4A5KA

Structural analyses of slm1-ph domain demonstrate ligand binding in the non-canonical site
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
115
structure length
115
Chain Sequence
FTEIKSGFLERRSKFLKSYSKGYYVLTPNFLHEFKTADRKKDLVPVMSLALSECTVTEHSRKNSTSSPNSTGSDAKFVLHAKQNGIIRRGHNWVFKADSYESMMSWFDNLKILTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords PHOSPHATIDYLINOSITOL 4,5-BISPHOSPHATE-BINDING PROTEIN SLM 1
publication title Structural Analyses of Slm1-Ph Domain Demonstrate Ligand Binding in the Non-Canonical Site
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 25
structure length 115
sequence length 115
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4a5kA00
3P6AA 4A6FB 2H7EA 3P7ZA 2D9WA 2P0DA 1FGYA 5DHFB 1V88A 1UPQA 2ELAA 2LOZA 1W1HA 3OANA 2UVMA 1X1FA 2DX5A 2YSZA 2ROVA 1BTNA 3X23A 4YONA 1UNPA 3FEHA 4HAVB 2DX1A 4P7IA 3SYXA 1OQNA 1FOEA 1V5PA 4NY0A 3SUZA 2UZSA 2PZ1A 2ADZA 2UZRA 3ML4A 1UNRA 4TYZA 4GPTB 1EAZA 3TCAA 2D11A 4YL8A 4F7UP 5DHAB 3ULCA 2K2UA 1J0WA 2DHJA 3IVFA 2COFA 1V89A 5HE3A 1MK7B 3HK0A 2CODA 2COAA 2P8VA 1U29A 2M14A 1X11A 4IFSA 5LONB 1Z87A 1XODA 5C16A 1U27A 2K00A 1NTVA 5KQ4A 2OQBA 4B6HA 1ZVRA 3UZTA 4H8SA 2AEHA 1MKEA 1U5FA 3PP2A 2I5CA 5C5BA 1UPRA 3SNHA 4DX90 3AU4A 1ZC3B 1MK9B 2AL6A 2DLWA 3CXBB 1GC6A 1TQZA 1PFJA 4DXAB 1NU2A 1XKEA 4F7HA 5KCVA 4WSFA 2ELBA 2QKLA 3ODWA 2DFKA 5D3YA 4EJNA 3WYFB 2Q13A 2Y7BA 1SGHA 4IOYX 2YVCA 5HE2A 2MWNB 2DYQA 2P0HA 4WVFB 1WJ1A 1ZC4B 2W2WA 1M7RA 1MIZB 1DBHA 1PMSA 1EGXA 1GC7A 3QBVB 2DYNA 2DTCA 5LOPB 1I2HA 2KGXB 3A98B 5DI9B 4TKNA 3ODXA 4ZRJA 2NZ8B 4HAZB 5JLJB 4XWXA 1KZ7A 5EFXA 2DKPA 2DKQA 1TXDA 1E5WA 1WVHA 4A5KA 5D3WA 3LJUX 2EMTA 3SO6A 3AU5A 1OMWA 1PLSA 2I5FA 2W2XC 4L6EA 3BJIA 1UNQA 1WI1A 5JHHA 4CHJA 1Q67A 3QIJA 3TO1A 4D0NB 4K17A 4KHBB 2R09A 2J0MA 3VIAA 2VKIA 5D27A 1I7AA 5J3YA 3A8PA 1EF1A 1Y5OA 4KAXB 1M7EA 3GYPA 2K2JA 5JP4A 3DXEA 2J0KA 3KZ1A 1FHXA 1ISNA 1NI2A 2LYDA 4A6HA 4KHAA 4HDOA 2KCJA 3CIKA 2D10A 3FSSA 4HAYB 5J3TA 3DXCA 1U2BA 3V5WA 3GYOA 5FI0A 4CHMA 5DIFB 3F0WA 1AWEA 3TVVA 2D9ZA 2IYBA 3KSYA 3N7CA 1WJMA 4DX8A 2GCLA 2CRFA 2CY4A 1H4RA 1FHWA 1V61A 3PG7A 4HAWB 4HB2B 1K5DB 2LG1A 2CY5A 1KZGA 3U7DA 4ZRKA 1QC6A 4CYEA 3TFMA 1V5UA 2LOXA 2RSGA 