2KIEA

A ph domain within ocrl bridges clathrin mediated membrane trafficking to phosphoinositide metabolis
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
124
structure length
124
Chain Sequence
GPLGSMEPPLPVGAQPLATVEGMEMKGPLREPCALTLAQRNGQYELIIQLHEKEQHVQDIIPINSHFRCVQEAEETLLIDIASNSGCKIRVQGDWIRERRFEIPDEEHCLKFLSAVLAAQKAQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inositol polyphosphate 5-phosphatase OCRL-1
publication title A PH domain within OCRL bridges clathrin-mediated membrane trafficking to phosphoinositide metabolism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 17
structure length 124
sequence length 124
ec nomenclature ec 3.1.3.36: Phosphoinositide 5-phosphatase.
pdb deposition date 2009-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16726 OCRL_clath_bd Inositol polyphosphate 5-phosphatase clathrin binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.110 Mainly Beta Roll PH-domain like PH-domain like 2kieA00
2KIEA 2KIGA
chains in the Genus database with same CATH superfamily
1TJ6A 2HE7A 2DYNA 3GYPA 3BJIA 4Y94A 5D3WA 4HB3B 1ZYIA 2Z13A 4A6KA 3N7CA 2DN6A 1KZGA 3PG7A 1BWNA 1AQCA 1Y19B 4GOUA 3VIAA 1ZVRA 3SYXA 4IAPA 4BBKA 2CRFA 3CIKA 2LYDA 2D9XA 2NBVA 2CY5A 4GZUA 3F5RA 4WJ7A 4QJ4B 2M14A 3KZ1A 5D3XA 2H7EA 1XR0B 3BINA 4HB2B 2DX5A 4IOYX 1V5PA 2QKMA 4HSIA 2Z0PA 5J3QA 2RVBB 2J0KA 3ODWA 2IFSA 1NTVA 1ZM0A 1U5GA 2DKPA 4WVFB 2YS3A 5JHGA 4DIXA 3AU4A 2K2JA 1DDWA 1EF1A 2UZRA 4ZRKA 2GCJA 2VSZA 2P0FA 5M4YB 1BTKA 5KQ4A 2X18A 5FI1A 2I5FA 2H7DA 4CHMA 1Q67A 2Z59A 1K5DB 2RRFA 1V5UA 2I1JA 2N0YA 5DI9B 1WVHA 2L2IA 5D3YA 2ELBA 4HB0B 1W1GA 1RJ2A 4L6EA 1W1HA 2V76A 3ZVRA 3G9WA 3ML4A 3M1IB 4Z2NA 1NTYA 5DIFB 1TXDA 3DXCA 1U27A 3HQCA 2G35A 4A5KA 5KQ1A 1M7RA 1U29A 3FSSA 1J0WA 2AEHA 1WG7A 4P7IA 3U12A 3PVUA 5C16A 1I2HA 1U5EA 2E2XA 1MIZB 2FJUB 3SUZA 1W1DA 1DBHA 5C79A 1NU2A 3TCAA 2EC1A 1QC6A 5HE2A 1BTNA 1H10A 3PEGA 3ULCA 4D6WA 1FHWA 5DHAB 2VKIA 1U5FA 2EMSA 2JP2A 1N3HA 1FHOA 4C0AA 1V61A 4CYEA 4EKUA 1XKEA 2KR0A 3IVFA 1M7EA 1XD4A 2RUKB 5IRSA 1BAKA 