2KIEA

A ph domain within ocrl bridges clathrin mediated membrane trafficking to phosphoinositide metabolis
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
124
structure length
124
Chain Sequence
b'GPLGSMEPPLPVGAQPLATVEGMEMKGPLREPCALTLAQRNGQYELIIQLHEKEQHVQDIIPINSHFRCVQEAEETLLIDIASNSGCKIRVQGDWIRERRFEIPDEEHCLKFLSAVLAAQKAQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inositol polyphosphate 5-phosphatase OCRL-1
publication title A PH domain within OCRL bridges clathrin-mediated membrane trafficking to phosphoinositide metabolism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 17
structure length 124
sequence length 124
ec nomenclature ec 3.1.3.36: Phosphoinositide 5-phosphatase.
pdb deposition date 2009-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16726 OCRL_clath_bd Inositol polyphosphate 5-phosphatase clathrin binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.110 Mainly Beta Roll PH-domain like PH-domain like 2kieA00
2KIEA 2KIGA
chains in the Genus database with same CATH superfamily
2BCJA 4GZUA 4D0NB 4HB4B 4HB2B 2DA0A 2COFA 4DX90 4IFSA 1EF1A 1OQNA 1NU2A 2LG1A 2QKMA 4OT1A 3PVWA 4Z2NA 1WJ1A 2D9VA 1EVHA 2KUPA 3NWFA 4NSWA 1MI1A 4DXAB 1OY2A 3N7CA 3F0WA 4XWXA 2COAA 5D3VA 2COCA 2K49A 2GUMA 2K8EA 2AL6A 1XR0B 3TVVA 1QQGA 4YL8A 1ZSQA 3LJUX 4YONA 4HSIA 1DBHA 4KAXB 1LW3A 1XODA 1IRSA 2HTHB 2DHIA 3P6AA 2YRYA 1QC6A 3OANA 2DTCA 4CYEA 2GJYA 1XKEA 3ULCA 2NMBA 1W1DA 4KHAA 3TO1A 3ODXA 1ISNA 1DYNA 2YS5A 3DCXA 1FHWA 4D6WA 4PQ0A 2RGNB 3TFMA 2NBVA 3HIEA 4KVGB 5DH9B 2ADZA 2CAYA 3AJ4A 1FGZA 1ZC3B 1ZC4B 3KZ1A 2YT0A 1P6SA 1EAZA 2EMSA 3CXBB 2CRFA 1Q67A 3HSAA 1FHOA 2J59M 4L6EA 1ZYIA 1V61A 2H7DA 1K5GB 5IRSA 1PLSA 3FVCA 4EKUA 4C0AA 1RRPB 3NWAA 3X23A 2P0HA 2HE7A 1B55A 1M7EA 2ZKMX 4HAUB 2RNRB 4K81A 2YS1A 2P0DA 4EMOA 3HQCA 3PVLA 5DHAB 4TYZA 4WJ7A 3QIJA 5C5BA 1DDWA 1H10A 2KR0A 5C6RA 2I5FA 1J0WA 4P7IA 1TQZA 2ZPYA 5D27A 1KZ7A 2I5CA 2KIEA 4IOYX 5C5BB 2DFKA 5JP4A 3ZVRA 1WVHA 1XX0A 2OTXA 2GS0A 3SUZA 1W1HA 5D3XA 4QJ4B 1I7AA 3KY9A 2I1KA 1V89A 2MFQA 2D9WA 