2KIEA

A ph domain within ocrl bridges clathrin mediated membrane trafficking to phosphoinositide metabolis
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
124
structure length
124
Chain Sequence
b'GPLGSMEPPLPVGAQPLATVEGMEMKGPLREPCALTLAQRNGQYELIIQLHEKEQHVQDIIPINSHFRCVQEAEETLLIDIASNSGCKIRVQGDWIRERRFEIPDEEHCLKFLSAVLAAQKAQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inositol polyphosphate 5-phosphatase OCRL-1
molecule tags Hydrolase
source organism Homo sapiens
publication title A PH domain within OCRL bridges clathrin-mediated membrane trafficking to phosphoinositide metabolism
pubmed doi rcsb
total genus 17
structure length 124
sequence length 124
ec nomenclature ec 3.1.3.36: Phosphoinositide 5-phosphatase.
pdb deposition date 2009-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16726 OCRL_clath_bd Inositol polyphosphate 5-phosphatase clathrin binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.110 Mainly Beta Roll PH-domain like PH-domain like 2kieA00
2KIEA 2KIGA
chains in the Genus database with same CATH superfamily
2CY5A 3ZDTA 3KSYA 1KZGA 3AU5A 1U5DA 5D3YA 2RSGA 2KUQA 1V5MA 1U5EA 2D9XA 2OQBA 2NZ8B 5L81A 2ADZA 5D27A 3FM8C 5KCVA 5JHGA 2QKLA 1ZC3B 2FJLA 4QJ3B 4HAYB 4DBBA 3SYXA 3DXCA 3KRWA 4HDQA 4MK0A 3OANA 1ZVRA 3DCXA 4WSFA 2RLOA 2LYDA 2K2UA 2KR0A 1LW3A 4CHMA 1U2BA 2EMTA 3PVWA 1PFJA 1BTNA 1MI1A 3GYPA 1AQCA 2V76A 2MKRA 3A98B 1SHCA 3PZDA 1N3HA 4PQ0A 4IAPA 1LB1A 2KUPA 1W1GA 2Y7BA 4F7GA 1XODA 1W1HA 4HB2B 4TKNA 5DH9B 2Q13A 3M1IB 1NU2A 4NSWA 4EJNA 4D6WA 2CODA 1FOEA 4ZRKA 2KGXB 4XWXA 3O96A 1TJ6A 3ODXA 3V5WA 1DBHA 5CLLB 1WJMA 3U12A 4A6HA 4F7HA 2COCA 1ISNA 2CAYA 2Z0QA 3PEGA 4IFSA 2VRWB 5LG4B 1BAKA 1V89A 4WJ7A 5KQ1A 4HDOA 2J0KA 2ROVA 2P0DA 2YSZA 3TVVA 2D9ZA 4B6HA 1X1FA 4Z2MB 3CIKA 3TFMA 4HAXB 3D8DA 1WGUA 2Z59A 1SGHA 4GMVA 2Z4DA 1GC7A 1ZSQA 4K2PA 4L1RA 2E2XA 2Z0OA 5GOWB 1UEFA 2W2XD 1Q67A 2R0DA 2ROZB 5DHFB 4MY6A 4HAWB 3ZVRA 2J0JA 1QC6A 2DYQA 1H4RA 2EJ8A 4P7IA 5C16A 3IVFA 1M7EA 4YONA 3RCPA 5LONB 2BCJA 1FGYA 5J3QA 3GYOA 4DXAB 2IYBA 5JHHA 