4A5KA

Structural analyses of slm1-ph domain demonstrate ligand binding in the non-canonical site
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
115
structure length
115
Chain Sequence
FTEIKSGFLERRSKFLKSYSKGYYVLTPNFLHEFKTADRKKDLVPVMSLALSECTVTEHSRKNSTSSPNSTGSDAKFVLHAKQNGIIRRGHNWVFKADSYESMMSWFDNLKILTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHOSPHATIDYLINOSITOL 4,5-BISPHOSPHATE-BINDING PROTEIN SLM 1
publication title Structural Analyses of Slm1-Ph Domain Demonstrate Ligand Binding in the Non-Canonical Site
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 25
structure length 115
sequence length 115
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4a5kA00
4A5KA 1ZVRA 1GC6A 5FI0A 2LOZA 2HTHB 4L6EA 4IFSA 2M14A 2ZPYA 1EVHA 2DHIA 3PVLA 1NI2A 3GYPA 3VOQA 5J3TA 1DROA 4WVFB 1ZM0A 5DIFB 5D3WA 4MT7A 2K2UA 4F7GA 5HE2A 1TXDA 1BTNA 1KI1B 1X1FA 1BAKA 2D11A 4DX90 5HE3A 2ROZB 3PVWA 5D3VA 2DYQA 4C0AA 2RNRB 4Z2NA 1OQNA 2CY5A 1RJ2A 4CYEA 4PQ0A 4HDOA 4GPTB 2DHKA 2Z0QA 2Q13A 2XQNM 1UNPA 1XX0A 1IRSA 2QKLA 2MKRA 2I1KA 4F7UP 1UPRA 3LJUX 3M1IB 1M7RA 4F7HA 5HE0A 3ODWA 4KHAA 4WSFA 4WJ7A 1WG7A 3P7ZA 1Y19B 3MPXA 1SGHA 2DFKA 2J0JA 1UNQA 1WGUA 1EAZA 2L2IA 5DH9B 2KGXB 1J0WA 2KUPA 2I5CA 5J3QA 2RVBB 3PG7A 1V5PA 1LW3A 1I7AA 2D9VA 3CIKA 2I5FA 1K5GB 4A6FA 4EMOA 2UVMA 2H7EA 4ZRIA 4A6KA 1V89A 2QKMA 2V76A 1X11A 1MAIA 1TQZA 3KZ1A 5CLQB 2PZ1A 2D9ZA 1MK7B 1DYNA 1OY2A 2DYNA 2IYBA 3CXBB 4YL8A 1V61A 5C16A 4EJNA 1W1GA 1X86A 2D2QA 5FI1A 3U8ZA 2EMSA 4HB3B 3X23A 2Y7BA 2R0DA 2DA0A 1B55A 4H8SA 4Y94A 1X1GA 1PMSA 3KRXA 2VRWB 2RGNB 3FSSA 3OANA 1H10A 1MK9B 3PZDA 5DHAB 4NSWA 2DTCA 3DXCA 1UNRA 3BJIA 4ZRJA 2K2JA 3QIJA 1J19A 1V88A 2YVCA 4HB2B 1MIZB 2OQBA 4NY0A 4B6HA 1NTVA 1WVHA 1XKEA 2N0YA 2ELBA 4KHOA 3TFMA 1ZC4B 4ZRKA 2AL6A 3ODOA 5C5BA 1DDMA 1W1HA 3BINA 3PEGA 3RCPA 1UEFA 1NTYA 2GCJA 2MDXA 2AEHA 4HAVB 1Z87A 1AWEA 1LB1A 4PNKA 1Q67A 2RLOA 5D3YA 3ULBA 2CAYA 3TW1A 3SV1A 3TVVA 1EF1A 2YT0A 3U7DA 2VSZA 1PFJA 2ROVA 2E2XA 2P0HA 1H4RA 1I2HA 1U29A 2NZ8B 2DN6A 3FEHA 4DBBA 1BWNA 2ADZA 4D0NB 1FGZA 2DHJA 2COFA 2LKOA 2YSZA 3P6AA 1WI1A 2Y8FA 3HK0A 2DLWA 1E5WA 2GCLA 4KAXB 3TCAA 1RRPB 1XCGA 1TJ6A 1V5MA 2GJYA 1U2BA 1KZ7A 4XWXA 1P3RA 2D9YA 2Z0OA 4GXBA 3AJ4A 1M7EA 1ZSQA 1N3HA 1FHWA 2D9XA 3D8FA 4HHVA 2COCA 3MDBC 3QWMA 4GN1A 1U5EA 5L81A 4MY6A 1U5FA 1WJMA 2MWNB 3SO6A 4IOYX 3ODXA 2H7DA 2X18A 2VKIA 1ZC3B 4P7IA 1V5UA 5J3YA 5JHGA 1QC6A 3G9WA 3KSYA 2EJ8A 4HAZB 2J0KA 2W2XC 2YRYA 1MIXA 1DBHA 4TYZA 2D10A 1DDVA 5DI9B 3AU5A 1NU2A 3HW2B 1FB8A 2RSGA 2KCJA 2BCJA 2DX1A 3PSCA 4HB0B 5C79A 4HAXB 1P5TA 1U5GA 1PLSA 4A6FB 4K2OA 2NMBA 5LOPB 3V5WA 2LYDA 3PVUA 3D8DA 1SHCA 2LOXA 2LG1A 1GG3A 2COAA 1WJ1A 2W2XD 1FGYA 3DXDA 4Z2MB 2IFSA 2P0FA 4HAYB 1X05A 1BTKA 3ZVRA 4EKUA 3UZTA 1ISNA 2L1CA 2CRFA 2Y8GA 4GMVA 4HDQA 2P8VA 2K00A 2JP2A 5JHHA 2OTXA 4HAWB 2FJLA 2UZSA 4BBKA 4DXAB 3T06A 1GC7A 1AQCA 5HE1A 3D8EA 3O96A 3ULCA 3VIAA 4HATB 1MPHA 5DHFB 2YF0A 