4GXBA 2Z4DA 4BBKA 1OMWA 2Z0QA 5DHFB 4ZRIA 5FI0A 5D3YA 5L81A 3A8QA 5DI9B 1KZGA 4GOUA 2DKQA 3B77A 2LKOA 4OSNA 1X05A 4PNKA 2Z13A 1FGYA 4A6HA 3P7ZA 4B6HA 3HW2B 3NWDA 3PVUA 1P5TA 3KRXA 3ML4A 2D9XA 4L1RA 2M14A 1WG7A 2IFSA 4QJ5B 5J3QA 2YT2A 5I2MA 1FB8A 5I2SA 1U5FA 2ROZB 1WGUA 1BWNA 3AU5A 1FOEA 2D2QA 5M4YB 3RCPA 1NI2A 2IYBA 1UPRA 2H7EA 2RLOA 1WGQA 4NY0A 1V5PA 1TXDA 4ZRJA 2P0FA 3HK0A 4GN1A 2GCLA 2R0DA 4WVFB 4GNKB 3PSCA 1W1GA 2YSZA 3BINA 1DDMA 3SV1A 2LOZA 1SGHA 1T77A 2W2XC 1U5GA 4HB0B 1Y19B 3G9WA 2EJ8A 5LG4B 2UZSA 3PP2A 4CHMA 2KIGA 2E2XA 1V5UA 1X1FA 1UNRA 4GMVA 1UNQA 4KHBA 1MK7B 1MAIA 4QXAB 4DIXA 2MKRA 3O96A 2MDXA 4DBBA 1N3HA 3GYOA 4KHBB 5J3YA 5HE3A 3M1IB 5KQ1A 4HAXB 1BTKA 1UNPA 3DXDA 4WSFA 1RJ2A 1FHXA 1U5EA 2KGXB 2J0JA 3FEHA 2X18A 1U5DA 3BJIA 1FAOA 4HAZB 2DKPA 2LULA 4MK0A 5D3WA 2DN6A 3KRWA 1M7RA 3D8EA 2D11A 1GC6A 3CIKA 4MT7A 1DROA 1WI1A 5LONB 5JHGA 4DX8A 4HAYB 2LOXA 2Z0PA 4A5KA 2VSZA 5JHHA 1EGXA 3FM8C 1MK9B 4HB3B 2UZRA 1J19A 2J0MA 4HATB 3ZDTA 2Y8FA 5JLJB 3WA0A 4GPTB 2Z59A 1SHCA 2D9YA 2DX5A 5GOWB 3VIAA 4A6FB 2N23A 2ROVA 1MKEA 2FJUB 2R09A 3QBVB 3DXCA 3TCAA 3U7DA 1E5WA 2VRWB 4CHJA 1MIZB 2DHKA 2DYQA 3UZTA 3SYXA 1H4RA 4H8SA 3D8DA 2K00A 3OHMB 1GC7A 2UVMA 1Y5OA 2M38A 2N0YA 1PMSA 3SNHA 2D10A 4K17A 2QKLA 2DLWA 1KI1B 2I1JA 1ZVRA 2L2IA 4F7HA 2R2YA 4K2OA 3A58A 4ZRKA 2ELBA 2J0KA 2Z14A 2Z0OA 3KSYA 1V5MA 2CY5A 2KCJA 2RVBB 1I2HA 2RSGA 4Z2MB 2KUQA 1Z87A 2L1CA 5KQ4A 1MPHA 2Y8GA 2YF0A 3MDBC 4MY6A 5C79A 1K5DB 2MWNB 1BAKA 3QWMA 3NSUA 3U8ZA 4TKNA 3U12A 2P8VA 3SO6A 1U2BA 1DDVA 5HE0A 2PZ1A 4KHOA 1XCGA 2DHJA 1P3RA 4F7UP 2W2WA 2AEHA 2K2JA 4HAWB 2OQBA 1PFJA 5J3TA 1V88A 4F7GA 5KCVA 4HAVB 3PZDA 3V5WA 1ZM0A 5C16A 2XQNM 4K2PA 1AWEA 5FI1A 4IAPA 2YVCA 3PG7A 5HE2A 4CSQA 1UEFA 5DIFB 1NTYA 1TJ6A 2VKIA 3T06A 2NZ8B 3AU4A 4HDQA 3A8PA 3VOQA 1X86A 2D9ZA 3WYFB 4Y94A 4HDOA 1UPQA 1WJMA 3IVFA 4QJ3B 2V76A 1LB1A 3D8FA 2LYDA 4GMXB 3GYPA 1XD4A 2RUKB 3NW8A 4HHVA 2JP2A 1U27A 3MPXA 1X1GA 3ODWA 3TW1A 2RRFA 2D4QA 2FJLA 3A98B 2CODA 2EC1A 5EFXA 4A6FA 2GCJA 5LOPB 4A6KA 5CLQB 3FSSA 2G35A 2K2UA 4EJNA 2EMTA 5CLLB 3F5RA 2YS3A 2W2XD 2Q13A 3ODOA 2ELAA 1BTNA 5HE1A 3DXEA 1X11A 2DX1A 3PEGA 1GG3A 1NTVA 2CY4A 3ULBA 1AQCA 1U29A 2Y7BA 1MIXA 2DYNA 2YT1A