4HAUB 1WG7A 2RVBB 2YS1A 1ZM0A 2Z0OA 2IFSA 4HB4B 2D4QA 2R0DA 3MPXA 2YS3A 2YF0A 3PSCA 1DDVA 2EJ8A 1W1DA 1XR0B 3AJ4A 1RRPB 1DDWA 4A6KA 5J3QA 2RUKB 2NMBA 4MT7A 3WA0A 2J59M 5CLLB 2QKMA 1U5EA 3MDBC 3D8FA 3NSUA 3KY9A 1BTKA 1FAOA 1GG3A 2ROZB 1XCGA 4BBKA 2P0FA 2GCJA 2LKOA 2GS0A 5JHGA 1NTYA 2COCA 3PZDA 5C6RA 2Y8GA 2KUPA 2L2IA 3A8QA 3ULBA 5D3VA 2FJLA 4MK0A 2ZPYA 4DBBA 5HE1A 2D2QA 2DHKA 3HQCA 4GZUA 1FGZA 4Y94A 2MKRA 4A6FA 1FHOA 1FB8A 2YRYA 1Y19B 4K81A 5FI1A 2YS5A 2EMSA 4C0AA 1U5GA 5DH9B 1AQCA 4Z2MB 1BWNA 4K2OA 3SV1A 1QQGA 2L1CA 4HDQA 3T06A 4GN1A 3HW2B 2I1JA 1XD4A 2X18A 1XX0A 1P5TA 1UEFA 2G35A 2DHIA 1EVHA 2YT0A 4HB0B 4F7GA 2DN6A 3DXDA 4KVGB 1DROA 5KQ1A 4Z2NA 1V5MA 1P3RA 1DYNA 3PEGA 1WGQA 5D3XA 4PQ0A 3FM8C 2JP2A 4GXBA 3QWMA 1OY2A 2RGNB 2MDXA 2CAYA 2VRWB 1LB1A 3PVWA 4EKUA 2YT1A 3G9WA 4K2PA 1TJ6A 4ZRIA 2J0JA 3O96A 2HE7A 3D8EA 1N3HA 1U5DA 1B55A 1X05A 2H7DA 3PVLA 1ZSQA 1MIXA 3ZVRA 1K5GB 3KRXA 2LULA 3KRWA 1MPHA 5C79A 1J19A 5L81A 3RCPA 2GJYA 5C5BB 2RLOA 2N0YA 2E2XA 4HHVA 2DA0A 1H10A 3TW1A 2EC1A 5HE0A 4HB3B 3F5RA 1MAIA 2BCJA 2M38A 1SHCA 2D9YA 3PVUA 2W2XD 2D9VA 1WGUA 2I1KA 4EMOA 1BAKA 3VOQA 2OTXA 2N23A 1LW3A 1W1GA 4WJ7A 3ZDTA 1RJ2A 2D9XA 3D8DA 3M1IB 2XQNM 2Z0QA 2Z0PA 5GOWB 3U8ZA 3BINA 1IRSA 4MY6A 2MFQA 4NSWA 2VSZA 5CLQB 4HAXB 4PNKA 3ODOA 1P6SA 1DDMA 2HTHB 2Y8FA 1KI1B 1X86A 2RNRB 2V76A 4KHOA 4IAPA 4GMVA 4HATB 1X1GA 4GMXB
chains in the Genus database with same CATH superfamily
3P6AA 4A6FB 2H7EA 3P7ZA 2D9WA 4KHBA 2P0DA 1FGYA 5DHFB 1V88A 1UPQA 2ELAA 2LOZA 2K49A 1W1HA 3OANA 2UVMA 1X1FA 2DX5A 2YT2A 2YSZA 2ROVA 1BTNA 3X23A 5M4YB 4YONA 1UNPA 3FEHA 4HAVB 2DX1A 4P7IA 3SYXA 1OQNA 1FOEA 1V5PA 3NWDA 4NY0A 3SUZA 2UZSA 3DCXA 2PZ1A 2ADZA 2UZRA 3ML4A 1UNRA 4TYZA 4GPTB 1EAZA 3TCAA 2D11A 4YL8A 4F7UP 5DHAB 3ULCA 2K2UA 1J0WA 2DHJA 3IVFA 2COFA 1V89A 4GOUA 2KIEA 3HSAA 5HE3A 1MK7B 3HK0A 2CODA 2COAA 2P8VA 1U29A 2M14A 1X11A 4IFSA 5LONB 1Z87A 1XODA 5C16A 1U27A 2K00A 1NTVA 5KQ4A 2OQBA 4B6HA 1ZVRA 3UZTA 4H8SA 2AEHA 1MKEA 3B77A 4DIXA 1U5FA 3PP2A 2I5CA 5C5BA 1UPRA 3SNHA 4DX90 3AU4A 1ZC3B 1MK9B 2AL6A 2DLWA 3CXBB 2ZKMX 1GC6A 1TQZA 2Z59A 1PFJA 4DXAB 1NU2A 1XKEA 4F7HA 5KCVA 4WSFA 2ELBA 2QKLA 3ODWA 2DFKA 5D3YA 4EJNA 2RRFA 4QJ5B 3WYFB 2Q13A 