1J0WA

Crystal structure analysis of the dok-5 ptb domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
99
structure length
99
Chain Sequence
QSERFNVYLMPSPNLDVHGECALQITYEYICLWDVQNPRVKLISWPLSALRRYGRDTTWFTFEAGRMCETGEGLFIFQTRDGEAIYQKVHSAALAIAEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure Analysis of the Dok-5 PTB Domain
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords downstream of tyrosine kinase 5
total genus 18
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature ec 2.7.1.112: Transferred entry: 2.7.10.1 and 2.7.10.2.
pdb deposition date 2002-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02174 IRS PTB domain (IRS-1 type)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1j0wA00
5DHAB 2V76A 1W1DA 5KCVA 1X86A 3WYFB 2DYQA 3A8PA 2MKRA 3D8FA 4BBKA 2CAYA 5C5BA 2K2UA 2JP2A 1ZC4B 1H4RA 4HAZB 2DKPA 3PVUA 3MDBC 1XCGA 1Z87A 2J0KA 3TVVA 4EJNA 1EGXA 3ODOA 3G9WA 2EJ8A 2X18A 3DXCA 1Y5OA 3SYXA 4TKNA 1ZM0A 2D9VA 5JHGA 1OY2A 1J0WA 2NZ8B 3DXDA 4GN1A 4A6HA 2DA0A 2H7DA 1AQCA 2EC1A 4EKUA 3FM8C 4C0AA 4HHVA 1AWEA 3D8EA 4K17A 2Y7BA 5C6RA 1OQNA 2COAA 3FEHA 2GJYA 2H7EA 2L1CA 2D11A 3P6AA 4HB0B 3AJ4A 5C5BB 1MIXA 5HE3A 1V5MA 5DHFB 1U27A 5FI0A 3ML4A 1DYNA 1MPHA 2ADZA 2I1KA 2Z0OA 1LB1A 2KCJA 3PVWA 1XODA 4ZRKA 5C79A 1Q67A 1M7EA 2BCJA 4TYZA 1MAIA 3V5WA 1P6SA 1RRPB 2LOXA 3QIJA 1DROA 1SHCA 1V61A 4B6HA 1FAOA 1DBHA 2MWNB 2D4QA 4DX90 1WJ1A 4A5KA 1B55A 1J19A 1TJ6A 4IOYX 4HDQA 4ZRIA 4KHOA 3CXBB 4WSFA 1WG7A 2Y8FA 2DKQA 2I5CA 3PP2A 4YONA 1RJ2A 5HE0A 1P5TA 4MY6A 5D3XA 2UVMA 3VOQA 3TW1A 2YS1A 2IYBA 5D3YA 1UPRA 2HTHB 4WJ7A 2ROVA 1U5DA 2OQBA 3X23A 2ZPYA 4HAWB 5J3YA 2P0HA 3AU5A 1QQGA 3T06A 1U29A 2RVBB 4XWXA 1ISNA 1OMWA 2DFKA 2M14A 2E2XA 2Z0QA 2Y8GA 2CY4A 2R0DA 1MKEA 2DLWA 1SGHA 5EFXA 1V5UA 2Q13A 1PMSA 2YVCA 2DHIA 1DDWA 3RCPA 2ELBA 1EVHA 5C16A 1X1GA 1K5DB 2P8VA 3MPXA 3O96A 5L81A 5KQ1A 4DX8A 4KVGB 2W2XD 1GG3A 1P3RA 1M7RA 3F5RA 3SNHA 3ZDTA 1WI1A 1X1FA 2FJLA 1FHOA 1UPQA 2DX5A 2YT0A 2GS0A 4KAXB 2Z0PA 2MDXA 1QC6A 1WVHA 1ZVRA 3WA0A 1MK7B 1UNRA 3QWMA 3ULCA 4CYEA 4A6FA 2N23A 2DTCA 4Z2MB 1DDVA 2OTXA 3ODWA 2UZSA 4K81A 1UNQA 3SO6A 1H10A 4F7UP 3PSCA 4KHBB 1U5FA 4HDOA 5D27A 3LJUX 2YS3A 1EF1A 3PVLA 2EMTA 1V89A 3ULBA 3VIAA 1MIZB 1WGQA 5DH9B 2YRYA 2LULA 4DBBA 4IFSA 2PZ1A 3A98B 4CHJA 1X11A 4KHAA 3N7CA 4Z2NA 2W2XC 1PFJA 2I5FA 3UZTA 2J0JA 3KZ1A 2W2WA 1NTVA 2K00A 3IVFA 1X05A 3GYPA 3NSUA 5CLQB 2R09A 4CHMA 4PQ0A 5HE2A 2QKMA 1XKEA 2YT1A 2VRWB 3TO1A 4HAYB 5KQ4A 4MT7A 1N3HA 2DYNA 4ZRJA 4A6FB 2UZRA 1XR0B 1ZC3B 4HB2B 1Y19B 1UNPA 2J59M 3SV1A 3PZDA 4K2PA 2CRFA 4HB4B 4WVFB 2D9XA 1NTYA 3BINA 1W1GA 1I2HA 1V88A 1IRSA 2VKIA 2D10A 5D3VA 1KZ7A 3GYOA 2N0YA 2P0DA 5GOWB 2AEHA 1U5GA 2D9YA 3CIKA 3ODXA 3OANA 2COCA 2COFA 4MK0A 2LYDA 3TCAA 2DHJA 1DDMA 3HQCA 2P0FA 2RSGA 2M38A 3A8QA 1UEFA 1BTKA 1TXDA 4HATB 4HAXB 2YSZA 4HAVB 3BJIA 4GPTB 4Y94A 4GXBA 1TQZA 5D3WA 4F7HA 2LG1A 1MK9B 4H8SA 3QBVB 1I7AA 1LW3A 2K2JA 4F7GA 