1J0WA

Crystal structure analysis of the dok-5 ptb domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
99
structure length
99
Chain Sequence
QSERFNVYLMPSPNLDVHGECALQITYEYICLWDVQNPRVKLISWPLSALRRYGRDTTWFTFEAGRMCETGEGLFIFQTRDGEAIYQKVHSAALAIAEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords downstream of tyrosine kinase 5
publication title Crystal Structure Analysis of the Dok-5 PTB Domain
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 18
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature ec 2.7.1.112: Transferred entry: 2.7.10.1 and 2.7.10.2.
pdb deposition date 2002-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02174 IRS PTB domain (IRS-1 type)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1j0wA00
2Z0QA 3A98B 1ZSQA 1WJMA 3PVWA 2AEHA 3KRXA 5D27A 4MT7A 3PG7A 4DX8A 1FOEA 2LG1A 3VIAA 2RGNB 5FI1A 4HDOA 4CHJA 3QWMA 1UEFA 1NTVA 2YS5A 3FM8C 4TKNA 1NI2A 2YF0A 5LOPB 2M14A 4Z2NA 2R0DA 2L1CA 4A6FA 2N0YA 1W1DA 2CODA 4KHOA 4D0NB 3BINA 2K00A 3A8QA 1QQGA 2D9YA 3O96A 3V5WA 2J59M 1OMWA 3NSUA 4GPTB 5EFXA 4K2OA 1BAKA 4KHAA 2RUKB 2G35A 1XODA 4HB4B 2DTCA 1U27A 5JHGA 1DROA 1LW3A 2Y8FA 4DX90 1H4RA 1V5MA 1N3HA 2DHKA 2EMTA 4EJNA 3G9WA 5CLQB 4K81A 1FHOA 4IOYX 1Y5OA 3TW1A 2CY4A 2Z0PA 5J3TA 1DYNA 4CHMA 1MPHA 1V61A 3AU5A 4HHVA 2UVMA 3QIJA 1XCGA 4HB2B 3U7DA 1ZC4B 1BTNA 2DFKA 2BCJA 4WJ7A 3TFMA 5JHHA 4WVFB 1BWNA 2YS1A 4GMXB 2MDXA 3OANA 4ZRKA 2YT1A 1I7AA 5J3QA 1U2BA 1K5GB 5GOWB 2CAYA 2RNRB 1UNPA 2X18A 1U5FA 3IVFA 2MKRA 4NY0A 1DDWA 5C5BB 1MAIA 2DYQA 2COFA 1B55A 1E5WA 3PSCA 1J19A 4DXAB 4HAVB 3CXBB 1X86A 4HAWB 1IRSA 3D8DA 2MFQA 2QKLA 3U8ZA 3SUZA 2COAA 2DHIA 4Z2MB 2CRFA 3D8FA 3UZTA 2VKIA 3F5RA 4KAXB 3BJIA 3CIKA 5KQ1A 4A5KA 4Y94A 2I5FA 1AWEA 2COCA 2D10A 2GJYA 2W2XC 3N7CA 1DDVA 3SYXA 5C16A 3QBVB 4H8SA 2I1JA 1X1GA 1QC6A 2DX1A 5CLLB 4F7GA 2GCLA 4DBBA 1WI1A 3ODOA 2W2WA 2D2QA 3ULCA 3GYPA 4K17A 5J3YA 1NTYA 5KQ4A 2H7EA 3SNHA 3WA0A 4MK0A 3HQCA 1P3RA 1DDMA 2RSGA 3HK0A 2J0JA 3FSSA 1I2HA 2DX5A 1UNRA 2I5CA 1FGYA 1WGUA 2D11A 5HE1A 3ODWA 3AU4A 5DH9B 2ZPYA 1SHCA 5DHFB 1K5DB 2D9WA 1XKEA 2DHJA 2HE7A 5JLJB 1V89A 4BBKA 2LULA 2UZRA 1LB1A 1M7EA 4HAZB 2I1KA 1OY2A 1PMSA 2V76A 5C6RA 2LYDA 4MY6A 1KI1B 1NU2A 2J0KA 5DHAB 1MIZB 2HTHB 3ULBA 2R09A 2QKMA 2YVCA 3HW2B 3PZDA 1FAOA 4YONA 1WG7A 3PVLA 2LOZA 1X05A 4A6KA 2NZ8B 2DA0A 2IYBA 2EC1A 1XR0B 3KY9A 2IFSA 1MK9B 2JP2A 4IAPA 1UPRA 5DI9B 2P8VA 4PQ0A 1U5DA 2Y7BA 2DKQA 5JP4A 2PZ1A 1M7RA 4B6HA 2ADZA 2P0FA 5C5BA 2D4QA 2J0MA 3AJ4A 2CY5A 2XQNM 5D3VA 3WYFB 1GC7A 1ISNA 4EKUA 4WSFA 5HE0A 5D3WA 2KCJA 3DXDA 4HAYB 2KUPA 3T06A 4L6EA 1ZVRA 3M1IB 2Y8GA 4C0AA 1RJ2A 5D3XA 2YT0A 4HDQA 1V5UA 5D3YA 4HB0B 2ROZB 3SO6A 1V5PA 1MKEA 4GN1A 4HB3B 4IFSA 2DKPA 3RCPA 4GZUA 1BTKA 2Q13A 1MK7B 4P7IA 5DIFB 3FEHA 2EJ8A 4ZRIA 1J0WA 2OQBA 2Z0OA 1ZM0A 4HAXB 4A6FB 1MIXA 4NSWA 1X11A 4CYEA 2RVBB 1U5EA 1XD4A 2YS3A 3ML4A 3TVVA 2GCJA 1KZ7A 3KZ1A 1Y19B 1W1HA 4ZRJA 1X1FA 1FB8A 1GC6A 5HE3A 