2Y7BA 1SGHA 4IOYX 2YVCA 5HE2A 2MWNB 5I2MA 2DYQA 2P0HA 4WVFB 1WJ1A 1ZC4B 2W2WA 1M7RA 1MIZB 1DBHA 1PMSA 1EGXA 1GC7A 3QBVB 2DYNA 2DTCA 5LOPB 1I2HA 2KGXB 3A98B 5DI9B 4TKNA 3ODXA 4ZRJA 2NZ8B 4HAZB 5JLJB 4XWXA 1KZ7A 5EFXA 2DKPA 2DKQA 1TXDA 1E5WA 1WVHA 4A5KA 5D3WA 3LJUX 2EMTA 3SO6A 3AU5A 1OMWA 1PLSA 2I5FA 2W2XC 4L6EA 3BJIA 1UNQA 1WI1A 5JHHA 4CHJA 1Q67A 3QIJA 2KR0A 3TO1A 4D0NB 4K17A 2Z13A 4KHBB 2R09A 2J0MA 3VIAA 2GUMA 2VKIA 5D27A 1I7AA 5J3YA 3A8PA 1EF1A 1Y5OA 4KAXB 1M7EA 3GYPA 2K2JA 5JP4A 3DXEA 2J0KA 3KZ1A 1FHXA 5LG4B 1ISNA 1NI2A 2LYDA 4QXAB 4L1RA 4A6HA 4OSNA 4KHAA 4HDOA 2KCJA 3CIKA 2D10A 3FSSA 4HAYB 4QJ4B 5J3TA 3DXCA 1U2BA 3V5WA 3NWAA 3GYOA 5FI0A 4CHMA 5DIFB 3F0WA 1AWEA 3TVVA 2D9ZA 2IYBA 3KSYA 3N7CA 1WJMA 4DX8A 4OT1A 2GCLA 2K8EA 2CRFA 2CY4A 1H4RA 1FHWA 1V61A 3PG7A 4HAWB 4HB2B 1K5DB 2LG1A 2CY5A 1KZGA 3U7DA 4ZRKA 1QC6A 3NW8A 4CYEA 3TFMA 1V5UA 2LOXA 2RSGA 4HAUB 1WG7A 2RVBB 2YS1A 1ZM0A 2Z0OA 2IFSA 3U12A 4HB4B 2D4QA 3FVCA 2R0DA 3MPXA 2YS3A 2YF0A 3PSCA 1DDVA 2EJ8A 1W1DA 1XR0B 3AJ4A 1RRPB 1DDWA 4A6KA 5J3QA 2RUKB 2NMBA 4MT7A 3WA0A 2J59M 5CLLB 2QKMA 1U5EA 3MDBC 3D8FA 3NSUA 3KY9A 1BTKA 1FAOA 2KUQA 1GG3A 2ROZB 1XCGA 4BBKA 2P0FA 2GCJA 2LKOA 2GS0A 5JHGA 1NTYA 1T77A 2COCA 3PZDA 5C6RA 2Y8GA 2KUPA 2L2IA 3OHMB 3A8QA 3ULBA 5D3VA 2FJLA 4MK0A 2ZPYA 4DBBA 5HE1A 2D2QA 2DHKA 3HQCA 4GZUA 1FGZA 4Y94A 2MKRA 4A6FA 1FHOA 1FB8A 2YRYA 1Y19B 4K81A 5FI1A 2YS5A 2EMSA 4C0AA 1U5GA 5DH9B 1AQCA 4Z2MB 1BWNA 4K2OA 3SV1A 1QQGA 2L1CA 4HDQA 3T06A 4GN1A 3HW2B 2I1JA 1XD4A 2KIGA 2X18A 1XX0A 4GNKB 1P5TA 1UEFA 2G35A 2DHIA 1EVHA 2YT0A 4HB0B 4F7GA 2DN6A 2R2YA 3DXDA 4KVGB 1DROA 5KQ1A 4Z2NA 1V5MA 1P3RA 1DYNA 3PEGA 4CSQA 1WGQA 5D3XA 2Z14A 4PQ0A 3FM8C 2JP2A 4GXBA 3QWMA 3NWFA 1OY2A 2RGNB 2MDXA 2CAYA 2VRWB 1LB1A 3PVWA 4EKUA 4QJ3B 2FJUB 2YT1A 3G9WA 4K2PA 1TJ6A 4ZRIA 2J0JA 3O96A 2HE7A 3D8EA 1N3HA 1U5DA 1B55A 1X05A 2H7DA 3PVLA 5IRSA 1ZSQA 1MIXA 3ZVRA 1K5GB 5I2SA 3KRXA 2LULA 3KRWA 1MPHA 5C79A 1J19A 5L81A 3RCPA 2GJYA 5C5BB 2RLOA 2N0YA 2E2XA 4HHVA 2DA0A 3HIEA 1H10A 3TW1A 2EC1A 5HE0A 4HB3B 3F5RA 1MAIA 2BCJA 2M38A 1SHCA 2D9YA 2Z4DA 3PVUA 2W2XD 2D9VA 1WGUA 2I1KA 4EMOA 1BAKA 3VOQA 2OTXA 2N23A 1LW3A 1W1GA 4WJ7A 3ZDTA 4D6WA 1MI1A 1RJ2A 2D9XA 3D8DA 3M1IB 2XQNM 2Z0QA 2Z0PA 4HSIA 5GOWB 3U8ZA 3BINA 1IRSA 4MY6A 2MFQA 4NSWA 2VSZA 5CLQB 3A58A 2NBVA 4HAXB 4PNKA 3ODOA 1P6SA 1DDMA 2HTHB 2Y8FA 1KI1B 1X86A 2RNRB 2V76A 4KHOA 4IAPA 4GMVA 4HATB 1X1GA 4GMXB 1ZYIA