1NI2A 1Y5OA 1P5TA 3QWMA 3TW1A 3B77A 1SGHA 3FVCA 5LOPB 3DXDA 3TVVA 1GG3A 2J0MA 2W2WA 3PVLA 2Y8GA 3MDBC 4GMVA 4TYZA 5HE1A 2YSZA 1X1GA 2R2YA 2BCJA 1MI1A 1WGQA 2Y8FA 4HAXB 2EMTA 5I2MA 5JP4A 3QBVB 1J19A 4HDOA 5I2SA 3PZDA 3HSAA 2DHIA 2GS0A 2KIGA 1P6SA 4HAVB 1WJ1A 3AU5A 4NSWA 2GJYA 2KUQA 1TQZA 4GXBA 2L1CA 3SV1A 2W2XD 3VOQA 2J59M 2D4QA 1X05A 1IRSA 5LG4B 2DA0A 1ISNA 4IFSA 2DTCA 3TO1A 4YONA 4ZRJA 5L81A 2MDXA 1OQNA 3NWAA 3OANA 4KAXB 1SHCA 2OTXA 4K2PA 2KIEA 4K17A 5D3VA 5C6RA 4HB4B 5J3YA 1UPRA 2ZPYA 3NW8A 2ROVA 2D9VA 2KGXB 3KY9A 2Z14A 1I7AA 4MY6A 2I1KA 1ZSQA 4WSFA 2D10A 1EAZA 4QJ3B 2R0DA 1MIXA 3KSYA 2DFKA 3O96A 3P7ZA 1MAIA 1KZ7A 1QQGA 4DX8A 4MK0A 5LONB 4KHBA 5J3TA 1X11A 5JHHA 2YVCA 1H4RA 4EJNA 4GPTB 4A6HA 1WJMA 4QXAB 2D2QA 2DYQA 3HK0A 1XX0A 2RNRB 4OT1A 4KHAA 1DDVA 2DKQA 1DYNA 3PVWA 4DXAB 2VRWB 1V88A 2LOXA 2P8VA 4KVGB 4NY0A 5CLQB 2K00A 2Z4DA 1XCGA 3RCPA 1GC7A 1WI1A 3NWFA 3X23A 4F7HA 2IYBA 2DLWA 4HAZB 4DX90 1V5MA 3A98B 1ZC4B 2COCA 2DHJA 3FEHA 1LB1A 2KUPA 2YS1A 2K2UA 2AL6A 2UZSA 2MFQA 3LJUX 3UZTA 2D9YA 2LOZA 4CSQA 1ZC3B 5JLJB 3GYOA 2LULA 4PQ0A 1B55A 4GMXB 3ZDTA 2XQNM 1GC6A 2QKLA 3OHMB 3A58A 4TKNA 4HHVA 2GUMA 4K2OA 4F7UP 1UNRA 5HE3A 1OY2A 2UVMA 3DXEA 3PSCA 1EGXA 1UNPA 2MKRA 1K5GB 3P6AA 4Z2MB 3ODXA 4HAYB 1FOEA 1FGYA 4HAWB 1V89A 1WGUA 4K81A 2HTHB 5D27A 4H8SA 2FJLA 3KRXA 5C5BA 2RGNB 5FI0A 2COAA 1E5WA 4HATB 2CY4A 2PZ1A 4GN1A 5GOWB 5C5BB 1FHXA 2DX1A 3ULBA 1UNQA 3D8EA 4QJ5B 3FM8C 3NWDA 3A8PA 3D8DA 1PLSA 2ADZA 4HDQA 1MPHA 3U7DA 1MK9B 2EJ8A 2MWNB 2RLOA 3PP2A 2CAYA 1FGZA 3D8FA 2ZKMX 4F7GA 4XWXA 1XODA 1U2BA 3NSUA 3WYFB 5CLLB 3SO6A 1PFJA 3TFMA 1P3RA 1MKEA 3WA0A 5HE0A 2Z0OA 2D9ZA 2YT0A 2NMBA 2OQBA 5EFXA 1OMWA 2LKOA 2YT2A 1FB8A 2D11A 1T77A 2CODA 4D0NB 2ROZB 1U5DA 4KHBB 3ODOA 2M38A 3HW2B 2J0JA 4EMOA 2NZ8B 3QIJA 2R09A 3F0WA 3T06A 2RSGA 3CXBB 4L1RA 1FAOA 3DCXA 1DROA 2P0HA 2Y7BA 4MT7A 4B6HA 2KCJA 2P0DA 3KRWA 4ZRIA 2Z0QA 1PMSA 2GCLA 3AJ4A 3HIEA 2Q13A 1UEFA 2I5CA 4YL8A 4OSNA 2N23A 4KHOA 4PNKA 2YS5A 2DHKA 3A8QA 1AWEA 3U8ZA 4CHJA 4A6FA 1LW3A 2ELAA 2YRYA 1DDMA 1UPQA 3V5WA 4HAUB 2K8EA 4DBBA 1EVHA 4A6FB 1KI1B 4GNKB 5DH9B 2LG1A 3SNHA 1MK7B 2YT1A 5DHFB 2W2XC 1RRPB 1X86A 5KCVA 3MPXA 1X1FA 2COFA 2YF0A 1Z87A 2D9WA 2K49A
