  1Z87 A;  3QBV B;  4A5K A;  2E2X A;  4HAY B;  2ELA A;  2D9Y A;  3PZD A;  4L6E A;  1ZC4 B;  3BIN A;  3TVV A;  5LON B;  1OQN A;  2UZS A;  2DTC A;  5D3X A;  4PNK A;  1M7R A;  1WGU A;  2H7D A;  3IVF A;  4ZRJ A;  3BJI A;  2EMT A;  2ROV A;  4EJN A;  2YS5 A;  2COD A;  3DXC A;  2AL6 A;  2G35 A;  1XD4 A;  1I7A A;  5FI0 A;  3F5R A;  3FM8 C;  2W2X D;  1K5D B;  5HE2 A;  1XKE A;  2CY5 A;  4KHB B;  1DDV A;  1Q67 A;  1W1H A;  4KHO A;  4Z2N A;  2CRF A;  5KCV A;  3SO6 A;  1ISN A;  2HTH B;  2XQN M;  1X1G A;  3T06 A;  2X18 A;  2RLO A;  1PMS A;  4HDO A;  2VSZ A;  1EF1 A;  2GJY A;  4A6F A;  3MPX A;  3HK0 A;  2DYN A;  2LOX A;  5JHG A;  1W1G A;  2COF A;  1FHO A;  1AQC A;  3D8D A;  2YS3 A;  1FHW A;  1U27 A;  2W2X C;  5CLQ B;  3FSS A;  5EFX A;  1RJ2 A;  2D2Q A;  2EMS A;  3TCA A;  4HAX B;  4HHV A;  3P7Z A;  4F7U P;  1IRS A;  2IYB A;  2YT0 A;  5J3Q A;  2J59 M;  4H8S A;  1UNQ A;  2UVM A;  2YF0 A;  4MY6 A;  2HE7 A;  3MDB C;  2D9Z A;  1E5W A;  3ODX A;  4YL8 A;  3SNH A;  1BWN A;  2D9W A;  2Z0P A;  1EAZ A;  2RGN B;  4K81 A;  3ULB A;  5C5B B;  1UNP A;  3U7D A;  2LUL A;  1EVH A;  2YVC A;  4BBK A;  3ZVR A;  1B55 A;  2BCJ A;  3ODW A;  2NZ8 B;  5HE3 A;  1UEF A;  4EKU A;  3PVW A;  3HQC A;  2MFQ A;  3WA0 A;  1MPH A;  3PP2 A;  4GMV A;  1V5M A;  3AU5 A;  2RSG A;  1U5G A;  2Q13 A;  4HB3 B;  1FGY A;  1X86 A;  2OTX A;  2LG1 A;  2ADZ A;  1XR0 B;  2D11 A;  3GYP A;  5C16 A;  3FEH A;  2DX1 A;  3KRW A;  3RCP A;  5DI9 B;  4MT7 A;  2J0J A;  5JP4 A;  1FGZ A;  3A8Q A;  2RUK B;  1ZC3 B;  2Z0O A;  1WGQ A;  2DKQ A;  3P6A A;  1U5E A;  3QWM A;  1NTY A;  3VIA A;  4GZU A;  1BTN A;  2P0H A;  5KQ1 A;  2M14 A;  3QIJ A;  1DRO A;  2DA0 A;  5HE0 A;  4HAT B;  2K2U A;  2N23 A;  1P5T A;  4A6H A;  4WJ7 A;  1K5G B;  2H7E A;  4ZRK A;  2KUP A;  1MK9 B;  4HAW B;  1LW3 A;  1OMW A;  1M7E A;  4NSW A;  1GC6 A;  1U5D A;  1UPQ A;  4KHA A;  1PLS A;  1J19 A;  2ELB A;  4PQ0 A;  3A8P A;  4Y94 A;  1ZVR A;  3M1I B;  1XOD A;  1UNR A;  3ZDT A;  1FB8 A;  2LYD A;  5FI1 A;  3ML4 A;  2W2W A;  2R0D A;  2GCL A;  4NY0 A;  1TJ6 A;  1GC7 A;  2VKI A;  3HW2 B;  2EC1 A;  1LB1 A;  1OY2 A;  2P0D A;  3O96 A;  