chains in the Genus database with same CATH topology
3P6AA 4A6FB 2H7EA 3P7ZA 2D9WA 2P0DA 1FGYA 5DHFB 1V88A 1UPQA 2ELAA 2LOZA 1W1HA 3OANA 2UVMA 1X1FA 2DX5A 2YSZA 2ROVA 1BTNA 3X23A 4YONA 1UNPA 3FEHA 4HAVB 2DX1A 4P7IA 3SYXA 1OQNA 1FOEA 1V5PA 4NY0A 3SUZA 2UZSA 2PZ1A 2ADZA 2UZRA 3ML4A 1UNRA 4TYZA 4GPTB 1EAZA 3TCAA 2D11A 4YL8A 4F7UP 5DHAB 3ULCA 2K2UA 1J0WA 2DHJA 3IVFA 2COFA 1V89A 5HE3A 1MK7B 3HK0A 2CODA 2COAA 2P8VA 1U29A 2M14A 1X11A 4IFSA 5LONB 1Z87A 1XODA 5C16A 1U27A 2K00A 1NTVA 5KQ4A 2OQBA 4B6HA 1ZVRA 3UZTA 4H8SA 2AEHA 1MKEA 1U5FA 3PP2A 2I5CA 5C5BA 1UPRA 3SNHA 4DX90 3AU4A 1ZC3B 1MK9B 2AL6A 2DLWA 3CXBB 1GC6A 1TQZA 1PFJA 4DXAB 1NU2A 1XKEA 4F7HA 5KCVA 4WSFA 2ELBA 2QKLA 3ODWA 2DFKA 5D3YA 4EJNA 3WYFB 2Q13A 2Y7BA 1SGHA 4IOYX 2YVCA 5HE2A 2MWNB 2DYQA 2P0HA 4WVFB 1WJ1A 1ZC4B 2W2WA 1M7RA 1MIZB 1DBHA 1PMSA 1EGXA 1GC7A 3QBVB 2DYNA 2DTCA 5LOPB 1I2HA 2KGXB 3A98B 5DI9B 4TKNA 3ODXA 4ZRJA 2NZ8B 4HAZB 5JLJB 4XWXA 1KZ7A 5EFXA 2DKPA 2DKQA 1TXDA 1E5WA 1WVHA 4A5KA 5D3WA 3LJUX 2EMTA 3SO6A 3AU5A 1OMWA 1PLSA 2I5FA 2W2XC 4L6EA 3BJIA 1UNQA 1WI1A 5JHHA 4CHJA 1Q67A 3QIJA 3TO1A 4D0NB 4K17A 4KHBB 2R09A 2J0MA 3VIAA 2VKIA 5D27A 1I7AA 5J3YA 3A8PA 1EF1A 1Y5OA 4KAXB 1M7EA 3GYPA 2K2JA 5JP4A 3DXEA 2J0KA 3KZ1A 1FHXA 1ISNA 1NI2A 2LYDA 4A6HA 4KHAA 4HDOA 2KCJA 3CIKA 2D10A 3FSSA 4HAYB 5J3TA 3DXCA 1U2BA 3V5WA 3GYOA 5FI0A 4CHMA 5DIFB 3F0WA 1AWEA 3TVVA 2D9ZA 2IYBA 3KSYA 3N7CA 1WJMA 4DX8A 2GCLA 2CRFA 2CY4A 1H4RA 1FHWA 1V61A 3PG7A 4HAWB 4HB2B 1K5DB 2LG1A 2CY5A 1KZGA 3U7DA 4ZRKA 1QC6A 4CYEA 3TFMA 1V5UA 2LOXA 2RSGA 4HAUB 1WG7A 2RVBB 2YS1A 1ZM0A 2Z0OA 2IFSA 4HB4B 2D4QA 2R0DA 3MPXA 2YS3A 2YF0A 3PSCA 1DDVA 2EJ8A 1W1DA 1XR0B 3AJ4A 1RRPB 1DDWA 4A6KA 5J3QA 2RUKB 2NMBA 4MT7A 3WA0A 2J59M 5CLLB 2QKMA 1U5EA 3MDBC 3D8FA 3NSUA 3KY9A 1BTKA 1FAOA 1GG3A 2ROZB 1XCGA 4BBKA 2P0FA 2GCJA 2LKOA 2GS0A 5JHGA 1NTYA 2COCA 3PZDA 5C6RA 2Y8GA 2KUPA 2L2IA 3A8QA 3ULBA 5D3VA 2FJLA 4MK0A 2ZPYA 4DBBA 5HE1A 2D2QA 2DHKA 3HQCA 4GZUA 1FGZA 4Y94A 2MKRA 4A6FA 1FHOA 1FB8A 2YRYA 1Y19B 4K81A 