1J0WA

Crystal structure analysis of the dok-5 ptb domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
99
structure length
99
Chain Sequence
QSERFNVYLMPSPNLDVHGECALQITYEYICLWDVQNPRVKLISWPLSALRRYGRDTTWFTFEAGRMCETGEGLFIFQTRDGEAIYQKVHSAALAIAEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords downstream of tyrosine kinase 5
publication title Crystal Structure Analysis of the Dok-5 PTB Domain
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 18
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature ec 2.7.1.112: Transferred entry: 2.7.10.1 and 2.7.10.2.
pdb deposition date 2002-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02174 IRS PTB domain (IRS-1 type)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1j0wA00
2H7EA 3T06A 2D10A 1V61A 2N0YA 2LOXA 4KAXB 2RNRB 2RVBB 5J3YA 4HDQA 3PVLA 2PZ1A 3DXCA 4TKNA 4A6FB 1Y5OA 1W1GA 2LOZA 2MWNB 1ISNA 4HAUB 1EGXA 4GN1A 2DHJA 2V76A 3KZ1A 4A5KA 1MIXA 5LOPB 2YVCA 4EJNA 3FM8C 5J3TA 2CAYA 1TQZA 2VSZA 1SGHA 1M7RA 3TCAA 1WGQA 5JHHA 1ZM0A 2ZPYA 1BTNA 2ROVA 1MIZB 3ZDTA 2COCA 4F7HA 5DHFB 1NTVA 1WGUA 5KQ1A 1XX0A 1UNPA 1PFJA 2J0MA 4Y94A 1P5TA 1B55A 3WYFB 3ODXA 1V5MA 5D3XA 1J0WA 3KRXA 1U27A 1DDMA 1K5DB 1E5WA 2M38A 1MPHA 3P7ZA 1EAZA 3A8PA 4HHVA 2DHKA 3UZTA 4H8SA 2D2QA 1MKEA 5HE1A 1EF1A 1LB1A 5JP4A 2YS1A 2DFKA 1DDVA 2MDXA 5LONB 1V5PA 3CXBB 5D27A 1W1DA 4HATB 1ZC3B 2E2XA 2M14A 2D9WA 2AEHA 2DYQA 1WI1A 2R09A 2ROZB 2RGNB 4GZUA 5FI0A 1OMWA 1U5DA 1X05A 4HB0B 4WSFA 4ZRIA 2YSZA 5C16A 4HB3B 1EVHA 3ULBA 4MY6A 2YS5A 1X11A 3M1IB 3VOQA 2K00A 1QQGA 2D9YA 4IFSA 2N23A 3KSYA 4P7IA 4F7GA 2NZ8B 1NTYA 1P3RA 3D8EA 2DKPA 2W2XC 5KCVA 2JP2A 3AJ4A 2CY5A 2EJ8A 5DI9B 2COFA 1KZ7A 4WVFB 5JLJB 2J0JA 4CHMA 2P0FA 4MK0A 1I7AA 5D3YA 4DX90 4F7UP 1M7EA 1KI1B 3PVWA 1BTKA 2D9VA 4Z2MB 3RCPA 1DBHA 3O96A 1WJMA 2YRYA 1NU2A 2KGXB 5DHAB 2G35A 2W2XD 2OTXA 5HE3A 2GS0A 2DA0A 1LW3A 2AL6A 2J0KA 2GCJA 1Q67A 4D0NB 2Z0OA 1H10A 1FAOA 4K81A 2DKQA 4KHAA 3SNHA 5C5BA 3AU4A 1MAIA 2HE7A 1AQCA 1GG3A 2UVMA 3ZVRA 2DX1A 2D11A 3F5RA 4HB2B 3D8FA 3MPXA 2R0DA 4ZRKA 2UZRA 3P6AA 1ZSQA 2LULA 5C6RA 1IRSA 2IYBA 4L6EA 2COAA 4A6FA 3ODWA 2P0DA 4NY0A 4A6HA 2YT1A 4K17A 2YF0A 2GJYA 1RRPB 4EKUA 2DTCA 2Q13A 2RLOA 2QKLA 1QC6A 3IVFA 4DX8A 3BJIA 4ZRJA 4GPTB 2L2IA 1XKEA 2DYNA 1UEFA 2K2JA 4HAVB 4MT7A 2LYDA 2DLWA 3HK0A 3HW2B 3G9WA 2MFQA 1GC7A 2I5CA 1MK7B 3PP2A 1U2BA 4GXBA 3SV1A 4YL8A 4IOYX 3PSCA 1K5GB 1KZGA 2RSGA 5C79A 5DH9B 1U5GA 1N3HA 2D4QA 1WG7A 4HAWB 1FGZA 2Y8GA 1AWEA 1DYNA 3AU5A 1UPRA 4HDOA 1FB8A 4B6HA 3SUZA 1U5FA 1U29A 2ELBA 1X1FA 4NSWA 3DXDA 3PZDA 4GMXB 3MDBC 3FEHA 3QIJA 4HAXB 2D9ZA 4A6KA 4GMVA 1XD4A 2I1JA 1H4RA 2KCJA 1DROA 2QKMA 3SYXA 5CLQB 5GOWB 2J59M 1DDWA 3TVVA 2CODA 3QWMA 1Z87A 1FHOA 2DN6A 2RUKB 2UZSA 2DHIA 2Y7BA 3ODOA 4TYZA 1V5UA 2EC1A 2GCLA 3KRWA 4CHJA 1BAKA 1U5EA 1Y19B 4DBBA 3KY9A 4KHBB 2OQBA 2ADZA 2I5FA 2Z0QA 1V89A 1WVHA 3BINA 1I2HA 1RJ2A 5D3VA 2NMBA 3PVUA 5HE0A 3X23A 1XR0B 5D3WA 1FHXA 