3X23 A;  4ZRI A;  4F7G A;  4GPT B;  2MWN B;  2YRY A;  1KZ7 A;  1P6S A;  3TO1 A;  5JHH A;  3CXB B;  3KY9 A;  1WJ1 A;  2DX5 A;  4HAU B;  3LJU X;  4A6F B;  4IFS A;  1MIX A;  2L2I A;  2LOZ A;  3SYX A;  2DHJ A;  3PG7 A;  5J3Y A;  4EMO A;  1QC6 A;  2I5F A;  4DBB A;  2YT1 A;  3VOQ A;  4TKN A;  2JP2 A;  2R09 A;  2Y7B A;  3D8E A;  3GYO A;  2N0Y A;  1N3H A;  2OQB A;  2MKR A;  1Y19 B;  5CLL B;  2DN6 A;  3PEG A;  1XX0 A;  3OAN A;  4HB2 B;  2QKL A;  1P3R A;  1KZG A;  1NTV A;  3SV1 A;  4Z2M B;  5GOW B;  2YSZ A;  4WSF A;  4DXA B;  3ODO A;  3F0W A;  2GS0 A;  3D8F A;  2I1J A;  2FJL A;  2AEH A;  4B6H A;  4HB0 B;  1I2H A;  2L1C A;  2QKM A;  5D3Y A;  3TFM A;  1EGX A;  1V89 A;  1FOE A;  4K2P A;  3A98 B;  1V5P A;  2K00 A;  2J0M A;  2Y8G A;  3V5W A;  4IAP A;  3KSY A;  3DXD A;  4K2O A;  1WI1 A;  4K17 A;  1TXD A;  3PVL A;  1U5F A;  4HAZ B;  2VRW B;  1SGH A;  4P7I A;  2DLW A;  4DX9 0;  2DYQ A;  2P8V A;  2D9X A;  4XWX A;  2D4Q A;  1Y5O A;  3WYF B;  1RRP B;  3DXE A;  3G9W A;  4IOY X;  2EJ8 A;  5DH9 B;  3UZT A;  3AJ4 A;  2ZPY A;  3PSC A;  4WVF B;  1X1F A;  2D9V A;  4CHJ A;  1BAK A;  1NU2 A;  2KCJ A;  1H10 A;  1GG3 A;  1U2B A;  3U8Z A;  4KVG B;  2J0K A;  5L81 A;  2CAY A;  1SHC A;  1WG7 A;  5JLJ B;  2RNR B;  4C0A A;  1V61 A;  1V88 A;  2M38 A;  1MKE A;  4A6K A;  1FHX A;  4DX8 A;  2COC A;  5C5B A;  1QQG A;  2PZ1 A;  3PVU A;  2I5C A;  4D0N B;  1TQZ A;  2DFK A;  4F7H A; 
#chains in the Genus database with same CATH topology
 1PFJ A;  4GMX B;  3U12 A;  5D3V A;  4GN1 A;  3SUZ A;  4TYZ A;  2UZR A;  1BTK A;  1ZSQ A;  2DKP A;  2IFS A;  5LG4 B;  2V76 A;  2CY4 A;  5C79 A;  5DIF B;  2YS1 A;  1W1D A;  2P0F A;  4HB4 B;  1WJM A;  1FAO A;  4HDQ A;  5C6R A;  2Z0Q A;  3OHM B;  2I1K A;  1AWE A;  2DHI A;  4CHM A;  5DHF B;  3ULC A;  5J3T A;  1X05 A;  1T77 A;  1MK7 B;  2COA A;  2MDX A;  3KRX A;  4YON A;  2K49 A;  4CYE A;  2RVB B;  4GXB A;  2DHK A;  4KAX B;  3NSU A;  1UPR A;  2Z59 A;  5D27 A;  1U29 A;  1WVH A;  4MK0 A;  1V5U A;  1MIZ B;  5HE1 A;  3TW1 A;  1DDW A;  2Z4D A;  2NMB A;  5M4Y B;  2ROZ B;  5DHA B;  1MAI A;  2GCJ A;  5LOP B;  1XCG A;  3N7C A;  2Y8F A;  4HAV