3KRWA 3KY9A 1BWNA 4P7IA 5DIFB 4HB3B 2D2QA 1PLSA 4A6KA 1BTNA 1K5GB 5JLJB 1FB8A 1V5PA 2YS5A 4NSWA 3HW2B 5J3QA 1XD4A 1FHWA 1FGYA 3PEGA 3PG7A 1NU2A 2KGXB 2ELAA 4GMVA 1NI2A 2D9WA 3DXEA 5DI9B 2RLOA 5CLLB 2EMSA 2NMBA 1BAKA 1EAZA 3TFMA 3AU4A 5LONB 2KUPA 1FGZA 2D9ZA 3U7DA 1U2BA 2XQNM 3KRXA 1FOEA 2AL6A 1XX0A 4PNKA 3FSSA 2MFQA 4GMXB 2HE7A 2CY5A 5JP4A 2DN6A 5HE1A 2DHKA 2I1JA 2YF0A 2J0MA 2IFSA 5JHHA 4D0NB 2RGNB 5LOPB 4K2OA 4EMOA 4GZUA 1W1HA 2CODA 2L2IA 2VSZA 4HAUB 3U8ZA 1ZSQA 3SUZA 3HK0A 2DX1A 2LOZA 2LKOA 2QKLA 1WJMA 1GC6A 4L6EA 4DXAB 2G35A 1GC7A 4IAPA 5J3TA 2ROZB 1KZGA 2GCLA 1WGUA 1E5WA 1U5EA 3KSYA 3P7ZA 3D8DA 3ZVRA 3F0WA 4YL8A 2GCJA 5FI1A 3M1IB 1FHXA 2RNRB 2RUKB 1KI1B 4NY0A
chains in the Genus database with same CATH superfamily
5DHAB 2V76A 1W1DA 5KCVA 1X86A 4GOUA 3HIEA 3WYFB 2DYQA 3A8PA 2MKRA 3D8FA 4BBKA 2CAYA 5C5BA 4GNKB 2K2UA 2JP2A 1ZC4B 1H4RA 4HAZB 2DKPA 3PVUA 3MDBC 1XCGA 1Z87A 2J0KA 4OT1A 3TVVA 4EJNA 1EGXA 3ODOA 3NW8A 3G9WA 2EJ8A 2X18A 3DXCA 1Y5OA 3SYXA 4TKNA 1ZM0A 2D9VA 2KIGA 5JHGA 1OY2A 1J0WA 2NZ8B 3DXDA 4GN1A 4A6HA 2DA0A 3B77A 2H7DA 1AQCA 2EC1A 4EKUA 3FM8C 4C0AA 4HHVA 1AWEA 3D8EA 4K17A 2Y7BA 5C6RA 1OQNA 2COAA 2KR0A 3FEHA 2GJYA 2H7EA 2L1CA 2D11A 3P6AA 4HB0B 3AJ4A 5C5BB 4CSQA 1MIXA 5LG4B 5HE3A 4L1RA 1V5MA 5DHFB 1U27A 5FI0A 3ML4A 1DYNA 1MPHA 2ADZA 2I1KA 2Z0OA 1LB1A 2KCJA 3PVWA 1XODA 4ZRKA 5C79A 1Q67A 1M7EA 1T77A 2BCJA 4TYZA 1MAIA 3V5WA 1P6SA 1RRPB 2LOXA 3QIJA 1DROA 1SHCA 1V61A 4B6HA 1FAOA 1DBHA 2MWNB 2D4QA 4DX90 1WJ1A 4A5KA 1B55A 1J19A 4OSNA 1TJ6A 4IOYX 4HDQA 4ZRIA 4KHOA 3CXBB 4WSFA 1WG7A 2Y8FA 2DKQA 2I5CA 3PP2A 4YONA 1RJ2A 5HE0A 1P5TA 4QJ5B 4MY6A 5D3XA 2UVMA 3VOQA 3OHMB 3TW1A 1MI1A 2YS1A 2IYBA 5D3YA 1UPRA 2HTHB 4WJ7A 2ROVA 1U5DA 2OQBA 3X23A 2ZPYA 4HAWB 5J3YA 2P0HA 3AU5A 1QQGA 4QJ4B 3T06A 1U29A 2RVBB 4XWXA 1ISNA 1OMWA 2DFKA 2M14A 2E2XA 2Z0QA 2Y8GA 2Z59A 2CY4A 2R0DA 1MKEA 2DLWA 1SGHA 5EFXA 1V5UA 2Q13A 5I2MA 1PMSA 2YVCA 2DHIA 1DDWA 3RCPA 2ELBA 1EVHA 5C16A 1X1GA 1K5DB 2P8VA 3MPXA 3O96A 1ZYIA 5L81A 5KQ1A 4DX8A 2Z4DA 4KVGB 2W2XD 2KUQA 1GG3A 1P3RA 1M7RA 3F5RA 3SNHA 3ZDTA 1WI1A 1X1FA 2FJLA 1FHOA 1UPQA 2DX5A 2YT0A 2RRFA 2GS0A 4KAXB 2Z0PA 2MDXA 1QC6A 1WVHA 1ZVRA 3WA0A 5I2SA 1MK7B 1UNRA 3QWMA 3ULCA 4CYEA 4A6FA 2N23A 3NWDA 2DTCA 4Z2MB 1DDVA 2OTXA 3ODWA 2Z13A 2UZSA 4K81A 1UNQA 2K8EA 3SO6A 1H10A 4F7UP 3PSCA 4KHBB 1U5FA 4HDOA 5D27A 3LJUX 2YS3A 5IRSA 1EF1A 3PVLA 2EMTA 4HSIA 2K49A 1V89A 3ULBA 3VIAA 1MIZB 1WGQA 5DH9B 2YRYA 2LULA 4DBBA 4IFSA 2PZ1A 3A98B 3NWAA 4CHJA 1X11A 4KHAA 3N7CA 4Z2NA 2W2XC 1PFJA 2I5FA 3UZTA 2J0JA 3KZ1A 4D6WA 2W2WA 1NTVA 2NBVA 2K00A 3IVFA 1X05A 3GYPA 3NSUA 5CLQB 2R09A 4CHMA 4PQ0A 5HE2A 2QKMA 1XKEA 2YT1A 2VRWB 3TO1A 4HAYB 5KQ4A 4MT7A 1N3HA 2DYNA 4ZRJA 4A6FB 2UZRA 1XR0B 1ZC3B 4HB2B 1Y19B 1UNPA 2J59M 3SV1A 2GUMA 3PZDA 4K2PA 2CRFA 4HB4B 4WVFB 2D9XA 1NTYA 3BINA 1W1GA 4QJ3B 1I2HA 1V88A 1IRSA 2VKIA 2D10A 5D3VA 1KZ7A 3GYOA 2N0YA 2P0DA 5GOWB 2AEHA 1U5GA 3NWFA 2D9YA 3CIKA 