1J0WA

Crystal structure analysis of the dok-5 ptb domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
99
structure length
99
Chain Sequence
QSERFNVYLMPSPNLDVHGECALQITYEYICLWDVQNPRVKLISWPLSALRRYGRDTTWFTFEAGRMCETGEGLFIFQTRDGEAIYQKVHSAALAIAEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords downstream of tyrosine kinase 5
publication title Crystal Structure Analysis of the Dok-5 PTB Domain
rcsb
source organism Homo sapiens
total genus 18
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature ec 2.7.1.112: Transferred entry: 2.7.10.1 and 2.7.10.2.
pdb deposition date 2002-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02174 IRS PTB domain (IRS-1 type)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1j0wA00
1Y5OA 3TFMA 2D4QA 4IOYX 1XX0A 1NU2A 1LB1A 2DX5A 4GXBA 4P7IA 2ZPYA 4HATB 4GZUA 4B6HA 2D11A 4HAXB 4Y94A 2HTHB 5CLQB 2M14A 1X05A 1XR0B 3CIKA 1H10A 4IAPA 2P0HA 1U5GA 2ROVA 1DDWA 2CRFA 3ZVRA 2H7EA 3FSSA 4KHOA 5FI0A 4K81A 1P5TA 2LG1A 4HAYB 2EJ8A 4EKUA 1OQNA 1BWNA 3ML4A 1WGQA 4MY6A 3ULCA 4A6FB 1MAIA 5D3VA 4PQ0A 1W1DA 1LW3A 1NTYA 2JP2A 4HAVB 1FHOA 2MDXA 1SHCA 3P7ZA 3D8EA 4HDQA 4A6FA 1J19A 2D10A 4WVFB 2RUKB 1IRSA 2OQBA 5HE2A 4F7UP 4KHAA 3DXDA 3A98B 1QC6A 2DX1A 2UZRA 2H7DA 2J0MA 2X18A 1TXDA 2VKIA 4DBBA 1UPRA 1V5UA 3IVFA 2Z0QA 3AU4A 5EFXA 2ELAA 2YS3A 1P3RA 2QKMA 2Y7BA 1AQCA 1MIZB 1XD4A 4HDOA 3ODOA 2YT0A 1H4RA 3HK0A 3ODXA 3VOQA 1EGXA 2CY5A 2BCJA 1U5FA 4NSWA 3QIJA 3X23A 4WSFA 1BTNA 2DLWA 2IFSA 3FEHA 3KY9A 2VRWB 2QKLA 2YVCA 2MFQA 4ZRKA 3UZTA 3AJ4A 1MK9B 4Z2MB 2COCA 3D8FA 2DHIA 2PZ1A 3ODWA 3PVWA 2J0JA 3KZ1A 5C5BB 2K2UA 2W2WA 2L2IA 3A8QA 4YONA 4KAXB 3O96A 1B55A 4HAZB 2Z0PA 5C5BA 3TCAA 4K17A 5D27A 2D9VA 4GN1A 4BBKA 2DKPA 2DA0A 5KQ4A 1U5DA 3GYOA 2D9YA 3DXCA 5J3YA 2DKQA 5HE1A 4H8SA 1K5DB 2E2XA 2I5CA 4HAWB 2LOZA 1J0WA 3TO1A 3OANA 4MT7A 3DXEA 2K2JA 1QQGA 2W2XC 1WJMA 5JHGA 1DDVA 1KZ7A 2RNRB 5HE3A 2DYQA 1DBHA 3G9WA 1OMWA 2EMSA 1UNQA 4F7HA 1XODA 2FJLA 3AU5A 3U8ZA 1FGYA 1P6SA 2EMTA 2RSGA 4K2PA 1X11A 1NI2A 2D9XA 2J59M 2ROZB 4DXAB 4EMOA 1ZVRA 1BTKA 2CODA 3KRXA 4EJNA 1W1HA 3P6AA 2GJYA 2R09A 4HB0B 1FAOA 3SNHA 1UPQA 5DH9B 2D9WA 2RGNB 3GYPA 1WGUA 5JLJB 2COFA 2YS5A 5LONB 3PVLA 3BJIA 3ULBA 2DYNA 1DROA 1TJ6A 5FI1A 1DYNA 1OY2A 2AL6A 4TKNA 1W1GA 2I1JA 4DX90 4A6KA 2ADZA 3HQCA 4ZRJA 4HB3B 2P8VA 4Z2NA 4IFSA 3KRWA 2COAA 4L6EA 4GMVA 4MK0A 4GPTB 4YL8A 2KCJA 1V5MA 3FM8C 2Y8FA 3PEGA 4HB2B 2YRYA 5C79A 3WA0A 3VIAA 2RVBB 3QBVB 1WVHA 1M7EA 3QWMA 2GCLA 2V76A 5KCVA 1V89A 2W2XD 2I5FA 2I1KA 2P0FA 4HHVA 2XQNM 2G35A 1Y19B 1X1GA 2CAYA 1PMSA 3MPXA 2P0DA 2YS1A 1EVHA 4CYEA 1UNRA 1X86A 3U7DA 5C16A 5DIFB 2VSZA 1XCGA 2DHKA 2D9ZA 5DHFB 1GC7A 1Q67A 4PNKA 3PZDA 4KHBB 2L1CA 2YSZA 1ISNA 3RCPA 2LKOA 5DI9B 2NMBA 2NZ8B 2RLOA 4CHMA 2KGXB 3M1IB 1UEFA 1SGHA 3CXBB 2OTXA 2R0DA 2DN6A 3V5WA 1WG7A 4HAUB 1KI1B 4HB4B 3F5RA 1FHXA 5JHHA 4GMXB 1K5GB 1U2BA 5KQ1A 3PG7A 5D3YA 1X1FA 2LULA 1ZSQA 1GC6A 2MWNB 3F0WA 4D0NB 