B;  1NI2 A;  3AU4 A;  2LKO A;  1DDM A;  1X11 A;  2K2J A;  1ZM0 A;  4DIX A;  1DYN A;  1J0W A;  1DBH A;  3CIK A;  1KI1 B;  4OSN A;  5D3W A;  2KGX B;  2D10 A;  5KQ4 A;  1H4R A;  3KZ1 A;  1Z87 A;  3QBV B;  4A5K A;  2E2X A;  4HAY B;  2ELA A;  2D9Y A;  3PZD A;  4L6E A;  1ZC4 B;  3BIN A;  3TVV A;  5LON B;  1OQN A;  2UZS A;  2DTC A;  5D3X A;  4PNK A;  1M7R A;  1WGU A;  2H7D A;  3IVF A;  4ZRJ A;  3BJI A;  2EMT A;  2ROV A;  4EJN A;  2YS5 A;  2COD A;  3DXC A;  2AL6 A;  3DCX A;  2G35 A;  3NWA A;  1XD4 A;  1I7A A;  5FI0 A;  3F5R A;  3FM8 C;  2W2X D;  1K5D B;  5HE2 A;  1XKE A;  2CY5 A;  4KHB B;  1DDV A;  1Q67 A;  1W1H A;  4KHO A;  2KUQ A;  4Z2N A;  2CRF A;  5KCV A;  3SO6 A;  1ISN A;  2HTH B;  2XQN M;  1X1G A;  3A58 A;  3T06 A;  2X18 A;  2RLO A;  1PMS A;  5IRS A;  4HDO A;  2VSZ A;  1EF1 A;  1ZYI A;  2GJY A;  4A6F A;  3MPX A;  3HK0 A;  2DYN A;  2ZKM X;  2LOX A;  5JHG A;  1W1G A;  2COF A;  1FHO A;  1AQC A;  3D8D A;  2YS3 A;  1FHW A;  1U27 A;  2W2X C;  5CLQ B;  3FSS A;  5EFX A;  1RJ2 A;  2D2Q A;  2EMS A;  3TCA A;  4HAX B;  2GUM A;  4HHV A;  3P7Z A;  4F7U P;  1IRS A;  2IYB A;  2YT0 A;  5J3Q A;  2J59 M;  4H8S A;  1UNQ A;  2UVM A;  4QJ3 B;  2YF0 A;  4MY6 A;  2HE7 A;  3MDB C;  2D9Z A;  1E5W A;  3ODX A;  4YL8 A;  3SNH A;  1BWN A;  2D9W A;  2Z0P A;  1EAZ A;  2RGN B;  4K81 A;  3ULB A;  5C5B B;  1UNP A;  3U7D A;  2LUL A;  2KIE A;  1EVH A;  2YVC A;  4BBK A;  3ZVR A;  1B55 A;  2BCJ A;  3ODW A;  2NZ8 B;  5HE3 A;  1UEF A;  4EKU A;  3PVW A;  3B77 A;  3HQC A;  2MFQ A;  3WA0 A;  1MPH A;  3PP2 A;  4GMV A;  1V5M A;  3AU5 A;  2RSG A;  1U5G A;  2Q13 A;  4HB3 B;  1FGY A;  1X86 A;  2OTX A;  2LG1 A;  2ADZ A;  1XR0 B;  2D11 A;  3GYP A;  5C16 A;  3FEH A;  4HSI A;  2DX1 A;  2KR0 A;  3KRW A;  3RCP A;  5DI9 B;  4D6W A;  3HIE A;  4MT7 A;  2J0J A;  5JP4 A;  1FGZ A;  3A8Q A;  2RUK B;  1ZC3 B;  2Z0O A;  1WGQ A;  2DKQ A;  3P6A A;  4KHB A;  1U5E A;  3QWM A;  1NTY A;  5I2S A;  3VIA A;  4GZU A;  1BTN A;  2P0H A;  5KQ1 A;  2M14 A;  3QIJ A;  1DRO A;  2DA0 A;  5HE0 A;  4L1R A;  4HAT B;  2K2U A;  2N23 A;  1P5T A;  4A6H A;  4WJ7 A;  1K5G B;  2KIG A;  2H7E A;  4ZRK A;  