5FI1A 2YS5A 2EMSA 4C0AA 1U5GA 5DH9B 1AQCA 4Z2MB 1BWNA 4K2OA 3SV1A 1QQGA 2L1CA 4HDQA 3T06A 4GN1A 3HW2B 2I1JA 1XD4A 2X18A 1XX0A 1P5TA 1UEFA 2G35A 2DHIA 1EVHA 2YT0A 4HB0B 4F7GA 2DN6A 3DXDA 4KVGB 1DROA 5KQ1A 4Z2NA 1V5MA 1P3RA 1DYNA 3PEGA 1WGQA 5D3XA 4PQ0A 3FM8C 2JP2A 4GXBA 3QWMA 1OY2A 2RGNB 2MDXA 2CAYA 2VRWB 1LB1A 3PVWA 4EKUA 2YT1A 3G9WA 4K2PA 1TJ6A 4ZRIA 2J0JA 3O96A 2HE7A 3D8EA 1N3HA 1U5DA 1B55A 1X05A 2H7DA 3PVLA 1ZSQA 1MIXA 3ZVRA 1K5GB 3KRXA 2LULA 3KRWA 1MPHA 5C79A 1J19A 5L81A 3RCPA 2GJYA 5C5BB 2RLOA 2N0YA 2E2XA 4HHVA 2DA0A 1H10A 3TW1A 2EC1A 5HE0A 4HB3B 3F5RA 1MAIA 2BCJA 2M38A 1SHCA 2D9YA 3PVUA 2W2XD 2D9VA 1WGUA 2I1KA 4EMOA 1BAKA 3VOQA 2OTXA 2N23A 1LW3A 1W1GA 4WJ7A 3ZDTA 1RJ2A 2D9XA 3D8DA 3M1IB 2XQNM 2Z0QA 2Z0PA 5GOWB 3U8ZA 3BINA 1IRSA 4MY6A 2MFQA 4NSWA 2VSZA 5CLQB 4HAXB 4PNKA 3ODOA 1P6SA 1DDMA 2HTHB 2Y8FA 1KI1B 1X86A 2RNRB 2V76A 4KHOA 4IAPA 4GMVA 4HATB 1X1GA 4GMXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P6A A;  4A6F B;  2H7E A;  3P7Z A;  2D9W A;  2P0D A;  1FGY A;  5DHF B;  1V88 A;  1UPQ A;  2ELA A;  2LOZ A;  1W1H A;  3OAN A;  2UVM A;  1X1F A;  2DX5 A;  2YSZ A;  2ROV A;  1BTN A;  3X23 A;  4YON A;  1UNP A;  3FEH A;  4HAV B;  2DX1 A;  4P7I A;  3SYX A;  1OQN A;  1FOE A;  1V5P A;  4NY0 A;  3SUZ A;  2UZS A;  2PZ1 A;  2ADZ A;  2UZR A;  3ML4 A;  1UNR A;  4TYZ A;  4GPT B;  1EAZ A;  3TCA A;  2D11 A;  4YL8 A;  4F7U P;  5DHA B;  3ULC A;  2K2U A;  1J0W A;  2DHJ A;  3IVF A;  2COF A;  1V89 A;  5HE3 A;  1MK7 B;  3HK0 A;  2COD A;  2COA A;  2P8V A;  1U29 A;  2M14 A;  1X11 A;  4IFS A;  5LON B;  1Z87 A;  1XOD A;  5C16 A;  1U27 A;  2K00 A;  1NTV A;  5KQ4 A;  2OQB A;  4B6H A;  1ZVR A;  3UZT A;  4H8S A;  2AEH A;  1MKE A;  1U5F A;  3PP2 A;  2I5C A;  5C5B A;  1UPR A;  3SNH A;  4DX9 0;  3AU4 A;  1ZC3 B;  1MK9 B;  2AL6 A;  2DLW A;  3CXB B;  1GC6 A;  1TQZ A;  1PFJ A;  4DXA B;  1NU2 A;  1XKE A;  4F7H A;  5KCV A;  4WSF A;  2ELB A;  2QKL A;  3ODW A;  2DFK A;  5D3Y A;  4EJN A;  3WYF B;  2Q13 A;  2Y7B A;  1SGH A;  4IOY X;  2YVC A;  5HE2 A;  2MWN B;  2DYQ A;  2P0H A;  4WVF B;  1WJ1 A;  1ZC4 B;  2W2W A;  1M7R A;  1MIZ B;  1DBH A;  1PMS A;  1EGX A;  1GC7 A;  3QBV B;  2DYN A;  2DTC A;  5LOP B;  1I2H A;  2KGX B;  