1MK7B 5LOPB 2K00A 2IYBA 3ZDTA 1RRPB 1ZM0A 1E5WA 1V5PA 3PSCA 1ZC4B 3A8PA 5J3QA 3SUZA 4C0AA 1EF1A 3KSYA 2UZSA 3MDBC 1FOEA 3SO6A 1PFJA 5L81A 3LJUX 5CLLB 1N3HA 5J3TA 1XKEA 1V88A 1MPHA 2KUPA 2UVMA 3BINA 2J0KA 3TVVA 4DX8A 2M38A 2GS0A 4K2OA 4F7GA 1EAZA 1FB8A 2Z0OA 1V61A 1I7AA 4CHJA 2N23A 2GCJA 1KZGA 4A5KA 1Z87A 1MIXA 5JP4A 2LOXA 3N7CA 5D3WA 5GOWB 5HE0A 1AWEA 1UNPA 4KVGB 1WI1A 2DHJA 1GG3A 1RJ2A 1PLSA 1FGZA 1U5EA 3SYXA 3PVUA 2LYDA 1U27A 3WYFB 5C6RA 2MKRA 3SV1A 1DDMA 1TQZA 2N0YA 2YF0A 4XWXA 2ELBA 3T06A 3TW1A 1I2HA 2DTCA 3NSUA 4WJ7A 2D2QA 4TYZA 1BAKA 2EC1A 1FHWA 2AEHA 5D3XA 1NTVA 2YT1A 4NY0A 2HE7A 1ZC3B 3D8DA 2CY4A 2Q13A 3HW2B 4ZRIA 2Y8GA 3PP2A 4A6HA 2DFKA 5DHAB 1WJ1A 1MKEA 1U29A 1M7RA
chains in the Genus database with same CATH superfamily
1Y5OA 3TFMA 2D4QA 4IOYX 1XX0A 1NU2A 1LB1A 2DX5A 4GXBA 4P7IA 2ZPYA 4HATB 4GZUA 5I2SA 4B6HA 3U12A 2D11A 4HAXB 4Y94A 2HTHB 5CLQB 2M14A 2NBVA 1X05A 1XR0B 3CIKA 1H10A 4IAPA 2P0HA 1U5GA 2ROVA 1DDWA 2CRFA 3ZVRA 2H7EA 3FSSA 4KHOA 5FI0A 4K81A 1P5TA 2LG1A 2Z13A 4HAYB 2EJ8A 4EKUA 1OQNA 1BWNA 3ML4A 1WGQA 4MY6A 3ULCA 2ZKMX 4A6FB 1MAIA 5D3VA 4PQ0A 1W1DA 1LW3A 1NTYA 2JP2A 4HAVB 1FHOA 2MDXA 1SHCA 3P7ZA 3D8EA 4HDQA 4A6FA 1J19A 2D10A 4WVFB 2RUKB 1IRSA 2OQBA 5HE2A 4F7UP 4KHAA 3DXDA 3A98B 1QC6A 2DX1A 2UZRA 2H7DA 2J0MA 2X18A 1TXDA 2VKIA 4DBBA 2KUQA 1UPRA 1V5UA 3IVFA 1MI1A 2Z0QA 3AU4A 5EFXA 3NW8A 2ELAA 2YS3A 1P3RA 2QKMA 2Y7BA 1AQCA 1MIZB 1XD4A 4HDOA 5M4YB 2FJUB 3ODOA 2YT0A 1H4RA 3HK0A 3ODXA 3VOQA 1EGXA 2CY5A 2BCJA 1U5FA 4NSWA 3QIJA 3X23A 4WSFA 1BTNA 2DLWA 2IFSA 3FEHA 3KY9A 2VRWB 2QKLA 2YVCA 5IRSA 2MFQA 4ZRKA 3UZTA 3AJ4A 1MK9B 4Z2MB 2COCA 3D8FA 2DHIA 2PZ1A 3NWDA 3ODWA 3PVWA 2Z14A 2J0JA 3KZ1A 5C5BB 2K2UA 2W2WA 2L2IA 3A8QA 4YONA 4KAXB 3O96A 1B55A 4HAZB 2Z0PA 5C5BA 4HSIA 3TCAA 4K17A 5D27A 2D9VA 4GN1A 4BBKA 2DKPA 2DA0A 5KQ4A 1U5DA 3GYOA 2D9YA 3DXCA 3OHMB 5J3YA 2DKQA 5HE1A 4H8SA 1K5DB 2E2XA 2I5CA 4HAWB 2LOZA 1J0WA 3TO1A 2KIGA 3OANA 4MT7A 3DXEA 3HIEA 2K2JA 1QQGA 2W2XC 1WJMA 5JHGA 1DDVA 4OSNA 1KZ7A 2RNRB 5HE3A 2DYQA 1DBHA 3G9WA 1OMWA 4QJ3B 2EMSA 1UNQA 4F7HA 3FVCA 1XODA 2FJLA 3AU5A 3U8ZA 1FGYA 1P6SA 2EMTA 2RSGA 4K2PA 1X11A 2GUMA 1NI2A 2D9XA 2J59M 2ROZB 4DXAB 4EMOA 1ZVRA 4D6WA 1BTKA 3HSAA 2CODA 3KRXA 4EJNA 1W1HA 2YT2A 3P6AA 2GJYA 2R09A 4HB0B 1FAOA 3SNHA 1UPQA 4GNKB 5DH9B 2D9WA 2RGNB 3GYPA 3B77A 1WGUA 5JLJB 2COFA 2YS5A 5LONB 3PVLA 3BJIA 3ULBA 2K8EA 2DYNA 1DROA 1TJ6A 5FI1A 1DYNA 1OY2A 2AL6A 4TKNA 1W1GA 2I1JA 4DX90 4A6KA 2ADZA 3HQCA 4ZRJA 4HB3B 2P8VA 4Z2NA 4IFSA 3KRWA 2COAA 4L6EA 4GMVA 4MK0A 4GPTB 4YL8A 2KCJA 1V5MA 3FM8C 2Y8FA 4OT1A 3PEGA 4HB2B 2YRYA 5C79A 4QJ5B 3WA0A 3VIAA 2RVBB 3QBVB 1WVHA 1M7EA 3QWMA 4CSQA 2GCLA 2V76A 5KCVA 1V89A 2W2XD 2I5FA 2I1KA 2P0FA 2KR0A 5LG4B 4HHVA 2XQNM 2G35A 1Y19B 1X1GA 2CAYA 1PMSA 3MPXA 4QXAB 3DCXA 2P0DA 2YS1A 1EVHA 4CYEA 1UNRA 1X86A 3U7DA 5C16A 5DIFB 2VSZA 1XCGA 2DHKA 2D9ZA 5DHFB 2Z59A 1GC7A 1Q67A 4PNKA 3PZDA 4KHBB 2L1CA 2YSZA 1ISNA 3RCPA 