1UPQA 1WI1A 4HAZB 3HK0A 1MK7B 5J3YA 1I7AA 2LKOA 2DYNA 2M14A 2R2YA 1FHOA 2GUMA 5C5BA 2ZPYA 4L6EA 4ZRJA 3NWDA 4GN1A 4WVFB 1H10A 4KHBB 2P8VA 3PP2A 4CHJA 3UZTA 2DHIA 3KZ1A 1OY2A 2H7DA 2K49A 5EFXA 1Y19B 3T06A 2L2IA 5FI0A 2RGNB 4DX90 2YT1A 1DDMA 2DHJA 1Z87A 1PLSA 2YS5A 2I1JA 3BINA 2Z13A 4A6FA 2DLWA 1UPRA 2DFKA 3F5RA 1DDVA 5JLJB 4QJ4B 2GJYA 1RJ2A 2IFSA 2LOZA 1U5FA 4A5KA 3TO1A 3HSAA 2YF0A 1EF1A 3KRXA 4MT7A 3MPXA 2K00A 1XD4A 3G9WA 2G35A 2UZRA 2VKIA 1OMWA 2NMBA 4HB3B 1DYNA 1TXDA 3KY9A 2H7EA 1T77A 4KHOA 2D9VA 3HQCA 4GXBA 2XQNM 4H8SA 1NTYA 4HAUB 1IRSA 1U29A 1MPHA 1MIXA 4DX8A 1FHWA 1MIZB 2D2QA 4A6KA 2W2XC 1WJ1A 5DI9B 1DDWA 1WGQA 3FEHA 3P7ZA 2PZ1A 4HB4B 2DKPA 2QKMA 2K8EA 1E5WA 5I2SA 4KAXB 4Z2NA 2LOXA 2W2WA 1J19A 1MAIA 4ZRIA 4QXAB 2P0HA 3ODWA 3CXBB 2M38A 2ELAA 1X11A 5JP4A 2CY4A 2KIEA 2I1KA 4OSNA 4KVGB 3TCAA 2Z0PA 2VSZA 3D8EA 2RNRB 1DROA 1XR0B 2COFA 5D3VA 2Y8FA 2DTCA 1P5TA 2YT0A 1MKEA 3QBVB 2UVMA 5M4YB 2CRFA 4A6FB 1ZYIA 2YVCA 5KQ4A 3SV1A 1KI1B 1XX0A 2Y8GA 3B77A 4DIXA 3HW2B 5C6RA 3X23A 1V5UA 3WA0A 1K5GB 2R09A 4HB0B 4K81A 1FB8A 1BWNA 3ML4A 3ULCA 1V61A 2DX5A 1FHXA 2LG1A 2YS1A 5HE1A 2D4QA 2HE7A 3D8FA 3DXEA 2K2JA 3NWAA 4KHBA 3PSCA 1UNPA 2MDXA 2N23A 1RRPB 2RVBB 3N7CA 4GPTB 1X1GA 1ZC4B 1FGZA 2JP2A 1PMSA 4F7UP 4CYEA 2KCJA 2MWNB 3U7DA 2J59M 5CLQB 2YT2A 4HATB 4GNKB 1QQGA 1NTVA 1TQZA 2COAA 5HE0A 2GCLA 3P6AA 5DHAB 2YRYA 1OQNA 3F0WA 5D3WA 1MK9B 2RRFA 4Y94A 4GMXB 5FI1A 1WVHA 2AEHA 5HE3A 3LJUX 2RUKB 4D0NB 3QIJA 4EKUA 4TYZA 5J3TA 1AWEA 1P3RA 5I2MA 1X86A 2L1CA 2D9WA 1NI2A 3QWMA 4HHVA 1UNRA 1GG3A 2NBVA 5LOPB 1GC6A 1XCGA 1U5GA 4GZUA 3FSSA 3VOQA 2YS3A 3AU4A 1XKEA 3SNHA 3WYFB 2DA0A 2AL6A 3ULBA 4KHAA 3NSUA 3PG7A 2J0MA 2DKQA 3U8ZA 2EC1A 2DN6A 4GOUA 3BJIA 4BBKA 1WG7A 5D3XA 2FJUB 3PVLA 2I5CA 1P6SA 3NWFA 1J0WA 5HE2A 2DX1A 3A8QA 1I2HA 1W1DA 2KIGA 2GCJA 4PNKA 2D10A 1ZM0A 2I5FA 3A8PA 2DHKA 1M7RA 2ELBA 1Y5OA 2MFQA 4QJ5B 3TW1A 5C79A 3FVCA 2Z14A 3A58A 4IOYX 2N0YA 2D9YA 4HSIA 1X05A 1FAOA 3HIEA 5IRSA 1V88A 4EMOA 4C0AA 2P0FA 2X18A 3DXDA 2LULA 4YL8A 4NY0A 3VIAA 3PVUA 1UNQA 3MDBC 3SUZA 4HAVB 4K17A 1KZ7A 5C5BB 3ODOA 2GS0A 1B55A 2UZSA 3OHMB 1EAZA 1EVHA 1K5DB 1EGXA 4K2OA 2OTXA 3NW8A 5DIFB 2HTHB 3SO6A 1U27A 3AJ4A 2D11A 4OT1A 1BTKA 4CSQA 1V5PA 2EMSA 2ZKMX