3A98 B;  5DI9 B;  4TKN A;  3ODX A;  4ZRJ A;  2NZ8 B;  4HAZ B;  5JLJ B;  4XWX A;  1KZ7 A;  5EFX A;  2DKP A;  2DKQ A;  1TXD A;  1E5W A;  1WVH A;  4A5K A;  5D3W A;  3LJU X;  2EMT A;  3SO6 A;  3AU5 A;  1OMW A;  1PLS A;  2I5F A;  2W2X C;  4L6E A;  3BJI A;  1UNQ A;  1WI1 A;  5JHH A;  4CHJ A;  1Q67 A;  3QIJ A;  3TO1 A;  4D0N B;  4K17 A;  4KHB B;  2R09 A;  2J0M A;  3VIA A;  2VKI A;  5D27 A;  1I7A A;  5J3Y A;  3A8P A;  1EF1 A;  1Y5O A;  4KAX B;  1M7E A;  3GYP A;  2K2J A;  5JP4 A;  3DXE A;  2J0K A;  3KZ1 A;  1FHX A;  1ISN A;  1NI2 A;  2LYD A;  4A6H A;  4KHA A;  4HDO A;  2KCJ A;  3CIK A;  2D10 A;  3FSS A;  4HAY B;  5J3T A;  3DXC A;  1U2B A;  3V5W A;  3GYO A;  5FI0 A;  4CHM A;  5DIF B;  3F0W A;  1AWE A;  3TVV A;  2D9Z A;  2IYB A;  3KSY A;  3N7C A;  1WJM A;  4DX8 A;  2GCL A;  2CRF A;  2CY4 A;  1H4R A;  1FHW A;  1V61 A;  3PG7 A;  4HAW B;  4HB2 B;  1K5D B;  2LG1 A;  2CY5 A;  1KZG A;  3U7D A;  4ZRK A;  1QC6 A;  4CYE A;  3TFM A;  1V5U A;  2LOX A;  2RSG A;  4HAU B;  1WG7 A;  2RVB B;  2YS1 A;  1ZM0 A;  2Z0O A;  2IFS A;  4HB4 B;  2D4Q A;  2R0D A;  3MPX A;  2YS3 A;  2YF0 A;  3PSC A;  1DDV A;  2EJ8 A;  1W1D A;  1XR0 B;  3AJ4 A;  1RRP B;  1DDW A;  4A6K A;  5J3Q A;  2RUK B;  2NMB A;  4MT7 A;  3WA0 A;  2J59 M;  5CLL B;  2QKM A;  1U5E A;  3MDB C;  3D8F A;  3NSU A;  3KY9 A;  1BTK A;  1FAO A;  1GG3 A;  2ROZ B;  1XCG A;  4BBK A;  2P0F A;  2GCJ A;  2LKO A;  2GS0 A;  5JHG A;  1NTY A;  2COC A;  3PZD A;  5C6R A;  2Y8G A;  2KUP A;  2L2I A;  3A8Q A;  3ULB A;  5D3V A;  2FJL A;  4MK0 A;  2ZPY A;  4DBB A;  5HE1 A;  2D2Q A;  2DHK A;  3HQC A;  4GZU A;  1FGZ A;  4Y94 A;  2MKR A;  4A6F A;  1FHO A;  1FB8 A;  2YRY A;  1Y19 B;  4K81 A;  5FI1 A;  2YS5 A;  2EMS A;  4C0A A;  1U5G A;  5DH9 B;  1AQC A;  4Z2M B;  1BWN A;  4K2O A;  3SV1 A;  1QQG A;  2L1C A;  4HDQ A;  3T06 A;  4GN1 A;  3HW2 B;  2I1J A;  1XD4 A;  2X18 A;  1XX0 A;  1P5T A;  1UEF A;  2G35 A;  2DHI A;  1EVH A;  2YT0 A;  4HB0 B;  4F7G A;  2DN6 A;  3DXD A;  4KVG B;  1DRO A;  5KQ1 A;  4Z2N A;  1V5M A;  1P3R A;  1DYN A;  3PEG A;  1WGQ A;  5D3X A;  4PQ0 A;  3FM8 C;  2JP2 A;  4GXB A;  3QWM A;  1OY2 A;  2RGN B;  2MDX A;  2CAY A;  2VRW B;  1LB1 A;  3PVW A;  4EKU A;  2YT1 A;  3G9W A;  