2LKOA 5DI9B 2NMBA 2NZ8B 2RLOA 4CHMA 2KGXB 3M1IB 1UEFA 1SGHA 3CXBB 2OTXA 4KHBA 2R0DA 2DN6A 4L1RA 3V5WA 4DIXA 1WG7A 4HAUB 1KI1B 4HB4B 3F5RA 1FHXA 5JHHA 2Z4DA 4GMXB 1K5GB 1U2BA 5KQ1A 3PG7A 5D3YA 1X1FA 2LULA 1ZSQA 1GC6A 2MWNB 3F0WA 4D0NB 2RRFA 1MK7B 5LOPB 2K00A 2IYBA 3ZDTA 1RRPB 1ZM0A 1E5WA 1V5PA 3PSCA 1ZC4B 3A8PA 5J3QA 3SUZA 4C0AA 1EF1A 3KSYA 2UZSA 3MDBC 1FOEA 3SO6A 1PFJA 5L81A 3LJUX 5CLLB 1N3HA 5J3TA 1XKEA 1V88A 1MPHA 2KUPA 2UVMA 3BINA 2J0KA 3TVVA 4DX8A 2M38A 2GS0A 3NWFA 4K2OA 4F7GA 1EAZA 1FB8A 2Z0OA 1V61A 1I7AA 4CHJA 2N23A 2GCJA 1KZGA 4A5KA 4QJ4B 1Z87A 1MIXA 5JP4A 2LOXA 3N7CA 5D3WA 3A58A 5GOWB 1ZYIA 5HE0A 1AWEA 2K49A 1UNPA 4KVGB 1WI1A 2DHJA 1GG3A 1RJ2A 1PLSA 1FGZA 1U5EA 3SYXA 3PVUA 2LYDA 1U27A 4GOUA 3WYFB 5C6RA 2MKRA 3SV1A 1DDMA 1TQZA 1T77A 2N0YA 2YF0A 4XWXA 2ELBA 3T06A 3TW1A 1I2HA 2DTCA 3NSUA 5I2MA 4WJ7A 2D2QA 4TYZA 1BAKA 2EC1A 1FHWA 2KIEA 2AEHA 5D3XA 1NTVA 2YT1A 3NWAA 4NY0A 2HE7A 1ZC3B 3D8DA 2CY4A 2Q13A 3HW2B 4ZRIA 2Y8GA 3PP2A 2R2YA 4A6HA 2DFKA 5DHAB 1WJ1A 1MKEA 1U29A 1M7RA
chains in the Genus database with same CATH topology
1Y5OA 3TFMA 2D4QA 4IOYX 1XX0A 1NU2A 1LB1A 2DX5A 4GXBA 4P7IA 2ZPYA 4HATB 4GZUA 4B6HA 2D11A 4HAXB 4Y94A 2HTHB 5CLQB 2M14A 1X05A 1XR0B 3CIKA 1H10A 4IAPA 2P0HA 1U5GA 2ROVA 1DDWA 2CRFA 3ZVRA 2H7EA 3FSSA 4KHOA 5FI0A 4K81A 1P5TA 2LG1A 4HAYB 2EJ8A 4EKUA 1OQNA 1BWNA 3ML4A 1WGQA 4MY6A 3ULCA 4A6FB 1MAIA 5D3VA 4PQ0A 1W1DA 1LW3A 1NTYA 2JP2A 4HAVB 1FHOA 2MDXA 1SHCA 3P7ZA 3D8EA 4HDQA 4A6FA 1J19A 2D10A 4WVFB 2RUKB 1IRSA 2OQBA 5HE2A 4F7UP 4KHAA 3DXDA 3A98B 1QC6A 2DX1A 2UZRA 2H7DA 2J0MA 2X18A 1TXDA 2VKIA 4DBBA 1UPRA 1V5UA 3IVFA 2Z0QA 3AU4A 5EFXA 2ELAA 2YS3A 1P3RA 2QKMA 2Y7BA 1AQCA 1MIZB 1XD4A 4HDOA 3ODOA 2YT0A 1H4RA 3HK0A 3ODXA 3VOQA 1EGXA 2CY5A 2BCJA 1U5FA 4NSWA 3QIJA 3X23A 4WSFA 1BTNA 2DLWA 2IFSA 3FEHA 3KY9A 2VRWB 2QKLA 2YVCA 2MFQA 4ZRKA 3UZTA 3AJ4A 1MK9B 4Z2MB 2COCA 3D8FA 2DHIA 2PZ1A 3ODWA 3PVWA 2J0JA 3KZ1A 5C5BB 2K2UA 2W2WA 2L2IA 3A8QA 4YONA 4KAXB 3O96A 1B55A 4HAZB 2Z0PA 5C5BA 3TCAA 4K17A 5D27A 2D9VA 4GN1A 4BBKA 2DKPA 2DA0A 5KQ4A 1U5DA 3GYOA 2D9YA 3DXCA 5J3YA 2DKQA 5HE1A 4H8SA 1K5DB 2E2XA 2I5CA 4HAWB 2LOZA 1J0WA 3TO1A 3OANA 4MT7A 3DXEA 2K2JA 1QQGA 2W2XC 1WJMA 5JHGA 1DDVA 1KZ7A 2RNRB 5HE3A 2DYQA 1DBHA 3G9WA 1OMWA 2EMSA 1UNQA 4F7HA 1XODA 2FJLA 3AU5A 3U8ZA 1FGYA 1P6SA 2EMTA 2RSGA 4K2PA 1X11A 1NI2A 2D9XA 2J59M 2ROZB 4DXAB 4EMOA 1ZVRA 1BTKA 2CODA 3KRXA 4EJNA 1W1HA 3P6AA 2GJYA 2R09A 4HB0B 1FAOA 3SNHA 1UPQA 5DH9B 2D9WA 2RGNB 3GYPA 1WGUA 5JLJB 2COFA 2YS5A 5LONB 3PVLA 3BJIA 3ULBA 2DYNA 1DROA 1TJ6A 5FI1A 1DYNA 1OY2A 2AL6A 4TKNA 1W1GA 2I1JA 4DX90 4A6KA 2ADZA 3HQCA 4ZRJA 4HB3B 2P8VA 4Z2NA 4IFSA 3KRWA 2COAA 4L6EA 4GMVA 4MK0A 4GPTB 4YL8A 2KCJA 1V5MA 3FM8C 2Y8FA 3PEGA 4HB2B 2YRYA 5C79A 3WA0A 3VIAA 2RVBB 3QBVB 1WVHA 1M7EA 3QWMA 2GCLA 2V76A 5KCVA 1V89A 2W2XD 2I5FA 2I1KA 2P0FA 4HHVA 2XQNM 2G35A 1Y19B 1X1GA 2CAYA 1PMSA 3MPXA 2P0DA 2YS1A 1EVHA 4CYEA 1UNRA 1X86A 3U7DA 5C16A 