3ODXA 3OANA 2COCA 2COFA 4MK0A 2LYDA 3TCAA 2DHJA 1DDMA 3HQCA 2P0FA 2RSGA 3FVCA 2M38A 3U12A 3HSAA 3A8QA 1UEFA 1BTKA 1TXDA 4HATB 4HAXB 2YSZA 4HAVB 3BJIA 4GPTB 2Z14A 4Y94A 4GXBA 5M4YB 1TQZA 5D3WA 4DIXA 4F7HA 2LG1A 1MK9B 4H8SA 3QBVB 1I7AA 1LW3A 2K2JA 4F7GA 3KRWA 3KY9A 1BWNA 4P7IA 5DIFB 4HB3B 2D2QA 1PLSA 2KIEA 4A6KA 1BTNA 1K5GB 5JLJB 1FB8A 1V5PA 2YS5A 2YT2A 4NSWA 4KHBA 3HW2B 5J3QA 1XD4A 1FHWA 1FGYA 3PEGA 2FJUB 3PG7A 1NU2A 2KGXB 2ELAA 4GMVA 1NI2A 2D9WA 3DXEA 5DI9B 2RLOA 5CLLB 2EMSA 2NMBA 1BAKA 1EAZA 3TFMA 3AU4A 5LONB 2KUPA 1FGZA 2D9ZA 3U7DA 1U2BA 2XQNM 3KRXA 1FOEA 2AL6A 1XX0A 4PNKA 3FSSA 2MFQA 4GMXB 2HE7A 2CY5A 5JP4A 2DN6A 5HE1A 2DHKA 2I1JA 3A58A 2YF0A 2J0MA 2IFSA 5JHHA 4D0NB 2RGNB 5LOPB 4K2OA 4EMOA 4GZUA 1W1HA 2CODA 2R2YA 2L2IA 2VSZA 4QXAB 4HAUB 3U8ZA 1ZSQA 3SUZA 3HK0A 2DX1A 2LOZA 2LKOA 2QKLA 1WJMA 1GC6A 4L6EA 4DXAB 2G35A 1GC7A 4IAPA 5J3TA 2ZKMX 2ROZB 1KZGA 2GCLA 1WGUA 1E5WA 1U5EA 3KSYA 3P7ZA 3D8DA 3ZVRA 3DCXA 3F0WA 4YL8A 2GCJA 5FI1A 3M1IB 1FHXA 2RNRB 2RUKB 1KI1B 4NY0A
chains in the Genus database with same CATH topology
5DHAB 2V76A 1W1DA 5KCVA 1X86A 3WYFB 2DYQA 3A8PA 2MKRA 3D8FA 4BBKA 2CAYA 5C5BA 2K2UA 2JP2A 1ZC4B 1H4RA 4HAZB 2DKPA 3PVUA 3MDBC 1XCGA 1Z87A 2J0KA 3TVVA 4EJNA 1EGXA 3ODOA 3G9WA 2EJ8A 2X18A 3DXCA 1Y5OA 3SYXA 4TKNA 1ZM0A 2D9VA 5JHGA 1OY2A 1J0WA 2NZ8B 3DXDA 4GN1A 4A6HA 2DA0A 2H7DA 1AQCA 2EC1A 4EKUA 3FM8C 4C0AA 4HHVA 1AWEA 3D8EA 4K17A 2Y7BA 5C6RA 1OQNA 2COAA 3FEHA 2GJYA 2H7EA 2L1CA 2D11A 3P6AA 4HB0B 3AJ4A 5C5BB 1MIXA 5HE3A 1V5MA 5DHFB 1U27A 5FI0A 3ML4A 1DYNA 1MPHA 2ADZA 2I1KA 2Z0OA 1LB1A 2KCJA 3PVWA 1XODA 4ZRKA 5C79A 1Q67A 1M7EA 2BCJA 4TYZA 1MAIA 3V5WA 1P6SA 1RRPB 2LOXA 3QIJA 1DROA 1SHCA 1V61A 4B6HA 1FAOA 1DBHA 2MWNB 2D4QA 4DX90 1WJ1A 4A5KA 1B55A 1J19A 1TJ6A 4IOYX 4HDQA 4ZRIA 4KHOA 3CXBB 4WSFA 1WG7A 2Y8FA 2DKQA 2I5CA 3PP2A 4YONA 1RJ2A 5HE0A 1P5TA 4MY6A 5D3XA 2UVMA 3VOQA 3TW1A 2YS1A 2IYBA 5D3YA 1UPRA 2HTHB 4WJ7A 2ROVA 1U5DA 2OQBA 3X23A 2ZPYA 4HAWB 5J3YA 2P0HA 3AU5A 1QQGA 3T06A 1U29A 2RVBB 4XWXA 1ISNA 1OMWA 2DFKA 2M14A 2E2XA 2Z0QA 2Y8GA 2CY4A 2R0DA 1MKEA 2DLWA 1SGHA 5EFXA 1V5UA 2Q13A 1PMSA 2YVCA 2DHIA 1DDWA 3RCPA 2ELBA 1EVHA 5C16A 1X1GA 1K5DB 2P8VA 3MPXA 3O96A 5L81A 5KQ1A 4DX8A 4KVGB 2W2XD 1GG3A 1P3RA 1M7RA 3F5RA 3SNHA 3ZDTA 1WI1A 1X1FA 2FJLA 1FHOA 1UPQA 2DX5A 2YT0A 2GS0A 4KAXB 2Z0PA 2MDXA 1QC6A 1WVHA 1ZVRA 3WA0A 1MK7B 1UNRA 3QWMA 3ULCA 4CYEA 4A6FA 2N23A 2DTCA 4Z2MB 1DDVA 2OTXA 3ODWA 2UZSA 4K81A 1UNQA 3SO6A 1H10A 4F7UP 3PSCA 4KHBB 1U5FA 4HDOA 5D27A 3LJUX 2YS3A 1EF1A 3PVLA 2EMTA 1V89A 3ULBA 3VIAA 1MIZB 1WGQA 5DH9B 2YRYA 2LULA 4DBBA 4IFSA 2PZ1A 3A98B 4CHJA 1X11A 4KHAA 3N7CA 4Z2NA 2W2XC 1PFJA 2I5FA 3UZTA 2J0JA 3KZ1A 2W2WA 1NTVA 2K00A 3IVFA 1X05A 3GYPA 3NSUA 5CLQB 2R09A 4CHMA 4PQ0A 5HE2A 2QKMA 1XKEA 2YT1A 2VRWB 3TO1A 4HAYB 5KQ4A 4MT7A 1N3HA 2DYNA 4ZRJA 4A6FB 2UZRA 1XR0B 1ZC3B 4HB2B 1Y19B 1UNPA 2J59M 3SV1A 3PZDA 4K2PA 2CRFA 4HB4B 4WVFB 2D9XA 1NTYA 3BINA 1W1GA 