chains in the Genus database with same CATH topology
4QJ3B 2KR0A 3GYPA 5LG4B 3U12A 5IRSA 5I2MA 2GCJA 4IFSA 4IOYX 4L1RA 2Z4DA 4CSQA 1ZYIA 4QJ5B 3TO1A 4HSIA 2Z13A 2FJUB 3GYOA 3NWDA 4KHBA 4Z2NA 5M4YB 3TW1A 4Z2MB 5I2SA 4PQ0A 3NWAA 3NWFA 4GOUA 2K8EA 3FVCA 2GCLA 2KIEA 2KIGA 3HIEA 4GNKB 2YT2A 4QXAB 3TVVA 2Z59A 2KUQA 2NBVA 3NW8A 4OT1A 2RRFA 2K49A 4KHBB 4KHAA 4D6WA 4DIXA 4OSNA 2Z14A 2ZKMX 3FSSA 4KHOA 4QJ4B 3OHMB 3A58A 2GUMA 2R2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KIE A;  2KIG A; 
#chains in the Genus database with same CATH topology
 1TJ6 A;  2HE7 A;  2DYN A;  3GYP A;  3BJI A;  4Y94 A;  5D3W A;  4HB3 B;  1ZYI A;  2Z13 A;  4A6K A;  3N7C A;  2DN6 A;  1KZG A;  3PG7 A;  1BWN A;  1AQC A;  1Y19 B;  4GOU A;  3VIA A;  1ZVR A;  3SYX A;  4IAP A;  4BBK A;  2CRF A;  3CIK A;  2LYD A;  2D9X A;  2NBV A;  2CY5 A;  4GZU A;  3F5R A;  4WJ7 A;  4QJ4 B;  2M14 A;  3KZ1 A;  5D3X A;  2H7E A;  1XR0 B;  3BIN A;  4HB2 B;  2DX5 A;  4IOY X;  1V5P A;  2QKM A;  4HSI A;  2Z0P A;  5J3Q A;  2RVB B;  2J0K A;  3ODW A;  2IFS A;  1NTV A;  1ZM0 A;  1U5G A;  2DKP A;  4WVF B;  2YS3 A;  5JHG A;  4DIX A;  3AU4 A;  2K2J A;  1DDW A;  1EF1 A;  2UZR A;  4ZRK A;  2GCJ A;  2VSZ A;  2P0F A;  5M4Y B;  1BTK A;  5KQ4 A;  2X18 A;  5FI1 A;  2I5F A;  2H7D A;  4CHM A;  1Q67 A;  2Z59 A;  1K5D B;  2RRF A;  1V5U A;  2I1J A;  2N0Y A;  5DI9 B;  1WVH A;  2L2I A;  5D3Y A;  2ELB A;  4HB0 B;  1W1G A;  1RJ2 A;  4L6E A;  1W1H A;  2V76 A;  3ZVR A;  3G9W A;  3ML4 A;  3M1I B;  4Z2N A;  1NTY A;  5DIF B;  1TXD A;  3DXC A;  1U27 A;  3HQC A;  2G35 A;  4A5K A;  5KQ1 A;  1M7R A;  1U29 A;  3FSS A;  1J0W A;  2AEH A;  1WG7 A;  4P7I A;  3U12 A;  3PVU A;  5C16 A;  1I2H A;  1U5E A;  2E2X A;  1MIZ B;  2FJU B;  3SUZ A;  1W1D A;  1DBH A;  5C79 A;  1NU2 A;  3TCA A;  2EC1 A;  1QC6 A;  5HE2 A;  1BTN A;  1H10 A;  3PEG A;  3ULC A;  4D6W A;  1FHW A;  5DHA B;  2VKI A;  1U5F A;  2EMS A;  2JP2 A;  