2KIEA

A ph domain within ocrl bridges clathrin mediated membrane trafficking to phosphoinositide metabolis
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
124
structure length
124
Chain Sequence
GPLGSMEPPLPVGAQPLATVEGMEMKGPLREPCALTLAQRNGQYELIIQLHEKEQHVQDIIPINSHFRCVQEAEETLLIDIASNSGCKIRVQGDWIRERRFEIPDEEHCLKFLSAVLAAQKAQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Inositol polyphosphate 5-phosphatase OCRL-1
publication title A PH domain within OCRL bridges clathrin-mediated membrane trafficking to phosphoinositide metabolism
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 124
sequence length 124
ec nomenclature ec 3.1.3.36: Phosphoinositide 5-phosphatase.
pdb deposition date 2009-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16726 OCRL_clath_bd Inositol polyphosphate 5-phosphatase clathrin binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.110 Mainly Beta Roll PH-domain like PH-domain like 2kieA00
2KIGA 2KIEA
chains in the Genus database with same CATH superfamily
3SV1A 2VKIA 1E5WA 3ZVRA 1KZGA 2COCA 1IRSA 2CAYA 2D9XA 4F7GA 2N23A 1W1HA 1NI2A 2E2XA 3NW8A 3A98B 4HAZB 4K17A 4QJ5B 3ODXA 1AWEA 2CY4A 3U12A 1V89A 2YRYA 2COFA 1MI1A 4IOYX 5JHGA 2KUQA 2ZPYA 1MIXA 1FHOA 1AQCA 1DDVA 2RLOA 1DDWA 1X1FA 2GCLA 4HAXB 1U5FA 1PFJA 3IVFA 4ZRIA 1DROA 3KSYA 2DX5A 3VOQA 2RGNB 4HSIA 1U27A 3PVUA 4K2PA 1XX0A 4YONA 2D9WA 4ZRJA 1P3RA 2D9ZA 2Y8GA 1W1DA 4KHBA 3CIKA 3B77A 2CODA 3P7ZA 3ODOA 3G9WA 1MIZB 1WG7A 1BTNA 4NY0A 1UNRA 2H7EA 4KAXB 2G35A 1MPHA 1Q67A 4DX90 2J59M 4QXAB 4HAYB 2R2YA 4OT1A 4EMOA 2PZ1A 2MFQA 2Y7BA 2R0DA 4A6FA 4MY6A 3AJ4A 2UZSA 2YT0A 1SHCA 5D3VA 2EMTA 3BINA 1XCGA 1WJ1A 1NTVA 1ZVRA 4OSNA 4HAUB 2K2UA 5JP4A 3SUZA 3ML4A 4D6WA 2YSZA 1M7RA 1NTYA 2DTCA 3NWAA 2YT1A 1GG3A 2ROVA 1SGHA 1X86A 5LOPB 1U5EA 5C6RA 1WGQA 5HE1A 3D8FA 4ZRKA 4QJ3B 4HAWB 1V61A 2ZKMX 1T77A 4MT7A 3BJIA 1KZ7A 4Z2NA 2Z59A 1WVHA 1TJ6A 3NWDA 2CRFA 5J3QA 2NZ8B 4NSWA 1ZM0A 1BTKA 1I2HA 2YF0A 2P0FA 1UEFA 3A58A 5L81A 2DX1A 2GCJA 3NWFA 5GOWB 2LOXA 5JLJB 2FJUB 3KRWA 3X23A 2J0MA 