4K2PA 2YSZA 2NMBA 1AQCA 3PP2A 4TYZA 4PNKA 4EMOA 1EVHA 2VSZA 5LONB 2ELBA 3LJUX 3X23A 1PFJA 1XX0A 3DXCA 2E2XA 1Z87A 2P0DA 2ELAA 2EMSA 4F7UP 3P7ZA 2K2JA 1FGZA 1OQNA 1TJ6A 3DXEA 2K2UA 3VOQA 3ZVRA 2D9XA 2DYNA 2OTXA 3ODXA 1W1GA 2UZSA 1EF1A 3A8PA 2YRYA 4HAUB 3D8EA 1EAZA 1SGHA 1V88A 2ROVA 3PEGA 1FHXA 1FHWA 1PLSA 2GS0A 3F0WA 5C79A 2D9VA 4YL8A 3KSYA 1Q67A 1KZGA 2H7DA 3KRWA 2L2IA 1TXDA 1RRPB 5KCVA 1TQZA 1WVHA 4F7HA 2LOXA 1P5TA 2FJLA 1UPQA 4A6HA 1H10A 2D9ZA 4GXBA 1DBHA 3ZDTA 5L81A 1U29A 2RLOA 1GG3A 1WGQA 2W2XD 3P6AA 4HATB 2LKOA 2DN6A 4KHBB 2M38A 4XWXA 2DLWA 3TO1A 1UNQA 2MWNB 3SV1A 2KGXB 1P6SA 3MPXA 1WJ1A 2P0HA 1EGXA 5FI0A 1ZC3B 1U5GA 3GYOA 2VRWB 4GMVA 5HE2A 2N23A 4KVGB 3TCAA 2AL6A 3MDBC 3PVUA
chains in the Genus database with same CATH superfamily
2Z4DA 2Z0QA 3A98B 1ZSQA 1WJMA 3PVWA 2AEHA 3KRXA 5D27A 2NBVA 4MT7A 3PG7A 4DX8A 1FOEA 2LG1A 3VIAA 2RGNB 5FI1A 4HDOA 4CHJA 3QWMA 4GOUA 1UEFA 1NTVA 3FM8C 2YS5A 4TKNA 1NI2A 2YF0A 5LOPB 2M14A 4Z2NA 2R0DA 2L1CA 4A6FA 2N0YA 1W1DA 3HSAA 2CODA 4KHOA 4D0NB 3BINA 3OHMB 2K00A 3A8QA 1QQGA 2D9YA 3O96A 3V5WA 2J59M 1OMWA 3NSUA 4GPTB 5EFXA 3NWDA 4K2OA 4DIXA 1BAKA 4KHAA 2RUKB 2RRFA 2G35A 1XODA 4HB4B 2DTCA 1U27A 5JHGA 1DROA 1LW3A 2Y8FA 4DX90 1H4RA 1V5MA 4OT1A 1N3HA 2DHKA 2EMTA 3FVCA 4EJNA 3G9WA 5CLQB 4K81A 1FHOA 4IOYX 1Y5OA 3TW1A 2CY4A 2Z0PA 5J3TA 1DYNA 4CHMA 1MPHA 1V61A 3NWFA 3AU5A 4HHVA 2UVMA 3QIJA 1XCGA 4HB2B 3U7DA 1ZC4B 1BTNA 2DFKA 2BCJA 4WJ7A 3TFMA 5JHHA 4WVFB 1BWNA 2YS1A 4GMXB 2MDXA 3OANA 4ZRKA 2YT1A 1I7AA 3U12A 5J3QA 1U2BA 1K5GB 5GOWB 3NWAA 2CAYA 2RNRB 1UNPA 2X18A 1U5FA 3IVFA 2MKRA 4NY0A 1DDWA 5C5BB 1MAIA 2DYQA 2COFA 1B55A 1E5WA 3PSCA 2Z13A 1J19A 4DXAB 4HAVB 4GNKB 3CXBB 1X86A 2KUQA 4HAWB 2KIGA 1IRSA 3D8DA 2MFQA 2QKLA 3U8ZA 2Z59A 3SUZA 2COAA 2DHIA 4Z2MB 2CRFA 3D8FA 3UZTA 2YT2A 2VKIA 3F5RA 4KAXB 3BJIA 3CIKA 5KQ1A 4A5KA 4Y94A 2I5FA 1AWEA 2ZKMX 2COCA 2D10A 2KR0A 2GJYA 2W2XC 2K49A 1DDVA 3N7CA 3SYXA 5C16A 3QBVB 4H8SA 2I1JA 1X1GA 1QC6A 2DX1A 5CLLB 5I2SA 4F7GA 2GCLA 4DBBA 1WI1A 3ODOA 2W2WA 2D2QA 3ULCA 3GYPA 4K17A 5J3YA 1NTYA 5KQ4A 3HIEA 1MI1A 2H7EA 4OSNA 3SNHA 3WA0A 4MK0A 3HQCA 1P3RA 2K8EA 1DDMA 3NW8A 2RSGA 1ZYIA 3HK0A 2J0JA 3FSSA 1I2HA 2DX5A 1UNRA 2I5CA 1FGYA 1WGUA 2D11A 5HE1A 3ODWA 3AU4A 5DH9B 2ZPYA 1SHCA 5DHFB 1K5DB 2D9WA 1XKEA 2DHJA 2HE7A 2FJUB 5JLJB 1V89A 4BBKA 2LULA 2UZRA 1LB1A 1M7EA 4HAZB 2KIEA 2I1KA 1OY2A 1PMSA 2V76A 5C6RA 2LYDA 4MY6A 1KI1B 1NU2A 2J0KA 5DHAB 1MIZB 4L1RA 2HTHB 3ULBA 2R09A 2QKMA 2YVCA 3HW2B 3PZDA 1FAOA 4YONA 1T77A 1WG7A 3PVLA 2LOZA 1X05A 4A6KA 2NZ8B 2DA0A 2IYBA 2EC1A 1XR0B 3KY9A 2IFSA 1MK9B 2JP2A 4IAPA 1UPRA 5DI9B 2P8VA 3A58A 1U5DA 4PQ0A 2Y7BA 2DKQA 5JP4A 2PZ1A 1M7RA 4B6HA 2ADZA 2P0FA 5C5BA 2D4QA 4KHBA 2J0MA 3AJ4A 2CY5A 2XQNM 4QJ3B 5D3VA 3WYFB 1GC7A 1ISNA 2GUMA 4WSFA 5HE0A 4EKUA 5D3WA 2KCJA 3DXDA 4HAYB 2KUPA 3T06A 4L6EA 1ZVRA 3M1IB 2Y8GA 4C0AA 1RJ2A 5D3XA 3B77A 2YT0A 4HDQA 5I2MA 1V5UA 5D3YA 4HB0B 2ROZB 3SO6A 1V5PA 1MKEA 4GN1A 