1N3H A;  1FHO A;  4C0A A;  1V61 A;  4CYE A;  4EKU A;  1XKE A;  2KR0 A;  3IVF A;  1M7E A;  1XD4 A;  2RUK B;  5IRS A;  1BAK A;  1NI2 A;  1Y5O A;  1P5T A;  3QWM A;  3TW1 A;  3B77 A;  1SGH A;  3FVC A;  5LOP B;  3DXD A;  3TVV A;  1GG3 A;  2J0M A;  2W2W A;  3PVL A;  2Y8G A;  3MDB C;  4GMV A;  4TYZ A;  5HE1 A;  2YSZ A;  1X1G A;  2R2Y A;  2BCJ A;  1MI1 A;  1WGQ A;  2Y8F A;  4HAX B;  2EMT A;  5I2M A;  5JP4 A;  3QBV B;  1J19 A;  4HDO A;  5I2S A;  3PZD A;  3HSA A;  2DHI A;  2GS0 A;  2KIG A;  1P6S A;  4HAV B;  1WJ1 A;  3AU5 A;  4NSW A;  2GJY A;  2KUQ A;  1TQZ A;  4GXB A;  2L1C A;  3SV1 A;  2W2X D;  3VOQ A;  2J59 M;  2D4Q A;  1X05 A;  1IRS A;  5LG4 B;  2DA0 A;  1ISN A;  4IFS A;  2DTC A;  3TO1 A;  4YON A;  4ZRJ A;  5L81 A;  2MDX A;  1OQN A;  3NWA A;  3OAN A;  4KAX B;  1SHC A;  2OTX A;  4K2P A;  2KIE A;  4K17 A;  5D3V A;  5C6R A;  4HB4 B;  5J3Y A;  1UPR A;  2ZPY A;  3NW8 A;  2ROV A;  2D9V A;  2KGX B;  3KY9 A;  2Z14 A;  1I7A A;  4MY6 A;  2I1K A;  1ZSQ A;  4WSF A;  2D10 A;  1EAZ A;  4QJ3 B;  2R0D A;  1MIX A;  3KSY A;  2DFK A;  3O96 A;  3P7Z A;  1MAI A;  1KZ7 A;  1QQG A;  4DX8 A;  4MK0 A;  5LON B;  4KHB A;  5J3T A;  1X11 A;  5JHH A;  2YVC A;  1H4R A;  4EJN A;  4GPT B;  4A6H A;  1WJM A;  4QXA B;  2D2Q A;  2DYQ A;  3HK0 A;  1XX0 A;  2RNR B;  4OT1 A;  4KHA A;  1DDV A;  2DKQ A;  1DYN A;  3PVW A;  4DXA B;  2VRW B;  1V88 A;  2LOX A;  2P8V A;  4KVG B;  4NY0 A;  5CLQ B;  2K00 A;  2Z4D A;  1XCG A;  3RCP A;  1GC7 A;  1WI1 A;  3NWF A;  3X23 A;  4F7H A;  2IYB A;  2DLW A;  4HAZ B;  4DX9 0;  1V5M A;  3A98 B;  1ZC4 B;  2COC A;  2DHJ A;  3FEH A;  1LB1 A;  2KUP A;  2YS1 A;  2K2U A;  2AL6 A;  2UZS A;  2MFQ A;  3LJU X;  3UZT A;  2D9Y A;  2LOZ A;  4CSQ A;  1ZC3 B;  5JLJ B;  3GYO A;  2LUL A;  4PQ0 A;  1B55 A;  4GMX B;  3ZDT A;  2XQN M;  1GC6 A;  2QKL A;  3OHM B;  3A58 A;  4TKN A;  4HHV A;  2GUM A;  4K2O A;  4F7U P;  1UNR A;  5HE3 A;  1OY2 A;  2UVM A;  3DXE A;  3PSC A;  1EGX A;  1UNP A;  2MKR A;  1K5G B;  3P6A A;  4Z2M B;  3ODX A;  4HAY B;  1FOE A;  1FGY A;  4HAW B;  1V89 A;  1WGU A;  