2KIEA

A ph domain within ocrl bridges clathrin mediated membrane trafficking to phosphoinositide metabolis
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
124
structure length
124
Chain Sequence
GPLGSMEPPLPVGAQPLATVEGMEMKGPLREPCALTLAQRNGQYELIIQLHEKEQHVQDIIPINSHFRCVQEAEETLLIDIASNSGCKIRVQGDWIRERRFEIPDEEHCLKFLSAVLAAQKAQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A PH domain within OCRL bridges clathrin-mediated membrane trafficking to phosphoinositide metabolism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Inositol polyphosphate 5-phosphatase OCRL-1
total genus 17
structure length 124
sequence length 124
ec nomenclature ec 3.1.3.36: Phosphoinositide 5-phosphatase.
pdb deposition date 2009-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16726 OCRL_clath_bd Inositol polyphosphate 5-phosphatase clathrin binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.110 Mainly Beta Roll PH-domain like PH-domain like 2kieA00
2KIGA 2KIEA
chains in the Genus database with same CATH superfamily
5HE2A 1QC6A 5DHAB 4P7IA 2FJUB 4NY0A 3KY9A 4GZUA 2DX5A 4K81A 5LOPB 2D9YA 5C16A 1V61A 5CLLB 2CY5A 2K2JA 1RJ2A 4EJNA 3OANA 2Z0QA 3WA0A 5DI9B 2YS1A 2ROZB 4MK0A 1KI1B 2GS0A 3A98B 2KIGA 3F5RA 1U29A 2MDXA 2W2WA 2HE7A 5CLQB 5D3VA 2DYNA 2DLWA 2D9ZA 1P6SA 2R0DA 3NWDA 1IRSA 4A6FA 2N0YA 1W1HA 1MKEA 2LULA 3P6AA 4F7UP 3D8FA 3SYXA 4D0NB 1UPQA 4XWXA 4NSWA 2P8VA 3NSUA 4GMXB 1U5FA 2EMSA 4WVFB 2AEHA 2CY4A 1AQCA 1MPHA 1NTVA 1PMSA 1P3RA 3G9WA 1TXDA 3FEHA 3ULCA 2DYQA 1ZYIA 2P0HA 2DKQA 4HB4B 1EAZA 1MI1A 1Q67A 1WJ1A 2EMTA 3OHMB 4IOYX 4A5KA 3PVLA 2Z14A 4IAPA 1XR0B 2L1CA 2YSZA 2DA0A 3SV1A 1MIZB 3X23A 1FAOA 2LYDA 3PVWA 3GYPA 3TVVA 2KGXB 1XKEA 2XQNM 2ELBA 1BTKA 1UPRA 1V5MA 2MKRA 2I1KA 3VIAA 4KHBB 5I2MA 1BTNA 2DTCA 4DIXA 3DXDA 4B6HA 5JLJB 2G35A 5M4YB 2GUMA 4DX8A 2RRFA 3PP2A 1X05A 3TW1A 3U7DA 1NI2A 2ROVA 3QIJA 1ZM0A 2J0MA 2CRFA 4DX90 5J3TA 1GC7A 4HB0B 1P5TA 3ZDTA 2OQBA 4TKNA 2COCA 3NW8A 2EC1A 2KR0A 1ISNA 5JHHA 2Z4DA 1MAIA 1XD4A 5KCVA 1U5EA 1XCGA 1U27A 4L6EA 1I2HA 4MT7A 