4HB3B 4IFSA 3DCXA 2DKPA 3RCPA 4GZUA 1BTKA 2Q13A 1MK7B 4P7IA 5DIFB 3FEHA 2EJ8A 4ZRIA 1J0WA 2OQBA 2Z0OA 1ZM0A 4HAXB 4A6FB 1MIXA 4NSWA 1X11A 4CYEA 2RVBB 1U5EA 1XD4A 5IRSA 2YS3A 3ML4A 3TVVA 2GCJA 1KZ7A 3KZ1A 1Y19B 4QXAB 1W1HA 4ZRJA 1X1FA 1FB8A 1GC6A 5HE3A 4K2PA 2YSZA 2NMBA 1AQCA 3PP2A 4TYZA 4PNKA 4EMOA 1EVHA 2VSZA 5LONB 2ELBA 3LJUX 5M4YB 3X23A 1PFJA 1XX0A 3DXCA 2E2XA 1Z87A 5LG4B 2P0DA 2ELAA 4D6WA 2EMSA 4F7UP 3P7ZA 2K2JA 1FGZA 1OQNA 1TJ6A 3DXEA 2K2UA 3VOQA 3ZVRA 2D9XA 2DYNA 2OTXA 3ODXA 1W1GA 2UZSA 1EF1A 3A8PA 2YRYA 4HAUB 3D8EA 1EAZA 1SGHA 1V88A 2ROVA 3PEGA 1FHXA 1FHWA 1PLSA 2GS0A 3F0WA 5C79A 2D9VA 4YL8A 3KSYA 1Q67A 1KZGA 2H7DA 3KRWA 2R2YA 2L2IA 1TXDA 1RRPB 5KCVA 1TQZA 1WVHA 4F7HA 2LOXA 1P5TA 2FJLA 1UPQA 4A6HA 1H10A 4QJ5B 2D9ZA 4GXBA 1DBHA 3ZDTA 5L81A 4QJ4B 1U29A 2RLOA 1GG3A 1WGQA 2W2XD 3P6AA 4HATB 2LKOA 2DN6A 4KHBB 2M38A 4XWXA 2DLWA 4HSIA 3TO1A 1UNQA 2MWNB 3SV1A 2KGXB 1P6SA 3MPXA 1WJ1A 2P0HA 4CSQA 1EGXA 5FI0A 1ZC3B 1U5GA 3GYOA 2VRWB 4GMVA 5HE2A 2Z14A 2N23A 4KVGB 3TCAA 2AL6A 3MDBC 3PVUA
chains in the Genus database with same CATH topology
2Z0QA 3A98B 1ZSQA 1WJMA 3PVWA 2AEHA 3KRXA 5D27A 4MT7A 3PG7A 4DX8A 1FOEA 2LG1A 3VIAA 2RGNB 5FI1A 4HDOA 4CHJA 3QWMA 1UEFA 1NTVA 2YS5A 3FM8C 4TKNA 1NI2A 2YF0A 5LOPB 2M14A 4Z2NA 2R0DA 2L1CA 4A6FA 2N0YA 1W1DA 2CODA 4KHOA 4D0NB 3BINA 2K00A 3A8QA 1QQGA 2D9YA 3O96A 3V5WA 2J59M 1OMWA 3NSUA 4GPTB 5EFXA 4K2OA 1BAKA 4KHAA 2RUKB 2G35A 1XODA 4HB4B 2DTCA 1U27A 5JHGA 1DROA 1LW3A 2Y8FA 4DX90 1H4RA 1V5MA 1N3HA 2DHKA 2EMTA 4EJNA 3G9WA 5CLQB 4K81A 1FHOA 4IOYX 1Y5OA 3TW1A 2CY4A 2Z0PA 5J3TA 1DYNA 4CHMA 1MPHA 1V61A 3AU5A 4HHVA 2UVMA 3QIJA 1XCGA 4HB2B 3U7DA 1ZC4B 1BTNA 2DFKA 2BCJA 4WJ7A 3TFMA 5JHHA 4WVFB 1BWNA 2YS1A 4GMXB 2MDXA 3OANA 4ZRKA 2YT1A 1I7AA 5J3QA 1U2BA 1K5GB 5GOWB 2CAYA 2RNRB 1UNPA 2X18A 1U5FA 3IVFA 2MKRA 4NY0A 1DDWA 5C5BB 1MAIA 2DYQA 2COFA 1B55A 1E5WA 3PSCA 1J19A 4DXAB 4HAVB 3CXBB 1X86A 4HAWB 1IRSA 3D8DA 2MFQA 2QKLA 3U8ZA 3SUZA 2COAA 2DHIA 4Z2MB 2CRFA 3D8FA 3UZTA 2VKIA 3F5RA 4KAXB 3BJIA 3CIKA 5KQ1A 4A5KA 4Y94A 2I5FA 1AWEA 2COCA 2D10A 2GJYA 2W2XC 3N7CA 1DDVA 3SYXA 5C16A 3QBVB 4H8SA 2I1JA 1X1GA 1QC6A 2DX1A 5CLLB 4F7GA 2GCLA 4DBBA 1WI1A 3ODOA 2W2WA 2D2QA 3ULCA 3GYPA 4K17A 5J3YA 1NTYA 5KQ4A 2H7EA 3SNHA 3WA0A 4MK0A 3HQCA 1P3RA 1DDMA 2RSGA 3HK0A 2J0JA 3FSSA 1I2HA 2DX5A 1UNRA 2I5CA 1FGYA 1WGUA 2D11A 5HE1A 3ODWA 3AU4A 5DH9B 2ZPYA 1SHCA 5DHFB 1K5DB 2D9WA 1XKEA 2DHJA 2HE7A 5JLJB 1V89A 4BBKA 2LULA 2UZRA 1LB1A 1M7EA 4HAZB 2I1KA 1OY2A 1PMSA 2V76A 5C6RA 2LYDA 4MY6A 1KI1B 1NU2A 2J0KA 5DHAB 1MIZB 2HTHB 3ULBA 2R09A 2QKMA 2YVCA 3HW2B 3PZDA 1FAOA 4YONA 1WG7A 3PVLA 2LOZA 1X05A 4A6KA 2NZ8B 2DA0A 2IYBA 2EC1A 1XR0B 3KY9A 2IFSA 1MK9B 2JP2A 4IAPA 1UPRA 5DI9B 2P8VA 4PQ0A 1U5DA 2Y7BA 2DKQA 5JP4A 2PZ1A 1M7RA 4B6HA 2ADZA 2P0FA 5C5BA 2D4QA 2J0MA 3AJ4A 2CY5A 2XQNM 5D3VA 3WYFB 1GC7A 1ISNA 4EKUA 4WSFA 5HE0A 5D3WA 2KCJA 3DXDA 4HAYB 2KUPA 3T06A 4L6EA 1ZVRA 3M1IB 2Y8GA 4C0AA 1RJ2A 