1TJ6A 4CYEA 4PQ0A 2X18A 3A98B 3OANA 1UNRA 1X86A 4PNKA 1W1HA 1WJ1A 3TFMA 2BCJA 5DIFB 2D9XA 2K2UA 3TW1A 2MKRA 1XODA 1X1GA 2Y8FA 5L81A 3FSSA 3ML4A 1FOEA 4HAZB 5CLLB 4K2OA 2ELAA 1NI2A 4KHOA 1FGYA 1P6SA 2DX5A 3PEGA 3U8ZA 1V88A 5KQ4A 3NSUA 2YS3A 3WA0A 2IFSA 4KVGB 1FHWA 1PLSA 5HE2A 2HTHB 2VRWB 2P8VA 2KUPA 2FJLA 4XWXA 1BWNA 4BBKA 2LG1A 1XCGA 4Z2NA 2VKIA 3ULCA 3F0WA 4K2PA 2LKOA 3DXEA 3CIKA 3HQCA 1OQNA 1OY2A 4DXAB 4YONA 3VIAA 5FI1A 5JHGA 1PMSA 2Z0PA 5EFXA 1J19A 1SHCA 2CY4A 4IAPA 1MK9B 1ZVRA 5J3QA 3GYOA 1UNQA 2YT0A 3N7CA 2XQNM 3PG7A 2W2WA 2H7DA 3TO1A 3U7DA 3V5WA 3A8QA 3D8DA 2EMSA 1GC6A 3LJUX 3SO6A 3GYPA 4C0AA 2P0HA 5C5BB 4HB4B 2I1KA 4HAYB 2L1CA 2CRFA 3QBVB 4EMOA 4WJ7A 1ZC4B 2EMTA 1UPQA 1TXDA
chains in the Genus database with same CATH superfamily
2H7EA 3T06A 2D10A 1V61A 2N0YA 2LOXA 4KAXB 2RNRB 2RVBB 5J3YA 4HDQA 2FJUB 3PVLA 2PZ1A 3DXCA 4TKNA 4A6FB 1Y5OA 4L1RA 4OT1A 1W1GA 2LOZA 2MWNB 1ISNA 4HAUB 1EGXA 4GN1A 2DHJA 2V76A 3KZ1A 4A5KA 1MIXA 5LOPB 2YVCA 3HIEA 4EJNA 3FM8C 5J3TA 2CAYA 1TQZA 2VSZA 1SGHA 1M7RA 5IRSA 3TCAA 1WGQA 5JHHA 1ZM0A 2ZPYA 1BTNA 2ROVA 1MIZB 3HSAA 4DIXA 3FVCA 3ZDTA 2COCA 5I2MA 4F7HA 5DHFB 1NTVA 1WGUA 5KQ1A 5M4YB 4KHBA 2RRFA 1XX0A 1UNPA 1PFJA 2J0MA 4Y94A 1P5TA 2ZKMX 1B55A 3WYFB 3ODXA 1V5MA 5D3XA 3NWDA 1J0WA 3KRXA 4D6WA 1U27A 1DDMA 1K5DB 1E5WA 2M38A 1MPHA 3P7ZA 1EAZA 3A8PA 4HHVA 2DHKA 3UZTA 4H8SA 2D2QA 1MKEA 5HE1A 2YT2A 1EF1A 1LB1A 5JP4A 2YS1A 2DFKA 1DDVA 2MDXA 5LONB 1V5PA 3CXBB 5D27A 1W1DA 4HATB 1ZC3B 2E2XA 2M14A 2D9WA 2GUMA 2AEHA 2DYQA 1WI1A 2R09A 2ROZB 2RGNB 3NWAA 4GZUA 5FI0A 1OMWA 1U5DA 1X05A 4HB0B 4WSFA 4ZRIA 2YSZA 5C16A 4HB3B 1EVHA 3ULBA 4MY6A 2YS5A 1X11A 3M1IB 3VOQA 2K00A 1QQGA 2D9YA 4IFSA 2N23A 3KSYA 4P7IA 4F7GA 2NZ8B 1NTYA 1P3RA 3D8EA 2DKPA 2W2XC 5KCVA 2JP2A 3AJ4A 2CY5A 2EJ8A 5DI9B 2COFA 1KZ7A 4WVFB 5JLJB 2KUQA 2J0JA 4CHMA 2P0FA 4MK0A 1I7AA 5D3YA 4DX90 4F7UP 1M7EA 1KI1B 3PVWA 1BTKA 2D9VA 4Z2MB 3RCPA 1DBHA 4QJ5B 1WJMA 2YRYA 3O96A 1NU2A 2KGXB 5DHAB 2G35A 2W2XD 2OTXA 5HE3A 2Z4DA 2GS0A 2DA0A 1LW3A 2AL6A 2J0KA 2GCJA 1Q67A 2K49A 4D0NB 2Z0OA 1H10A 1FAOA 4K81A 2DKQA 4KHAA 3SNHA 5C5BA 3AU4A 1MAIA 2HE7A 1AQCA 1GG3A 2UVMA 3ZVRA 2DX1A 2D11A 3F5RA 4HB2B 3U12A 3NW8A 3D8FA 3MPXA 2R0DA 4ZRKA 4QXAB 2UZRA 3P6AA 1ZSQA 2Z13A 2LULA 5C6RA 1IRSA 2IYBA 4L6EA 2COAA 1MI1A 2P0DA 3ODWA 4NY0A 4A6FA 4A6HA 2YT1A 4K17A 4QJ3B 2YF0A 2GJYA 1RRPB 4EKUA 2DTCA 2Q13A 2RLOA 2QKLA 1QC6A 3IVFA 4DX8A 3BJIA 4ZRJA 4GPTB 2L2IA 2KIGA 1XKEA 2DYNA 1UEFA 2K2JA 4HAVB 4MT7A 2LYDA 2DLWA 3HK0A 3HW2B 3G9WA 3B77A 2MFQA 1GC7A 2I5CA 1MK7B 3PP2A 1U2BA 4GXBA 3SV1A 4HSIA 4YL8A 4QJ4B 4IOYX 3PSCA 1K5GB 1KZGA 2RSGA 5C79A 5DH9B 1U5GA 1N3HA 2D4QA 1WG7A 4HAWB 1FGZA 2Y8GA 1AWEA 1DYNA 3AU5A 5LG4B 1UPRA 4HDOA 1FB8A 4B6HA 3SUZA 1U5FA 1U29A 2ELBA 1X1FA 4NSWA 3DXDA 3PZDA 4GMXB 3MDBC 3FEHA 3QIJA 4HAXB 2D9ZA 4A6KA 4GMVA 1XD4A 2I1JA 1H4RA 2KCJA 1DROA 2QKMA 3SYXA 5CLQB 5GOWB 2J59M 1DDWA 3TVVA 2CODA 3QWMA 1Z87A 1FHOA 2DN6A 2RUKB 