5DIFB 2VSZA 1XCGA 2DHKA 2D9ZA 5DHFB 1GC7A 1Q67A 4PNKA 3PZDA 4KHBB 2L1CA 2YSZA 1ISNA 3RCPA 2LKOA 5DI9B 2NMBA 2NZ8B 2RLOA 4CHMA 2KGXB 3M1IB 1UEFA 1SGHA 3CXBB 2OTXA 2R0DA 2DN6A 3V5WA 1WG7A 4HAUB 1KI1B 4HB4B 3F5RA 1FHXA 5JHHA 4GMXB 1K5GB 1U2BA 5KQ1A 3PG7A 5D3YA 1X1FA 2LULA 1ZSQA 1GC6A 2MWNB 3F0WA 4D0NB 1MK7B 5LOPB 2K00A 2IYBA 3ZDTA 1RRPB 1ZM0A 1E5WA 1V5PA 3PSCA 1ZC4B 3A8PA 5J3QA 3SUZA 4C0AA 1EF1A 3KSYA 2UZSA 3MDBC 1FOEA 3SO6A 1PFJA 5L81A 3LJUX 5CLLB 1N3HA 5J3TA 1XKEA 1V88A 1MPHA 2KUPA 2UVMA 3BINA 2J0KA 3TVVA 4DX8A 2M38A 2GS0A 4K2OA 4F7GA 1EAZA 1FB8A 2Z0OA 1V61A 1I7AA 4CHJA 2N23A 2GCJA 1KZGA 4A5KA 1Z87A 1MIXA 5JP4A 2LOXA 3N7CA 5D3WA 5GOWB 5HE0A 1AWEA 1UNPA 4KVGB 1WI1A 2DHJA 1GG3A 1RJ2A 1PLSA 1FGZA 1U5EA 3SYXA 3PVUA 2LYDA 1U27A 3WYFB 5C6RA 2MKRA 3SV1A 1DDMA 1TQZA 2N0YA 2YF0A 4XWXA 2ELBA 3T06A 3TW1A 1I2HA 2DTCA 3NSUA 4WJ7A 2D2QA 4TYZA 1BAKA 2EC1A 1FHWA 2AEHA 5D3XA 1NTVA 2YT1A 4NY0A 2HE7A 1ZC3B 3D8DA 2CY4A 2Q13A 3HW2B 4ZRIA 2Y8GA 3PP2A 4A6HA 2DFKA 5DHAB 1WJ1A 1MKEA 1U29A 1M7RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y5O A;  3TFM A;  2D4Q A;  4IOY X;  1XX0 A;  1NU2 A;  1LB1 A;  2DX5 A;  4GXB A;  4P7I A;  2ZPY A;  4HAT B;  4GZU A;  4B6H A;  2D11 A;  4HAX B;  4Y94 A;  2HTH B;  5CLQ B;  2M14 A;  1X05 A;  1XR0 B;  3CIK A;  1H10 A;  4IAP A;  2P0H A;  1U5G A;  2ROV A;  1DDW A;  2CRF A;  3ZVR A;  2H7E A;  3FSS A;  4KHO A;  5FI0 A;  4K81 A;  1P5T A;  2LG1 A;  4HAY B;  2EJ8 A;  4EKU A;  1OQN A;  1BWN A;  3ML4 A;  1WGQ A;  4MY6 A;  3ULC A;  4A6F B;  1MAI A;  5D3V A;  4PQ0 A;  1W1D A;  1LW3 A;  1NTY A;  2JP2 A;  4HAV B;  1FHO A;  2MDX A;  1SHC A;  3P7Z A;  3D8E A;  4HDQ A;  4A6F A;  1J19 A;  2D10 A;  4WVF B;  2RUK B;  1IRS A;  2OQB A;  5HE2 A;  4F7U P;  4KHA A;  3DXD A;  3A98 B;  1QC6 A;  2DX1 A;  2UZR A;  2H7D A;  2J0M A;  2X18 A;  1TXD A;  2VKI A;  4DBB A;  1UPR A;  1V5U A;  3IVF A;  2Z0Q A;  3AU4 A;  5EFX A;  2ELA A;  2YS3 A;  1P3R A;  2QKM A;  2Y7B A;  1AQC A;  1MIZ B;  1XD4 A;  4HDO A;  3ODO A;  2YT0 A;  1H4R A;  3HK0 A;  3ODX A;  3VOQ A;  1EGX A;  2CY5 A;  2BCJ A;  1U5F A;  4NSW A;  3QIJ A;  3X23 A;  4WSF A;  1BTN A;  2DLW A;  2IFS A;  3FEH A;  3KY9 A;  2VRW B;  2QKL A;  2YVC A;  2MFQ A;  4ZRK A;  3UZT A;  3AJ4 A;  1MK9 B;  4Z2M B;  2COC A;  3D8F A;  2DHI A;  2PZ1 A;  3ODW A;  3PVW A;  2J0J A;  3KZ1 A;  5C5B B;  2K2U A;  2W2W A;  2L2I A;  3A8Q A;  4YON A;  4KAX B;  3O96 A;  1B55 A;  4HAZ B;  2Z0P A;  5C5B A;  3TCA A;  4K17 A;  5D27 A;  2D9V A;  4GN1 A;  4BBK A;  2DKP A;  2DA0 A;  5KQ4 A;  1U5D A;  3GYO A;  2D9Y A;  3DXC A;  5J3Y A;  2DKQ A;  5HE1 A;  4H8S A;  1K5D B;  2E2X A;  2I5C A;  4HAW B;  2LOZ A;  1J0W A;  3TO1 A;  3OAN A;  4MT7 A;  3DXE A;  2K2J A;  1QQG A;  2W2X C;  1WJM A;  5JHG A;  1DDV A;  1KZ7 A;  2RNR B;  5HE3 A;  2DYQ A;  1DBH A;  3G9W A;  1OMW A;  2EMS A;  1UNQ A;  4F7H A;  1XOD A;  2FJL A;  3AU5 A;  3U8Z A;  1FGY A;  1P6S A;  2EMT A;  2RSG A;  