5D3XA 2YT0A 4HDQA 1V5UA 5D3YA 4HB0B 2ROZB 3SO6A 1V5PA 1MKEA 4GN1A 4HB3B 4IFSA 2DKPA 3RCPA 4GZUA 1BTKA 2Q13A 1MK7B 4P7IA 5DIFB 3FEHA 2EJ8A 4ZRIA 1J0WA 2OQBA 2Z0OA 1ZM0A 4HAXB 4A6FB 1MIXA 4NSWA 1X11A 4CYEA 2RVBB 1U5EA 1XD4A 2YS3A 3ML4A 3TVVA 2GCJA 1KZ7A 3KZ1A 1Y19B 1W1HA 4ZRJA 1X1FA 1FB8A 1GC6A 5HE3A 4K2PA 2YSZA 2NMBA 1AQCA 3PP2A 4TYZA 4PNKA 4EMOA 1EVHA 2VSZA 5LONB 2ELBA 3LJUX 3X23A 1PFJA 1XX0A 3DXCA 2E2XA 1Z87A 2P0DA 2ELAA 2EMSA 4F7UP 3P7ZA 2K2JA 1FGZA 1OQNA 1TJ6A 3DXEA 2K2UA 3VOQA 3ZVRA 2D9XA 2DYNA 2OTXA 3ODXA 1W1GA 2UZSA 1EF1A 3A8PA 2YRYA 4HAUB 3D8EA 1EAZA 1SGHA 1V88A 2ROVA 3PEGA 1FHXA 1FHWA 1PLSA 2GS0A 3F0WA 5C79A 2D9VA 4YL8A 3KSYA 1Q67A 1KZGA 2H7DA 3KRWA 2L2IA 1TXDA 1RRPB 5KCVA 1TQZA 1WVHA 4F7HA 2LOXA 1P5TA 2FJLA 1UPQA 4A6HA 1H10A 2D9ZA 4GXBA 1DBHA 3ZDTA 5L81A 1U29A 2RLOA 1GG3A 1WGQA 2W2XD 3P6AA 4HATB 2LKOA 2DN6A 4KHBB 2M38A 4XWXA 2DLWA 3TO1A 1UNQA 2MWNB 3SV1A 2KGXB 1P6SA 3MPXA 1WJ1A 2P0HA 1EGXA 5FI0A 1ZC3B 1U5GA 3GYOA 2VRWB 4GMVA 5HE2A 2N23A 4KVGB 3TCAA 2AL6A 3MDBC 3PVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z0Q A;  3A98 B;  1ZSQ A;  1WJM A;  3PVW A;  2AEH A;  3KRX A;  5D27 A;  4MT7 A;  3PG7 A;  4DX8 A;  1FOE A;  2LG1 A;  3VIA A;  2RGN B;  5FI1 A;  4HDO A;  4CHJ A;  3QWM A;  1UEF A;  1NTV A;  2YS5 A;  3FM8 C;  4TKN A;  1NI2 A;  2YF0 A;  5LOP B;  2M14 A;  4Z2N A;  2R0D A;  2L1C A;  4A6F A;  2N0Y A;  1W1D A;  2COD A;  4KHO A;  4D0N B;  3BIN A;  2K00 A;  3A8Q A;  1QQG A;  2D9Y A;  3O96 A;  3V5W A;  2J59 M;  1OMW A;  3NSU A;  4GPT B;  5EFX A;  4K2O A;  1BAK A;  4KHA A;  2RUK B;  2G35 A;  1XOD A;  4HB4 B;  2DTC A;  1U27 A;  5JHG A;  1DRO A;  1LW3 A;  2Y8F A;  4DX9 0;  1H4R A;  1V5M A;  1N3H A;  2DHK A;  2EMT A;  4EJN A;  3G9W A;  5CLQ B;  4K81 A;  1FHO A;  4IOY X;  1Y5O A;  3TW1 A;  2CY4 A;  2Z0P A;  5J3T A;  1DYN A;  4CHM A;  1MPH A;  1V61 A;  3AU5 A;  4HHV A;  2UVM A;  3QIJ A;  1XCG A;  4HB2 B;  3U7D A;  1ZC4 B;  1BTN A;  2DFK A;  2BCJ A;  4WJ7 A;  3TFM A;  5JHH A;  4WVF B;  1BWN A;  2YS1 A;  4GMX B;  2MDX A;  3OAN A;  4ZRK A;  2YT1 A;  1I7A A;  5J3Q A;  1U2B A;  1K5G B;  5GOW B;  2CAY A;  2RNR B;  1UNP A;  2X18 A;  1U5F A;  3IVF A;  2MKR A;  4NY0 A;  1DDW A;  5C5B B;  1MAI A;  2DYQ A;  2COF A;  1B55 A;  1E5W A;  3PSC A;  1J19 A;  4DXA B;  4HAV B;  3CXB B;  1X86 A;  4HAW B;  1IRS A;  3D8D A;  2MFQ A;  2QKL A;  3U8Z A;  3SUZ A;  2COA A;  2DHI A;  4Z2M B;  2CRF A;  3D8F A;  3UZT A;  2VKI A;  3F5R A;  4KAX B;  3BJI A;  3CIK A;  5KQ1 A;  4A5K A;  4Y94 A;  2I5F A;  1AWE A;  2COC A;  2D10 A;  2GJY A;  2W2X C;  3N7C A;  1DDV A;  3SYX A;  5C16 A;  3QBV B;  4H8S A;  2I1J A;  1X1G A;  1QC6 A;  2DX1 A;  5CLL B;  4F7G A;  2GCL A;  4DBB A;  1WI1 A;  3ODO A;  2W2W A;  2D2Q A;  3ULC A;  3GYP A;  4K17 A;  5J3Y A;  1NTY A;  5KQ4 A;  2H7E A;  3SNH A;  3WA0 A;  4MK0 A;  3HQC A;  1P3R A;  1DDM A;  2RSG A;  3HK0 A;  2J0J A;  3FSS A;  1I2H A;  2DX5 A;  1UNR A;  2I5C