2UZSA 2DHIA 2Y7BA 3ODOA 4TYZA 1V5UA 2EC1A 2GCLA 3KRWA 4CHJA 1BAKA 1U5EA 1Y19B 4DBBA 5I2SA 3KY9A 4KHBB 2OQBA 2ADZA 2I5FA 2Z0QA 1V89A 1WVHA 3BINA 1I2HA 3DCXA 1RJ2A 5D3VA 2NMBA 3PVUA 5HE0A 3X23A 1XR0B 5D3WA 1FHXA 1TJ6A 4CYEA 4PQ0A 2X18A 3A98B 3OANA 1UNRA 1X86A 4PNKA 1W1HA 1WJ1A 3TFMA 2BCJA 5DIFB 2D9XA 2K2UA 3TW1A 2MKRA 3NWFA 1XODA 1X1GA 2Y8FA 5L81A 4OSNA 2Z59A 3FSSA 3ML4A 1FOEA 4HAZB 5CLLB 4K2OA 2ELAA 1NI2A 4KHOA 1FGYA 1P6SA 2DX5A 3PEGA 3U8ZA 1V88A 5KQ4A 3NSUA 2YS3A 3WA0A 2IFSA 4KVGB 1FHWA 1PLSA 5HE2A 2HTHB 2VRWB 2Z14A 2P8VA 2KUPA 2FJLA 4XWXA 1BWNA 4BBKA 2LG1A 1XCGA 4GOUA 4Z2NA 2VKIA 3ULCA 3F0WA 4K2PA 2LKOA 3DXEA 3CIKA 3HQCA 1OQNA 1OY2A 2KR0A 4YONA 4CSQA 3VIAA 4DXAB 5FI1A 5JHGA 1PMSA 2Z0PA 5EFXA 1J19A 1SHCA 2CY4A 4IAPA 1MK9B 3A58A 1ZYIA 1ZVRA 5J3QA 3GYOA 1UNQA 2YT0A 1T77A 3N7CA 2XQNM 3PG7A 2NBVA 2W2WA 2H7DA 3TO1A 3U7DA 3V5WA 3A8QA 2K8EA 3D8DA 2EMSA 1GC6A 3LJUX 3OHMB 3SO6A 3GYPA 4C0AA 2P0HA 5C5BB 4HB4B 2KIEA 2I1KA 4GNKB 4HAYB 2L1CA 2CRFA 3QBVB 2R2YA 4EMOA 4WJ7A 1ZC4B 2EMTA 1UPQA 1TXDA
chains in the Genus database with same CATH topology
2H7EA 3T06A 2D10A 1V61A 2N0YA 2LOXA 4KAXB 2RNRB 2RVBB 5J3YA 4HDQA 3PVLA 2PZ1A 3DXCA 4TKNA 4A6FB 1Y5OA 1W1GA 2LOZA 2MWNB 1ISNA 4HAUB 1EGXA 4GN1A 2DHJA 2V76A 3KZ1A 4A5KA 1MIXA 5LOPB 2YVCA 4EJNA 3FM8C 5J3TA 2CAYA 1TQZA 2VSZA 1SGHA 1M7RA 3TCAA 1WGQA 5JHHA 1ZM0A 2ZPYA 1BTNA 2ROVA 1MIZB 3ZDTA 2COCA 4F7HA 5DHFB 1NTVA 1WGUA 5KQ1A 1XX0A 1UNPA 1PFJA 2J0MA 4Y94A 1P5TA 1B55A 3WYFB 3ODXA 1V5MA 5D3XA 1J0WA 3KRXA 1U27A 1DDMA 1K5DB 1E5WA 2M38A 1MPHA 3P7ZA 1EAZA 3A8PA 4HHVA 2DHKA 3UZTA 4H8SA 2D2QA 1MKEA 5HE1A 1EF1A 1LB1A 5JP4A 2YS1A 2DFKA 1DDVA 2MDXA 5LONB 1V5PA 3CXBB 5D27A 1W1DA 4HATB 1ZC3B 2E2XA 2M14A 2D9WA 2AEHA 2DYQA 1WI1A 2R09A 2ROZB 2RGNB 4GZUA 5FI0A 1OMWA 1U5DA 1X05A 4HB0B 4WSFA 4ZRIA 2YSZA 5C16A 4HB3B 1EVHA 3ULBA 4MY6A 2YS5A 1X11A 3M1IB 3VOQA 2K00A 1QQGA 2D9YA 4IFSA 2N23A 3KSYA 4P7IA 4F7GA 2NZ8B 1NTYA 1P3RA 3D8EA 2DKPA 2W2XC 5KCVA 2JP2A 3AJ4A 2CY5A 2EJ8A 5DI9B 2COFA 1KZ7A 4WVFB 5JLJB 2J0JA 4CHMA 2P0FA 4MK0A 1I7AA 5D3YA 4DX90 4F7UP 1M7EA 1KI1B 3PVWA 1BTKA 2D9VA 4Z2MB 3RCPA 1DBHA 3O96A 1WJMA 2YRYA 1NU2A 2KGXB 5DHAB 2G35A 2W2XD 2OTXA 5HE3A 2GS0A 2DA0A 1LW3A 2AL6A 2J0KA 2GCJA 1Q67A 4D0NB 2Z0OA 1H10A 1FAOA 4K81A 2DKQA 4KHAA 3SNHA 5C5BA 3AU4A 1MAIA 2HE7A 1AQCA 1GG3A 2UVMA 3ZVRA 2DX1A 2D11A 3F5RA 4HB2B 3D8FA 3MPXA 2R0DA 4ZRKA 2UZRA 3P6AA 1ZSQA 2LULA 5C6RA 1IRSA 2IYBA 4L6EA 2COAA 4A6FA 3ODWA 2P0DA 4NY0A 4A6HA 2YT1A 4K17A 2YF0A 2GJYA 1RRPB 4EKUA 2DTCA 2Q13A 2RLOA 2QKLA 1QC6A 3IVFA 4DX8A 3BJIA 4ZRJA 4GPTB 2L2IA 1XKEA 2DYNA 1UEFA 2K2JA 4HAVB 4MT7A 2LYDA 2DLWA 3HK0A 3HW2B 3G9WA 2MFQA 1GC7A 2I5CA 1MK7B 3PP2A 1U2BA 4GXBA 3SV1A 4YL8A 4IOYX 3PSCA 1K5GB 1KZGA 2RSGA 5C79A 5DH9B 1U5GA 1N3HA 2D4QA 1WG7A 4HAWB 1FGZA 2Y8GA 1AWEA 1DYNA 3AU5A 1UPRA 4HDOA 1FB8A 4B6HA 3SUZA 1U5FA 1U29A 2ELBA 1X1FA 4NSWA 3DXDA 3PZDA 4GMXB 3MDBC 3FEHA 3QIJA 4HAXB 2D9ZA 4A6KA 4GMVA 1XD4A 