chains in the Genus database with same CATH topology
4KHAA 3TO1A 3NWDA 1ZYIA 2Z4DA 2GCLA 4KHBA 4QXAB 4DIXA 5IRSA 2K49A 2FJUB 2GUMA 3FVCA 4GNKB 4IFSA 4D6WA 2K8EA 4PQ0A 4QJ3B 2KR0A 3NWAA 3GYOA 4L1RA 3U12A 3TVVA 2NBVA 3HIEA 4QJ5B 4KHBB 3GYPA 2ZKMX 4HSIA 3NW8A 4OT1A 2YT2A 4GOUA 5I2MA 4Z2NA 2KIEA 4IOYX 5I2SA 2R2YA 3NWFA 4CSQA 3A58A 3TW1A 2RRFA 3OHMB 5M4YB 4KHOA 2Z14A 4OSNA 2GCJA 5LG4B 2Z13A 4QJ4B 2Z59A 2KIGA 4Z2MB 2KUQA 3FSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KIE A;  2KIG A; 
#chains in the Genus database with same CATH topology
 2BCJ A;  4GZU A;  4D0N B;  4HB4 B;  4HB2 B;  2DA0 A;  2COF A;  4DX9 0;  4IFS A;  1EF1 A;  1OQN A;  1NU2 A;  2LG1 A;  2QKM A;  4OT1 A;  3PVW A;  4Z2N A;  1WJ1 A;  2D9V A;  1EVH A;  2KUP A;  3NWF A;  4NSW A;  1MI1 A;  4DXA B;  1OY2 A;  3N7C A;  3F0W A;  4XWX A;  2COA A;  5D3V A;  2COC A;  2K49 A;  2GUM A;  2K8E A;  2AL6 A;  1XR0 B;  3TVV A;  1QQG A;  4YL8 A;  1ZSQ A;  3LJU X;  4YON A;  4HSI A;  1DBH A;  4KAX B;  1LW3 A;  1XOD A;  1IRS A;  2HTH B;  2DHI A;  3P6A A;  2YRY A;  1QC6 A;  3OAN A;  2DTC A;  4CYE A;  2GJY A;  1XKE A;  3ULC A;  2NMB A;  1W1D A;  4KHA A;  3TO1 A;  3ODX A;  1ISN A;  1DYN A;  2YS5 A;  3DCX A;  1FHW A;  4D6W A;  4PQ0 A;  2RGN B;  3TFM A;  2NBV A;  3HIE A;  4KVG B;  5DH9 B;  2ADZ A;  2CAY A;  3AJ4 A;  1FGZ A;  1ZC3 B;  1ZC4 B;  3KZ1 A;  2YT0 A;  1P6S A;  1EAZ A;  2EMS A;  3CXB B;  2CRF A;  1Q67 A;  3HSA A;  1FHO A;  2J59 M;  4L6E A;  1ZYI A;  1V61 A;  2H7D A;  1K5G B;  5IRS A;  1PLS A;  3FVC A;  4EKU A;  4C0A A;  1RRP B;  3NWA A;  3X23 A;  2P0H A;  2HE7 A;  1B55 A;  1M7E A;  2ZKM X;  4HAU B;  2RNR B;  4K81 A;  2YS1 A;  2P0D A;  4EMO A;  3HQC A;  3PVL A;  5DHA B;  4TYZ A;  4WJ7 A;  3QIJ A;  5C5B A;  1DDW A;  1H10 A;  2KR0 A;  5C6R A;  2I5F A;  1J0W A;  4P7I A;  1TQZ A;  2ZPY A;  5D27 A;  1KZ7 A;  2I5C A;  2KIE A;  4IOY X;  5C5B B;  2DFK A;  5JP4 A;  3ZVR A;  