4K2P A;  1X11 A;  1NI2 A;  2D9X A;  2J59 M;  2ROZ B;  4DXA B;  4EMO A;  1ZVR A;  1BTK A;  2COD A;  3KRX A;  4EJN A;  1W1H A;  3P6A A;  2GJY A;  2R09 A;  4HB0 B;  1FAO A;  3SNH A;  1UPQ A;  5DH9 B;  2D9W A;  2RGN B;  3GYP A;  1WGU A;  5JLJ B;  2COF A;  2YS5 A;  5LON B;  3PVL A;  3BJI A;  3ULB A;  2DYN A;  1DRO A;  1TJ6 A;  5FI1 A;  1DYN A;  1OY2 A;  2AL6 A;  4TKN A;  1W1G A;  2I1J A;  4DX9 0;  4A6K A;  2ADZ A;  3HQC A;  4ZRJ A;  4HB3 B;  2P8V A;  4Z2N A;  4IFS A;  3KRW A;  2COA A;  4L6E A;  4GMV A;  4MK0 A;  4GPT B;  4YL8 A;  2KCJ A;  1V5M A;  3FM8 C;  2Y8F A;  3PEG A;  4HB2 B;  2YRY A;  5C79 A;  3WA0 A;  3VIA A;  2RVB B;  3QBV B;  1WVH A;  1M7E A;  3QWM A;  2GCL A;  2V76 A;  5KCV A;  1V89 A;  2W2X D;  2I5F A;  2I1K A;  2P0F A;  4HHV A;  2XQN M;  2G35 A;  1Y19 B;  1X1G A;  2CAY A;  1PMS A;  3MPX A;  2P0D A;  2YS1 A;  1EVH A;  4CYE A;  1UNR A;  1X86 A;  3U7D A;  5C16 A;  5DIF B;  2VSZ A;  1XCG A;  2DHK A;  2D9Z A;  5DHF B;  1GC7 A;  1Q67 A;  4PNK A;  3PZD A;  4KHB B;  2L1C A;  2YSZ A;  1ISN A;  3RCP A;  2LKO A;  5DI9 B;  2NMB A;  2NZ8 B;  2RLO A;  4CHM A;  2KGX B;  3M1I B;  1UEF A;  1SGH A;  3CXB B;  2OTX A;  2R0D A;  2DN6 A;  3V5W A;  1WG7 A;  4HAU B;  1KI1 B;  4HB4 B;  3F5R A;  1FHX A;  5JHH A;  4GMX B;  1K5G B;  1U2B A;  5KQ1 A;  3PG7 A;  5D3Y A;  1X1F A;  2LUL A;  1ZSQ A;  1GC6 A;  2MWN B;  3F0W A;  4D0N B;  1MK7 B;  5LOP B;  2K00 A;  2IYB A;  3ZDT A;  1RRP B;  1ZM0 A;  1E5W A;  1V5P A;  3PSC A;  1ZC4 B;  3A8P A;  5J3Q A;  3SUZ A;  4C0A A;  1EF1 A;  3KSY A;  2UZS A;  3MDB C;  1FOE A;  3SO6 A;  1PFJ A;  5L81 A;  3LJU X;  5CLL B;  1N3H A;  5J3T A;  1XKE A;  1V88 A;  1MPH A;  2KUP A;  2UVM A;  3BIN A;  2J0K A;  3TVV A;  4DX8 A;  2M38 A;  2GS0 A;  4K2O A;  4F7G A;  1EAZ A;  1FB8 A;  2Z0O A;  1V61 A;  1I7A A;  4CHJ A;  2N23 A;  2GCJ A;  1KZG A;  4A5K A;  1Z87 A;  1MIX A;  5JP4 A;  2LOX A;  3N7C A;  5D3W A;  5GOW B;  5HE0 A;  1AWE A;  1UNP A;  4KVG B;  1WI1 A;  2DHJ A;  1GG3 A;  1RJ2 A;  1PLS A;  1FGZ A;  1U5E A;  3SYX A;  3PVU A;  2LYD A;  1U27 A;  3WYF B;  5C6R A;  2MKR A;  3SV1 A;  1DDM A;  1TQZ A;  2N0Y A;  2YF0 A;  4XWX A;  2ELB A;  3T06 A;  3TW1 A;  1I2H A;  2DTC A;  3NSU A;  4WJ7 A;  2D2Q A;  4TYZ A;  1BAK A;  2EC1 A;  1FHW A;  2AEH A;  5D3X A;  1NTV A;  2YT1 A;  4NY0 A;  2HE7 A;  1ZC3 B;  3D8D A;  2CY4 A;  2Q13 A;  3HW2 B;  4ZRI A;  2Y8G A;  3PP2 A;  4A6H A;  2DFK A;  5DHA B;  1WJ1 A;  1MKE A;  1U29 A;  1M7R A; 
#chains in the Genus database with same CATH topology