2I1JA 1H4RA 2KCJA 1DROA 2QKMA 3SYXA 5CLQB 5GOWB 2J59M 1DDWA 3TVVA 2CODA 3QWMA 1Z87A 1FHOA 2DN6A 2RUKB 2UZSA 2DHIA 2Y7BA 3ODOA 4TYZA 1V5UA 2EC1A 2GCLA 3KRWA 4CHJA 1BAKA 1U5EA 1Y19B 4DBBA 3KY9A 4KHBB 2OQBA 2ADZA 2I5FA 2Z0QA 1V89A 1WVHA 3BINA 1I2HA 1RJ2A 5D3VA 2NMBA 3PVUA 5HE0A 3X23A 1XR0B 5D3WA 1FHXA 1TJ6A 4CYEA 4PQ0A 2X18A 3A98B 3OANA 1UNRA 1X86A 4PNKA 1W1HA 1WJ1A 3TFMA 2BCJA 5DIFB 2D9XA 2K2UA 3TW1A 2MKRA 1XODA 1X1GA 2Y8FA 5L81A 3FSSA 3ML4A 1FOEA 4HAZB 5CLLB 4K2OA 2ELAA 1NI2A 4KHOA 1FGYA 1P6SA 2DX5A 3PEGA 3U8ZA 1V88A 5KQ4A 3NSUA 2YS3A 3WA0A 2IFSA 4KVGB 1FHWA 1PLSA 5HE2A 2HTHB 2VRWB 2P8VA 2KUPA 2FJLA 4XWXA 1BWNA 4BBKA 2LG1A 1XCGA 4Z2NA 2VKIA 3ULCA 3F0WA 4K2PA 2LKOA 3DXEA 3CIKA 3HQCA 1OQNA 1OY2A 4DXAB 4YONA 3VIAA 5FI1A 5JHGA 1PMSA 2Z0PA 5EFXA 1J19A 1SHCA 2CY4A 4IAPA 1MK9B 1ZVRA 5J3QA 3GYOA 1UNQA 2YT0A 3N7CA 2XQNM 3PG7A 2W2WA 2H7DA 3TO1A 3U7DA 3V5WA 3A8QA 3D8DA 2EMSA 1GC6A 3LJUX 3SO6A 3GYPA 4C0AA 2P0HA 5C5BB 4HB4B 2I1KA 4HAYB 2L1CA 2CRFA 3QBVB 4EMOA 4WJ7A 1ZC4B 2EMTA 1UPQA 1TXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H7E A;  3T06 A;  2D10 A;  1V61 A;  2N0Y A;  2LOX A;  4KAX B;  2RNR B;  2RVB B;  5J3Y A;  4HDQ A;  3PVL A;  2PZ1 A;  3DXC A;  4TKN A;  4A6F B;  1Y5O A;  1W1G A;  2LOZ A;  2MWN B;  1ISN A;  4HAU B;  1EGX A;  4GN1 A;  2DHJ A;  2V76 A;  3KZ1 A;  4A5K A;  1MIX A;  5LOP B;  2YVC A;  4EJN A;  3FM8 C;  5J3T A;  2CAY A;  1TQZ A;  2VSZ A;  1SGH A;  1M7R A;  3TCA A;  1WGQ A;  5JHH A;  1ZM0 A;  2ZPY A;  1BTN A;  2ROV A;  1MIZ B;  3ZDT A;  2COC A;  4F7H A;  5DHF B;  1NTV A;  1WGU A;  5KQ1 A;  1XX0 A;  1UNP A;  1PFJ A;  2J0M A;  4Y94 A;  1P5T A;  1B55 A;  3WYF B;  3ODX A;  1V5M A;  5D3X A;  1J0W A;  3KRX A;  1U27 A;  1DDM A;  1K5D B;  1E5W A;  2M38 A;  1MPH A;  3P7Z A;  1EAZ A;  3A8P A;  4HHV A;  2DHK A;  3UZT A;  4H8S A;  2D2Q A;  1MKE A;  5HE1 A;  1EF1 A;  1LB1 A;  5JP4 A;  2YS1 A;  2DFK A;  1DDV A;  2MDX A;  5LON B;  1V5P A;  3CXB B;  5D27 A;  1W1D A;  4HAT B;  1ZC3 B;  2E2X A;  2M14 A;  2D9W A;  2AEH A;  2DYQ A;  1WI1 A;  2R09 A;  2ROZ B;  2RGN B;  4GZU A;  5FI0 A;  1OMW A;  1U5D A;  1X05 A;  4HB0 B;  4WSF A;  4ZRI A;  2YSZ A;  5C16 A;  4HB3 B;  1EVH A;  3ULB A;  4MY6 A;  2YS5 A;  1X11 A;  3M1I B;  3VOQ A;  2K00 A;  1QQG A;  2D9Y A;  4IFS A;  2N23 A;  3KSY A;  4P7I A;  4F7G A;  2NZ8 B;  1NTY A;  1P3R A;  3D8E A;  2DKP A;  2W2X C;  5KCV A;  2JP2 A;  3AJ4 A;  2CY5 A;  2EJ8 A;  5DI9 B;  2COF A;  1KZ7 A;  4WVF B;  5JLJ B;  2J0J A;  4CHM A;  2P0F A;  4MK0 A;  1I7A A;  5D3Y A;  4DX9 0;  4F7U P;  1M7E A;  1KI1 B;  3PVW A;  1BTK A;  2D9V A;  4Z2M B;  3RCP A;  1DBH A;  3O96 A;  1WJM A;  2YRY A;  1NU2 A;  2KGX B;  5DHA B;  2G35 A;  2W2X D;  2OTX A;  5HE3 A;  2GS0 A;  2DA0 A;  1LW3 A;  2AL6 A;  2J0K A;  2GCJ A;  1Q67 A;  4D0N B;  2Z0O A;  1H10 A;  1FAO A;  4K81 A;  2DKQ A;  4KHA A;  3SNH A;  5C5B A;  3AU4 A;  1MAI A;  2HE7 A;  1AQC A;  1GG3 A;  2UVM A;  3ZVR