3WYFB 3F5RA 2DX5A 2EMTA 2CY4A 5LONB 5KQ4A 2GS0A 2D4QA 2M38A 5D3XA 3A98B 3HQCA 2P0DA 3SUZA 3N7CA 3FM8C 2YT1A 2J0MA 3TO1A 4KVGB 2LULA 4GZUA 4K17A 1FHXA 2J59M 3KY9A 5C5BB 1EGXA 2MFQA 5EFXA 2UZRA 2CODA 2DKQA 2G35A 5GOWB 3GYOA 4TKNA 1K5DB 4A6HA 2YS5A 3QBVB 3ML4A 1XODA 1U5DA 5C6RA 3SYXA 4K81A 4GMXB 4MK0A 3PP2A 3A8QA 1KZGA 2W2WA 1FAOA 5JLJB 3A8PA 5D27A 3SNHA 2HE7A 1FHOA 2R09A 3WA0A 1UPQA 1XD4A 3NSUA 5CLLB 4CHJA 1DDWA 1Y5OA 5KQ1A 3F0WA 4CHMA 4K2PA 1FOEA 3AU4A 1U27A 3IVFA 2I1JA 4HAUB 4IAPA 5KCVA 2N23A 2Z0PA 4YONA 3KRWA 5JP4A 1OMWA 3ZDTA 2RUKB 1MKEA 1W1DA 1QQGA 2YS1A 2YS3A 4KHBB 3DXEA 1P6SA 4DX8A 2ELAA 4HB4B 1XR0B 2EC1A 2D9WA 1WGQA 2DKPA
chains in the Genus database with same CATH superfamily
4A5KA 1ZVRA 1GC6A 5FI0A 2LOZA 2HTHB 4L6EA 4IFSA 2M14A 2ZPYA 1EVHA 2DHIA 3DCXA 3PVLA 1NI2A 3GYPA 3VOQA 5J3TA 1DROA 4WVFB 1ZM0A 5DIFB 5D3WA 4MT7A 2K2UA 4F7GA 5HE2A 1TXDA 1BTNA 1KI1B 1X1FA 1BAKA 2D11A 4QJ5B 4DX90 5HE3A 2ROZB 3PVWA 5D3VA 2DYQA 4C0AA 2RNRB 5LG4B 4Z2NA 1OQNA 4QJ4B 2CY5A 1RJ2A 4CYEA 4PQ0A 4HDOA 4GPTB 2DHKA 2Z0QA 2Q13A 2XQNM 1UNPA 1XX0A 1IRSA 2QKLA 2MKRA 2I1KA 4F7UP 1UPRA 3LJUX 3M1IB 1M7RA 4F7HA 5HE0A 3ODWA 4KHAA 4WSFA 4WJ7A 1WG7A 3P7ZA 1Y19B 3MPXA 1SGHA 2DFKA 2J0JA 1UNQA 1WGUA 1EAZA 2L2IA 5DH9B 2KGXB 1J0WA 2Z4DA 2KUPA 4QJ3B 2I5CA 5J3QA 2RVBB 3HIEA 3PG7A 1V5PA 1LW3A 3HSAA 1I7AA 2D9VA 3CIKA 2I5FA 1K5GB 2Z14A 4A6FA 4EMOA 2UVMA 2H7EA 4ZRIA 4A6KA 1V89A 2QKMA 2V76A 1X11A 1MAIA 1TQZA 3KZ1A 3U12A 5CLQB 2PZ1A 2D9ZA 1MK7B 1DYNA 2KIGA 1OY2A 3A58A 2DYNA 2IYBA 3CXBB 4YL8A 1V61A 5C16A 1MI1A 2K49A 4EJNA 1W1GA 1X86A 2D2QA 5FI1A 3U8ZA 2EMSA 4HB3B 3X23A 2Y7BA 2R0DA 2DA0A 1B55A 4H8SA 4Y94A 1X1GA 1PMSA 2KIEA 3KRXA 2VRWB 2RGNB 3FSSA 3OANA 1H10A 1MK9B 3PZDA 5DHAB 4NSWA 2DTCA 3DXCA 1UNRA 3BJIA 4ZRJA 2K2JA 3QIJA 1J19A 1V88A 2YVCA 4D6WA 4HB2B 1MIZB 2OQBA 4NY0A 4B6HA 1NTVA 1WVHA 1XKEA 2N0YA 2ELBA 3B77A 4KHOA 3TFMA 1ZC4B 4ZRKA 2AL6A 3ODOA 5C5BA 2Z13A 1DDMA 1W1HA 3BINA 3PEGA 3RCPA 5I2MA 1UEFA 1NTYA 2GCJA 2MDXA 2AEHA 3NWDA 4HAVB 3FVCA 1Z87A 1AWEA 1LB1A 4PNKA 1Q67A 2RLOA 5D3YA 3ULBA 2CAYA 3TW1A 3SV1A 3TVVA 1EF1A 2YT0A 3U7DA 2VSZA 1PFJA 2RRFA 2ROVA 4OT1A 2E2XA 2P0HA 1H4RA 1I2HA 1U29A 4GOUA 2NZ8B 2DN6A 3FEHA 4DBBA 1T77A 1BWNA 2ADZA 4D0NB 5I2SA 1FGZA 2DHJA 2COFA 2LKOA 2YSZA 3NW8A 3P6AA 1WI1A 2Y8FA 3HK0A 2DLWA 1E5WA 2GCLA 4KAXB 3TCAA 1RRPB 1XCGA 1TJ6A 1V5MA 2GJYA 4CSQA 1U2BA 3NWAA 1KZ7A 4XWXA 1P3RA 2D9YA 2Z0OA 4GXBA 2Z59A 3AJ4A 1M7EA 1ZSQA 1N3HA 1FHWA 2D9XA 3D8FA 4HHVA 4KHBA 2COCA 3MDBC 3QWMA 4GN1A 1U5EA 1ZYIA 5L81A 4MY6A 1U5FA 1WJMA 2MWNB 3SO6A 4IOYX 2NBVA 3ODXA 2H7DA 2X18A 2VKIA 1ZC3B 4P7IA 1V5UA 5J3YA 5JHGA 1QC6A 3G9WA 3KSYA 3OHMB 2EJ8A 4HAZB 2J0KA 2W2XC 2YRYA 1MIXA 1DBHA 4TYZA 2D10A 1DDVA 5DI9B 3AU5A 1NU2A 3HW2B 4DIXA 1FB8A 2RSGA 2KCJA 2BCJA 2DX1A 3PSCA 4HB0B 5C79A 4HAXB 1P5TA 1U5GA 2K8EA 1PLSA 4A6FB 4K2OA 2NMBA 5LOPB 3V5WA 2LYDA 3PVUA 3D8DA 1SHCA 2ZKMX 2LOXA 2LG1A 1GG3A 2COAA 1WJ1A 3NWFA 2W2XD 