2KUP A;  1MK9 B;  4HAW B;  1LW3 A;  1OMW A;  1M7E A;  4NSW A;  1GC6 A;  3NWD A;  1U5D A;  1UPQ A;  4KHA A;  1PLS A;  1J19 A;  4GOU A;  2ELB A;  4PQ0 A;  3A8P A;  4Y94 A;  1ZVR A;  3M1I B;  3HSA A;  1XOD A;  1UNR A;  4GNK B;  3ZDT A;  1FB8 A;  2LYD A;  5FI1 A;  3ML4 A;  2W2W A;  2R0D A;  2GCL A;  4NY0 A;  1TJ6 A;  1GC7 A;  2VKI A;  3HW2 B;  2EC1 A;  1LB1 A;  1OY2 A;  2P0D A;  3O96 A;  3X23 A;  3FVC A;  4ZRI A;  4F7G A;  4GPT B;  2MWN B;  2YRY A;  1KZ7 A;  1P6S A;  3TO1 A;  5JHH A;  3CXB B;  3KY9 A;  1WJ1 A;  2DX5 A;  4HAU B;  3LJU X;  4A6F B;  4IFS A;  2Z14 A;  1MIX A;  2L2I A;  2Z13 A;  2LOZ A;  3SYX A;  2DHJ A;  3PG7 A;  5J3Y A;  4EMO A;  1QC6 A;  2I5F A;  4DBB A;  2YT1 A;  4OT1 A;  3VOQ A;  4TKN A;  2JP2 A;  2R09 A;  2Y7B A;  5I2M A;  3D8E A;  3GYO A;  2N0Y A;  1N3H A;  2OQB A;  2MKR A;  1Y19 B;  5CLL B;  2DN6 A;  3PEG A;  1XX0 A;  3OAN A;  4HB2 B;  4QJ5 B;  2QKL A;  1P3R A;  1KZG A;  1NTV A;  2K8E A;  3SV1 A;  4Z2M B;  5GOW B;  4QXA B;  4QJ4 B;  2YSZ A;  4WSF A;  2YT2 A;  4DXA B;  3ODO A;  3NWF A;  3F0W A;  2GS0 A;  3D8F A;  2I1J A;  4CSQ A;  2FJL A;  2AEH A;  4B6H A;  4HB0 B;  1I2H A;  2L1C A;  2QKM A;  5D3Y A;  3TFM A;  1EGX A;  1V89 A;  1FOE A;  4K2P A;  3A98 B;  1V5P A;  2K00 A;  2J0M A;  2Y8G A;  3V5W A;  4IAP A;  3KSY A;  3DXD A;  4K2O A;  1WI1 A;  4K17 A;  1TXD A;  2FJU B;  3PVL A;  1U5F A;  4HAZ B;  2VRW B;  1SGH A;  4P7I A;  2DLW A;  4DX9 0;  2DYQ A;  2P8V A;  1MI1 A;  2D9X A;  4XWX A;  2D4Q A;  1Y5O A;  3WYF B;  1RRP B;  3DXE A;  3G9W A;  4IOY X;  2EJ8 A;  5DH9 B;  3UZT A;  3AJ4 A;  2ZPY A;  3PSC A;  4WVF B;  1X1F A;  2D9V A;  4CHJ A;  1BAK A;  2NBV A;  1NU2 A;  2RRF A;  2KCJ A;  1H10 A;  1GG3 A;  1U2B A;  3U8Z A;  4KVG B;  2J0K A;  5L81 A;  2CAY A;  1SHC A;  1WG7 A;  5JLJ B;  2RNR B;  4C0A A;  3NW8 A;  1V61 A;  1V88 A;  2M38 A;  1MKE A;  4A6K A;  1FHX A;  4DX8 A;  2COC A;  5C5B A;  1QQG A;  2PZ1 A;  3PVU A;  2I5C A;  4D0N B;  1TQZ A;  2R2Y A;  2DFK A;  4F7H A; 
#chains in the Genus database with same CATH homology