A;  2DX1 A;  2D11 A;  3F5R A;  4HB2 B;  3D8F A;  3MPX A;  2R0D A;  4ZRK A;  2UZR A;  3P6A A;  1ZSQ A;  2LUL A;  5C6R A;  1IRS A;  2IYB A;  4L6E A;  2COA A;  4A6F A;  3ODW A;  2P0D A;  4NY0 A;  4A6H A;  2YT1 A;  4K17 A;  2YF0 A;  2GJY A;  1RRP B;  4EKU A;  2DTC A;  2Q13 A;  2RLO A;  2QKL A;  1QC6 A;  3IVF A;  4DX8 A;  3BJI A;  4ZRJ A;  4GPT B;  2L2I A;  1XKE A;  2DYN A;  1UEF A;  2K2J A;  4HAV B;  4MT7 A;  2LYD A;  2DLW A;  3HK0 A;  3HW2 B;  3G9W A;  2MFQ A;  1GC7 A;  2I5C A;  1MK7 B;  3PP2 A;  1U2B A;  4GXB A;  3SV1 A;  4YL8 A;  4IOY X;  3PSC A;  1K5G B;  1KZG A;  2RSG A;  5C79 A;  5DH9 B;  1U5G A;  1N3H A;  2D4Q A;  1WG7 A;  4HAW B;  1FGZ A;  2Y8G A;  1AWE A;  1DYN A;  3AU5 A;  1UPR A;  4HDO A;  1FB8 A;  4B6H A;  3SUZ A;  1U5F A;  1U29 A;  2ELB A;  1X1F A;  4NSW A;  3DXD A;  3PZD A;  4GMX B;  3MDB C;  3FEH A;  3QIJ A;  4HAX B;  2D9Z A;  4A6K A;  4GMV A;  1XD4 A;  2I1J A;  1H4R A;  2KCJ A;  1DRO A;  2QKM A;  3SYX A;  5CLQ B;  5GOW B;  2J59 M;  1DDW A;  3TVV A;  2COD A;  3QWM A;  1Z87 A;  1FHO A;  2DN6 A;  2RUK B;  2UZS A;  2DHI A;  2Y7B A;  3ODO A;  4TYZ A;  1V5U A;  2EC1 A;  2GCL A;  3KRW A;  4CHJ A;  1BAK A;  1U5E A;  1Y19 B;  4DBB A;  3KY9 A;  4KHB B;  2OQB A;  2ADZ A;  2I5F A;  2Z0Q A;  1V89 A;  1WVH A;  3BIN A;  1I2H A;  1RJ2 A;  5D3V A;  2NMB A;  3PVU A;  5HE0 A;  3X23 A;  1XR0 B;  5D3W A;  1FHX A;  1TJ6 A;  4CYE A;  4PQ0 A;  2X18 A;  3A98 B;  3OAN A;  1UNR A;  1X86 A;  4PNK A;  1W1H A;  1WJ1 A;  3TFM A;  2BCJ A;  5DIF B;  2D9X A;  2K2U A;  3TW1 A;  2MKR A;  1XOD A;  1X1G A;  2Y8F A;  5L81 A;  3FSS A;  3ML4 A;  1FOE A;  4HAZ B;  5CLL B;  4K2O A;  2ELA A;  1NI2 A;  4KHO A;  1FGY A;  1P6S A;  2DX5 A;  3PEG A;  3U8Z A;  1V88 A;  5KQ4 A;  3NSU A;  2YS3 A;  3WA0 A;  2IFS A;  4KVG B;  1FHW A;  1PLS A;  5HE2 A;  2HTH B;  2VRW B;  2P8V A;  2KUP A;  2FJL A;  4XWX A;  1BWN A;  4BBK A;  2LG1 A;  1XCG A;  4Z2N A;  2VKI A;  3ULC A;  3F0W A;  4K2P A;  2LKO A;  3DXE A;  3CIK A;  3HQC A;  1OQN A;  1OY2 A;  4DXA B;  4YON A;  3VIA A;  5FI1 A;  5JHG A;  1PMS A;  2Z0P A;  5EFX A;  1J19 A;  1SHC A;  2CY4 A;  4IAP A;  1MK9 B;  1ZVR A;  5J3Q A;  3GYO A;  1UNQ A;  2YT0 A;  3N7C A;  2XQN M;  3PG7 A;  2W2W A;  2H7D A;  3TO1 A;  3U7D A;  3V5W A;  3A8Q A;  3D8D A;  2EMS A;  1GC6 A;  3LJU X;  3SO6 A;  3GYP A;  4C0A A;  2P0H A;  5C5B B;  4HB4 B;  2I1K A;  4HAY B;  2L1C A;  2CRF A;  3QBV B;  4EMO A;  4WJ7 A;  1ZC4 B;  2EMT A;  1UPQ A;  1TXD A; 
#chains in the Genus database with same CATH topology