1WVH A;  1XX0 A;  2OTX A;  2GS0 A;  3SUZ A;  1W1H A;  5D3X A;  4QJ4 B;  1I7A A;  3KY9 A;  2I1K A;  1V89 A;  2MFQ A;  2D9W A;  4GXB A;  2Z4D A;  4BBK A;  1OMW A;  2Z0Q A;  5DHF B;  4ZRI A;  5FI0 A;  5D3Y A;  5L81 A;  3A8Q A;  5DI9 B;  1KZG A;  4GOU A;  2DKQ A;  3B77 A;  2LKO A;  4OSN A;  1X05 A;  4PNK A;  2Z13 A;  1FGY A;  4A6H A;  3P7Z A;  4B6H A;  3HW2 B;  3NWD A;  3PVU A;  1P5T A;  3KRX A;  3ML4 A;  2D9X A;  4L1R A;  2M14 A;  1WG7 A;  2IFS A;  4QJ5 B;  5J3Q A;  2YT2 A;  5I2M A;  1FB8 A;  5I2S A;  1U5F A;  2ROZ B;  1WGU A;  1BWN A;  3AU5 A;  1FOE A;  2D2Q A;  5M4Y B;  3RCP A;  1NI2 A;  2IYB A;  1UPR A;  2H7E A;  2RLO A;  1WGQ A;  4NY0 A;  1V5P A;  1TXD A;  4ZRJ A;  2P0F A;  3HK0 A;  4GN1 A;  2GCL A;  2R0D A;  4WVF B;  4GNK B;  3PSC A;  1W1G A;  2YSZ A;  3BIN A;  1DDM A;  3SV1 A;  2LOZ A;  1SGH A;  1T77 A;  2W2X C;  1U5G A;  4HB0 B;  1Y19 B;  3G9W A;  2EJ8 A;  5LG4 B;  2UZS A;  3PP2 A;  4CHM A;  2KIG A;  2E2X A;  1V5U A;  1X1F A;  1UNR A;  4GMV A;  1UNQ A;  4KHB A;  1MK7 B;  1MAI A;  4QXA B;  4DIX A;  2MKR A;  3O96 A;  2MDX A;  4DBB A;  1N3H A;  3GYO A;  4KHB B;  5J3Y A;  5HE3 A;  3M1I B;  5KQ1 A;  4HAX B;  1BTK A;  1UNP A;  3DXD A;  4WSF A;  1RJ2 A;  1FHX A;  1U5E A;  2KGX B;  2J0J A;  3FEH A;  2X18 A;  1U5D A;  3BJI A;  1FAO A;  4HAZ B;  2DKP A;  2LUL A;  4MK0 A;  5D3W A;  2DN6 A;  3KRW A;  1M7R A;  3D8E A;  2D11 A;  1GC6 A;  3CIK A;  4MT7 A;  1DRO A;  1WI1 A;  5LON B;  5JHG A;  4DX8 A;  4HAY B;  2LOX A;  2Z0P A;  4A5K A;  2VSZ A;  5JHH A;  1EGX A;  3FM8 C;  1MK9 B;  4HB3 B;  2UZR A;  1J19 A;  2J0M A;  4HAT B;  3ZDT A;  2Y8F A;  5JLJ B;  3WA0 A;  4GPT B;  2Z59 A;  1SHC A;  2D9Y A;  2DX5 A;  5GOW B;  3VIA A;  4A6F B;  2N23 A;  2ROV A;  1MKE A;  2FJU B;  2R09 A;  3QBV B;  3DXC A;  3TCA A;  3U7D A;  1E5W A;  2VRW B;  4CHJ A;  1MIZ B;  2DHK A;  2DYQ A;  3UZT A;  3SYX A;  1H4R A;  4H8S A;  3D8D A;  2K00 A;  3OHM B;  1GC7 A;  2UVM A;  1Y5O A;  2M38 A;  2N0Y A;  1PMS A;  3SNH A;  2D10 A;  4K17 A;  2QKL A;  2DLW A;  1KI1 B;  2I1J A;  1ZVR A;  2L2I A;  