1I2HA 1V88A 1IRSA 2VKIA 2D10A 5D3VA 1KZ7A 3GYOA 2N0YA 2P0DA 5GOWB 2AEHA 1U5GA 2D9YA 3CIKA 3ODXA 3OANA 2COCA 2COFA 4MK0A 2LYDA 3TCAA 2DHJA 1DDMA 3HQCA 2P0FA 2RSGA 2M38A 3A8QA 1UEFA 1BTKA 1TXDA 4HATB 4HAXB 2YSZA 4HAVB 3BJIA 4GPTB 4Y94A 4GXBA 1TQZA 5D3WA 4F7HA 2LG1A 1MK9B 4H8SA 3QBVB 1I7AA 1LW3A 2K2JA 4F7GA 3KRWA 3KY9A 1BWNA 4P7IA 5DIFB 4HB3B 2D2QA 1PLSA 4A6KA 1BTNA 1K5GB 5JLJB 1FB8A 1V5PA 2YS5A 4NSWA 3HW2B 5J3QA 1XD4A 1FHWA 1FGYA 3PEGA 3PG7A 1NU2A 2KGXB 2ELAA 4GMVA 1NI2A 2D9WA 3DXEA 5DI9B 2RLOA 5CLLB 2EMSA 2NMBA 1BAKA 1EAZA 3TFMA 3AU4A 5LONB 2KUPA 1FGZA 2D9ZA 3U7DA 1U2BA 2XQNM 3KRXA 1FOEA 2AL6A 1XX0A 4PNKA 3FSSA 2MFQA 4GMXB 2HE7A 2CY5A 5JP4A 2DN6A 5HE1A 2DHKA 2I1JA 2YF0A 2J0MA 2IFSA 5JHHA 4D0NB 2RGNB 5LOPB 4K2OA 4EMOA 4GZUA 1W1HA 2CODA 2L2IA 2VSZA 4HAUB 3U8ZA 1ZSQA 3SUZA 3HK0A 2DX1A 2LOZA 2LKOA 2QKLA 1WJMA 1GC6A 4L6EA 4DXAB 2G35A 1GC7A 4IAPA 5J3TA 2ROZB 1KZGA 2GCLA 1WGUA 1E5WA 1U5EA 3KSYA 3P7ZA 3D8DA 3ZVRA 3F0WA 4YL8A 2GCJA 5FI1A 3M1IB 1FHXA 2RNRB 2RUKB 1KI1B 4NY0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DHA B;  2V76 A;  1W1D A;  5KCV A;  1X86 A;  3WYF B;  2DYQ A;  3A8P A;  2MKR A;  3D8F A;  4BBK A;  2CAY A;  5C5B A;  2K2U A;  2JP2 A;  1ZC4 B;  1H4R A;  4HAZ B;  2DKP A;  3PVU A;  3MDB C;  1XCG A;  1Z87 A;  2J0K A;  3TVV A;  4EJN A;  1EGX A;  3ODO A;  3G9W A;  2EJ8 A;  2X18 A;  3DXC A;  1Y5O A;  3SYX A;  4TKN A;  1ZM0 A;  2D9V A;  5JHG A;  1OY2 A;  1J0W A;  2NZ8 B;  3DXD A;  4GN1 A;  4A6H A;  2DA0 A;  2H7D A;  1AQC A;  2EC1 A;  4EKU A;  3FM8 C;  4C0A A;  4HHV A;  1AWE A;  3D8E A;  4K17 A;  2Y7B A;  5C6R A;  1OQN A;  2COA A;  3FEH A;  2GJY A;  2H7E A;  2L1C A;  2D11 A;  3P6A A;  4HB0 B;  3AJ4 A;  5C5B B;  1MIX A;  5HE3 A;  1V5M A;  5DHF B;  1U27 A;  5FI0 A;  3ML4 A;  1DYN A;  1MPH A;  2ADZ A;  2I1K A;  2Z0O A;  1LB1 A;  2KCJ A;  3PVW A;  1XOD A;  4ZRK A;  5C79 A;  1Q67 A;  1M7E A;  2BCJ A;  4TYZ A;  1MAI A;  3V5W A;  1P6S A;  1RRP B;  2LOX A;  3QIJ A;  1DRO A;  1SHC A;  1V61 A;  4B6H A;  1FAO A;  1DBH A;  2MWN B;  2D4Q A;  4DX9 0;  1WJ1 A;  4A5K A;  1B55 A;  1J19 A;  1TJ6 A;  4IOY X;  4HDQ A;  4ZRI A;  4KHO A;  3CXB B;  4WSF A;  1WG7 A;  2Y8F A;  2DKQ A;  2I5C A;  3PP2 A;  4YON A;  1RJ2 A;  5HE0 A;  1P5T A;  4MY6 A;  5D3X A;  2UVM A;  3VOQ A;  3TW1 A;  2YS1 A;  2IYB A;  5D3Y A;  1UPR A;  2HTH B;  4WJ7 A;  2ROV A;  1U5D A;  2OQB A;  3X23 A;  2ZPY A;  4HAW B;  5J3Y A;  2P0H A;  3AU5 A;  1QQG A;  3T06 A;  1U29 A;  2RVB B;  4XWX A;  1ISN A;  1OMW A;  2DFK A;  2M14 A;  2E2X A;  2Z0Q A;  2Y8G A;  2CY4 A;  2R0D A;  1MKE A;  2DLW A;  1SGH A;  5EFX A;  1V5U A;  2Q13 A;  1PMS A;  2YVC A;  2DHI A;  1DDW A;  3RCP A;  2ELB A;  1EVH A;  5C16 A;  1X1G A;  1K5D B;  2P8V A;  3MPX A;  3O96 A;  5L81 A;  5KQ1 A;  4DX8 A;  4KVG B;  2W2X D;  1GG3 A;  1P3R A;  1M7R A;  3F5R A;  3SNH A;  3ZDT A;  1WI1 A;  1X1F A;  2FJL A;  1FHO A;  1UPQ A;  2DX5 A;  2YT0 A;  2GS0 A;  4KAX