1FHOA 1K5DB 2VRWB 3KRXA 2Y8GA 2YF0A 2J0JA 2Z13A 4CSQA 1FHXA 5HE3A 4HAVB 1U5DA 2KCJA 2V76A 3TO1A 2YVCA 2ELAA 3DXEA 1M7EA 2RVBB 3M1IB 1ZC3B 1H10A 2DKPA 2KIEA 1WGUA 2AL6A 2Z0PA 1FGYA 2YS3A 4C0AA 1X11A 1PFJA 4K2PA 1U2BA 2D2QA 5JP4A 3ZVRA 3ODWA 4HAXB 3HIEA 2K00A 4CHJA 3PVUA 5D27A 5D3YA 4ZRKA 1K5GB 2LG1A 3TFMA 1PLSA 4HDOA 4F7GA 2GCJA 4K17A 3PZDA 2EJ8A 4TYZA 2RGNB 3PG7A 1V88A 2D11A 3LJUX 4QXAB 4HHVA 4WJ7A 1W1DA 4Y94A 2E2XA 4GOUA 5IRSA 2D4QA 4KHAA 1V5UA 2M14A 4PNKA 4DXAB 3T06A 3A8PA 4GPTB 2KUQA 4IFSA 2DX1A 2YT0A 2YT1A 3CIKA 2DN6A 2M38A 2Q13A 4HAZB 1DBHA 1GG3A 2ZKMX 2IFSA 1EVHA 3V5WA 2YT2A 1LW3A 1UNPA 1DYNA 2LOXA 4H8SA 4HAWB 3P7ZA 3FSSA 1FOEA 3KSYA 4GXBA 3A8QA 2COAA 3PSCA 1B55A 4GN1A 1QQGA 1FGZA 5KQ4A 3BINA 1Y5OA 1WG7A 2NZ8B 1DDMA 2MWNB 4CYEA 4KHOA 3O96A 2W2XD 1W1GA 2DHKA 3CXBB 1UNRA 5LONB 2J59M 5C79A 2PZ1A 3SUZA 5HE1A 2D9WA 4GMVA 1I7AA 4ZRIA 2MFQA 2RLOA 3VOQA 3U8ZA 4KVGB 4A6FB 1ZVRA 1XODA 3B77A 1OMWA 2D10A 4WSFA 1DDVA 4CHMA 1TJ6A 5J3YA 1Y19B 1Z87A 4QJ3B 3AU5A 5GOWB 5L81A 1AWEA 2NBVA 4HAYB 2IYBA 2K49A 3QBVB 1UEFA 3HQCA 3RCPA 1H4RA 1DDWA 4HB3B 3WYFB 4Z2MB 1RRPB 4YONA 1MK7B 2KUPA 5EFXA 5DIFB 2LOZA 2D9VA 2QKMA 2YS5A 2I5FA 2I1JA 3TCAA 1NU2A 3BJIA 4F7HA 4HAUB 5I2SA 2FJLA 2R09A 5FI1A 2COFA 5LG4B 1TQZA 1UNQA 4A6KA 1V89A 5DH9B 1FB8A 5D3WA 1EF1A 4YL8A 4QJ5B 2CODA 3PEGA 3NWFA 2J0KA 3IVFA 4ZRJA 1U5GA 3ODOA 3HK0A 1ZC4B 4D6WA 5HE0A 2Y8FA 3DCXA 5C5BB 1WJMA 4HSIA 2K8EA 2YRYA 3NWAA 2W2XC 1FHWA 3U12A 3ULBA 1BWNA 1WGQA 1ZSQA 2I5CA 3A58A 2GCLA 1KZ7A 2Y7BA 4QJ4B 4HATB 3D8DA 3N7CA 1E5WA 2ADZA 3HSAA 2BCJA 3QWMA 4HDQA 1V5PA 2K2UA 3GYOA 4KAXB 2R2YA 1T77A 3KZ1A 4A6HA 4DBBA 2UZSA 2ZPYA 5DHFB 5C5BA 2QKLA 4MY6A 1MK9B 2D9XA 3KRWA 4GNKB 5J3QA 1BAKA 3ODXA 1LB1A 1N3HA 4HB2B 2L2IA 4EKUA 1J0WA 1EGXA 1KZGA 2Z0OA 1X86A 4EMOA 2UVMA 1XX0A 1MIXA 2DFKA 4BBKA 2JP2A 2N23A 4KHBA 2H7DA 2GJYA 3SO6A 3AU4A 1SGHA 4PQ0A 1WVHA 2RUKB 2LKOA 3SNHA 2DHIA 2Z59A 2RNRB 3HW2B 1GC6A 3FM8C 1OQNA 4Z2NA 2HTHB 3AJ4A 2OTXA 2UZRA 1X1GA 5FI0A 5D3XA 1X1FA 3UZTA 4K2OA 1NTYA 3MPXA 4L1RA 5JHGA 4OSNA 2VSZA 3DXCA 2NMBA 2VKIA 2CAYA 2P0DA 2X18A 1M7RA 2RSGA 1DROA 3ML4A 2P0FA 2H7EA 1SHCA 3MDBC 5C6RA 1J19A 3F0WA 3D8EA 3FVCA 4OT1A 2DHJA 5KQ1A 1WI1A 1OY2A