 1Y5O A;  3TFM A;  2D4Q A;  4IOY X;  1XX0 A;  1NU2 A;  1LB1 A;  2DX5 A;  4GXB A;  4P7I A;  2ZPY A;  4HAT B;  4GZU A;  5I2S A;  4B6H A;  3U12 A;  2D11 A;  4HAX B;  4Y94 A;  2HTH B;  5CLQ B;  2M14 A;  2NBV A;  1X05 A;  1XR0 B;  3CIK A;  1H10 A;  4IAP A;  2P0H A;  1U5G A;  2ROV A;  1DDW A;  2CRF A;  3ZVR A;  2H7E A;  3FSS A;  4KHO A;  5FI0 A;  4K81 A;  1P5T A;  2LG1 A;  2Z13 A;  4HAY B;  2EJ8 A;  4EKU A;  1OQN A;  1BWN A;  3ML4 A;  1WGQ A;  4MY6 A;  3ULC A;  2ZKM X;  4A6F B;  1MAI A;  5D3V A;  4PQ0 A;  1W1D A;  1LW3 A;  1NTY A;  2JP2 A;  4HAV B;  1FHO A;  2MDX A;  1SHC A;  3P7Z A;  3D8E A;  4HDQ A;  4A6F A;  1J19 A;  2D10 A;  4WVF B;  2RUK B;  1IRS A;  2OQB A;  5HE2 A;  4F7U P;  4KHA A;  3DXD A;  3A98 B;  1QC6 A;  2DX1 A;  2UZR A;  2H7D A;  2J0M A;  2X18 A;  1TXD A;  2VKI A;  4DBB A;  2KUQ A;  1UPR A;  1V5U A;  3IVF A;  1MI1 A;  2Z0Q A;  3AU4 A;  5EFX A;  3NW8 A;  2ELA A;  2YS3 A;  1P3R A;  2QKM A;  2Y7B A;  1AQC A;  1MIZ B;  1XD4 A;  4HDO A;  5M4Y B;  2FJU B;  3ODO A;  2YT0 A;  1H4R A;  3HK0 A;  3ODX A;  3VOQ A;  1EGX A;  2CY5 A;  2BCJ A;  1U5F A;  4NSW A;  3QIJ A;  3X23 A;  4WSF A;  1BTN A;  2DLW A;  2IFS A;  3FEH A;  3KY9 A;  2VRW B;  2QKL A;  2YVC A;  5IRS A;  2MFQ A;  4ZRK A;  3UZT A;  3AJ4 A;  1MK9 B;  4Z2M B;  2COC A;  3D8F A;  2DHI A;  2PZ1 A;  3NWD A;  3ODW A;  3PVW A;  2Z14 A;  2J0J A;  3KZ1 A;  5C5B B;  2K2U A;  2W2W A;  2L2I A;  3A8Q A;  4YON A;  4KAX B;  3O96 A;  1B55 A;  4HAZ B;  2Z0P A;  5C5B A;  4HSI A;  3TCA A;  4K17 A;  5D27 A;  2D9V A;  4GN1 A;  4BBK A;  2DKP A;  2DA0 A;  5KQ4 A;  1U5D A;  3GYO A;  2D9Y A;  3DXC A;  3OHM B;  5J3Y A;  2DKQ A;  5HE1 A;  4H8S A;  1K5D B;  2E2X A;  2I5C A;  4HAW B;  2LOZ A;  1J0W A;  3TO1 A;  2KIG A;  3OAN A;  4MT7 A;  3DXE A;  3HIE A;  2K2J A;  1QQG A;  2W2X C;  1WJM A;  5JHG A;  1DDV A;  4OSN A;  1KZ7 A;  2RNR B;  5HE3 A;  2DYQ A;  1DBH A;  3G9W A;  1OMW A;  4QJ3 B;  2EMS A;  1UNQ A;  4F7H A;  3FVC A;  1XOD A;  2FJL A;  3AU5 A;  3U8Z A;  1FGY A;  1P6S A;  2EMT A;  2RSG A;  4K2P A;  1X11 A;  2GUM A;  1NI2 A;  2D9X A;  2J59 M;  2ROZ B;  4DXA B;  4EMO A;  1ZVR A;  4D6W A;  1BTK A;  3HSA A;  2COD A;  3KRX A;  4EJN A;  1W1H A;  2YT2 A;  3P6A A;  2GJY A;  2R09 A;  4HB0 B;  1FAO A;  3SNH A;  1UPQ A;  4GNK B;  5DH9 B;  2D9W A;  2RGN B;  3GYP A;  3B77 A;  1WGU A;  5JLJ B;  2COF A;  2YS5 A;  5LON B;  3PVL A;  3BJI A;  3ULB A;  2K8E A;  2DYN A;  1DRO A;  1TJ6 A;  5FI1 A;  1DYN A;  1OY2 A;  2AL6 A;  4TKN A;  1W1G A;  2I1J A;  4DX9 0;  4A6K A;  2ADZ A;  3HQC A;  4ZRJ A;  4HB3 B;  2P8V A;  4Z2N A;  4IFS A;  3KRW A;  2COA A;  4L6E A;  4GMV A;  4MK0 A;  4GPT B;  4YL8 A;  2KCJ A;  1V5M A;  3FM8 C;  2Y8F A;  4OT1 A;  3PEG A;  4HB2 B;  2YRY A;  5C79 A;  4QJ5 B;  3WA0 A;  3VIA A;  2RVB B;  3QBV B;  1WVH A;  1M7E A;  3QWM A;  4CSQ A;  2GCL A;  2V76 A;  5KCV A;  1V89 A;  2W2X D;  2I5F A;  2I1K A;  2P0F A;  2KR0 A;  5LG4 B;  4HHV A;  2XQN M;  2G35 A;  1Y19 B;  1X1G A;  2CAY A;  1PMS A;  3MPX A;  4QXA B;  3DCX A;  2P0D A;  2YS1 A;  1EVH A;  4CYE A;  1UNR A;  1X86 A;  3U7D A;  5C16 A;  5DIF B;  2VSZ A;  1XCG A;  2DHK A;  2D9Z A;  5DHF B;  2Z59 A;  1GC7 A;  1Q67 A;  4PNK A;  3PZD A;  4KHB B;  2L1C A;  2YSZ A;  1ISN A;  3RCP A;  2LKO A;  5DI9 B;  2NMB A;  2NZ8 B;  2RLO A;  4CHM A;  2KGX B;  3M1I B;  1UEF A;  1SGH A;  3CXB B;  2OTX