 2H7E A;  3T06 A;  2D10 A;  1V61 A;  2N0Y A;  2LOX A;  4KAX B;  2RNR B;  2RVB B;  5J3Y A;  4HDQ A;  2FJU B;  3PVL A;  2PZ1 A;  3DXC A;  4TKN A;  4A6F B;  1Y5O A;  4L1R A;  4OT1 A;  1W1G A;  2LOZ A;  2MWN B;  1ISN A;  4HAU B;  1EGX A;  4GN1 A;  2DHJ A;  2V76 A;  3KZ1 A;  4A5K A;  1MIX A;  5LOP B;  2YVC A;  3HIE A;  4EJN A;  3FM8 C;  5J3T A;  2CAY A;  1TQZ A;  2VSZ A;  1SGH A;  1M7R A;  5IRS A;  3TCA A;  1WGQ A;  5JHH A;  1ZM0 A;  2ZPY A;  1BTN A;  2ROV A;  1MIZ B;  3HSA A;  4DIX A;  3FVC A;  3ZDT A;  2COC A;  5I2M A;  4F7H A;  5DHF B;  1NTV A;  1WGU A;  5KQ1 A;  5M4Y B;  4KHB A;  2RRF A;  1XX0 A;  1UNP A;  1PFJ A;  2J0M A;  4Y94 A;  1P5T A;  2ZKM X;  1B55 A;  3WYF B;  3ODX A;  1V5M A;  5D3X A;  3NWD A;  1J0W A;  3KRX A;  4D6W A;  1U27 A;  1DDM A;  1K5D B;  1E5W A;  2M38 A;  1MPH A;  3P7Z A;  1EAZ A;  3A8P A;  4HHV A;  2DHK A;  3UZT A;  4H8S A;  2D2Q A;  1MKE A;  5HE1 A;  2YT2 A;  1EF1 A;  1LB1 A;  5JP4 A;  2YS1 A;  2DFK A;  1DDV A;  2MDX A;  5LON B;  1V5P A;  3CXB B;  5D27 A;  1W1D A;  4HAT B;  1ZC3 B;  2E2X A;  2M14 A;  2D9W A;  2GUM A;  2AEH A;  2DYQ A;  1WI1 A;  2R09 A;  2ROZ B;  2RGN B;  3NWA A;  4GZU A;  5FI0 A;  1OMW A;  1U5D A;  1X05 A;  4HB0 B;  4WSF A;  4ZRI A;  2YSZ A;  5C16 A;  4HB3 B;  1EVH A;  3ULB A;  4MY6 A;  2YS5 A;  1X11 A;  3M1I B;  3VOQ A;  2K00 A;  1QQG A;  2D9Y A;  4IFS A;  2N23 A;  3KSY A;  4P7I A;  4F7G A;  2NZ8 B;  1NTY A;  1P3R A;  3D8E A;  2DKP A;  2W2X C;  5KCV A;  2JP2 A;  3AJ4 A;  2CY5 A;  2EJ8 A;  5DI9 B;  2COF A;  1KZ7 A;  4WVF B;  5JLJ B;  2KUQ A;  2J0J A;  4CHM A;  2P0F A;  4MK0 A;  1I7A A;  5D3Y A;  4DX9 0;  4F7U P;  1M7E A;  1KI1 B;  3PVW A;  1BTK A;  2D9V A;  4Z2M B;  3RCP A;  1DBH A;  4QJ5 B;  1WJM A;  2YRY A;  3O96 A;  1NU2 A;  2KGX B;  5DHA B;  2G35 A;  2W2X D;  2OTX A;  5HE3 A;  2Z4D A;  2GS0 A;  2DA0 A;  1LW3 A;  2AL6 A;  2J0K A;  2GCJ A;  1Q67 A;  2K49 A;  4D0N B;  2Z0O A;  1H10 A;  1FAO A;  4K81 A;  2DKQ A;  4KHA A;  3SNH A;  5C5B A;  3AU4 A;  1MAI A;  2HE7 A;  1AQC A;  1GG3 A;  2UVM A;  3ZVR A;  2DX1 A;  2D11 A;  3F5R A;  4HB2 B;  3U12 A;  3NW8 A;  3D8F A;  3MPX A;  2R0D A;  4ZRK A;  4QXA B;  2UZR A;  3P6A A;  1ZSQ A;  2Z13 A;  2LUL A;  5C6R A;  1IRS A;  2IYB A;  4L6E A;  2COA A;  1MI1 A;  2P0D A;  3ODW A;  4NY0 A;  4A6F A;  4A6H A;  2YT1 A;  4K17 A;  4QJ3 B;  2YF0 A;  2GJY A;  1RRP B;  4EKU A;  2DTC A;  2Q13 A;  2RLO A;  2QKL A;  1QC6 A;  3IVF A;  4DX8 A;  3BJI A;  4ZRJ A;  4GPT B;  2L2I A;  2KIG A;  1XKE A;  2DYN A;  1UEF A;  2K2J A;  4HAV B;  4MT7 A;  2LYD A;  2DLW A;  3HK0 A;  3HW2 B;  3G9W A;  3B77 A;  2MFQ A;  1GC7 A;  2I5C A;  1MK7 B;  3PP2 A;  1U2B A;  4GXB A;  3SV1 A;  4HSI A;  4YL8 A;  4QJ4 B;  4IOY X;  3PSC A;  1K5G B;  1KZG A;  2RSG A;  5C79 A;  5DH9 B;  1U5G A;  1N3H A;  2D4Q A;  1WG7 A;  4HAW B;  1FGZ A;  2Y8G A;  1AWE A;  1DYN A;  3AU5 A;  5LG4 B;  1UPR A;  4HDO A;  1FB8 A;  4B6H A;  3SUZ A;  1U5F A;  1U29 A;  2ELB A;  1X1F A;  4NSW A;  3DXD A;  3PZD A;  4GMX B;  3MDB C;  3FEH A;  3QIJ A;  4HAX B;  2D9Z A;  4A6K A;  4GMV A;  1XD4 A;  2I1J A;  1H4R A;  2KCJ A;  1DRO A;  2QKM A;  3SYX A;  5CLQ B;  5GOW B;  2J59 M;  1DDW A;  3TVV A;  2COD A;  3QWM A;  1Z87 A;  1FHO A;  2DN6 A;  2RUK B;  2UZS A;  2DHI A;  2Y7B A;  3ODO A;  4TYZ A;  1V5U A;  2EC1 A;  2GCL A;  3KRW A;  4CHJ A;  1BAK A;  1U5E A;  