4F7H A;  2R2Y A;  4K2O A;  3A58 A;  4ZRK A;  2ELB A;  2J0K A;  2Z14 A;  2Z0O A;  3KSY A;  1V5M A;  2CY5 A;  2KCJ A;  2RVB B;  1I2H A;  2RSG A;  4Z2M B;  2KUQ A;  1Z87 A;  2L1C A;  5KQ4 A;  1MPH A;  2Y8G A;  2YF0 A;  3MDB C;  4MY6 A;  5C79 A;  1K5D B;  2MWN B;  1BAK A;  3QWM A;  3NSU A;  3U8Z A;  4TKN A;  3U12 A;  2P8V A;  3SO6 A;  1U2B A;  1DDV A;  5HE0 A;  2PZ1 A;  4KHO A;  1XCG A;  2DHJ A;  1P3R A;  4F7U P;  2W2W A;  2AEH A;  2K2J A;  4HAW B;  2OQB A;  1PFJ A;  5J3T A;  1V88 A;  4F7G A;  5KCV A;  4HAV B;  3PZD A;  3V5W A;  1ZM0 A;  5C16 A;  2XQN M;  4K2P A;  1AWE A;  5FI1 A;  4IAP A;  2YVC A;  3PG7 A;  5HE2 A;  4CSQ A;  1UEF A;  5DIF B;  1NTY A;  1TJ6 A;  2VKI A;  3T06 A;  2NZ8 B;  3AU4 A;  4HDQ A;  3A8P A;  3VOQ A;  1X86 A;  2D9Z A;  3WYF B;  4Y94 A;  4HDO A;  1UPQ A;  1WJM A;  3IVF A;  4QJ3 B;  2V76 A;  1LB1 A;  3D8F A;  2LYD A;  4GMX B;  3GYP A;  1XD4 A;  2RUK B;  3NW8 A;  4HHV A;  2JP2 A;  1U27 A;  3MPX A;  1X1G A;  3ODW A;  3TW1 A;  2RRF A;  2D4Q A;  2FJL A;  3A98 B;  2COD A;  2EC1 A;  5EFX A;  4A6F A;  2GCJ A;  5LOP B;  4A6K A;  5CLQ B;  3FSS A;  2G35 A;  2K2U A;  4EJN A;  2EMT A;  5CLL B;  3F5R A;  2YS3 A;  2W2X D;  2Q13 A;  3ODO A;  2ELA A;  1BTN A;  5HE1 A;  3DXE A;  1X11 A;  2DX1 A;  3PEG A;  1GG3 A;  1NTV A;  2CY4 A;  3ULB A;  1AQC A;  1U29 A;  2Y7B A;  1MIX A;  2DYN A;  2YT1 A; 
#chains in the Genus database with same CATH homology
 4KHA A;  3TO1 A;  3NWD A;  1ZYI A;  2Z4D A;  2GCL A;  4KHB A;  4QXA B;  4DIX A;  5IRS A;  2K49 A;  2FJU B;  2GUM A;  3FVC A;  4GNK B;  4IFS A;  4D6W A;  2K8E A;  4PQ0 A;  4QJ3 B;  2KR0 A;  3NWA A;  3GYO A;  4L1R A;  3U12 A;  3TVV A;  2NBV A;  3HIE A;  4QJ5 B;  4KHB B;  3GYP A;  2ZKM X;  4HSI A;  3NW8 A;  4OT1 A;  2YT2 A;  4GOU A;  5I2M A;  4Z2N A;  2KIE A;  4IOY X;  5I2S A;  2R2Y A;  3NWF A;  4CSQ A;  3A58 A;  3TW1 A;  2RRF A;  3OHM B;  5M4Y B;  4KHO A;  2Z14 A;  4OSN A;  2GCJ A;  5LG4 B;  2Z13 A;  4QJ4 B;  2Z59 A;  2KIG A;  4Z2M B;  2KUQ A;  3FSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...