A;  4KHB A;  2R0D A;  2DN6 A;  4L1R A;  3V5W A;  4DIX A;  1WG7 A;  4HAU B;  1KI1 B;  4HB4 B;  3F5R A;  1FHX A;  5JHH A;  2Z4D A;  4GMX B;  1K5G B;  1U2B A;  5KQ1 A;  3PG7 A;  5D3Y A;  1X1F A;  2LUL A;  1ZSQ A;  1GC6 A;  2MWN B;  3F0W A;  4D0N B;  2RRF A;  1MK7 B;  5LOP B;  2K00 A;  2IYB A;  3ZDT A;  1RRP B;  1ZM0 A;  1E5W A;  1V5P A;  3PSC A;  1ZC4 B;  3A8P A;  5J3Q A;  3SUZ A;  4C0A A;  1EF1 A;  3KSY A;  2UZS A;  3MDB C;  1FOE A;  3SO6 A;  1PFJ A;  5L81 A;  3LJU X;  5CLL B;  1N3H A;  5J3T A;  1XKE A;  1V88 A;  1MPH A;  2KUP A;  2UVM A;  3BIN A;  2J0K A;  3TVV A;  4DX8 A;  2M38 A;  2GS0 A;  3NWF A;  4K2O A;  4F7G A;  1EAZ A;  1FB8 A;  2Z0O A;  1V61 A;  1I7A A;  4CHJ A;  2N23 A;  2GCJ A;  1KZG A;  4A5K A;  4QJ4 B;  1Z87 A;  1MIX A;  5JP4 A;  2LOX A;  3N7C A;  5D3W A;  3A58 A;  5GOW B;  1ZYI A;  5HE0 A;  1AWE A;  2K49 A;  1UNP A;  4KVG B;  1WI1 A;  2DHJ A;  1GG3 A;  1RJ2 A;  1PLS A;  1FGZ A;  1U5E A;  3SYX A;  3PVU A;  2LYD A;  1U27 A;  4GOU A;  3WYF B;  5C6R A;  2MKR A;  3SV1 A;  1DDM A;  1TQZ A;  1T77 A;  2N0Y A;  2YF0 A;  4XWX A;  2ELB A;  3T06 A;  3TW1 A;  1I2H A;  2DTC A;  3NSU A;  5I2M A;  4WJ7 A;  2D2Q A;  4TYZ A;  1BAK A;  2EC1 A;  1FHW A;  2KIE A;  2AEH A;  5D3X A;  1NTV A;  2YT1 A;  3NWA A;  4NY0 A;  2HE7 A;  1ZC3 B;  3D8D A;  2CY4 A;  2Q13 A;  3HW2 B;  4ZRI A;  2Y8G A;  3PP2 A;  2R2Y A;  4A6H A;  2DFK A;  5DHA B;  1WJ1 A;  1MKE A;  1U29 A;  1M7R A; 
#chains in the Genus database with same CATH homology
 1Y5O A;  3TFM A;  2D4Q A;  4IOY X;  1XX0 A;  1NU2 A;  1LB1 A;  2DX5 A;  4GXB A;  4P7I A;  2ZPY A;  4HAT B;  4GZU A;  4B6H A;  2D11 A;  4HAX B;  4Y94 A;  2HTH B;  5CLQ B;  2M14 A;  1X05 A;  1XR0 B;  3CIK A;  1H10 A;  4IAP A;  2P0H A;  1U5G A;  2ROV A;  1DDW A;  2CRF A;  3ZVR A;  2H7E A;  3FSS A;  4KHO A;  5FI0 A;  4K81 A;  1P5T A;  2LG1 A;  4HAY B;  2EJ8 A;  4EKU A;  1OQN A;  1BWN A;  3ML4 A;  1WGQ A;  4MY6 A;  3ULC A;  4A6F B;  1MAI A;  5D3V A;  4PQ0 A;  1W1D A;  1LW3 A;  1NTY A;  2JP2 A;  4HAV B;  1FHO A;  2MDX A;  1SHC A;  3P7Z A;  3D8E A;  4HDQ A;  4A6F A;  1J19 A;  2D10 A;  4WVF B;  2RUK B;  1IRS A;  2OQB A;  5HE2 A;  4F7U P;  4KHA A;  3DXD A;  3A98 B;  1QC6 A;  2DX1 A;  2UZR A;  2H7D A;  2J0M A;  2X18 A;  1TXD A;  2VKI A;  4DBB A;  1UPR A;  1V5U A;  3IVF A;  2Z0Q A;  3AU4 A;  5EFX A;  2ELA A;  2YS3 A;  1P3R A;  2QKM A;  2Y7B A;  1AQC A;  1MIZ B;  1XD4 A;  4HDO A;  3ODO A;  2YT0 A;  1H4R A;  3HK0 A;  3ODX A;  3VOQ A;  1EGX A;  2CY5 A;  2BCJ A;  1U5F A;  4NSW A;  3QIJ A;  3X23 A;  4WSF A;  1BTN A;  2DLW A;  2IFS A;  3FEH A;  3KY9 A;  2VRW B;  2QKL A;  2YVC A;  2MFQ A;  4ZRK A;  3UZT A;  3AJ4 A;  1MK9 B;  4Z2M B;  2COC A;  3D8F A;  2DHI A;  2PZ1 A;  3ODW A;  3PVW A;  2J0J A;  3KZ1 A;  5C5B B;  2K2U A;  2W2W A;  2L2I A;  3A8Q A;  4YON A;  4KAX B;  3O96 A;  1B55 A;  4HAZ B;  2Z0P A;  5C5B A;  3TCA A;  4K17 A;  5D27 A;  2D9V A;  4GN1 A;  4BBK A;  2DKP