2V76A 4BBKA 4HATB 5C5BA 4Y94A 2DHJA 1QQGA 4B6HA 2D11A 2KUPA 3KZ1A 2QKLA 2W2WA 3MDBC 2Z0PA 3HIEA 1X11A 4GZUA 5KQ1A 1FHWA 1FAOA 2XQNM 3FVCA 1K5GB 1XD4A 4DBBA 2UZRA 2FJLA 1V88A 4H8SA 4MK0A 1I7AA 5I2MA 1X05A 3ULCA 4PQ0A 2MDXA 4F7UP 2KGXB 4IFSA 2LG1A 2ELBA 3SO6A 3O96A 2RVBB 1V5UA 3RCPA 3CXBB 1U2BA 5DHFB 1WI1A 2Q13A 1DDMA 2LYDA 2BCJA 2P8VA 2Z14A 1PLSA 2YT2A 2YS3A 1OMWA 2VSZA 5CLLB 2K8EA 4HDOA 5DI9B 4KVGB 2D10A 2GUMA 2R09A 1RRPB 2D9VA 2K00A 2KIEA 3WA0A 4KHOA 3QIJA 2GS0A 2NMBA 1N3HA 3ULBA 1FGYA 2VRWB 3TW1A 5HE2A 4CYEA 4A5KA 2L1CA 2ADZA 5HE3A 2OQBA 4CHMA 1K5DB 1BWNA 2J0JA 3DXEA 3VIAA 4EKUA 1B55A 1KI1B 2ROZB 3HSAA 4XWXA 2NBVA 1GC6A 2I5CA 4DX8A 5KCVA 4GPTB 2MKRA 1FOEA 2M14A 3HQCA 1FGZA 1Y5OA 3PEGA 3U7DA 1UPRA 2KCJA 1EGXA 2I1JA 2P0DA 3TCAA 3PVLA 4A6HA 2ELAA 5JHHA 1P6SA 2D2QA 2YS1A 1NU2A 4WVFB 1J0WA 2RRFA 5LONB 1OY2A 3DXDA 4GOUA 2UVMA 1UNPA 2LULA 2EMSA 1FB8A 2LOZA 4HAVB 2Z13A 4GN1A 5IRSA 3HK0A 3MPXA 3NSUA 4HB3B 2L2IA 2DLWA 3T06A 4HHVA 3SYXA 2HTHB 1UPQA 2EJ8A 2H7DA 5D3WA 2EC1A 3DXCA 4PNKA 4WSFA 3ODWA 2RSGA 1QC6A 3KRXA 4YL8A 5DHAB 4QJ4B 1WGUA 2DFKA 1XKEA 2HE7A 3TVVA 1MK9B 2K49A 5D3XA 1ZC4B 2CY5A 2MWNB 4K81A 3PG7A 2YVCA 2W2XC 3F0WA 4KHBB 3FEHA 3N7CA 3PVWA 2I1KA 3HW2B 5D3YA 2D4QA 4L1RA 4CSQA 2RNRB 4IAPA 1MAIA 3U8ZA 3V5WA 3P6AA 3ZDTA 4A6KA 1MK7B 3AU5A 5DIFB 3D8DA 1V5PA 2DKQA 3AU4A 2YS5A 1DYNA 2KR0A 4A6FB 2DYQA 3M1IB 2LKOA 5D27A 1LW3A 5FI1A 3KY9A 1RJ2A 2W2XD 4DIXA 1FHXA 1LB1A 4GMVA 2Z0QA 5J3TA 1DBHA 1TXDA 2I5FA 3DCXA 4TKNA 2DHKA 2JP2A 4HB4B 3UZTA 1EF1A 3QWMA 2X18A 4DXAB 1WJMA 4L6EA 1H10A 5HE0A 5FI0A 1BAKA 1OQNA 1J19A 3A8PA 3D8EA 2M38A 5LG4B 1Z87A 3PZDA 5M4YB 3PSCA 3F5RA 1X1GA 1MKEA 2AL6A 3FSSA 4K2OA 1H4RA 1U5DA 3LJUX 5C79A 1XR0B 1V5MA 5I2SA 3TFMA 2DKPA 4HB0B 5CLQB 1P5TA 1U29A 3GYOA 2IYBA 4D0NB 4P7IA 5EFXA 1ISNA 1XODA 2AEHA 4GXBA 5DH9B 1EAZA 1ZSQA 1UNQA 3OANA 2QKMA 4CHJA 3SNHA 4GNKB 2IFSA 4TYZA 4GMXB 4HB2B 2K2JA 2DYNA 1GC7A 2DHIA 2KIGA 3FM8C 4WJ7A 3WYFB 2GJYA 4KHAA 4C0AA 4HDQA 1EVHA 1TQZA 1U5GA 3PP2A 5C16A 3TO1A 4EJNA 1ZYIA 2RUKB 1PMSA 4F7HA 2D9YA 5KQ4A 2Y8FA 1M7EA 5C5BB 2J0KA 2Z0OA 3GYPA 2DA0A 2N0YA 1ZC3B 5J3YA 2Z4DA 3A8QA 2DN6A 2P0HA 3OHMB 3QBVB 2OTXA 1W1GA 1Y19B 4Z2MB 2COAA