A;  1FGY A;  1WGU A;  2D11 A;  5HE1 A;  3ODW A;  3AU4 A;  5DH9 B;  2ZPY A;  1SHC A;  5DHF B;  1K5D B;  2D9W A;  1XKE A;  2DHJ A;  2HE7 A;  5JLJ B;  1V89 A;  4BBK A;  2LUL A;  2UZR A;  1LB1 A;  1M7E A;  4HAZ B;  2I1K A;  1OY2 A;  1PMS A;  2V76 A;  5C6R A;  2LYD A;  4MY6 A;  1KI1 B;  1NU2 A;  2J0K A;  5DHA B;  1MIZ B;  2HTH B;  3ULB A;  2R09 A;  2QKM A;  2YVC A;  3HW2 B;  3PZD A;  1FAO A;  4YON A;  1WG7 A;  3PVL A;  2LOZ A;  1X05 A;  4A6K A;  2NZ8 B;  2DA0 A;  2IYB A;  2EC1 A;  1XR0 B;  3KY9 A;  2IFS A;  1MK9 B;  2JP2 A;  4IAP A;  1UPR A;  5DI9 B;  2P8V A;  4PQ0 A;  1U5D A;  2Y7B A;  2DKQ A;  5JP4 A;  2PZ1 A;  1M7R A;  4B6H A;  2ADZ A;  2P0F A;  5C5B A;  2D4Q A;  2J0M A;  3AJ4 A;  2CY5 A;  2XQN M;  5D3V A;  3WYF B;  1GC7 A;  1ISN A;  4EKU A;  4WSF A;  5HE0 A;  5D3W A;  2KCJ A;  3DXD A;  4HAY B;  2KUP A;  3T06 A;  4L6E A;  1ZVR A;  3M1I B;  2Y8G A;  4C0A A;  1RJ2 A;  5D3X A;  2YT0 A;  4HDQ A;  1V5U A;  5D3Y A;  4HB0 B;  2ROZ B;  3SO6 A;  1V5P A;  1MKE A;  4GN1 A;  4HB3 B;  4IFS A;  2DKP A;  3RCP A;  4GZU A;  1BTK A;  2Q13 A;  1MK7 B;  4P7I A;  5DIF B;  3FEH A;  2EJ8 A;  4ZRI A;  1J0W A;  2OQB A;  2Z0O A;  1ZM0 A;  4HAX B;  4A6F B;  1MIX A;  4NSW A;  1X11 A;  4CYE A;  2RVB B;  1U5E A;  1XD4 A;  2YS3 A;  3ML4 A;  3TVV A;  2GCJ A;  1KZ7 A;  3KZ1 A;  1Y19 B;  1W1H A;  4ZRJ A;  1X1F A;  1FB8 A;  1GC6 A;  5HE3 A;  4K2P A;  2YSZ A;  2NMB A;  1AQC A;  3PP2 A;  4TYZ A;  4PNK A;  4EMO A;  1EVH A;  2VSZ A;  5LON B;  2ELB A;  3LJU X;  3X23 A;  1PFJ A;  1XX0 A;  3DXC A;  2E2X A;  1Z87 A;  2P0D A;  2ELA A;  2EMS A;  4F7U P;  3P7Z A;  2K2J A;  1FGZ A;  1OQN A;  1TJ6 A;  3DXE A;  2K2U A;  3VOQ A;  3ZVR A;  2D9X A;  2DYN A;  2OTX A;  3ODX A;  1W1G A;  2UZS A;  1EF1 A;  3A8P A;  2YRY A;  4HAU B;  3D8E A;  1EAZ A;  1SGH A;  1V88 A;  2ROV A;  3PEG A;  1FHX A;  1FHW A;  1PLS A;  2GS0 A;  3F0W A;  5C79 A;  2D9V A;  4YL8 A;  3KSY A;  1Q67 A;  1KZG A;  2H7D A;  3KRW A;  2L2I A;  1TXD A;  1RRP B;  5KCV A;  1TQZ A;  1WVH A;  4F7H A;  2LOX A;  1P5T A;  2FJL A;  1UPQ A;  4A6H A;  1H10 A;  2D9Z A;  4GXB A;  1DBH A;  3ZDT A;  5L81 A;  1U29 A;  2RLO A;  1GG3 A;  1WGQ A;  2W2X D;  3P6A A;  4HAT B;  2LKO A;  2DN6 A;  4KHB B;  2M38 A;  4XWX A;  2DLW A;  3TO1 A;  1UNQ A;  2MWN B;  3SV1 A;  2KGX B;  1P6S A;  3MPX A;  1WJ1 A;  2P0H A;  1EGX A;  5FI0 A;  1ZC3 B;  1U5G A;  3GYO A;  2VRW B;  4GMV A;  5HE2 A;  2N23 A;  4KVG B;  3TCA A;  2AL6 A;  3MDB C;  3PVU A; 
#chains in the Genus database with same CATH topology