1FGYA 3DXDA 4Z2MB 2IFSA 2P0FA 4HAYB 1X05A 1BTKA 3ZVRA 4EKUA 3UZTA 1ISNA 2L1CA 2YT2A 2CRFA 2Y8GA 4GMVA 4HDQA 2P8VA 2K00A 2JP2A 5JHHA 2OTXA 4HAWB 2FJLA 2UZSA 4BBKA 4DXAB 3T06A 2FJUB 1GC7A 1AQCA 4GNKB 5HE1A 3D8EA 3O96A 3ULCA 3VIAA 4QXAB 4HATB 1MPHA 5DHFB 2YF0A 3WYFB 3F5RA 2DX5A 2EMTA 2CY4A 5LONB 5KQ4A 2GS0A 2D4QA 2M38A 5D3XA 3A98B 3HQCA 2P0DA 3SUZA 3N7CA 3FM8C 2YT1A 2J0MA 3TO1A 4KVGB 2LULA 4GZUA 4K17A 1FHXA 2J59M 3KY9A 5C5BB 1EGXA 2MFQA 5EFXA 2UZRA 2CODA 2DKQA 2G35A 5GOWB 3GYOA 4TKNA 1K5DB 4A6HA 4HSIA 2YS5A 3QBVB 3ML4A 5IRSA 1XODA 1U5DA 5C6RA 3SYXA 4K81A 4GMXB 4MK0A 2GUMA 3PP2A 3A8QA 1KZGA 2W2WA 1FAOA 5JLJB 3A8PA 5D27A 4L1RA 3SNHA 2HE7A 1FHOA 2R09A 3WA0A 1UPQA 1XD4A 3NSUA 5CLLB 4CHJA 1DDWA 1Y5OA 5KQ1A 3F0WA 2KR0A 5M4YB 4CHMA 4K2PA 1FOEA 3AU4A 1U27A 3IVFA 2I1JA 4HAUB 4IAPA 5KCVA 2N23A 2Z0PA 4YONA 4OSNA 3KRWA 2R2YA 5JP4A 1OMWA 3ZDTA 2RUKB 2KUQA 1MKEA 1W1DA 1QQGA 2YS1A 2YS3A 4KHBB 3DXEA 1P6SA 4DX8A 2ELAA 4HB4B 1XR0B 2EC1A 2D9WA 1WGQA 2DKPA
chains in the Genus database with same CATH topology
4A5KA 1ZVRA 1GC6A 5FI0A 2LOZA 2HTHB 4L6EA 4IFSA 2M14A 2ZPYA 1EVHA 2DHIA 3PVLA 1NI2A 3GYPA 3VOQA 5J3TA 1DROA 4WVFB 1ZM0A 5DIFB 5D3WA 4MT7A 2K2UA 4F7GA 5HE2A 1TXDA 1BTNA 1KI1B 1X1FA 1BAKA 2D11A 4DX90 5HE3A 2ROZB 3PVWA 5D3VA 2DYQA 4C0AA 2RNRB 4Z2NA 1OQNA 2CY5A 1RJ2A 4CYEA 4PQ0A 4HDOA 4GPTB 2DHKA 2Z0QA 2Q13A 2XQNM 1UNPA 1XX0A 1IRSA 2QKLA 2MKRA 2I1KA 4F7UP 1UPRA 3LJUX 3M1IB 1M7RA 4F7HA 5HE0A 3ODWA 4KHAA 4WSFA 4WJ7A 1WG7A 3P7ZA 1Y19B 3MPXA 1SGHA 2DFKA 2J0JA 1UNQA 1WGUA 1EAZA 2L2IA 5DH9B 2KGXB 1J0WA 2KUPA 2I5CA 5J3QA 2RVBB 3PG7A 1V5PA 1LW3A 1I7AA 2D9VA 3CIKA 2I5FA 1K5GB 4A6FA 4EMOA 2UVMA 2H7EA 4ZRIA 4A6KA 1V89A 2QKMA 2V76A 1X11A 1MAIA 1TQZA 3KZ1A 5CLQB 2PZ1A 2D9ZA 1MK7B 1DYNA 1OY2A 2DYNA 2IYBA 3CXBB 4YL8A 1V61A 5C16A 4EJNA 1W1GA 1X86A 2D2QA 5FI1A 3U8ZA 2EMSA 4HB3B 3X23A 2Y7BA 2R0DA 2DA0A 1B55A 4H8SA 4Y94A 1X1GA 1PMSA 3KRXA 2VRWB 2RGNB 3FSSA 3OANA 1H10A 1MK9B 3PZDA 5DHAB 4NSWA 2DTCA 3DXCA 1UNRA 3BJIA 4ZRJA 2K2JA 3QIJA 1J19A 1V88A 2YVCA 4HB2B 1MIZB 2OQBA 4NY0A 4B6HA 1NTVA 1WVHA 1XKEA 2N0YA 2ELBA 4KHOA 3TFMA 1ZC4B 4ZRKA 2AL6A 3ODOA 5C5BA 1DDMA 1W1HA 3BINA 3PEGA 3RCPA 1UEFA 1NTYA 2GCJA 2MDXA 2AEHA 4HAVB 1Z87A 1AWEA 1LB1A 4PNKA 1Q67A 2RLOA 5D3YA 3ULBA 2CAYA 3TW1A 3SV1A 3TVVA 1EF1A 2YT0A 3U7DA 2VSZA 1PFJA 2ROVA 2E2XA 2P0HA 1H4RA 1I2HA 1U29A 2NZ8B 2DN6A 3FEHA 4DBBA 1BWNA 2ADZA 4D0NB 1FGZA 2DHJA 2COFA 2LKOA 2YSZA 3P6AA 1WI1A 2Y8FA 3HK0A 2DLWA 1E5WA 2GCLA 4KAXB 3TCAA 1RRPB 1XCGA 1TJ6A 1V5MA 2GJYA 1U2BA 1KZ7A 4XWXA 1P3RA 2D9YA 2Z0OA 4GXBA 3AJ4A 1M7EA 1ZSQA 1N3HA 1FHWA 2D9XA 3D8FA 4HHVA 2COCA 3MDBC 3QWMA 4GN1A 1U5EA 5L81A 4MY6A 1U5FA 1WJMA 2MWNB 3SO6A 4IOYX 3ODXA 2H7DA 2X18A 2VKIA 1ZC3B 4P7IA 1V5UA 5J3YA 5JHGA 1QC6A 3G9WA 3KSYA 2EJ8A 4HAZB 2J0KA 2W2XC 2YRYA 1MIXA 1DBHA 4TYZA 2D10A 1DDVA 5DI9B 3AU5A 1NU2A 3HW2B 1FB8A 2RSGA 2KCJA 2BCJA 2DX1A 3PSCA 4HB0B 5C79A 4HAXB 1P5TA 1U5GA 1PLSA 4A6FB 