chains in the Genus database with same CATH topology
2FJUB 3NWDA 3GYOA 4D6WA 2KIGA 3NWAA 3FVCA 4QXAB 4KHAA 4QJ4B 2R2YA 4OT1A 3TW1A 2K49A 3TVVA 3NW8A 2Z13A 2KR0A 3TO1A 4HSIA 1ZYIA 4QJ5B 5LG4B 5IRSA 5M4YB 5I2MA 2Z14A 3U12A 3GYPA 2YT2A 3FSSA 4PQ0A 4KHBA 4IOYX 4KHBB 4DIXA 2K8EA 4IFSA 2KUQA 2NBVA 2Z4DA 4QJ3B 3A58A 2GUMA 2RRFA 3OHMB 2ZKMX 5I2SA 2GCJA 4GNKB 3NWFA 4L1RA 4CSQA 4OSNA 2KIEA 3HIEA 2GCLA 4KHOA 4Z2NA 2Z59A 4GOUA 4Z2MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KIG A;  2KIE A; 
#chains in the Genus database with same CATH topology
 3SV1 A;  2VKI A;  1E5W A;  3ZVR A;  1KZG A;  2COC A;  1IRS A;  2CAY A;  2D9X A;  4F7G A;  2N23 A;  1W1H A;  1NI2 A;  2E2X A;  3NW8 A;  3A98 B;  4HAZ B;  4K17 A;  4QJ5 B;  3ODX A;  1AWE A;  2CY4 A;  3U12 A;  1V89 A;  2YRY A;  2COF A;  1MI1 A;  4IOY X;  5JHG A;  2KUQ A;  2ZPY A;  1MIX A;  1FHO A;  1AQC A;  1DDV A;  2RLO A;  1DDW A;  1X1F A;  2GCL A;  4HAX B;  1U5F A;  1PFJ A;  3IVF A;  4ZRI A;  1DRO A;  3KSY A;  2DX5 A;  3VOQ A;  2RGN B;  4HSI A;  1U27 A;  3PVU A;  4K2P A;  1XX0 A;  4YON A;  2D9W A;  4ZRJ A;  1P3R A;  2D9Z A;  2Y8G A;  1W1D A;  4KHB A;  3CIK A;  3B77 A;  2COD A;  3P7Z A;  3ODO A;  3G9W A;  1MIZ B;  1WG7 A;  1BTN A;  4NY0 A;  1UNR A;  2H7E A;  4KAX B;  2G35 A;  1MPH A;  1Q67 A;  4DX9 0;  2J59 M;  4QXA B;  4HAY B;  2R2Y A;  4OT1 A;  4EMO A;  2PZ1 A;  2MFQ A;  2Y7B A;  2R0D A;  4A6F A;  4MY6 A;  3AJ4 A;  2UZS A;  2YT0 A;  1SHC A;  5D3V A;  2EMT A;  3BIN A;  1XCG A;  1WJ1 A;  1NTV A;  1ZVR A;  4OSN A;  4HAU B;  2K2U A;  5JP4 A;  3SUZ A;  3ML4 A;  4D6W A;  2YSZ A;  1M7R A;  1NTY A;  2DTC A;  3NWA A;  2YT1 A;  1GG3 A;  2ROV A;  1SGH A;  1X86 A;  5LOP B;  1U5E A;  5C6R A;  1WGQ A;  5HE1 A;  3D8F A;  4ZRK A;  4QJ3 B;  4HAW B;  1V61 A;  2ZKM X;  1T77 A;  4MT7 A;  3BJI A;  1KZ7 A;  4Z2N A;  2Z59 A;  1WVH A;  1TJ6 A;  3NWD A;  2CRF A;  5J3Q A;  2NZ8 B;  4NSW A;  1ZM0 A;  1BTK A;  