chains in the Genus database with same CATH topology
2K8EA 2KR0A 4PQ0A 4Z2MB 3TO1A 2Z4DA 2KUQA 3NWAA 4KHBB 2FJUB 4QJ5B 2GCJA 4IFSA 5I2MA 3NWFA 4GNKB 4OSNA 3U12A 2Z59A 4DIXA 4KHOA 1ZYIA 3A58A 2GUMA 5M4YB 2KIEA 3NWDA 2RRFA 2GCLA 4IOYX 3OHMB 4QJ4B 2Z14A 4QXAB 4Z2NA 3TW1A 2ZKMX 4QJ3B 2YT2A 4GOUA 5I2SA 5IRSA 4KHAA 4D6WA 3GYPA 3TVVA 2NBVA 2K49A 2Z13A 3FSSA 4CSQA 3FVCA 3HIEA 4KHBA 3GYOA 4OT1A 5LG4B 2KIGA 4HSIA 2R2YA 3NW8A 4L1RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KIG A;  2KIE A; 
#chains in the Genus database with same CATH topology
 5HE2 A;  1QC6 A;  5DHA B;  4P7I A;  2FJU B;  4NY0 A;  3KY9 A;  4GZU A;  2DX5 A;  4K81 A;  5LOP B;  2D9Y A;  5C16 A;  1V61 A;  5CLL B;  2CY5 A;  2K2J A;  1RJ2 A;  4EJN A;  3OAN A;  2Z0Q A;  3WA0 A;  5DI9 B;  2YS1 A;  2ROZ B;  4MK0 A;  1KI1 B;  2GS0 A;  3A98 B;  2KIG A;  3F5R A;  1U29 A;  2MDX A;  2W2W A;  2HE7 A;  5CLQ B;  5D3V A;  2DYN A;  2DLW A;  2D9Z A;  1P6S A;  2R0D A;  3NWD A;  1IRS A;  4A6F A;  2N0Y A;  1W1H A;  1MKE A;  2LUL A;  3P6A A;  4F7U P;  3D8F A;  3SYX A;  4D0N B;  1UPQ A;  4XWX A;  4NSW A;  2P8V A;  3NSU A;  4GMX B;  1U5F A;  2EMS A;  4WVF B;  2AEH A;  2CY4 A;  1AQC A;  1MPH A;  1NTV A;  1PMS A;  1P3R A;  3G9W A;  1TXD A;  3FEH A;  3ULC A;  2DYQ A;  1ZYI A;  2P0H A;  2DKQ A;  4HB4 B;  1EAZ A;  1MI1 A;  1Q67 A;  1WJ1 A;  2EMT A;  3OHM B;  4IOY X;  4A5K A;  3PVL A;  2Z14 A;  4IAP A;  1XR0 B;  2L1C A;  2YSZ A;  2DA0 A;  3SV1 A;  1MIZ B;  3X23 A;  1FAO A;  2LYD A;  3PVW A;  3GYP A;  3TVV A;  2KGX B;  1XKE A;  2XQN M;  2ELB A;  1BTK A;  1UPR A;  1V5M A;  2MKR A;  2I1K A;  3VIA A;  4KHB B;  5I2M A;  1BTN A;  2DTC A;  4DIX A;  3DXD A;  4B6H A;  5JLJ B;  2G35 A;  5M4Y B;  2GUM A;  4DX8 A;  2RRF A;  3PP2 A;  1X05 A;  3TW1 A;  3U7D A;  1NI2 A;  2ROV A;  3QIJ A;  1ZM0 A;  2J0M A;  2CRF A;  4DX9 0;  5J3T A;  1GC7 A;  4HB0 B;  1P5T A;  3ZDT A;  2OQB A;  4TKN A;  2COC A;  3NW8 