chains in the Genus database with same CATH topology
4OSNA 2Z13A 2YT2A 3NWDA 3NWFA 4D6WA 3HIEA 4KHBB 4GNKB 5IRSA 3OHMB 3TVVA 2NBVA 4KHOA 2KR0A 4QJ4B 4Z2MB 2KIGA 3NW8A 2GCJA 2KUQA 2K8EA 3FSSA 2GCLA 5I2SA 2K49A 3GYPA 3NWAA 3TO1A 5M4YB 4KHBA 4Z2NA 3U12A 3GYOA 2Z59A 1ZYIA 2RRFA 4QXAB 4PQ0A 4QJ5B 4OT1A 4KHAA 3TW1A 2Z4DA 3FVCA 2Z14A 4CSQA 4L1RA 2FJUB 3A58A 4IFSA 4GOUA 4DIXA 4IOYX 2KIEA 4QJ3B 5LG4B 5I2MA 2R2YA 2GUMA 4HSIA 2ZKMX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KIE A;  2KIG A; 
#chains in the Genus database with same CATH topology
 2CY5 A;  3ZDT A;  3KSY A;  1KZG A;  3AU5 A;  1U5D A;  5D3Y A;  2RSG A;  2KUQ A;  1V5M A;  1U5E A;  2D9X A;  2OQB A;  2NZ8 B;  5L81 A;  2ADZ A;  5D27 A;  3FM8 C;  5KCV A;  5JHG A;  2QKL A;  1ZC3 B;  2FJL A;  4QJ3 B;  4HAY B;  4DBB A;  3SYX A;  3DXC A;  3KRW A;  4HDQ A;  4MK0 A;  3OAN A;  1ZVR A;  3DCX A;  4WSF A;  2RLO A;  2LYD A;  2K2U A;  2KR0 A;  1LW3 A;  4CHM A;  1U2B A;  2EMT A;  3PVW A;  1PFJ A;  1BTN A;  1MI1 A;  3GYP A;  1AQC A;  2V76 A;  2MKR A;  3A98 B;  1SHC A;  3PZD A;  1N3H A;  4PQ0 A;  4IAP A;  1LB1 A;  2KUP A;  1W1G A;  2Y7B A;  4F7G A;  1XOD A;  1W1H A;  4HB2 B;  4TKN A;  5DH9 B;  2Q13 A;  3M1I B;  1NU2 A;  4NSW A;  4EJN A;  4D6W A;  2COD A;  1FOE A;  4ZRK A;  2KGX B;  4XWX A;  3O96 A;  1TJ6 A;  3ODX A;  3V5W A;  1DBH A;  5CLL B;  1WJM A;  3U12 A;  4A6H A;  4F7H A;  2COC A;  1ISN A;  2CAY A;  2Z0Q A;  3PEG A;  4IFS A;  2VRW B;  5LG4 B;  1BAK A;  1V89 A;  4WJ7 A;  5KQ1 A;  4HDO A;  2J0K A;  2ROV A;  2P0D A;  2YSZ A;  3TVV A;  2D9Z A;  4B6H A;  1X1F A;  4Z2M B;  3CIK A;  3TFM A;  4HAX B;  3D8D A;  1WGU A;  2Z59 A;  1SGH A;  4GMV A;  2Z4D A;  1GC7 A;  1ZSQ A;  4K2P A;  4L1R A;  2E2X A;  2Z0O A;  5GOW B;  1UEF A;  2W2X D;  1Q67 A;  2R0D A;  2ROZ B;  5DHF B;  4MY6 A;  4HAW B;  3ZVR A;  2J0J A;  1QC6 A;  2DYQ A;  1H4R A;  2EJ8 A;  4P7I A;  5C16 A;  3IVF A;  