 1PFJ A;  4GMX B;  5D3V A;  4GN1 A;  3SUZ A;  4TYZ A;  2UZR A;  1BTK A;  1ZSQ A;  2DKP A;  2IFS A;  2V76 A;  2CY4 A;  5C79 A;  5DIF B;  2YS1 A;  1W1D A;  2P0F A;  4HB4 B;  1WJM A;  1FAO A;  4HDQ A;  5C6R A;  2Z0Q A;  2I1K A;  1AWE A;  2DHI A;  4CHM A;  5DHF B;  3ULC A;  5J3T A;  1X05 A;  1MK7 B;  2COA A;  2MDX A;  3KRX A;  4YON A;  4CYE A;  2RVB B;  4GXB A;  2DHK A;  4KAX B;  3NSU A;  1UPR A;  5D27 A;  1U29 A;  1WVH A;  4MK0 A;  1V5U A;  1MIZ B;  5HE1 A;  3TW1 A;  1DDW A;  2NMB A;  2ROZ B;  5DHA B;  1MAI A;  2GCJ A;  5LOP B;  1XCG A;  3N7C A;  2Y8F A;  4HAV B;  1NI2 A;  3AU4 A;  2LKO A;  1DDM A;  1X11 A;  2K2J A;  1ZM0 A;  1DYN A;  1J0W A;  1DBH A;  3CIK A;  1KI1 B;  5D3W A;  2KGX B;  2D10 A;  5KQ4 A;  1H4R A;  3KZ1 A;  1Z87 A;  3QBV B;  4A5K A;  2E2X A;  4HAY B;  2ELA A;  2D9Y A;  3PZD A;  4L6E A;  1ZC4 B;  3BIN A;  3TVV A;  5LON B;  1OQN A;  2UZS A;  2DTC A;  5D3X A;  4PNK A;  1M7R A;  1WGU A;  2H7D A;  3IVF A;  4ZRJ A;  3BJI A;  2EMT A;  2ROV A;  4EJN A;  2YS5 A;  2COD A;  3DXC A;  2AL6 A;  2G35 A;  1XD4 A;  1I7A A;  5FI0 A;  3F5R A;  3FM8 C;  2W2X D;  1K5D B;  5HE2 A;  1XKE A;  2CY5 A;  4KHB B;  1DDV A;  1Q67 A;  1W1H A;  4KHO A;  4Z2N A;  2CRF A;  5KCV A;  3SO6 A;  1ISN A;  2HTH B;  2XQN M;  1X1G A;  3T06 A;  2X18 A;  2RLO A;  1PMS A;  4HDO A;  2VSZ A;  1EF1 A;  2GJY A;  4A6F A;  3MPX A;  3HK0 A;  2DYN A;  2LOX A;  5JHG A;  1W1G A;  2COF A;  1FHO A;  1AQC A;  3D8D A;  2YS3 A;  1FHW A;  1U27 A;  2W2X C;  5CLQ B;  3FSS A;  5EFX A;  1RJ2 A;  2D2Q A;  2EMS A;  3TCA A;  4HAX B;  4HHV A;  3P7Z A;  4F7U P;  1IRS A;  2IYB A;  2YT0 A;  5J3Q A;  2J59 M;  4H8S A;  1UNQ A;  2UVM A;  2YF0 A;  4MY6 A;  2HE7 A;  3MDB C;  2D9Z A;  1E5W A;  3ODX A;  4YL8 A;  3SNH A;  1BWN A;  2D9W A;  2Z0P A;  1EAZ A;  2RGN B;  4K81 A;  3ULB A;  5C5B B;  1UNP A;  3U7D A;  2LUL A;  1EVH A;  2YVC A;  4BBK A;  3ZVR A;  1B55 A;  2BCJ A;  3ODW A;  2NZ8 B;  5HE3 A;  1UEF A;  4EKU A;  3PVW A;  3HQC A;  2MFQ A;  3WA0 A;  1MPH A;  3PP2 A;  4GMV A;  1V5M A;  3AU5 A;  2RSG A;  1U5G A;  2Q13 A;  4HB3 B;  1FGY A;  1X86 A;  2OTX A;  2LG1 A;  2ADZ A;  1XR0 B;  2D11 A;  3GYP A;  5C16 A;  3FEH A;  2DX1 A;  3KRW A;  3RCP A;  5DI9 B;  4MT7 A;  