A;  2DA0 A;  5KQ4 A;  1U5D A;  3GYO A;  2D9Y A;  3DXC A;  5J3Y A;  2DKQ A;  5HE1 A;  4H8S A;  1K5D B;  2E2X A;  2I5C A;  4HAW B;  2LOZ A;  1J0W A;  3TO1 A;  3OAN A;  4MT7 A;  3DXE A;  2K2J A;  1QQG A;  2W2X C;  1WJM A;  5JHG A;  1DDV A;  1KZ7 A;  2RNR B;  5HE3 A;  2DYQ A;  1DBH A;  3G9W A;  1OMW A;  2EMS A;  1UNQ A;  4F7H A;  1XOD A;  2FJL A;  3AU5 A;  3U8Z A;  1FGY A;  1P6S A;  2EMT A;  2RSG A;  4K2P A;  1X11 A;  1NI2 A;  2D9X A;  2J59 M;  2ROZ B;  4DXA B;  4EMO A;  1ZVR A;  1BTK A;  2COD A;  3KRX A;  4EJN A;  1W1H A;  3P6A A;  2GJY A;  2R09 A;  4HB0 B;  1FAO A;  3SNH A;  1UPQ A;  5DH9 B;  2D9W A;  2RGN B;  3GYP A;  1WGU A;  5JLJ B;  2COF A;  2YS5 A;  5LON B;  3PVL A;  3BJI A;  3ULB A;  2DYN A;  1DRO A;  1TJ6 A;  5FI1 A;  1DYN A;  1OY2 A;  2AL6 A;  4TKN A;  1W1G A;  2I1J A;  4DX9 0;  4A6K A;  2ADZ A;  3HQC A;  4ZRJ A;  4HB3 B;  2P8V A;  4Z2N A;  4IFS A;  3KRW A;  2COA A;  4L6E A;  4GMV A;  4MK0 A;  4GPT B;  4YL8 A;  2KCJ A;  1V5M A;  3FM8 C;  2Y8F A;  3PEG A;  4HB2 B;  2YRY A;  5C79 A;  3WA0 A;  3VIA A;  2RVB B;  3QBV B;  1WVH A;  1M7E A;  3QWM A;  2GCL A;  2V76 A;  5KCV A;  1V89 A;  2W2X D;  2I5F A;  2I1K A;  2P0F A;  4HHV A;  2XQN M;  2G35 A;  1Y19 B;  1X1G A;  2CAY A;  1PMS A;  3MPX A;  2P0D A;  2YS1 A;  1EVH A;  4CYE A;  1UNR A;  1X86 A;  3U7D A;  5C16 A;  5DIF B;  2VSZ A;  1XCG A;  2DHK A;  2D9Z A;  5DHF B;  1GC7 A;  1Q67 A;  4PNK A;  3PZD A;  4KHB B;  2L1C A;  2YSZ A;  1ISN A;  3RCP A;  2LKO A;  5DI9 B;  2NMB A;  2NZ8 B;  2RLO A;  4CHM A;  2KGX B;  3M1I B;  1UEF A;  1SGH A;  3CXB B;  2OTX A;  2R0D A;  2DN6 A;  3V5W A;  1WG7 A;  4HAU B;  1KI1 B;  4HB4 B;  3F5R A;  1FHX A;  5JHH A;  4GMX B;  1K5G B;  1U2B A;  5KQ1 A;  3PG7 A;  5D3Y A;  1X1F A;  2LUL A;  1ZSQ A;  1GC6 A;  2MWN B;  3F0W A;  4D0N B;  1MK7 B;  5LOP B;  2K00 A;  2IYB A;  3ZDT A;  1RRP B;  1ZM0 A;  1E5W A;  1V5P A;  3PSC A;  1ZC4 B;  3A8P A;  5J3Q A;  3SUZ A;  4C0A A;  1EF1 A;  3KSY A;  2UZS A;  3MDB C;  1FOE A;  3SO6 A;  1PFJ A;  5L81 A;  3LJU X;  5CLL B;  1N3H A;  5J3T A;  1XKE A;  1V88 A;  1MPH A;  2KUP A;  2UVM A;  3BIN A;  2J0K A;  3TVV A;  4DX8 A;  2M38 A;  2GS0 A;  4K2O A;  4F7G A;  1EAZ A;  1FB8 A;  2Z0O A;  1V61 A;  1I7A A;  4CHJ A;  2N23 A;  2GCJ A;  1KZG A;  4A5K A;  1Z87 A;  1MIX A;  5JP4 A;  2LOX A;  3N7C A;  5D3W A;  5GOW B;  5HE0 A;  1AWE A;  1UNP A;  4KVG B;  1WI1 A;  2DHJ A;  1GG3 A;  1RJ2 A;  1PLS A;  1FGZ A;  1U5E A;  3SYX A;  3PVU A;  2LYD A;  1U27 A;  3WYF B;  5C6R A;  2MKR A;  3SV1 A;  1DDM A;  1TQZ A;  2N0Y A;  2YF0 A;  4XWX A;  2ELB A;  3T06 A;  3TW1 A;  1I2H A;  2DTC A;  3NSU A;  4WJ7 A;  2D2Q A;  4TYZ A;  1BAK A;  2EC1 A;  1FHW A;  2AEH A;  5D3X A;  1NTV A;  2YT1 A;  4NY0 A;  2HE7 A;  1ZC3 B;  3D8D A;  2CY4 A;  2Q13 A;  3HW2 B;  4ZRI A;  2Y8G A;  3PP2 A;  4A6H A;  2DFK A;  5DHA B;  1WJ1 A;  1MKE A;  1U29 A;  1M7R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...