1M7E A;  4YON A;  3RCP A;  5LON B;  2BCJ A;  1FGY A;  5J3Q A;  3GYO A;  4DXA B;  2IYB A;  5JHH A;  1UPQ A;  1WI1 A;  4HAZ B;  3HK0 A;  1MK7 B;  5J3Y A;  1I7A A;  2LKO A;  2DYN A;  2M14 A;  2R2Y A;  1FHO A;  2GUM A;  5C5B A;  2ZPY A;  4L6E A;  4ZRJ A;  3NWD A;  4GN1 A;  4WVF B;  1H10 A;  4KHB B;  2P8V A;  3PP2 A;  4CHJ A;  3UZT A;  2DHI A;  3KZ1 A;  1OY2 A;  2H7D A;  2K49 A;  5EFX A;  1Y19 B;  3T06 A;  2L2I A;  5FI0 A;  2RGN B;  4DX9 0;  2YT1 A;  1DDM A;  2DHJ A;  1Z87 A;  1PLS A;  2YS5 A;  2I1J A;  3BIN A;  2Z13 A;  4A6F A;  2DLW A;  1UPR A;  2DFK A;  3F5R A;  1DDV A;  5JLJ B;  4QJ4 B;  2GJY A;  1RJ2 A;  2IFS A;  2LOZ A;  1U5F A;  4A5K A;  3TO1 A;  3HSA A;  2YF0 A;  1EF1 A;  3KRX A;  4MT7 A;  3MPX A;  2K00 A;  1XD4 A;  3G9W A;  2G35 A;  2UZR A;  2VKI A;  1OMW A;  2NMB A;  4HB3 B;  1DYN A;  1TXD A;  3KY9 A;  2H7E A;  1T77 A;  4KHO A;  2D9V A;  3HQC A;  4GXB A;  2XQN M;  4H8S A;  1NTY A;  4HAU B;  1IRS A;  1U29 A;  1MPH A;  1MIX A;  4DX8 A;  1FHW A;  1MIZ B;  2D2Q A;  4A6K A;  2W2X C;  1WJ1 A;  5DI9 B;  1DDW A;  1WGQ A;  3FEH A;  3P7Z A;  2PZ1 A;  4HB4 B;  2DKP A;  2QKM A;  2K8E A;  1E5W A;  5I2S A;  4KAX B;  4Z2N A;  2LOX A;  2W2W A;  1J19 A;  1MAI A;  4ZRI A;  4QXA B;  2P0H A;  3ODW A;  3CXB B;  2M38 A;  2ELA A;  1X11 A;  5JP4 A;  2CY4 A;  2KIE A;  2I1K A;  4OSN A;  4KVG B;  3TCA A;  2Z0P A;  2VSZ A;  3D8E A;  2RNR B;  1DRO A;  1XR0 B;  2COF A;  5D3V A;  2Y8F A;  2DTC A;  1P5T A;  2YT0 A;  1MKE A;  3QBV B;  2UVM A;  5M4Y B;  2CRF A;  4A6F B;  1ZYI A;  2YVC A;  5KQ4 A;  3SV1 A;  1KI1 B;  1XX0 A;  2Y8G A;  3B77 A;  4DIX A;  3HW2 B;  5C6R A;  3X23 A;  1V5U A;  3WA0 A;  1K5G B;  2R09 A;  4HB0 B;  4K81 A;  1FB8 A;  1BWN A;  3ML4 A;  3ULC A;  1V61 A;  2DX5 A;  1FHX A;  2LG1 A;  2YS1 A;  5HE1 A;  2D4Q A;  2HE7 A;  3D8F A;  3DXE A;  2K2J A;  3NWA A;  4KHB A;  3PSC A;  1UNP A;  2MDX A;  2N23 A;  1RRP B;  2RVB B;  3N7C A;  4GPT B;  1X1G A;  1ZC4 B;  1FGZ A;  2JP2 A;  1PMS A;  4F7U P;  4CYE A;  2KCJ A;  2MWN B;  3U7D A;  2J59 M;  5CLQ B;  2YT2 A;  4HAT B;  4GNK