4K2OA 2NMBA 5LOPB 3V5WA 2LYDA 3PVUA 3D8DA 1SHCA 2LOXA 2LG1A 1GG3A 2COAA 1WJ1A 2W2XD 1FGYA 3DXDA 4Z2MB 2IFSA 2P0FA 4HAYB 1X05A 1BTKA 3ZVRA 4EKUA 3UZTA 1ISNA 2L1CA 2CRFA 2Y8GA 4GMVA 4HDQA 2P8VA 2K00A 2JP2A 5JHHA 2OTXA 4HAWB 2FJLA 2UZSA 4BBKA 4DXAB 3T06A 1GC7A 1AQCA 5HE1A 3D8EA 3O96A 3ULCA 3VIAA 4HATB 1MPHA 5DHFB 2YF0A 3WYFB 3F5RA 2DX5A 2EMTA 2CY4A 5LONB 5KQ4A 2GS0A 2D4QA 2M38A 5D3XA 3A98B 3HQCA 2P0DA 3SUZA 3N7CA 3FM8C 2YT1A 2J0MA 3TO1A 4KVGB 2LULA 4GZUA 4K17A 1FHXA 2J59M 3KY9A 5C5BB 1EGXA 2MFQA 5EFXA 2UZRA 2CODA 2DKQA 2G35A 5GOWB 3GYOA 4TKNA 1K5DB 4A6HA 2YS5A 3QBVB 3ML4A 1XODA 1U5DA 5C6RA 3SYXA 4K81A 4GMXB 4MK0A 3PP2A 3A8QA 1KZGA 2W2WA 1FAOA 5JLJB 3A8PA 5D27A 3SNHA 2HE7A 1FHOA 2R09A 3WA0A 1UPQA 1XD4A 3NSUA 5CLLB 4CHJA 1DDWA 1Y5OA 5KQ1A 3F0WA 4CHMA 4K2PA 1FOEA 3AU4A 1U27A 3IVFA 2I1JA 4HAUB 4IAPA 5KCVA 2N23A 2Z0PA 4YONA 3KRWA 5JP4A 1OMWA 3ZDTA 2RUKB 1MKEA 1W1DA 1QQGA 2YS1A 2YS3A 4KHBB 3DXEA 1P6SA 4DX8A 2ELAA 4HB4B 1XR0B 2EC1A 2D9WA 1WGQA 2DKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A5K A;  1ZVR A;  1GC6 A;  5FI0 A;  2LOZ A;  2HTH B;  4L6E A;  4IFS A;  2M14 A;  2ZPY A;  1EVH A;  2DHI A;  3PVL A;  1NI2 A;  3GYP A;  3VOQ A;  5J3T A;  1DRO A;  4WVF B;  1ZM0 A;  5DIF B;  5D3W A;  4MT7 A;  2K2U A;  4F7G A;  5HE2 A;  1TXD A;  1BTN A;  1KI1 B;  1X1F A;  1BAK A;  2D11 A;  4DX9 0;  5HE3 A;  2ROZ B;  3PVW A;  5D3V A;  2DYQ A;  4C0A A;  2RNR B;  4Z2N A;  1OQN A;  2CY5 A;  1RJ2 A;  4CYE A;  4PQ0 A;  4HDO A;  4GPT B;  2DHK A;  2Z0Q A;  2Q13 A;  2XQN M;  1UNP A;  1XX0 A;  1IRS A;  2QKL A;  2MKR A;  2I1K A;  4F7U P;  1UPR A;  3LJU X;  3M1I B;  1M7R A;  4F7H A;  5HE0 A;  3ODW A;  4KHA A;  4WSF A;  4WJ7 A;  1WG7 A;  3P7Z A;  1Y19 B;  3MPX A;  1SGH A;  2DFK A;  2J0J A;  1UNQ A;  1WGU A;  1EAZ A;  2L2I A;  5DH9 B;  2KGX B;  1J0W A;  2KUP A;  2I5C A;  5J3Q A;  2RVB B;  3PG7 A;  1V5P A;  1LW3 A;  1I7A A;  2D9V A;  3CIK A;  2I5F A;  1K5G B;  4A6F A;  4EMO A;  2UVM A;  2H7E A;  4ZRI A;  4A6K A;  1V89 A;  2QKM A;  2V76 A;  1X11 A;  1MAI A;  1TQZ A;  3KZ1 A;  5CLQ B;  2PZ1 A;  2D9Z A;  1MK7 B;  1DYN A;  1OY2 A;  2DYN A;  2IYB A;  3CXB B;  4YL8 A;  1V61 A;  5C16 A;  4EJN A;  1W1G A;  1X86 A;  2D2Q A;  5FI1 A;  3U8Z A;  2EMS A;  4HB3 B;  3X23 A;  2Y7B A;  2R0D A;  2DA0 A;  1B55 A;  4H8S A;  4Y94 A;  1X1G A;  1PMS A;  3KRX A;  2VRW B;  2RGN B;  3FSS A;  3OAN A;  1H10 A;  1MK9 B;  3PZD A;  5DHA B;  4NSW A;  2DTC A;  3DXC A;  1UNR A;  3BJI A;  4ZRJ A;  2K2J A;  3QIJ A;  1J19 A;  1V88 A;  2YVC A;  4HB2 B;  1MIZ B;  2OQB A;  4NY0 A;  4B6H A;  1NTV A;  1WVH A;  1XKE A;  2N0Y A;  2ELB A;  4KHO A;  3TFM A;  1ZC4 B;  4ZRK A;  2AL6 A;  3ODO A;  5C5B A;  1DDM A;  1W1H A;  3BIN A;  3PEG A;  3RCP A;  1UEF A;  1NTY A;  2GCJ A;  2MDX A;  2AEH A;  4HAV B;  1Z87 A;  1AWE A;  1LB1 A;  4PNK A;  1Q67 A;  2RLO A;  5D3Y A;  3ULB A;  2CAY A;  3TW1 A;  3SV1 A;  3TVV A;  1EF1 A;  2YT0 A;  3U7D A;  