B;  2Z0P A;  2MDX A;  1QC6 A;  1WVH A;  1ZVR A;  3WA0 A;  1MK7 B;  1UNR A;  3QWM A;  3ULC A;  4CYE A;  4A6F A;  2N23 A;  2DTC A;  4Z2M B;  1DDV A;  2OTX A;  3ODW A;  2UZS A;  4K81 A;  1UNQ A;  3SO6 A;  1H10 A;  4F7U P;  3PSC A;  4KHB B;  1U5F A;  4HDO A;  5D27 A;  3LJU X;  2YS3 A;  1EF1 A;  3PVL A;  2EMT A;  1V89 A;  3ULB A;  3VIA A;  1MIZ B;  1WGQ A;  5DH9 B;  2YRY A;  2LUL A;  4DBB A;  4IFS A;  2PZ1 A;  3A98 B;  4CHJ A;  1X11 A;  4KHA A;  3N7C A;  4Z2N A;  2W2X C;  1PFJ A;  2I5F A;  3UZT A;  2J0J A;  3KZ1 A;  2W2W A;  1NTV A;  2K00 A;  3IVF A;  1X05 A;  3GYP A;  3NSU A;  5CLQ B;  2R09 A;  4CHM A;  4PQ0 A;  5HE2 A;  2QKM A;  1XKE A;  2YT1 A;  2VRW B;  3TO1 A;  4HAY B;  5KQ4 A;  4MT7 A;  1N3H A;  2DYN A;  4ZRJ A;  4A6F B;  2UZR A;  1XR0 B;  1ZC3 B;  4HB2 B;  1Y19 B;  1UNP A;  2J59 M;  3SV1 A;  3PZD A;  4K2P A;  2CRF A;  4HB4 B;  4WVF B;  2D9X A;  1NTY A;  3BIN A;  1W1G A;  1I2H A;  1V88 A;  1IRS A;  2VKI A;  2D10 A;  5D3V A;  1KZ7 A;  3GYO A;  2N0Y A;  2P0D A;  5GOW B;  2AEH A;  1U5G A;  2D9Y A;  3CIK A;  3ODX A;  3OAN A;  2COC A;  2COF A;  4MK0 A;  2LYD A;  3TCA A;  2DHJ A;  1DDM A;  3HQC A;  2P0F A;  2RSG A;  2M38 A;  3A8Q A;  1UEF A;  1BTK A;  1TXD A;  4HAT B;  4HAX B;  2YSZ A;  4HAV B;  3BJI A;  4GPT B;  4Y94 A;  4GXB A;  1TQZ A;  5D3W A;  4F7H A;  2LG1 A;  1MK9 B;  4H8S A;  3QBV B;  1I7A A;  1LW3 A;  2K2J A;  4F7G A;  3KRW A;  3KY9 A;  1BWN A;  4P7I A;  5DIF B;  4HB3 B;  2D2Q A;  1PLS A;  4A6K A;  1BTN A;  1K5G B;  5JLJ B;  1FB8 A;  1V5P A;  2YS5 A;  4NSW A;  3HW2 B;  5J3Q A;  1XD4 A;  1FHW A;  1FGY A;  3PEG A;  3PG7 A;  1NU2 A;  2KGX B;  2ELA A;  4GMV A;  1NI2 A;  2D9W A;  3DXE A;  5DI9 B;  2RLO A;  5CLL B;  2EMS A;  2NMB A;  1BAK A;  1EAZ A;  3TFM A;  3AU4 A;  5LON B;  2KUP A;  1FGZ A;  2D9Z A;  3U7D A;  1U2B A;  2XQN M;  3KRX A;  1FOE A;  2AL6 A;  1XX0 A;  4PNK A;  3FSS A;  2MFQ A;  4GMX B;  2HE7 A;  2CY5 A;  5JP4 A;  2DN6 A;  5HE1 A;  2DHK A;  2I1J A;  2YF0 A;  2J0M A;  2IFS A;  5JHH A;  4D0N B;  2RGN B;  5LOP B;  4K2O A;  4EMO A;  4GZU A;  1W1H A;  2COD A;  2L2I A;  2VSZ A;  4HAU B;  3U8Z A;  1ZSQ A;  3SUZ A;  3HK0 A;  2DX1 A;  2LOZ A;  2LKO A;  2QKL A;  1WJM A;  1GC6 A;  4L6E A;  4DXA B;  2G35 A;  1GC7 A;  4IAP A;  5J3T A;  2ROZ B;  1KZG A;  2GCL A;  1WGU A;  1E5W A;  1U5E A;  3KSY A;  3P7Z A;  3D8D A;  3ZVR A;  3F0W A;  4YL8 A;  2GCJ A;  5FI1 A;  3M1I B;  1FHX A;  2RNR B;  2RUK B;  1KI1 B;  4NY0 A; 
#chains in the Genus database with same CATH topology