 2Z4D A;  2Z0Q A;  3A98 B;  1ZSQ A;  1WJM A;  3PVW A;  2AEH A;  3KRX A;  5D27 A;  2NBV A;  4MT7 A;  3PG7 A;  4DX8 A;  1FOE A;  2LG1 A;  3VIA A;  2RGN B;  5FI1 A;  4HDO A;  4CHJ A;  3QWM A;  4GOU A;  1UEF A;  1NTV A;  3FM8 C;  2YS5 A;  4TKN A;  1NI2 A;  2YF0 A;  5LOP B;  2M14 A;  4Z2N A;  2R0D A;  2L1C A;  4A6F A;  2N0Y A;  1W1D A;  3HSA A;  2COD A;  4KHO A;  4D0N B;  3BIN A;  3OHM B;  2K00 A;  3A8Q A;  1QQG A;  2D9Y A;  3O96 A;  3V5W A;  2J59 M;  1OMW A;  3NSU A;  4GPT B;  5EFX A;  3NWD A;  4K2O A;  4DIX A;  1BAK A;  4KHA A;  2RUK B;  2RRF A;  2G35 A;  1XOD A;  4HB4 B;  2DTC A;  1U27 A;  5JHG A;  1DRO A;  1LW3 A;  2Y8F A;  4DX9 0;  1H4R A;  1V5M A;  4OT1 A;  1N3H A;  2DHK A;  2EMT A;  3FVC A;  4EJN A;  3G9W A;  5CLQ B;  4K81 A;  1FHO A;  4IOY X;  1Y5O A;  3TW1 A;  2CY4 A;  2Z0P A;  5J3T A;  1DYN A;  4CHM A;  1MPH A;  1V61 A;  3NWF A;  3AU5 A;  4HHV A;  2UVM A;  3QIJ A;  1XCG A;  4HB2 B;  3U7D A;  1ZC4 B;  1BTN A;  2DFK A;  2BCJ A;  4WJ7 A;  3TFM A;  5JHH A;  4WVF B;  1BWN A;  2YS1 A;  4GMX B;  2MDX A;  3OAN A;  4ZRK A;  2YT1 A;  1I7A A;  3U12 A;  5J3Q A;  1U2B A;  1K5G B;  5GOW B;  3NWA A;  2CAY A;  2RNR B;  1UNP A;  2X18 A;  1U5F A;  3IVF A;  2MKR A;  4NY0 A;  1DDW A;  5C5B B;  1MAI A;  2DYQ A;  2COF A;  1B55 A;  1E5W A;  3PSC A;  2Z13 A;  1J19 A;  4DXA B;  4HAV B;  4GNK B;  3CXB B;  1X86 A;  2KUQ A;  4HAW B;  2KIG A;  1IRS A;  3D8D A;  2MFQ A;  2QKL A;  3U8Z A;  2Z59 A;  3SUZ A;  2COA A;  2DHI A;  4Z2M B;  2CRF A;  3D8F A;  3UZT A;  2YT2 A;  2VKI A;  3F5R A;  4KAX B;  3BJI A;  3CIK A;  5KQ1 A;  4A5K A;  4Y94 A;  2I5F A;  1AWE A;  2ZKM X;  2COC A;  2D10 A;  2KR0 A;  2GJY A;  2W2X C;  2K49 A;  1DDV A;  3N7C A;  3SYX A;  5C16 A;  3QBV B;  4H8S A;  2I1J A;  1X1G A;  1QC6 A;  2DX1 A;  5CLL B;  5I2S A;  4F7G A;  2GCL A;  4DBB A;  1WI1 A;  3ODO A;  2W2W A;  2D2Q A;  3ULC A;  3GYP A;  4K17 A;  5J3Y A;  1NTY A;  5KQ4 A;  3HIE A;  1MI1 A;  2H7E A;  4OSN A;  3SNH A;  3WA0 A;  4MK0 A;  3HQC A;  1P3R A;  2K8E A;  1DDM A;  3NW8 A;  2RSG A;  1ZYI A;  3HK0 A;  2J0J A;  3FSS A;  1I2H A;  2DX5 A;  1UNR A;  2I5C A;  1FGY A;  1WGU A;  2D11 A;  5HE1 A;  3ODW A;  3AU4 A;  5DH9 B;  2ZPY A;  1SHC A;  5DHF B;  1K5D B;  2D9W A;  1XKE A;  2DHJ A;  2HE7 A;  2FJU B;  5JLJ B;  1V89 A;  4BBK A;  2LUL A;  2UZR A;  1LB1 A;  1M7E A;  4HAZ B;  2KIE A;  2I1K A;  1OY2 A;  1PMS A;  2V76 A;  5C6R A;  2LYD A;  4MY6 A;  1KI1 B;  1NU2 A;  2J0K A;  5DHA B;  1MIZ B;  4L1R A;  2HTH B;  3ULB A;  2R09 A;  2QKM A;  2YVC A;  3HW2 B;  3PZD A;  1FAO A;  4YON A;  1T77 A;  1WG7 A;  3PVL A;  2LOZ A;  1X05 A;  4A6K A;  2NZ8 B;  2DA0 A;  2IYB A;  2EC1 A;  1XR0 B;  3KY9 A;  2IFS A;  1MK9 B;  2JP2 A;  4IAP A;  1UPR A;  5DI9 B;  2P8V A;  3A58 A;  1U5D A;  4PQ0 A;  2Y7B A;  2DKQ A;  5JP4 A;  2PZ1 A;  1M7R A;  4B6H A;  2ADZ A;  2P0F A;  5C5B A;  2D4Q A;  4KHB A;  2J0M A;  3AJ4 A;  2CY5 A;  2XQN M;  4QJ3 B;  5D3V A;  3WYF B;  1GC7 A;  1ISN A;  2GUM A;  4WSF A;  5HE0 A;  4EKU A;  5D3W A;  2KCJ A;  3DXD A;  4HAY B;  2KUP A;  3T06 A;  4L6E A;  1ZVR A;  3M1I B;  2Y8G A;  4C0A A;  1RJ2 A;  5D3X A;  3B77 A;  2YT0 A;  4HDQ A;  5I2M A;  1V5U A;  5D3Y A;  4HB0 B;  2ROZ B;  3SO6 A;  1V5P A;  1MKE A;  4GN1 A;  4HB3 B;  4IFS A;  3DCX A;  2DKP A;  3RCP A;  4GZU A;  1BTK A;  2Q13 A;  1MK7 B;  4P7I A;  5DIF B;  3FEH A;  