1I2H A;  2YF0 A;  2P0F A;  1UEF A;  3A58 A;  5L81 A;  2DX1 A;  2GCJ A;  3NWF A;  5GOW B;  2LOX A;  5JLJ B;  2FJU B;  3KRW A;  3X23 A;  2J0M A;  2V76 A;  4BBK A;  4HAT B;  5C5B A;  4Y94 A;  2DHJ A;  1QQG A;  4B6H A;  2D11 A;  2KUP A;  3KZ1 A;  2QKL A;  2W2W A;  3MDB C;  2Z0P A;  3HIE A;  1X11 A;  4GZU A;  5KQ1 A;  1FHW A;  1FAO A;  2XQN M;  3FVC A;  1K5G B;  1XD4 A;  4DBB A;  2UZR A;  2FJL A;  1V88 A;  4H8S A;  4MK0 A;  1I7A A;  5I2M A;  1X05 A;  3ULC A;  4PQ0 A;  2MDX A;  4F7U P;  2KGX B;  4IFS A;  2LG1 A;  2ELB A;  3SO6 A;  3O96 A;  2RVB B;  1V5U A;  3RCP A;  3CXB B;  1U2B A;  5DHF B;  1WI1 A;  2Q13 A;  1DDM A;  2LYD A;  2BCJ A;  2P8V A;  2Z14 A;  1PLS A;  2YT2 A;  2YS3 A;  1OMW A;  2VSZ A;  5CLL B;  2K8E A;  4HDO A;  5DI9 B;  4KVG B;  2D10 A;  2GUM A;  2R09 A;  1RRP B;  2D9V A;  2K00 A;  2KIE A;  3WA0 A;  4KHO A;  3QIJ A;  2GS0 A;  2NMB A;  1N3H A;  3ULB A;  1FGY A;  2VRW B;  3TW1 A;  5HE2 A;  4CYE A;  4A5K A;  2L1C A;  2ADZ A;  5HE3 A;  2OQB A;  4CHM A;  1K5D B;  1BWN A;  2J0J A;  3DXE A;  3VIA A;  4EKU A;  1B55 A;  1KI1 B;  2ROZ B;  3HSA A;  4XWX A;  2NBV A;  1GC6 A;  2I5C A;  4DX8 A;  5KCV A;  4GPT B;  2MKR A;  1FOE A;  2M14 A;  3HQC A;  1FGZ A;  1Y5O A;  3PEG A;  3U7D A;  1UPR A;  2KCJ A;  1EGX A;  2I1J A;  2P0D A;  3TCA A;  3PVL A;  4A6H A;  2ELA A;  5JHH A;  1P6S A;  2D2Q A;  2YS1 A;  1NU2 A;  4WVF B;  1J0W A;  2RRF A;  5LON B;  1OY2 A;  3DXD A;  4GOU A;  2UVM A;  1UNP A;  2LUL A;  2EMS A;  1FB8 A;  2LOZ A;  4HAV B;  2Z13 A;  4GN1 A;  5IRS A;  3HK0 A;  3MPX A;  3NSU A;  4HB3 B;  2L2I A;  2DLW A;  3T06 A;  4HHV A;  3SYX A;  2HTH B;  1UPQ A;  2EJ8 A;  2H7D A;  5D3W A;  2EC1 A;  3DXC A;  4PNK A;  4WSF A;  3ODW A;  2RSG A;  1QC6 A;  3KRX A;  4YL8 A;  5DHA B;  4QJ4 B;  1WGU A;  2DFK A;  1XKE A;  2HE7 A;  3TVV A;  1MK9 B;  2K49 A;  5D3X A;  1ZC4 B;  2CY5 A;  2MWN B;  4K81 A;  3PG7 A;  2YVC A;  2W2X C;  3F0W A;  4KHB B;  3FEH A;  3N7C A;  3PVW A;  2I1K A;  3HW2 B;  5D3Y A;  2D4Q A;  4L1R A;  4CSQ A;  2RNR B;  4IAP A;  1MAI A;  3U8Z A;  3V5W