4K2P A;  1TJ6 A;  4ZRI A;  2J0J A;  3O96 A;  2HE7 A;  3D8E A;  1N3H A;  1U5D A;  1B55 A;  1X05 A;  2H7D A;  3PVL A;  1ZSQ A;  1MIX A;  3ZVR A;  1K5G B;  3KRX A;  2LUL A;  3KRW A;  1MPH A;  5C79 A;  1J19 A;  5L81 A;  3RCP A;  2GJY A;  5C5B B;  2RLO A;  2N0Y A;  2E2X A;  4HHV A;  2DA0 A;  1H10 A;  3TW1 A;  2EC1 A;  5HE0 A;  4HB3 B;  3F5R A;  1MAI A;  2BCJ A;  2M38 A;  1SHC A;  2D9Y A;  3PVU A;  2W2X D;  2D9V A;  1WGU A;  2I1K A;  4EMO A;  1BAK A;  3VOQ A;  2OTX A;  2N23 A;  1LW3 A;  1W1G A;  4WJ7 A;  3ZDT A;  1RJ2 A;  2D9X A;  3D8D A;  3M1I B;  2XQN M;  2Z0Q A;  2Z0P A;  5GOW B;  3U8Z A;  3BIN A;  1IRS A;  4MY6 A;  2MFQ A;  4NSW A;  2VSZ A;  5CLQ B;  4HAX B;  4PNK A;  3ODO A;  1P6S A;  1DDM A;  2HTH B;  2Y8F A;  1KI1 B;  1X86 A;  2RNR B;  2V76 A;  4KHO A;  4IAP A;  4GMV A;  4HAT B;  1X1G A;  4GMX B; 
#chains in the Genus database with same CATH topology
 3P6A A;  4A6F B;  2H7E A;  3P7Z A;  2D9W A;  4KHB A;  2P0D A;  1FGY A;  5DHF B;  1V88 A;  1UPQ A;  2ELA A;  2LOZ A;  2K49 A;  1W1H A;  3OAN A;  2UVM A;  1X1F A;  2DX5 A;  2YT2 A;  2YSZ A;  2ROV A;  1BTN A;  3X23 A;  5M4Y B;  4YON A;  1UNP A;  3FEH A;  4HAV B;  2DX1 A;  4P7I A;  3SYX A;  1OQN A;  1FOE A;  1V5P A;  3NWD A;  4NY0 A;  3SUZ A;  2UZS A;  3DCX A;  2PZ1 A;  2ADZ A;  2UZR A;  3ML4 A;  1UNR A;  4TYZ A;  4GPT B;  1EAZ A;  3TCA A;  2D11 A;  4YL8 A;  4F7U P;  5DHA B;  3ULC A;  2K2U A;  1J0W A;  2DHJ A;  3IVF A;  2COF A;  1V89 A;  4GOU A;  2KIE A;  3HSA A;  5HE3 A;  1MK7 B;  3HK0 A;  2COD A;  2COA A;  2P8V A;  1U29 A;  2M14 A;  1X11 A;  4IFS A;  5LON B;  1Z87 A;  1XOD A;  5C16 A;  1U27 A;  2K00 A;  1NTV A;  5KQ4 A;  2OQB A;  4B6H A;  1ZVR A;  3UZT A;  4H8S A;  2AEH A;  1MKE A;  3B77 A;  4DIX A;  1U5F A;  3PP2 A;  2I5C A;  5C5B A;  1UPR A;  3SNH A;  4DX9 0;  3AU4 A;  1ZC3 B;  1MK9 B;  2AL6 A;  2DLW A;  3CXB B;  2ZKM X;  1GC6 A;  1TQZ A;  2Z59 A;  1PFJ A;  4DXA B;  1NU2 A;  1XKE A;  4F7H A;  5KCV A;  4WSF A;  2ELB A;  2QKL A;  3ODW A;  2DFK A;  5D3Y A;  4EJN A;  2RRF A;  4QJ5 B;  3WYF B;  2Q13 A;  2Y7B A;  1SGH A;  4IOY X;  2YVC A;  5HE2 A;  2MWN B;  5I2M A;  2DYQ A;  2P0H A;  4WVF B;  1WJ1 A;  1ZC4 B;  2W2W A;  1M7R A;  1MIZ B;  1DBH A;  