 5DHA B;  2V76 A;  1W1D A;  5KCV A;  1X86 A;  4GOU A;  3HIE A;  3WYF B;  2DYQ A;  3A8P A;  2MKR A;  3D8F A;  4BBK A;  2CAY A;  5C5B A;  4GNK B;  2K2U A;  2JP2 A;  1ZC4 B;  1H4R A;  4HAZ B;  2DKP A;  3PVU A;  3MDB C;  1XCG A;  1Z87 A;  2J0K A;  4OT1 A;  3TVV A;  4EJN A;  1EGX A;  3ODO A;  3NW8 A;  3G9W A;  2EJ8 A;  2X18 A;  3DXC A;  1Y5O A;  3SYX A;  4TKN A;  1ZM0 A;  2D9V A;  2KIG A;  5JHG A;  1OY2 A;  1J0W A;  2NZ8 B;  3DXD A;  4GN1 A;  4A6H A;  2DA0 A;  3B77 A;  2H7D A;  1AQC A;  2EC1 A;  4EKU A;  3FM8 C;  4C0A A;  4HHV A;  1AWE A;  3D8E A;  4K17 A;  2Y7B A;  5C6R A;  1OQN A;  2COA A;  2KR0 A;  3FEH A;  2GJY A;  2H7E A;  2L1C A;  2D11 A;  3P6A A;  4HB0 B;  3AJ4 A;  5C5B B;  4CSQ A;  1MIX A;  5LG4 B;  5HE3 A;  4L1R A;  1V5M A;  5DHF B;  1U27 A;  5FI0 A;  3ML4 A;  1DYN A;  1MPH A;  2ADZ A;  2I1K A;  2Z0O A;  1LB1 A;  2KCJ A;  3PVW A;  1XOD A;  4ZRK A;  5C79 A;  1Q67 A;  1M7E A;  1T77 A;  2BCJ A;  4TYZ A;  1MAI A;  3V5W A;  1P6S A;  1RRP B;  2LOX A;  3QIJ A;  1DRO A;  1SHC A;  1V61 A;  4B6H A;  1FAO A;  1DBH A;  2MWN B;  2D4Q A;  4DX9 0;  1WJ1 A;  4A5K A;  1B55 A;  1J19 A;  4OSN A;  1TJ6 A;  4IOY X;  4HDQ A;  4ZRI A;  4KHO A;  3CXB B;  4WSF A;  1WG7 A;  2Y8F A;  2DKQ A;  2I5C A;  3PP2 A;  4YON A;  1RJ2 A;  5HE0 A;  1P5T A;  4QJ5 B;  4MY6 A;  5D3X A;  2UVM A;  3VOQ A;  3OHM B;  3TW1 A;  1MI1 A;  2YS1 A;  2IYB A;  5D3Y A;  1UPR A;  2HTH B;  4WJ7 A;  2ROV A;  1U5D A;  2OQB A;  3X23 A;  2ZPY A;  4HAW B;  5J3Y A;  2P0H A;  3AU5 A;  1QQG A;  4QJ4 B;  3T06 A;  1U29 A;  2RVB B;  4XWX A;  1ISN A;  1OMW A;  2DFK A;  2M14 A;  2E2X A;  2Z0Q A;  2Y8G A;  2Z59 A;  2CY4 A;  2R0D A;  1MKE A;  2DLW A;  1SGH A;  5EFX A;  1V5U A;  2Q13 A;  5I2M A;  1PMS A;  2YVC A;  2DHI A;  1DDW A;  3RCP A;  2ELB A;  1EVH A;  5C16 A;  1X1G A;  1K5D B;  2P8V A;  3MPX A;  3O96 A;  1ZYI A;  5L81 A;  5KQ1 A;  4DX8 A;  2Z4D A;  4KVG B;  2W2X D;  2KUQ A;  1GG3 A;  1P3R A;  1M7R A;  3F5R A;  3SNH A;  3ZDT A;  1WI1 A;  1X1F A;  2FJL A;  1FHO A;  1UPQ A;  2DX5 A;  2YT0 A;  2RRF A;  2GS0 A;  4KAX B;  2Z0P A;  2MDX A;  1QC6 A;  1WVH A;  1ZVR A;  3WA0 A;  5I2S A;  1MK7 B;  1UNR A;  3QWM A;  3ULC A;  4CYE A;  4A6F A;  2N23 A;  3NWD A;  2DTC A;  4Z2M B;  1DDV A;  2OTX A;  3ODW A;  2Z13 A;  2UZS A;  4K81 A;  1UNQ A;  2K8E A;  3SO6 A;  1H10 A;  4F7U P;  3PSC A;  4KHB B;  1U5F A;  4HDO A;  5D27 A;  3LJU X;  2YS3 A;  5IRS A;  1EF1 A;  3PVL A;  2EMT A;  4HSI A;  2K49 A;  1V89 A;  3ULB A;  3VIA A;  1MIZ B;  1WGQ A;  5DH9 B;  2YRY A;  2LUL A;  4DBB A;  4IFS A;  2PZ1 A;  3A98 B;  3NWA A;  4CHJ A;  1X11 A;  4KHA A;  3N7C A;  4Z2N A;  2W2X C;  1PFJ A;  2I5F A;  3UZT A;  2J0J A;  3KZ1 A;  4D6W A;  2W2W A;  1NTV A;  2NBV A;  2K00 A;  3IVF A;  1X05 A;  3GYP A;  3NSU A;  5CLQ B;  2R09 A;  4CHM A;  4PQ0 A;  5HE2 A;  2QKM A;  1XKE A;  2YT1 A;  2VRW B;  3TO1 A;  4HAY B;  5KQ4 A;  4MT7 A;  1N3H A;  2DYN A;  4ZRJ A;  4A6F B;  2UZR A;  1XR0 B;  1ZC3 B;  4HB2 B;  1Y19 B;  1UNP A;  2J59 M;  3SV1 A;  2GUM A;  3PZD A;  4K2P A;  2CRF A;  4HB4 B;  4WVF B;  2D9X A;  1NTY A;  3BIN A;  1W1G A;  4QJ3 B;  1I2H A;  1V88 A;  1IRS A;  2VKI A;  2D10 A;  5D3V A;  1KZ7 A;  3GYO A;  2N0Y A;  2P0D A;  5GOW B;  2AEH A;  1U5G A;  3NWF A;  2D9Y A;  3CIK A;  3ODX A;  3OAN A;  2COC A;  2COF A;  4MK0 A;  2LYD A;  3TCA A;  2DHJ A;  1DDM A;  3HQC