2VSZ A;  1PFJ A;  2ROV A;  2E2X A;  2P0H A;  1H4R A;  1I2H A;  1U29 A;  2NZ8 B;  2DN6 A;  3FEH A;  4DBB A;  1BWN A;  2ADZ A;  4D0N B;  1FGZ A;  2DHJ A;  2COF A;  2LKO A;  2YSZ A;  3P6A A;  1WI1 A;  2Y8F A;  3HK0 A;  2DLW A;  1E5W A;  2GCL A;  4KAX B;  3TCA A;  1RRP B;  1XCG A;  1TJ6 A;  1V5M A;  2GJY A;  1U2B A;  1KZ7 A;  4XWX A;  1P3R A;  2D9Y A;  2Z0O A;  4GXB A;  3AJ4 A;  1M7E A;  1ZSQ A;  1N3H A;  1FHW A;  2D9X A;  3D8F A;  4HHV A;  2COC A;  3MDB C;  3QWM A;  4GN1 A;  1U5E A;  5L81 A;  4MY6 A;  1U5F A;  1WJM A;  2MWN B;  3SO6 A;  4IOY X;  3ODX A;  2H7D A;  2X18 A;  2VKI A;  1ZC3 B;  4P7I A;  1V5U A;  5J3Y A;  5JHG A;  1QC6 A;  3G9W A;  3KSY A;  2EJ8 A;  4HAZ B;  2J0K A;  2W2X C;  2YRY A;  1MIX A;  1DBH A;  4TYZ A;  2D10 A;  1DDV A;  5DI9 B;  3AU5 A;  1NU2 A;  3HW2 B;  1FB8 A;  2RSG A;  2KCJ A;  2BCJ A;  2DX1 A;  3PSC A;  4HB0 B;  5C79 A;  4HAX B;  1P5T A;  1U5G A;  1PLS A;  4A6F B;  4K2O A;  2NMB A;  5LOP B;  3V5W A;  2LYD A;  3PVU A;  3D8D A;  1SHC A;  2LOX A;  2LG1 A;  1GG3 A;  2COA A;  1WJ1 A;  2W2X D;  1FGY A;  3DXD A;  4Z2M B;  2IFS A;  2P0F A;  4HAY B;  1X05 A;  1BTK A;  3ZVR A;  4EKU A;  3UZT A;  1ISN A;  2L1C A;  2CRF A;  2Y8G A;  4GMV A;  4HDQ A;  2P8V A;  2K00 A;  2JP2 A;  5JHH A;  2OTX A;  4HAW B;  2FJL A;  2UZS A;  4BBK A;  4DXA B;  3T06 A;  1GC7 A;  1AQC A;  5HE1 A;  3D8E A;  3O96 A;  3ULC A;  3VIA A;  4HAT B;  1MPH A;  5DHF B;  2YF0 A;  3WYF B;  3F5R A;  2DX5 A;  2EMT A;  2CY4 A;  5LON B;  5KQ4 A;  2GS0 A;  2D4Q A;  2M38 A;  5D3X A;  3A98 B;  3HQC A;  2P0D A;  3SUZ A;  3N7C A;  3FM8 C;  2YT1 A;  2J0M A;  3TO1 A;  4KVG B;  2LUL A;  4GZU A;  4K17 A;  1FHX A;  2J59 M;  3KY9 A;  5C5B B;  1EGX A;  2MFQ A;  5EFX A;  2UZR A;  2COD A;  2DKQ A;  2G35 A;  5GOW B;  3GYO A;  4TKN A;  1K5D B;  4A6H A;  2YS5 A;  3QBV B;  3ML4 A;  1XOD A;  1U5D A;  5C6R A;  3SYX A;  4K81 A;  4GMX B;  4MK0 A;  3PP2 A;  3A8Q A;  1KZG A;  2W2W A;  1FAO A;  5JLJ B;  3A8P A;  5D27 A;  3SNH A;  2HE7 A;  1FHO A;  2R09 A;  3WA0 A;  1UPQ A;  1XD4 A;  3NSU A;  5CLL B;  4CHJ A;  1DDW A;  1Y5O A;  5KQ1 A;  3F0W A;  4CHM A;  4K2P A;  1FOE A;  3AU4 A;  1U27 A;  3IVF A;  2I1J A;  4HAU B;  4IAP A;  5KCV A;  2N23 A;  2Z0P A;  4YON A;  3KRW A;  5JP4 A;  1OMW A;  3ZDT A;  2RUK B;  1MKE A;  1W1D A;  1QQG A;  2YS1 A;  2YS3 A;  4KHB B;  3DXE A;  1P6S A;  4DX8 A;  2ELA A;  4HB4 B;  1XR0 B;  2EC1 A;  2D9W A;  1WGQ A;  2DKP A; 
#chains in the Genus database with same CATH topology