B;  1QQG A;  1NTV A;  1TQZ A;  2COA A;  5HE0 A;  2GCL A;  3P6A A;  5DHA B;  2YRY A;  1OQN A;  3F0W A;  5D3W A;  1MK9 B;  2RRF A;  4Y94 A;  4GMX B;  5FI1 A;  1WVH A;  2AEH A;  5HE3 A;  3LJU X;  2RUK B;  4D0N B;  3QIJ A;  4EKU A;  4TYZ A;  5J3T A;  1AWE A;  1P3R A;  5I2M A;  1X86 A;  2L1C A;  2D9W A;  1NI2 A;  3QWM A;  4HHV A;  1UNR A;  1GG3 A;  2NBV A;  5LOP B;  1GC6 A;  1XCG A;  1U5G A;  4GZU A;  3FSS A;  3VOQ A;  2YS3 A;  3AU4 A;  1XKE A;  3SNH A;  3WYF B;  2DA0 A;  2AL6 A;  3ULB A;  4KHA A;  3NSU A;  3PG7 A;  2J0M A;  2DKQ A;  3U8Z A;  2EC1 A;  2DN6 A;  4GOU A;  3BJI A;  4BBK A;  1WG7 A;  5D3X A;  2FJU B;  3PVL A;  2I5C A;  1P6S A;  3NWF A;  1J0W A;  5HE2 A;  2DX1 A;  3A8Q A;  1I2H A;  1W1D A;  2KIG A;  2GCJ A;  4PNK A;  2D10 A;  1ZM0 A;  2I5F A;  3A8P A;  2DHK A;  1M7R A;  2ELB A;  1Y5O A;  2MFQ A;  4QJ5 B;  3TW1 A;  5C79 A;  3FVC A;  2Z14 A;  3A58 A;  4IOY X;  2N0Y A;  2D9Y A;  4HSI A;  1X05 A;  1FAO A;  3HIE A;  5IRS A;  1V88 A;  4EMO A;  4C0A A;  2P0F A;  2X18 A;  3DXD A;  2LUL A;  4YL8 A;  4NY0 A;  3VIA A;  3PVU A;  1UNQ A;  3MDB C;  3SUZ A;  4HAV B;  4K17 A;  1KZ7 A;  5C5B B;  3ODO A;  2GS0 A;  1B55 A;  2UZS A;  3OHM B;  1EAZ A;  1EVH A;  1K5D B;  1EGX A;  4K2O A;  2OTX A;  3NW8 A;  5DIF B;  2HTH B;  3SO6 A;  1U27 A;  3AJ4 A;  2D11 A;  4OT1 A;  1BTK A;  4CSQ A;  1V5P A;  2EMS A;  2ZKM X; 
#chains in the Genus database with same CATH homology
 4OSN A;  2Z13 A;  2YT2 A;  3NWD A;  3NWF A;  4D6W A;  3HIE A;  4KHB B;  4GNK B;  5IRS A;  3OHM B;  3TVV A;  2NBV A;  4KHO A;  2KR0 A;  4QJ4 B;  4Z2M B;  2KIG A;  3NW8 A;  2GCJ A;  2KUQ A;  2K8E A;  3FSS A;  2GCL A;  5I2S A;  2K49 A;  3GYP A;  3NWA A;  3TO1 A;  5M4Y B;  4KHB A;  4Z2N A;  3U12 A;  3GYO A;  2Z59 A;  1ZYI A;  2RRF A;  4QXA B;  4PQ0 A;  4QJ5 B;  4OT1 A;  4KHA A;  3TW1 A;  2Z4D A;  3FVC A;  2Z14 A;  4CSQ A;  4L1R A;  2FJU B;  3A58 A;  4IFS A;  4GOU A;  4DIX A;  4IOY X;  2KIE A;  4QJ3 B;  5LG4 B;  5I2M A;  2R2Y A;  2GUM A;  4HSI A;  2ZKM X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...