A;  2P0F A;  2RSG A;  3FVC A;  2M38 A;  3U12 A;  3HSA A;  3A8Q A;  1UEF A;  1BTK A;  1TXD A;  4HAT B;  4HAX B;  2YSZ A;  4HAV B;  3BJI A;  4GPT B;  2Z14 A;  4Y94 A;  4GXB A;  5M4Y B;  1TQZ A;  5D3W A;  4DIX A;  4F7H A;  2LG1 A;  1MK9 B;  4H8S A;  3QBV B;  1I7A A;  1LW3 A;  2K2J A;  4F7G A;  3KRW A;  3KY9 A;  1BWN A;  4P7I A;  5DIF B;  4HB3 B;  2D2Q A;  1PLS A;  2KIE A;  4A6K A;  1BTN A;  1K5G B;  5JLJ B;  1FB8 A;  1V5P A;  2YS5 A;  2YT2 A;  4NSW A;  4KHB A;  3HW2 B;  5J3Q A;  1XD4 A;  1FHW A;  1FGY A;  3PEG A;  2FJU B;  3PG7 A;  1NU2 A;  2KGX B;  2ELA A;  4GMV A;  1NI2 A;  2D9W A;  3DXE A;  5DI9 B;  2RLO A;  5CLL B;  2EMS A;  2NMB A;  1BAK A;  1EAZ A;  3TFM A;  3AU4 A;  5LON B;  2KUP A;  1FGZ A;  2D9Z A;  3U7D A;  1U2B A;  2XQN M;  3KRX A;  1FOE A;  2AL6 A;  1XX0 A;  4PNK A;  3FSS A;  2MFQ A;  4GMX B;  2HE7 A;  2CY5 A;  5JP4 A;  2DN6 A;  5HE1 A;  2DHK A;  2I1J A;  3A58 A;  2YF0 A;  2J0M A;  2IFS A;  5JHH A;  4D0N B;  2RGN B;  5LOP B;  4K2O A;  4EMO A;  4GZU A;  1W1H A;  2COD A;  2R2Y A;  2L2I A;  2VSZ A;  4QXA B;  4HAU B;  3U8Z A;  1ZSQ A;  3SUZ A;  3HK0 A;  2DX1 A;  2LOZ A;  2LKO A;  2QKL A;  1WJM A;  1GC6 A;  4L6E A;  4DXA B;  2G35 A;  1GC7 A;  4IAP A;  5J3T A;  2ZKM X;  2ROZ B;  1KZG A;  2GCL A;  1WGU A;  1E5W A;  1U5E A;  3KSY A;  3P7Z A;  3D8D A;  3ZVR A;  3DCX A;  3F0W A;  4YL8 A;  2GCJ A;  5FI1 A;  3M1I B;  1FHX A;  2RNR B;  2RUK B;  1KI1 B;  4NY0 A; 
#chains in the Genus database with same CATH homology
 5DHA B;  2V76 A;  1W1D A;  5KCV A;  1X86 A;  3WYF B;  2DYQ A;  3A8P A;  2MKR A;  3D8F A;  4BBK A;  2CAY A;  5C5B A;  2K2U A;  2JP2 A;  1ZC4 B;  1H4R A;  4HAZ B;  2DKP A;  3PVU A;  3MDB C;  1XCG A;  1Z87 A;  2J0K A;  3TVV A;  4EJN A;  1EGX A;  3ODO A;  3G9W A;  2EJ8 A;  2X18 A;  3DXC A;  1Y5O A;  3SYX A;  4TKN A;  1ZM0 A;  2D9V A;  5JHG A;  1OY2 A;  1J0W A;  2NZ8 B;  3DXD A;  4GN1 A;  4A6H A;  2DA0 A;  2H7D A;  1AQC A;  2EC1 A;  4EKU A;  3FM8 C;  4C0A A;  4HHV A;  1AWE A;  3D8E A;  4K17 A;  2Y7B A;  5C6R A;  1OQN A;  2COA A;  3FEH A;  2GJY A;  2H7E A;  2L1C A;  2D11 A;  3P6A A;  4HB0 B;  3AJ4 A;  5C5B B;  1MIX A;  5HE3 A;  1V5M A;  5DHF B;  1U27 A;  5FI0 A;  3ML4 A;  1DYN A;  1MPH A;  2ADZ A;  2I1K A;  2Z0O A;  1LB1 A;  2KCJ A;  3PVW A;  1XOD A;  4ZRK A;  5C79 A;  1Q67 A;  1M7E A;  2BCJ A;  4TYZ A;  1MAI A;  3V5W A;  1P6S A;  1RRP B;  2LOX A;  3QIJ A;  1DRO A;  1SHC A;  1V61 A;  4B6H A;  1FAO A;  1DBH A;  2MWN B;  2D4Q A;  4DX9 0;  1WJ1 A;  4A5K A;  1B55 A;  1J19 A;  1TJ6 A;  4IOY X;  4HDQ A;  4ZRI A;  4KHO A;  3CXB B;  4WSF A;  1WG7 A;  2Y8F A;  2DKQ A;  2I5C A;  3PP2 A;  4YON A;  1RJ2 A;  5HE0 A;  1P5T A;  4MY6 A;  5D3X A;  2UVM A;  3VOQ A;  3TW1 A;  2YS1 A;  2IYB A;  5D3Y A;  1UPR A;  2HTH B;  4WJ7 A;  2ROV A;  1U5D A;  2OQB A;  3X23 A;  2ZPY A;  4HAW B;  5J3Y A;  2P0H A;  3AU5 A;  1QQG A;  3T06 A;  1U29 A;  2RVB B;  4XWX A;  1ISN A;  1OMW A;  2DFK