1Y19 B;  4DBB A;  5I2S A;  3KY9 A;  4KHB B;  2OQB A;  2ADZ A;  2I5F A;  2Z0Q A;  1V89 A;  1WVH A;  3BIN A;  1I2H A;  3DCX A;  1RJ2 A;  5D3V A;  2NMB A;  3PVU A;  5HE0 A;  3X23 A;  1XR0 B;  5D3W A;  1FHX A;  1TJ6 A;  4CYE A;  4PQ0 A;  2X18 A;  3A98 B;  3OAN A;  1UNR A;  1X86 A;  4PNK A;  1W1H A;  1WJ1 A;  3TFM A;  2BCJ A;  5DIF B;  2D9X A;  2K2U A;  3TW1 A;  2MKR A;  3NWF A;  1XOD A;  1X1G A;  2Y8F A;  5L81 A;  4OSN A;  2Z59 A;  3FSS A;  3ML4 A;  1FOE A;  4HAZ B;  5CLL B;  4K2O A;  2ELA A;  1NI2 A;  4KHO A;  1FGY A;  1P6S A;  2DX5 A;  3PEG A;  3U8Z A;  1V88 A;  5KQ4 A;  3NSU A;  2YS3 A;  3WA0 A;  2IFS A;  4KVG B;  1FHW A;  1PLS A;  5HE2 A;  2HTH B;  2VRW B;  2Z14 A;  2P8V A;  2KUP A;  2FJL A;  4XWX A;  1BWN A;  4BBK A;  2LG1 A;  1XCG A;  4GOU A;  4Z2N A;  2VKI A;  3ULC A;  3F0W A;  4K2P A;  2LKO A;  3DXE A;  3CIK A;  3HQC A;  1OQN A;  1OY2 A;  2KR0 A;  4YON A;  4CSQ A;  3VIA A;  4DXA B;  5FI1 A;  5JHG A;  1PMS A;  2Z0P A;  5EFX A;  1J19 A;  1SHC A;  2CY4 A;  4IAP A;  1MK9 B;  3A58 A;  1ZYI A;  1ZVR A;  5J3Q A;  3GYO A;  1UNQ A;  2YT0 A;  1T77 A;  3N7C A;  2XQN M;  3PG7 A;  2NBV A;  2W2W A;  2H7D A;  3TO1 A;  3U7D A;  3V5W A;  3A8Q A;  2K8E A;  3D8D A;  2EMS A;  1GC6 A;  3LJU X;  3OHM B;  3SO6 A;  3GYP A;  4C0A A;  2P0H A;  5C5B B;  4HB4 B;  2KIE A;  2I1K A;  4GNK B;  4HAY B;  2L1C A;  2CRF A;  3QBV B;  2R2Y A;  4EMO A;  4WJ7 A;  1ZC4 B;  2EMT A;  1UPQ A;  1TXD A; 
#chains in the Genus database with same CATH homology
 2H7E A;  3T06 A;  2D10 A;  1V61 A;  2N0Y A;  2LOX A;  4KAX B;  2RNR B;  2RVB B;  5J3Y A;  4HDQ A;  3PVL A;  2PZ1 A;  3DXC A;  4TKN A;  4A6F B;  1Y5O A;  1W1G A;  2LOZ A;  2MWN B;  1ISN A;  4HAU B;  1EGX A;  4GN1 A;  2DHJ A;  2V76 A;  3KZ1 A;  4A5K A;  1MIX A;  5LOP B;  2YVC A;  4EJN A;  3FM8 C;  5J3T A;  2CAY A;  1TQZ A;  2VSZ A;  1SGH A;  1M7R A;  3TCA A;  1WGQ A;  5JHH A;  1ZM0 A;  2ZPY A;  1BTN A;  2ROV A;  1MIZ B;  3ZDT A;  2COC A;  4F7H A;  5DHF B;  1NTV A;  1WGU A;  5KQ1 A;  1XX0 A;  1UNP A;  1PFJ A;  2J0M A;  4Y94 A;  1P5T A;  1B55 A;  3WYF B;  3ODX A;  1V5M A;  5D3X A;  1J0W A;  3KRX A;  1U27 A;  1DDM A;  1K5D B;  1E5W A;  2M38 A;  1MPH A;  3P7Z A;  1EAZ A;  3A8P A;  4HHV A;  2DHK A;  3UZT A;  4H8S A;  2D2Q A;  1MKE A;  5HE1 A;  1EF1 A;  1LB1 A;  5JP4 A;  2YS1 A;  2DFK A;  1DDV A;  2MDX A;  5LON B;  1V5P A;  3CXB B;  5D27 A;  1W1D A;  4HAT B;  1ZC3 B;  2E2X A;  2M14 A;  2D9W A;  2AEH A;  2DYQ A;  1WI1 A;  2R09 A;  2ROZ B;  2RGN B;  4GZU A;  5FI0 A;  1OMW A;  1U5D A;  1X05 A;  4HB0 B;  4WSF A;  4ZRI A;  2YSZ A;  5C16 A;  4HB3 B;  1EVH A;  3ULB A;  4MY6 A;  2YS5 A;  1X11 A;  3M1I B;  3VOQ A;  2K00 A;  1QQG A;  2D9Y A;  4IFS A;  2N23 A;  3KSY A;  4P7I A;  4F7G A;  2NZ8 B;  1NTY A;  1P3R A;  3D8E A;  2DKP A;  2W2X C;  5KCV A;  2JP2 A;  3AJ4 A;  2CY5 A;  2EJ8 A;  5DI9 B;  2COF A;  1KZ7 A;  4WVF B;  5JLJ B;  2J0J A;  4CHM A;  2P0F A;  4MK0 A;  