4K81 A;  2HTH B;  5D27 A;  4H8S A;  2FJL A;  3KRX A;  5C5B A;  2RGN B;  5FI0 A;  2COA A;  1E5W A;  4HAT B;  2CY4 A;  2PZ1 A;  4GN1 A;  5GOW B;  5C5B B;  1FHX A;  2DX1 A;  3ULB A;  1UNQ A;  3D8E A;  4QJ5 B;  3FM8 C;  3NWD A;  3A8P A;  3D8D A;  1PLS A;  2ADZ A;  4HDQ A;  1MPH A;  3U7D A;  1MK9 B;  2EJ8 A;  2MWN B;  2RLO A;  3PP2 A;  2CAY A;  1FGZ A;  3D8F A;  2ZKM X;  4F7G A;  4XWX A;  1XOD A;  1U2B A;  3NSU A;  3WYF B;  5CLL B;  3SO6 A;  1PFJ A;  3TFM A;  1P3R A;  1MKE A;  3WA0 A;  5HE0 A;  2Z0O A;  2D9Z A;  2YT0 A;  2NMB A;  2OQB A;  5EFX A;  1OMW A;  2LKO A;  2YT2 A;  1FB8 A;  2D11 A;  1T77 A;  2COD A;  4D0N B;  2ROZ B;  1U5D A;  4KHB B;  3ODO A;  2M38 A;  3HW2 B;  2J0J A;  4EMO A;  2NZ8 B;  3QIJ A;  2R09 A;  3F0W A;  3T06 A;  2RSG A;  3CXB B;  4L1R A;  1FAO A;  3DCX A;  1DRO A;  2P0H A;  2Y7B A;  4MT7 A;  4B6H A;  2KCJ A;  2P0D A;  3KRW A;  4ZRI A;  2Z0Q A;  1PMS A;  2GCL A;  3AJ4 A;  3HIE A;  2Q13 A;  1UEF A;  2I5C A;  4YL8 A;  4OSN A;  2N23 A;  4KHO A;  4PNK A;  2YS5 A;  2DHK A;  3A8Q A;  1AWE A;  3U8Z A;  4CHJ A;  4A6F A;  1LW3 A;  2ELA A;  2YRY A;  1DDM A;  1UPQ A;  3V5W A;  4HAU B;  2K8E A;  4DBB A;  1EVH A;  4A6F B;  1KI1 B;  4GNK B;  5DH9 B;  2LG1 A;  3SNH A;  1MK7 B;  2YT1 A;  5DHF B;  2W2X C;  1RRP B;  1X86 A;  5KCV A;  3MPX A;  1X1F A;  2COF A;  2YF0 A;  1Z87 A;  2D9W A;  2K49 A; 
#chains in the Genus database with same CATH homology
 4QJ3 B;  2KR0 A;  3GYP A;  5LG4 B;  3U12 A;  5IRS A;  5I2M A;  2GCJ A;  4IFS A;  4IOY X;  4L1R A;  2Z4D A;  4CSQ A;  1ZYI A;  4QJ5 B;  3TO1 A;  4HSI A;  2Z13 A;  2FJU B;  3GYO A;  3NWD A;  4KHB A;  4Z2N A;  5M4Y B;  3TW1 A;  4Z2M B;  5I2S A;  4PQ0 A;  3NWA A;  3NWF A;  4GOU A;  2K8E A;  3FVC A;  2GCL A;  2KIE A;  2KIG A;  3HIE A;  4GNK B;  2YT2 A;  4QXA B;  3TVV A;  2Z59 A;  2KUQ A;  2NBV A;  3NW8 A;  4OT1 A;  2RRF A;  2K49 A;  4KHB B;  4KHA A;  4D6W A;  4DIX A;  4OSN A;  2Z14 A;  2ZKM X;  3FSS A;  4KHO A;  4QJ4 B;  3OHM B;  3A58 A;  2GUM A;  2R2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...