A;  2M14 A;  2E2X A;  2Z0Q A;  2Y8G A;  2CY4 A;  2R0D A;  1MKE A;  2DLW A;  1SGH A;  5EFX A;  1V5U A;  2Q13 A;  1PMS A;  2YVC A;  2DHI A;  1DDW A;  3RCP A;  2ELB A;  1EVH A;  5C16 A;  1X1G A;  1K5D B;  2P8V A;  3MPX A;  3O96 A;  5L81 A;  5KQ1 A;  4DX8 A;  4KVG B;  2W2X D;  1GG3 A;  1P3R A;  1M7R A;  3F5R A;  3SNH A;  3ZDT A;  1WI1 A;  1X1F A;  2FJL A;  1FHO A;  1UPQ A;  2DX5 A;  2YT0 A;  2GS0 A;  4KAX B;  2Z0P A;  2MDX A;  1QC6 A;  1WVH A;  1ZVR A;  3WA0 A;  1MK7 B;  1UNR A;  3QWM A;  3ULC A;  4CYE A;  4A6F A;  2N23 A;  2DTC A;  4Z2M B;  1DDV A;  2OTX A;  3ODW A;  2UZS A;  4K81 A;  1UNQ A;  3SO6 A;  1H10 A;  4F7U P;  3PSC A;  4KHB B;  1U5F A;  4HDO A;  5D27 A;  3LJU X;  2YS3 A;  1EF1 A;  3PVL A;  2EMT A;  1V89 A;  3ULB A;  3VIA A;  1MIZ B;  1WGQ A;  5DH9 B;  2YRY A;  2LUL A;  4DBB A;  4IFS A;  2PZ1 A;  3A98 B;  4CHJ A;  1X11 A;  4KHA A;  3N7C A;  4Z2N A;  2W2X C;  1PFJ A;  2I5F A;  3UZT A;  2J0J A;  3KZ1 A;  2W2W A;  1NTV A;  2K00 A;  3IVF A;  1X05 A;  3GYP A;  3NSU A;  5CLQ B;  2R09 A;  4CHM A;  4PQ0 A;  5HE2 A;  2QKM A;  1XKE A;  2YT1 A;  2VRW B;  3TO1 A;  4HAY B;  5KQ4 A;  4MT7 A;  1N3H A;  2DYN A;  4ZRJ A;  4A6F B;  2UZR A;  1XR0 B;  1ZC3 B;  4HB2 B;  1Y19 B;  1UNP A;  2J59 M;  3SV1 A;  3PZD A;  4K2P A;  2CRF A;  4HB4 B;  4WVF B;  2D9X A;  1NTY A;  3BIN A;  1W1G A;  1I2H A;  1V88 A;  1IRS A;  2VKI A;  2D10 A;  5D3V A;  1KZ7 A;  3GYO A;  2N0Y A;  2P0D A;  5GOW B;  2AEH A;  1U5G A;  2D9Y A;  3CIK A;  3ODX A;  3OAN A;  2COC A;  2COF A;  4MK0 A;  2LYD A;  3TCA A;  2DHJ A;  1DDM A;  3HQC A;  2P0F A;  2RSG A;  2M38 A;  3A8Q A;  1UEF A;  1BTK A;  1TXD A;  4HAT B;  4HAX B;  2YSZ A;  4HAV B;  3BJI A;  4GPT B;  4Y94 A;  4GXB A;  1TQZ A;  5D3W A;  4F7H A;  2LG1 A;  1MK9 B;  4H8S A;  3QBV B;  1I7A A;  1LW3 A;  2K2J A;  4F7G A;  3KRW A;  3KY9 A;  1BWN A;  4P7I A;  5DIF B;  4HB3 B;  2D2Q A;  1PLS A;  4A6K A;  1BTN A;  1K5G B;  5JLJ B;  1FB8 A;  1V5P A;  2YS5 A;  4NSW A;  3HW2 B;  5J3Q A;  1XD4 A;  1FHW A;  1FGY A;  3PEG A;  3PG7 A;  1NU2 A;  2KGX B;  2ELA A;  4GMV A;  1NI2 A;  2D9W A;  3DXE A;  5DI9 B;  2RLO A;  5CLL B;  2EMS A;  2NMB A;  1BAK A;  1EAZ A;  3TFM A;  3AU4 A;  5LON B;  2KUP A;  1FGZ A;  2D9Z A;  3U7D A;  1U2B A;  2XQN M;  3KRX A;  1FOE A;  2AL6 A;  1XX0 A;  4PNK A;  3FSS A;  2MFQ A;  4GMX B;  2HE7 A;  2CY5 A;  5JP4 A;  2DN6 A;  5HE1 A;  2DHK A;  2I1J A;  2YF0 A;  2J0M A;  2IFS A;  5JHH A;  4D0N B;  2RGN B;  5LOP B;  4K2O A;  4EMO A;  4GZU A;  1W1H A;  2COD A;  2L2I A;  2VSZ A;  4HAU B;  3U8Z A;  1ZSQ A;  3SUZ A;  3HK0 A;  2DX1 A;  2LOZ A;  2LKO A;  2QKL A;  1WJM A;  1GC6 A;  4L6E A;  4DXA B;  2G35 A;  1GC7 A;  4IAP A;  5J3T A;  2ROZ B;  1KZG A;  2GCL A;  1WGU A;  1E5W A;  1U5E A;  3KSY A;  3P7Z A;  3D8D A;  3ZVR A;  3F0W A;  4YL8 A;  2GCJ A;  5FI1 A;  3M1I B;  1FHX A;  2RNR B;  2RUK B;  1KI1 B;  4NY0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...