 4A5K A;  1ZVR A;  1GC6 A;  5FI0 A;  2LOZ A;  2HTH B;  4L6E A;  4IFS A;  2M14 A;  2ZPY A;  1EVH A;  2DHI A;  3DCX A;  3PVL A;  1NI2 A;  3GYP A;  3VOQ A;  5J3T A;  1DRO A;  4WVF B;  1ZM0 A;  5DIF B;  5D3W A;  4MT7 A;  2K2U A;  4F7G A;  5HE2 A;  1TXD A;  1BTN A;  1KI1 B;  1X1F A;  1BAK A;  2D11 A;  4QJ5 B;  4DX9 0;  5HE3 A;  2ROZ B;  3PVW A;  5D3V A;  2DYQ A;  4C0A A;  2RNR B;  5LG4 B;  4Z2N A;  1OQN A;  4QJ4 B;  2CY5 A;  1RJ2 A;  4CYE A;  4PQ0 A;  4HDO A;  4GPT B;  2DHK A;  2Z0Q A;  2Q13 A;  2XQN M;  1UNP A;  1XX0 A;  1IRS A;  2QKL A;  2MKR A;  2I1K A;  4F7U P;  1UPR A;  3LJU X;  3M1I B;  1M7R A;  4F7H A;  5HE0 A;  3ODW A;  4KHA A;  4WSF A;  4WJ7 A;  1WG7 A;  3P7Z A;  1Y19 B;  3MPX A;  1SGH A;  2DFK A;  2J0J A;  1UNQ A;  1WGU A;  1EAZ A;  2L2I A;  5DH9 B;  2KGX B;  1J0W A;  2Z4D A;  2KUP A;  4QJ3 B;  2I5C A;  5J3Q A;  2RVB B;  3HIE A;  3PG7 A;  1V5P A;  1LW3 A;  3HSA A;  1I7A A;  2D9V A;  3CIK A;  2I5F A;  1K5G B;  2Z14 A;  4A6F A;  4EMO A;  2UVM A;  2H7E A;  4ZRI A;  4A6K A;  1V89 A;  2QKM A;  2V76 A;  1X11 A;  1MAI A;  1TQZ A;  3KZ1 A;  3U12 A;  5CLQ B;  2PZ1 A;  2D9Z A;  1MK7 B;  1DYN A;  2KIG A;  1OY2 A;  3A58 A;  2DYN A;  2IYB A;  3CXB B;  4YL8 A;  1V61 A;  5C16 A;  1MI1 A;  2K49 A;  4EJN A;  1W1G A;  1X86 A;  2D2Q A;  5FI1 A;  3U8Z A;  2EMS A;  4HB3 B;  3X23 A;  2Y7B A;  2R0D A;  2DA0 A;  1B55 A;  4H8S A;  4Y94 A;  1X1G A;  1PMS A;  2KIE A;  3KRX A;  2VRW B;  2RGN B;  3FSS A;  3OAN A;  1H10 A;  1MK9 B;  3PZD A;  5DHA B;  4NSW A;  2DTC A;  3DXC A;  1UNR A;  3BJI A;  4ZRJ A;  2K2J A;  3QIJ A;  1J19 A;  1V88 A;  2YVC A;  4D6W A;  4HB2 B;  1MIZ B;  2OQB A;  4NY0 A;  4B6H A;  1NTV A;  1WVH A;  1XKE A;  2N0Y A;  2ELB A;  3B77 A;  4KHO A;  3TFM A;  1ZC4 B;  4ZRK A;  2AL6 A;  3ODO A;  5C5B A;  2Z13 A;  1DDM A;  1W1H A;  3BIN A;  3PEG A;  3RCP A;  5I2M A;  1UEF A;  1NTY A;  2GCJ A;  2MDX A;  2AEH A;  3NWD A;  4HAV B;  3FVC A;  1Z87 A;  1AWE A;  1LB1 A;  4PNK A;  1Q67 A;  2RLO A;  5D3Y A;  3ULB A;  2CAY A;  3TW1 A;  3SV1 A;  3TVV A;  1EF1 A;  2YT0 A;  3U7D A;  2VSZ A;  1PFJ A;  2RRF A;  2ROV A;  4OT1 A;  2E2X A;  2P0H A;  1H4R A;  1I2H A;  1U29 A;  4GOU A;  2NZ8 B;  2DN6 A;  3FEH A;  4DBB A;  1T77 A;  1BWN A;  2ADZ A;  4D0N B;  5I2S A;  1FGZ A;  2DHJ A;  2COF A;  2LKO A;  2YSZ A;  3NW8 A;  3P6A A;  1WI1 A;  2Y8F A;  3HK0 A;  2DLW A;  1E5W A;  2GCL A;  4KAX B;  3TCA A;  1RRP B;  1XCG A;  1TJ6 A;  1V5M A;  2GJY A;  4CSQ A;  1U2B A;  3NWA A;  1KZ7 A;  4XWX A;  1P3R A;  2D9Y A;  2Z0O A;  4GXB A;  2Z59 A;  3AJ4 A;  1M7E A;  1ZSQ A;  1N3H A;  1FHW A;  2D9X A;  3D8F A;  4HHV A;  4KHB A;  2COC A;  3MDB C;  3QWM A;  4GN1 A;  1U5E A;  1ZYI A;  5L81 A;  4MY6 A;  1U5F A;  1WJM A;  2MWN B;  3SO6 A;  4IOY X;  2NBV A;  3ODX A;  2H7D A;  2X18 A;  2VKI A;  1ZC3 B;  4P7I A;  1V5U A;  5J3Y A;  5JHG A;  1QC6 A;  3G9W A;  3KSY A;  3OHM B;  2EJ8 A;  4HAZ B;  2J0K A;  2W2X C;  2YRY A;  1MIX A;  1DBH A;  4TYZ A;  2D10 A;  1DDV A;  5DI9 B;  3AU5 A;  1NU2 A;  3HW2 B;  4DIX A;  1FB8 A;  2RSG A;  2KCJ A;  2BCJ A;  2DX1 A;  3PSC A;  4HB0 B;  5C79 A;  4HAX B;  1P5T A;  1U5G A;  2K8E A;  1PLS A;  4A6F B;  4K2O A;  2NMB A;  5LOP B;  3V5W A;  2LYD A;  3PVU A;  3D8D A;  1SHC A;  2ZKM X;  2LOX A;  2LG1 A;  1GG3 A;  2COA A;  1WJ1 A;  3NWF A;  2W2X D;  1FGY A;  3DXD A;  4Z2M B;  2IFS A;  2P0F A;  4HAY