A;  3P6A A;  3ZDT A;  4A6K A;  1MK7 B;  3AU5 A;  5DIF B;  3D8D A;  1V5P A;  2DKQ A;  3AU4 A;  2YS5 A;  1DYN A;  2KR0 A;  4A6F B;  2DYQ A;  3M1I B;  2LKO A;  5D27 A;  1LW3 A;  5FI1 A;  3KY9 A;  1RJ2 A;  2W2X D;  4DIX A;  1FHX A;  1LB1 A;  4GMV A;  2Z0Q A;  5J3T A;  1DBH A;  1TXD A;  2I5F A;  3DCX A;  4TKN A;  2DHK A;  2JP2 A;  4HB4 B;  3UZT A;  1EF1 A;  3QWM A;  2X18 A;  4DXA B;  1WJM A;  4L6E A;  1H10 A;  5HE0 A;  5FI0 A;  1BAK A;  1OQN A;  1J19 A;  3A8P A;  3D8E A;  2M38 A;  5LG4 B;  1Z87 A;  3PZD A;  5M4Y B;  3PSC A;  3F5R A;  1X1G A;  1MKE A;  2AL6 A;  3FSS A;  4K2O A;  1H4R A;  1U5D A;  3LJU X;  5C79 A;  1XR0 B;  1V5M A;  5I2S A;  3TFM A;  2DKP A;  4HB0 B;  5CLQ B;  1P5T A;  1U29 A;  3GYO A;  2IYB A;  4D0N B;  4P7I A;  5EFX A;  1ISN A;  1XOD A;  2AEH A;  4GXB A;  5DH9 B;  1EAZ A;  1ZSQ A;  1UNQ A;  3OAN A;  2QKM A;  4CHJ A;  3SNH A;  4GNK B;  2IFS A;  4TYZ A;  4GMX B;  4HB2 B;  2K2J A;  2DYN A;  1GC7 A;  2DHI A;  2KIG A;  3FM8 C;  4WJ7 A;  3WYF B;  2GJY A;  4KHA A;  4C0A A;  4HDQ A;  1EVH A;  1TQZ A;  1U5G A;  3PP2 A;  5C16 A;  3TO1 A;  4EJN A;  1ZYI A;  2RUK B;  1PMS A;  4F7H A;  2D9Y A;  5KQ4 A;  2Y8F A;  1M7E A;  5C5B B;  2J0K A;  2Z0O A;  3GYP A;  2DA0 A;  2N0Y A;  1ZC3 B;  5J3Y A;  2Z4D A;  3A8Q A;  2DN6 A;  2P0H A;  3OHM B;  3QBV B;  2OTX A;  1W1G A;  1Y19 B;  4Z2M B;  2COA A; 
#chains in the Genus database with same CATH homology
 2FJU B;  3NWD A;  3GYO A;  4D6W A;  2KIG A;  3NWA A;  3FVC A;  4QXA B;  4KHA A;  4QJ4 B;  2R2Y A;  4OT1 A;  3TW1 A;  2K49 A;  3TVV A;  3NW8 A;  2Z13 A;  2KR0 A;  3TO1 A;  4HSI A;  1ZYI A;  4QJ5 B;  5LG4 B;  5IRS A;  5M4Y B;  5I2M A;  2Z14 A;  3U12 A;  3GYP A;  2YT2 A;  3FSS A;  4PQ0 A;  4KHB A;  4IOY X;  4KHB B;  4DIX A;  2K8E A;  4IFS A;  2KUQ A;  2NBV A;  2Z4D A;  4QJ3 B;  3A58 A;  2GUM A;  2RRF A;  3OHM B;  2ZKM X;  5I2S A;  2GCJ A;  4GNK B;  3NWF A;  4L1R A;  4CSQ A;  4OSN A;  2KIE A;  3HIE A;  2GCL A;  4KHO A;  4Z2N A;  2Z59 A;  4GOU A;  4Z2M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...