2EJ8 A;  4ZRI A;  1J0W A;  2OQB A;  2Z0O A;  1ZM0 A;  4HAX B;  4A6F B;  1MIX A;  4NSW A;  1X11 A;  4CYE A;  2RVB B;  1U5E A;  1XD4 A;  5IRS A;  2YS3 A;  3ML4 A;  3TVV A;  2GCJ A;  1KZ7 A;  3KZ1 A;  1Y19 B;  4QXA B;  1W1H A;  4ZRJ A;  1X1F A;  1FB8 A;  1GC6 A;  5HE3 A;  4K2P A;  2YSZ A;  2NMB A;  1AQC A;  3PP2 A;  4TYZ A;  4PNK A;  4EMO A;  1EVH A;  2VSZ A;  5LON B;  2ELB A;  3LJU X;  5M4Y B;  3X23 A;  1PFJ A;  1XX0 A;  3DXC A;  2E2X A;  1Z87 A;  5LG4 B;  2P0D A;  2ELA A;  4D6W A;  2EMS A;  4F7U P;  3P7Z A;  2K2J A;  1FGZ A;  1OQN A;  1TJ6 A;  3DXE A;  2K2U A;  3VOQ A;  3ZVR A;  2D9X A;  2DYN A;  2OTX A;  3ODX A;  1W1G A;  2UZS A;  1EF1 A;  3A8P A;  2YRY A;  4HAU B;  3D8E A;  1EAZ A;  1SGH A;  1V88 A;  2ROV A;  3PEG A;  1FHX A;  1FHW A;  1PLS A;  2GS0 A;  3F0W A;  5C79 A;  2D9V A;  4YL8 A;  3KSY A;  1Q67 A;  1KZG A;  2H7D A;  3KRW A;  2R2Y A;  2L2I A;  1TXD A;  1RRP B;  5KCV A;  1TQZ A;  1WVH A;  4F7H A;  2LOX A;  1P5T A;  2FJL A;  1UPQ A;  4A6H A;  1H10 A;  4QJ5 B;  2D9Z A;  4GXB A;  1DBH A;  3ZDT A;  5L81 A;  4QJ4 B;  1U29 A;  2RLO A;  1GG3 A;  1WGQ A;  2W2X D;  3P6A A;  4HAT B;  2LKO A;  2DN6 A;  4KHB B;  2M38 A;  4XWX A;  2DLW A;  4HSI A;  3TO1 A;  1UNQ A;  2MWN B;  3SV1 A;  2KGX B;  1P6S A;  3MPX A;  1WJ1 A;  2P0H A;  4CSQ A;  1EGX A;  5FI0 A;  1ZC3 B;  1U5G A;  3GYO A;  2VRW B;  4GMV A;  5HE2 A;  2Z14 A;  2N23 A;  4KVG B;  3TCA A;  2AL6 A;  3MDB C;  3PVU A; 
#chains in the Genus database with same CATH homology
 2Z0Q A;  3A98 B;  1ZSQ A;  1WJM A;  3PVW A;  2AEH A;  3KRX A;  5D27 A;  4MT7 A;  3PG7 A;  4DX8 A;  1FOE A;  2LG1 A;  3VIA A;  2RGN B;  5FI1 A;  4HDO A;  4CHJ A;  3QWM A;  1UEF A;  1NTV A;  2YS5 A;  3FM8 C;  4TKN A;  1NI2 A;  2YF0 A;  5LOP B;  2M14 A;  4Z2N A;  2R0D A;  2L1C A;  4A6F A;  2N0Y A;  1W1D A;  2COD A;  4KHO A;  4D0N B;  3BIN A;  2K00 A;  3A8Q A;  1QQG A;  2D9Y A;  3O96 A;  3V5W A;  2J59 M;  1OMW A;  3NSU A;  4GPT B;  5EFX A;  4K2O A;  1BAK A;  4KHA A;  2RUK B;  2G35 A;  1XOD A;  4HB4 B;  2DTC A;  1U27 A;  5JHG A;  1DRO A;  1LW3 A;  2Y8F A;  4DX9 0;  1H4R A;  1V5M A;  1N3H A;  2DHK A;  2EMT A;  4EJN A;  3G9W A;  5CLQ B;  4K81 A;  1FHO A;  4IOY X;  1Y5O A;  3TW1 A;  2CY4 A;  2Z0P A;  5J3T A;  1DYN A;  4CHM A;  1MPH A;  1V61 A;  3AU5 A;  4HHV A;  2UVM A;  3QIJ A;  1XCG A;  4HB2 B;  3U7D A;  1ZC4 B;  1BTN A;  2DFK A;  2BCJ A;  4WJ7 A;  3TFM A;  5JHH A;  4WVF B;  1BWN A;  2YS1 A;  4GMX B;  2MDX A;  3OAN A;  4ZRK A;  2YT1 A;  1I7A A;  5J3Q A;  1U2B A;  1K5G B;  5GOW B;  2CAY A;  2RNR B;  1UNP A;  2X18 A;  1U5F A;  3IVF A;  2MKR A;  4NY0 A;  1DDW A;  5C5B B;  1MAI A;  2DYQ A;  2COF A;  1B55 A;  1E5W A;  3PSC A;  1J19 A;  4DXA B;  4HAV B;  3CXB B;  1X86 A;  4HAW B;  1IRS A;  3D8D A;  2MFQ A;  2QKL A;  3U8Z A;  3SUZ A;  2COA A;  2DHI A;  4Z2M B;  2CRF A;  3D8F A;  3UZT A;  2VKI A;  3F5R A;  4KAX B;  3BJI A;  3CIK A;  5KQ1 A;  4A5K A;  4Y94 A;  