A;  2EC1 A;  2KR0 A;  1ISN A;  5JHH A;  2Z4D A;  1MAI A;  1XD4 A;  5KCV A;  1U5E A;  1XCG A;  1U27 A;  4L6E A;  1I2H A;  4MT7 A;  1FHO A;  1K5D B;  2VRW B;  3KRX A;  2Y8G A;  2YF0 A;  2J0J A;  2Z13 A;  4CSQ A;  1FHX A;  5HE3 A;  4HAV B;  1U5D A;  2KCJ A;  2V76 A;  3TO1 A;  2YVC A;  2ELA A;  3DXE A;  1M7E A;  2RVB B;  3M1I B;  1ZC3 B;  1H10 A;  2DKP A;  2KIE A;  1WGU A;  2AL6 A;  2Z0P A;  1FGY A;  2YS3 A;  4C0A A;  1X11 A;  1PFJ A;  4K2P A;  1U2B A;  2D2Q A;  5JP4 A;  3ZVR A;  3ODW A;  4HAX B;  3HIE A;  2K00 A;  4CHJ A;  3PVU A;  5D27 A;  5D3Y A;  4ZRK A;  1K5G B;  2LG1 A;  3TFM A;  1PLS A;  4HDO A;  4F7G A;  2GCJ A;  4K17 A;  3PZD A;  2EJ8 A;  4TYZ A;  2RGN B;  3PG7 A;  1V88 A;  2D11 A;  3LJU X;  4QXA B;  4HHV A;  4WJ7 A;  1W1D A;  4Y94 A;  2E2X A;  4GOU A;  5IRS A;  2D4Q A;  4KHA A;  1V5U A;  2M14 A;  4PNK A;  4DXA B;  3T06 A;  3A8P A;  4GPT B;  2KUQ A;  4IFS A;  2DX1 A;  2YT0 A;  2YT1 A;  3CIK A;  2DN6 A;  2M38 A;  2Q13 A;  4HAZ B;  1DBH A;  1GG3 A;  2ZKM X;  2IFS A;  1EVH A;  3V5W A;  2YT2 A;  1LW3 A;  1UNP A;  1DYN A;  2LOX A;  4H8S A;  4HAW B;  3P7Z A;  3FSS A;  1FOE A;  3KSY A;  4GXB A;  3A8Q A;  2COA A;  3PSC A;  1B55 A;  4GN1 A;  1QQG A;  1FGZ A;  5KQ4 A;  3BIN A;  1Y5O A;  1WG7 A;  2NZ8 B;  1DDM A;  2MWN B;  4CYE A;  4KHO A;  3O96 A;  2W2X D;  1W1G A;  2DHK A;  3CXB B;  1UNR A;  5LON B;  2J59 M;  5C79 A;  2PZ1 A;  3SUZ A;  5HE1 A;  2D9W A;  4GMV A;  1I7A A;  4ZRI A;  2MFQ A;  2RLO A;  3VOQ A;  3U8Z A;  4KVG B;  4A6F B;  1ZVR A;  1XOD A;  3B77 A;  1OMW A;  2D10 A;  4WSF A;  1DDV A;  4CHM A;  1TJ6 A;  5J3Y A;  1Y19 B;  1Z87 A;  4QJ3 B;  3AU5 A;  5GOW B;  5L81 A;  1AWE A;  2NBV A;  4HAY B;  2IYB A;  2K49 A;  3QBV B;  1UEF A;  3HQC A;  3RCP A;  1H4R A;  1DDW A;  4HB3 B;  3WYF B;  4Z2M B;  1RRP B;  4YON A;  1MK7 B;  2KUP A;  5EFX A;  5DIF B;  2LOZ A;  2D9V A;  2QKM A;  2YS5 A;  2I5F A;  2I1J A;  3TCA A;  1NU2 A;  3BJI A;  4F7H A;  4HAU B;  5I2S A;  2FJL A;  2R09 A;  5FI1 A;  2COF A;  5LG4 B;  1TQZ A;  1UNQ A;  4A6K A;  1V89 A;  5DH9 B;  