B;  1X05 A;  1BTK A;  3ZVR A;  4EKU A;  3UZT A;  1ISN A;  2L1C A;  2YT2 A;  2CRF A;  2Y8G A;  4GMV A;  4HDQ A;  2P8V A;  2K00 A;  2JP2 A;  5JHH A;  2OTX A;  4HAW B;  2FJL A;  2UZS A;  4BBK A;  4DXA B;  3T06 A;  2FJU B;  1GC7 A;  1AQC A;  4GNK B;  5HE1 A;  3D8E A;  3O96 A;  3ULC A;  3VIA A;  4QXA B;  4HAT B;  1MPH A;  5DHF B;  2YF0 A;  3WYF B;  3F5R A;  2DX5 A;  2EMT A;  2CY4 A;  5LON B;  5KQ4 A;  2GS0 A;  2D4Q A;  2M38 A;  5D3X A;  3A98 B;  3HQC A;  2P0D A;  3SUZ A;  3N7C A;  3FM8 C;  2YT1 A;  2J0M A;  3TO1 A;  4KVG B;  2LUL A;  4GZU A;  4K17 A;  1FHX A;  2J59 M;  3KY9 A;  5C5B B;  1EGX A;  2MFQ A;  5EFX A;  2UZR A;  2COD A;  2DKQ A;  2G35 A;  5GOW B;  3GYO A;  4TKN A;  1K5D B;  4A6H A;  4HSI A;  2YS5 A;  3QBV B;  3ML4 A;  5IRS A;  1XOD A;  1U5D A;  5C6R A;  3SYX A;  4K81 A;  4GMX B;  4MK0 A;  2GUM A;  3PP2 A;  3A8Q A;  1KZG A;  2W2W A;  1FAO A;  5JLJ B;  3A8P A;  5D27 A;  4L1R A;  3SNH A;  2HE7 A;  1FHO A;  2R09 A;  3WA0 A;  1UPQ A;  1XD4 A;  3NSU A;  5CLL B;  4CHJ A;  1DDW A;  1Y5O A;  5KQ1 A;  3F0W A;  2KR0 A;  5M4Y B;  4CHM A;  4K2P A;  1FOE A;  3AU4 A;  1U27 A;  3IVF A;  2I1J A;  4HAU B;  4IAP A;  5KCV A;  2N23 A;  2Z0P A;  4YON A;  4OSN A;  3KRW A;  2R2Y A;  5JP4 A;  1OMW A;  3ZDT A;  2RUK B;  2KUQ A;  1MKE A;  1W1D A;  1QQG A;  2YS1 A;  2YS3 A;  4KHB B;  3DXE A;  1P6S A;  4DX8 A;  2ELA A;  4HB4 B;  1XR0 B;  2EC1 A;  2D9W A;  1WGQ A;  2DKP A; 
#chains in the Genus database with same CATH homology
 4A5K A;  1ZVR A;  1GC6 A;  5FI0 A;  2LOZ A;  2HTH B;  4L6E A;  4IFS A;  2M14 A;  2ZPY A;  1EVH A;  2DHI A;  3PVL A;  1NI2 A;  3GYP A;  3VOQ A;  5J3T A;  1DRO A;  4WVF B;  1ZM0 A;  5DIF B;  5D3W A;  4MT7 A;  2K2U A;  4F7G A;  5HE2 A;  1TXD A;  1BTN A;  1KI1 B;  1X1F A;  1BAK A;  2D11 A;  4DX9 0;  5HE3 A;  2ROZ B;  3PVW A;  5D3V A;  2DYQ A;  4C0A A;  2RNR B;  4Z2N A;  1OQN A;  2CY5 A;  1RJ2 A;  4CYE A;  4PQ0 A;  4HDO A;  4GPT B;  2DHK A;  2Z0Q A;  2Q13 A;  2XQN M;  1UNP A;  1XX0 A;  1IRS A;  2QKL A;  2MKR A;  2I1K A;  4F7U P;  1UPR A;  3LJU X;  3M1I B;  1M7R A;  4F7H A;  5HE0 A;  3ODW A;  4KHA A;  4WSF A;  4WJ7 A;  1WG7 A;  3P7Z A;  1Y19 B;  3MPX A;  1SGH A;  2DFK A;  2J0J A;  1UNQ A;  1WGU A;  1EAZ A;  2L2I A;  5DH9 B;  2KGX B;  1J0W A;  2KUP A;  2I5C A;  5J3Q A;  2RVB B;  3PG7 A;  1V5P A;  1LW3 A;  1I7A A;  2D9V A;  3CIK A;  2I5F A;  1K5G B;  4A6F A;  4EMO A;  2UVM A;  2H7E A;  4ZRI A;  4A6K A;  1V89 A;  2QKM A;  2V76 A;  1X11 A;  1MAI A;  1TQZ A;  3KZ1 A;  5CLQ B;  2PZ1 A;  2D9Z A;  1MK7 B;  1DYN A;  1OY2 A;  2DYN A;  2IYB A;  3CXB B;  4YL8 A;  1V61 A;  5C16 A;  4EJN A;  1W1G A;  1X86 A;  2D2Q A;  5FI1 A;  3U8Z A;  2EMS A;  4HB3 B;  3X23 A;  2Y7B A;  2R0D A;  2DA0 A;  1B55 A;  4H8S A;  4Y94 A;  1X1G A;  1PMS A;  3KRX A;  2VRW B;  2RGN B;  3FSS A;  3OAN A;  1H10 A;  1MK9 B;  3PZD A;  5DHA B;  4NSW A;  2DTC A;  3DXC A;  1UNR A;  3BJI A;  4ZRJ A;  2K2J A;  