1I7A A;  5D3Y A;  4DX9 0;  4F7U P;  1M7E A;  1KI1 B;  3PVW A;  1BTK A;  2D9V A;  4Z2M B;  3RCP A;  1DBH A;  3O96 A;  1WJM A;  2YRY A;  1NU2 A;  2KGX B;  5DHA B;  2G35 A;  2W2X D;  2OTX A;  5HE3 A;  2GS0 A;  2DA0 A;  1LW3 A;  2AL6 A;  2J0K A;  2GCJ A;  1Q67 A;  4D0N B;  2Z0O A;  1H10 A;  1FAO A;  4K81 A;  2DKQ A;  4KHA A;  3SNH A;  5C5B A;  3AU4 A;  1MAI A;  2HE7 A;  1AQC A;  1GG3 A;  2UVM A;  3ZVR A;  2DX1 A;  2D11 A;  3F5R A;  4HB2 B;  3D8F A;  3MPX A;  2R0D A;  4ZRK A;  2UZR A;  3P6A A;  1ZSQ A;  2LUL A;  5C6R A;  1IRS A;  2IYB A;  4L6E A;  2COA A;  4A6F A;  3ODW A;  2P0D A;  4NY0 A;  4A6H A;  2YT1 A;  4K17 A;  2YF0 A;  2GJY A;  1RRP B;  4EKU A;  2DTC A;  2Q13 A;  2RLO A;  2QKL A;  1QC6 A;  3IVF A;  4DX8 A;  3BJI A;  4ZRJ A;  4GPT B;  2L2I A;  1XKE A;  2DYN A;  1UEF A;  2K2J A;  4HAV B;  4MT7 A;  2LYD A;  2DLW A;  3HK0 A;  3HW2 B;  3G9W A;  2MFQ A;  1GC7 A;  2I5C A;  1MK7 B;  3PP2 A;  1U2B A;  4GXB A;  3SV1 A;  4YL8 A;  4IOY X;  3PSC A;  1K5G B;  1KZG A;  2RSG A;  5C79 A;  5DH9 B;  1U5G A;  1N3H A;  2D4Q A;  1WG7 A;  4HAW B;  1FGZ A;  2Y8G A;  1AWE A;  1DYN A;  3AU5 A;  1UPR A;  4HDO A;  1FB8 A;  4B6H A;  3SUZ A;  1U5F A;  1U29 A;  2ELB A;  1X1F A;  4NSW A;  3DXD A;  3PZD A;  4GMX B;  3MDB C;  3FEH A;  3QIJ A;  4HAX B;  2D9Z A;  4A6K A;  4GMV A;  1XD4 A;  2I1J A;  1H4R A;  2KCJ A;  1DRO A;  2QKM A;  3SYX A;  5CLQ B;  5GOW B;  2J59 M;  1DDW A;  3TVV A;  2COD A;  3QWM A;  1Z87 A;  1FHO A;  2DN6 A;  2RUK B;  2UZS A;  2DHI A;  2Y7B A;  3ODO A;  4TYZ A;  1V5U A;  2EC1 A;  2GCL A;  3KRW A;  4CHJ A;  1BAK A;  1U5E A;  1Y19 B;  4DBB A;  3KY9 A;  4KHB B;  2OQB A;  2ADZ A;  2I5F A;  2Z0Q A;  1V89 A;  1WVH A;  3BIN A;  1I2H A;  1RJ2 A;  5D3V A;  2NMB A;  3PVU A;  5HE0 A;  3X23 A;  1XR0 B;  5D3W A;  1FHX A;  1TJ6 A;  4CYE A;  4PQ0 A;  2X18 A;  3A98 B;  3OAN A;  1UNR A;  1X86 A;  4PNK A;  1W1H A;  1WJ1 A;  3TFM A;  2BCJ A;  5DIF B;  2D9X A;  2K2U A;  3TW1 A;  2MKR A;  1XOD A;  1X1G A;  2Y8F A;  5L81 A;  3FSS A;  3ML4 A;  1FOE A;  4HAZ B;  5CLL B;  4K2O A;  2ELA A;  1NI2 A;  4KHO A;  1FGY A;  1P6S A;  2DX5 A;  3PEG A;  3U8Z A;  1V88 A;  5KQ4 A;  3NSU A;  2YS3 A;  3WA0 A;  2IFS A;  4KVG B;  1FHW A;  1PLS A;  5HE2 A;  2HTH B;  2VRW B;  2P8V A;  2KUP A;  2FJL A;  4XWX A;  1BWN A;  4BBK A;  2LG1 A;  1XCG A;  4Z2N A;  2VKI A;  3ULC A;  3F0W A;  4K2P A;  2LKO A;  3DXE A;  3CIK A;  3HQC A;  1OQN A;  1OY2 A;  4DXA B;  4YON A;  3VIA A;  5FI1 A;  5JHG A;  1PMS A;  2Z0P A;  5EFX A;  1J19 A;  1SHC A;  2CY4 A;  4IAP A;  1MK9 B;  1ZVR A;  5J3Q A;  3GYO A;  1UNQ A;  2YT0 A;  3N7C A;  2XQN M;  3PG7 A;  2W2W A;  2H7D A;  3TO1 A;  3U7D A;  3V5W A;  3A8Q A;  3D8D A;  2EMS A;  1GC6 A;  3LJU X;  3SO6 A;  3GYP A;  4C0A A;  2P0H A;  5C5B B;  4HB4 B;  2I1K A;  4HAY B;  2L1C A;  2CRF A;  3QBV B;  4EMO A;  4WJ7 A;  1ZC4 B;  2EMT A;  1UPQ A;  1TXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...