2I5F A;  1AWE A;  2COC A;  2D10 A;  2GJY A;  2W2X C;  3N7C A;  1DDV A;  3SYX A;  5C16 A;  3QBV B;  4H8S A;  2I1J A;  1X1G A;  1QC6 A;  2DX1 A;  5CLL B;  4F7G A;  2GCL A;  4DBB A;  1WI1 A;  3ODO A;  2W2W A;  2D2Q A;  3ULC A;  3GYP A;  4K17 A;  5J3Y A;  1NTY A;  5KQ4 A;  2H7E A;  3SNH A;  3WA0 A;  4MK0 A;  3HQC A;  1P3R A;  1DDM A;  2RSG A;  3HK0 A;  2J0J A;  3FSS A;  1I2H A;  2DX5 A;  1UNR A;  2I5C A;  1FGY A;  1WGU A;  2D11 A;  5HE1 A;  3ODW A;  3AU4 A;  5DH9 B;  2ZPY A;  1SHC A;  5DHF B;  1K5D B;  2D9W A;  1XKE A;  2DHJ A;  2HE7 A;  5JLJ B;  1V89 A;  4BBK A;  2LUL A;  2UZR A;  1LB1 A;  1M7E A;  4HAZ B;  2I1K A;  1OY2 A;  1PMS A;  2V76 A;  5C6R A;  2LYD A;  4MY6 A;  1KI1 B;  1NU2 A;  2J0K A;  5DHA B;  1MIZ B;  2HTH B;  3ULB A;  2R09 A;  2QKM A;  2YVC A;  3HW2 B;  3PZD A;  1FAO A;  4YON A;  1WG7 A;  3PVL A;  2LOZ A;  1X05 A;  4A6K A;  2NZ8 B;  2DA0 A;  2IYB A;  2EC1 A;  1XR0 B;  3KY9 A;  2IFS A;  1MK9 B;  2JP2 A;  4IAP A;  1UPR A;  5DI9 B;  2P8V A;  4PQ0 A;  1U5D A;  2Y7B A;  2DKQ A;  5JP4 A;  2PZ1 A;  1M7R A;  4B6H A;  2ADZ A;  2P0F A;  5C5B A;  2D4Q A;  2J0M A;  3AJ4 A;  2CY5 A;  2XQN M;  5D3V A;  3WYF B;  1GC7 A;  1ISN A;  4EKU A;  4WSF A;  5HE0 A;  5D3W A;  2KCJ A;  3DXD A;  4HAY B;  2KUP A;  3T06 A;  4L6E A;  1ZVR A;  3M1I B;  2Y8G A;  4C0A A;  1RJ2 A;  5D3X A;  2YT0 A;  4HDQ A;  1V5U A;  5D3Y A;  4HB0 B;  2ROZ B;  3SO6 A;  1V5P A;  1MKE A;  4GN1 A;  4HB3 B;  4IFS A;  2DKP A;  3RCP A;  4GZU A;  1BTK A;  2Q13 A;  1MK7 B;  4P7I A;  5DIF B;  3FEH A;  2EJ8 A;  4ZRI A;  1J0W A;  2OQB A;  2Z0O A;  1ZM0 A;  4HAX B;  4A6F B;  1MIX A;  4NSW A;  1X11 A;  4CYE A;  2RVB B;  1U5E A;  1XD4 A;  2YS3 A;  3ML4 A;  3TVV A;  2GCJ A;  1KZ7 A;  3KZ1 A;  1Y19 B;  1W1H A;  4ZRJ A;  1X1F A;  1FB8 A;  1GC6 A;  5HE3 A;  4K2P A;  2YSZ A;  2NMB A;  1AQC A;  3PP2 A;  4TYZ A;  4PNK A;  4EMO A;  1EVH A;  2VSZ A;  5LON B;  2ELB A;  3LJU X;  3X23 A;  1PFJ A;  1XX0 A;  3DXC A;  2E2X A;  1Z87 A;  2P0D A;  2ELA A;  2EMS A;  4F7U P;  3P7Z A;  2K2J A;  1FGZ A;  1OQN A;  1TJ6 A;  3DXE A;  2K2U A;  3VOQ A;  3ZVR A;  2D9X A;  2DYN A;  2OTX A;  3ODX A;  1W1G A;  2UZS A;  1EF1 A;  3A8P A;  2YRY A;  4HAU B;  3D8E A;  1EAZ A;  1SGH A;  1V88 A;  2ROV A;  3PEG A;  1FHX A;  1FHW A;  1PLS A;  2GS0 A;  3F0W A;  5C79 A;  2D9V A;  4YL8 A;  3KSY A;  1Q67 A;  1KZG A;  2H7D A;  3KRW A;  2L2I A;  1TXD A;  1RRP B;  5KCV A;  1TQZ A;  1WVH A;  4F7H A;  2LOX A;  1P5T A;  2FJL A;  1UPQ A;  4A6H A;  1H10 A;  2D9Z A;  4GXB A;  1DBH A;  3ZDT A;  5L81 A;  1U29 A;  2RLO A;  1GG3 A;  1WGQ A;  2W2X D;  3P6A A;  4HAT B;  2LKO A;  2DN6 A;  4KHB B;  2M38 A;  4XWX A;  2DLW A;  3TO1 A;  1UNQ A;  2MWN B;  3SV1 A;  2KGX B;  1P6S A;  3MPX A;  1WJ1 A;  2P0H A;  1EGX A;  5FI0 A;  1ZC3 B;  1U5G A;  3GYO A;  2VRW B;  4GMV A;  5HE2 A;  2N23 A;  4KVG B;  3TCA A;  2AL6 A;  3MDB C;  3PVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...