2J0J A;  5JP4 A;  1FGZ A;  3A8Q A;  2RUK B;  1ZC3 B;  2Z0O A;  1WGQ A;  2DKQ A;  3P6A A;  1U5E A;  3QWM A;  1NTY A;  3VIA A;  4GZU A;  1BTN A;  2P0H A;  5KQ1 A;  2M14 A;  3QIJ A;  1DRO A;  2DA0 A;  5HE0 A;  4HAT B;  2K2U A;  2N23 A;  1P5T A;  4A6H A;  4WJ7 A;  1K5G B;  2H7E A;  4ZRK A;  2KUP A;  1MK9 B;  4HAW B;  1LW3 A;  1OMW A;  1M7E A;  4NSW A;  1GC6 A;  1U5D A;  1UPQ A;  4KHA A;  1PLS A;  1J19 A;  2ELB A;  4PQ0 A;  3A8P A;  4Y94 A;  1ZVR A;  3M1I B;  1XOD A;  1UNR A;  3ZDT A;  1FB8 A;  2LYD A;  5FI1 A;  3ML4 A;  2W2W A;  2R0D A;  2GCL A;  4NY0 A;  1TJ6 A;  1GC7 A;  2VKI A;  3HW2 B;  2EC1 A;  1LB1 A;  1OY2 A;  2P0D A;  3O96 A;  3X23 A;  4ZRI A;  4F7G A;  4GPT B;  2MWN B;  2YRY A;  1KZ7 A;  1P6S A;  3TO1 A;  5JHH A;  3CXB B;  3KY9 A;  1WJ1 A;  2DX5 A;  4HAU B;  3LJU X;  4A6F B;  4IFS A;  1MIX A;  2L2I A;  2LOZ A;  3SYX A;  2DHJ A;  3PG7 A;  5J3Y A;  4EMO A;  1QC6 A;  2I5F A;  4DBB A;  2YT1 A;  3VOQ A;  4TKN A;  2JP2 A;  2R09 A;  2Y7B A;  3D8E A;  3GYO A;  2N0Y A;  1N3H A;  2OQB A;  2MKR A;  1Y19 B;  5CLL B;  2DN6 A;  3PEG A;  1XX0 A;  3OAN A;  4HB2 B;  2QKL A;  1P3R A;  1KZG A;  1NTV A;  3SV1 A;  4Z2M B;  5GOW B;  2YSZ A;  4WSF A;  4DXA B;  3ODO A;  3F0W A;  2GS0 A;  3D8F A;  2I1J A;  2FJL A;  2AEH A;  4B6H A;  4HB0 B;  1I2H A;  2L1C A;  2QKM A;  5D3Y A;  3TFM A;  1EGX A;  1V89 A;  1FOE A;  4K2P A;  3A98 B;  1V5P A;  2K00 A;  2J0M A;  2Y8G A;  3V5W A;  4IAP A;  3KSY A;  3DXD A;  4K2O A;  1WI1 A;  4K17 A;  1TXD A;  3PVL A;  1U5F A;  4HAZ B;  2VRW B;  1SGH A;  4P7I A;  2DLW A;  4DX9 0;  2DYQ A;  2P8V A;  2D9X A;  4XWX A;  2D4Q A;  1Y5O A;  3WYF B;  1RRP B;  3DXE A;  3G9W A;  4IOY X;  2EJ8 A;  5DH9 B;  3UZT A;  3AJ4 A;  2ZPY A;  3PSC A;  4WVF B;  1X1F A;  2D9V A;  4CHJ A;  1BAK A;  1NU2 A;  2KCJ A;  1H10 A;  1GG3 A;  1U2B A;  3U8Z A;  4KVG B;  2J0K A;  5L81 A;  2CAY A;  1SHC A;  1WG7 A;  5JLJ B;  2RNR B;  4C0A A;  1V61 A;  1V88 A;  2M38 A;  1MKE A;  4A6K A;  1FHX A;  4DX8 A;  2COC A;  5C5B A;  1QQG A;  2PZ1 A;  3PVU A;  2I5C A;  4D0N B;  1TQZ A;  2DFK A;  4F7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...