3QIJ A;  1J19 A;  1V88 A;  2YVC A;  4HB2 B;  1MIZ B;  2OQB A;  4NY0 A;  4B6H A;  1NTV A;  1WVH A;  1XKE A;  2N0Y A;  2ELB A;  4KHO A;  3TFM A;  1ZC4 B;  4ZRK A;  2AL6 A;  3ODO A;  5C5B A;  1DDM A;  1W1H A;  3BIN A;  3PEG A;  3RCP A;  1UEF A;  1NTY A;  2GCJ A;  2MDX A;  2AEH A;  4HAV B;  1Z87 A;  1AWE A;  1LB1 A;  4PNK A;  1Q67 A;  2RLO A;  5D3Y A;  3ULB A;  2CAY A;  3TW1 A;  3SV1 A;  3TVV A;  1EF1 A;  2YT0 A;  3U7D A;  2VSZ A;  1PFJ A;  2ROV A;  2E2X A;  2P0H A;  1H4R A;  1I2H A;  1U29 A;  2NZ8 B;  2DN6 A;  3FEH A;  4DBB A;  1BWN A;  2ADZ A;  4D0N B;  1FGZ A;  2DHJ A;  2COF A;  2LKO A;  2YSZ A;  3P6A A;  1WI1 A;  2Y8F A;  3HK0 A;  2DLW A;  1E5W A;  2GCL A;  4KAX B;  3TCA A;  1RRP B;  1XCG A;  1TJ6 A;  1V5M A;  2GJY A;  1U2B A;  1KZ7 A;  4XWX A;  1P3R A;  2D9Y A;  2Z0O A;  4GXB A;  3AJ4 A;  1M7E A;  1ZSQ A;  1N3H A;  1FHW A;  2D9X A;  3D8F A;  4HHV A;  2COC A;  3MDB C;  3QWM A;  4GN1 A;  1U5E A;  5L81 A;  4MY6 A;  1U5F A;  1WJM A;  2MWN B;  3SO6 A;  4IOY X;  3ODX A;  2H7D A;  2X18 A;  2VKI A;  1ZC3 B;  4P7I A;  1V5U A;  5J3Y A;  5JHG A;  1QC6 A;  3G9W A;  3KSY A;  2EJ8 A;  4HAZ B;  2J0K A;  2W2X C;  2YRY A;  1MIX A;  1DBH A;  4TYZ A;  2D10 A;  1DDV A;  5DI9 B;  3AU5 A;  1NU2 A;  3HW2 B;  1FB8 A;  2RSG A;  2KCJ A;  2BCJ A;  2DX1 A;  3PSC A;  4HB0 B;  5C79 A;  4HAX B;  1P5T A;  1U5G A;  1PLS A;  4A6F B;  4K2O A;  2NMB A;  5LOP B;  3V5W A;  2LYD A;  3PVU A;  3D8D A;  1SHC A;  2LOX A;  2LG1 A;  1GG3 A;  2COA A;  1WJ1 A;  2W2X D;  1FGY A;  3DXD A;  4Z2M B;  2IFS A;  2P0F A;  4HAY B;  1X05 A;  1BTK A;  3ZVR A;  4EKU A;  3UZT A;  1ISN A;  2L1C A;  2CRF A;  2Y8G A;  4GMV A;  4HDQ A;  2P8V A;  2K00 A;  2JP2 A;  5JHH A;  2OTX A;  4HAW B;  2FJL A;  2UZS A;  4BBK A;  4DXA B;  3T06 A;  1GC7 A;  1AQC A;  5HE1 A;  3D8E A;  3O96 A;  3ULC A;  3VIA A;  4HAT B;  1MPH A;  5DHF B;  2YF0 A;  3WYF B;  3F5R A;  2DX5 A;  2EMT A;  2CY4 A;  5LON B;  5KQ4 A;  2GS0 A;  2D4Q A;  2M38 A;  5D3X A;  3A98 B;  3HQC A;  2P0D A;  3SUZ A;  3N7C A;  3FM8 C;  2YT1 A;  2J0M A;  3TO1 A;  4KVG B;  2LUL A;  4GZU A;  4K17 A;  1FHX A;  2J59 M;  3KY9 A;  5C5B B;  1EGX A;  2MFQ A;  5EFX A;  2UZR A;  2COD A;  2DKQ A;  2G35 A;  5GOW B;  3GYO A;  4TKN A;  1K5D B;  4A6H A;  2YS5 A;  3QBV B;  3ML4 A;  1XOD A;  1U5D A;  5C6R A;  3SYX A;  4K81 A;  4GMX B;  4MK0 A;  3PP2 A;  3A8Q A;  1KZG A;  2W2W A;  1FAO A;  5JLJ B;  3A8P A;  5D27 A;  3SNH A;  2HE7 A;  1FHO A;  2R09 A;  3WA0 A;  1UPQ A;  1XD4 A;  3NSU A;  5CLL B;  4CHJ A;  1DDW A;  1Y5O A;  5KQ1 A;  3F0W A;  4CHM A;  4K2P A;  1FOE A;  3AU4 A;  1U27 A;  3IVF A;  2I1J A;  4HAU B;  4IAP A;  5KCV A;  2N23 A;  2Z0P A;  4YON A;  3KRW A;  5JP4 A;  1OMW A;  3ZDT A;  2RUK B;  1MKE A;  1W1D A;  1QQG A;  2YS1 A;  2YS3 A;  4KHB B;  3DXE A;  1P6S A;  4DX8 A;  2ELA A;  4HB4 B;  1XR0 B;  2EC1 A;  2D9W A;  1WGQ A;  2DKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...