1FB8 A;  5D3W A;  1EF1 A;  4YL8 A;  4QJ5 B;  2COD A;  3PEG A;  3NWF A;  2J0K A;  3IVF A;  4ZRJ A;  1U5G A;  3ODO A;  3HK0 A;  1ZC4 B;  4D6W A;  5HE0 A;  2Y8F A;  3DCX A;  5C5B B;  1WJM A;  4HSI A;  2K8E A;  2YRY A;  3NWA A;  2W2X C;  1FHW A;  3U12 A;  3ULB A;  1BWN A;  1WGQ A;  1ZSQ A;  2I5C A;  3A58 A;  2GCL A;  1KZ7 A;  2Y7B A;  4QJ4 B;  4HAT B;  3D8D A;  3N7C A;  1E5W A;  2ADZ A;  3HSA A;  2BCJ A;  3QWM A;  4HDQ A;  1V5P A;  2K2U A;  3GYO A;  4KAX B;  2R2Y A;  1T77 A;  3KZ1 A;  4A6H A;  4DBB A;  2UZS A;  2ZPY A;  5DHF B;  5C5B A;  2QKL A;  4MY6 A;  1MK9 B;  2D9X A;  3KRW A;  4GNK B;  5J3Q A;  1BAK A;  3ODX A;  1LB1 A;  1N3H A;  4HB2 B;  2L2I A;  4EKU A;  1J0W A;  1EGX A;  1KZG A;  2Z0O A;  1X86 A;  4EMO A;  2UVM A;  1XX0 A;  1MIX A;  2DFK A;  4BBK A;  2JP2 A;  2N23 A;  4KHB A;  2H7D A;  2GJY A;  3SO6 A;  3AU4 A;  1SGH A;  4PQ0 A;  1WVH A;  2RUK B;  2LKO A;  3SNH A;  2DHI A;  2Z59 A;  2RNR B;  3HW2 B;  1GC6 A;  3FM8 C;  1OQN A;  4Z2N A;  2HTH B;  3AJ4 A;  2OTX A;  2UZR A;  1X1G A;  5FI0 A;  5D3X A;  1X1F A;  3UZT A;  4K2O A;  1NTY A;  3MPX A;  4L1R A;  5JHG A;  4OSN A;  2VSZ A;  3DXC A;  2NMB A;  2VKI A;  2CAY A;  2P0D A;  2X18 A;  1M7R A;  2RSG A;  1DRO A;  3ML4 A;  2P0F A;  2H7E A;  1SHC A;  3MDB C;  5C6R A;  1J19 A;  3F0W A;  3D8E A;  3FVC A;  4OT1 A;  2DHJ A;  5KQ1 A;  1WI1 A;  1OY2 A; 
#chains in the Genus database with same CATH homology
 2K8E A;  2KR0 A;  4PQ0 A;  4Z2M B;  3TO1 A;  2Z4D A;  2KUQ A;  3NWA A;  4KHB B;  2FJU B;  4QJ5 B;  2GCJ A;  4IFS A;  5I2M A;  3NWF A;  4GNK B;  4OSN A;  3U12 A;  2Z59 A;  4DIX A;  4KHO A;  1ZYI A;  3A58 A;  2GUM A;  5M4Y B;  2KIE A;  3NWD A;  2RRF A;  2GCL A;  4IOY X;  3OHM B;  4QJ4 B;  2Z14 A;  4QXA B;  4Z2N A;  3TW1 A;  2ZKM X;  4QJ3 B;  2YT2 A;  4GOU A;  5I2S A;  5IRS A;  4KHA A;  4D6W A;  3GYP A;  3TVV A;  2NBV A;  2K49 A;  2Z13 A;  3FSS A;  4CSQ A;  3FVC A;  3HIE A;  4KHB A;  3GYO A;  4OT1 A;  5LG4 B;  2KIG A;  4HSI A;  2R2Y A;  3NW8 A;  4L1R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...