1PMS A;  1EGX A;  1GC7 A;  3QBV B;  2DYN A;  2DTC A;  5LOP B;  1I2H A;  2KGX B;  3A98 B;  5DI9 B;  4TKN A;  3ODX A;  4ZRJ A;  2NZ8 B;  4HAZ B;  5JLJ B;  4XWX A;  1KZ7 A;  5EFX A;  2DKP A;  2DKQ A;  1TXD A;  1E5W A;  1WVH A;  4A5K A;  5D3W A;  3LJU X;  2EMT A;  3SO6 A;  3AU5 A;  1OMW A;  1PLS A;  2I5F A;  2W2X C;  4L6E A;  3BJI A;  1UNQ A;  1WI1 A;  5JHH A;  4CHJ A;  1Q67 A;  3QIJ A;  2KR0 A;  3TO1 A;  4D0N B;  4K17 A;  2Z13 A;  4KHB B;  2R09 A;  2J0M A;  3VIA A;  2GUM A;  2VKI A;  5D27 A;  1I7A A;  5J3Y A;  3A8P A;  1EF1 A;  1Y5O A;  4KAX B;  1M7E A;  3GYP A;  2K2J A;  5JP4 A;  3DXE A;  2J0K A;  3KZ1 A;  1FHX A;  5LG4 B;  1ISN A;  1NI2 A;  2LYD A;  4QXA B;  4L1R A;  4A6H A;  4OSN A;  4KHA A;  4HDO A;  2KCJ A;  3CIK A;  2D10 A;  3FSS A;  4HAY B;  4QJ4 B;  5J3T A;  3DXC A;  1U2B A;  3V5W A;  3NWA A;  3GYO A;  5FI0 A;  4CHM A;  5DIF B;  3F0W A;  1AWE A;  3TVV A;  2D9Z A;  2IYB A;  3KSY A;  3N7C A;  1WJM A;  4DX8 A;  4OT1 A;  2GCL A;  2K8E A;  2CRF A;  2CY4 A;  1H4R A;  1FHW A;  1V61 A;  3PG7 A;  4HAW B;  4HB2 B;  1K5D B;  2LG1 A;  2CY5 A;  1KZG A;  3U7D A;  4ZRK A;  1QC6 A;  3NW8 A;  4CYE A;  3TFM A;  1V5U A;  2LOX A;  2RSG A;  4HAU B;  1WG7 A;  2RVB B;  2YS1 A;  1ZM0 A;  2Z0O A;  2IFS A;  3U12 A;  4HB4 B;  2D4Q A;  3FVC A;  2R0D A;  3MPX A;  2YS3 A;  2YF0 A;  3PSC A;  1DDV A;  2EJ8 A;  1W1D A;  1XR0 B;  3AJ4 A;  1RRP B;  1DDW A;  4A6K A;  5J3Q A;  2RUK B;  2NMB A;  4MT7 A;  3WA0 A;  2J59 M;  5CLL B;  2QKM A;  1U5E A;  3MDB C;  3D8F A;  3NSU A;  3KY9 A;  1BTK A;  1FAO A;  2KUQ A;  1GG3 A;  2ROZ B;  1XCG A;  4BBK A;  2P0F A;  2GCJ A;  2LKO A;  2GS0 A;  5JHG A;  1NTY A;  1T77 A;  2COC A;  3PZD A;  5C6R A;  2Y8G A;  2KUP A;  2L2I A;  3OHM B;  3A8Q A;  3ULB A;  5D3V A;  2FJL A;  4MK0 A;  2ZPY A;  4DBB A;  5HE1 A;  2D2Q A;  2DHK A;  3HQC A;  4GZU A;  1FGZ A;  4Y94 A;  2MKR A;  4A6F A;  1FHO A;  1FB8 A;  2YRY A;  1Y19 B;  4K81 A;  5FI1 A;  2YS5 A;  2EMS A;  4C0A A;  1U5G A;  5DH9 B;  1AQC A;  4Z2M B;  1BWN A;  4K2O A;  3SV1 A;  1QQG A;  2L1C A;  4HDQ A;  3T06 A;  4GN1 A;  3HW2 B;  2I1J A;  1XD4 A;  2KIG A;  2X18 A;  1XX0 A;  4GNK B;  1P5T A;  1UEF A;  2G35 A;  2DHI A;  1EVH A;  2YT0 A;  4HB0 B;  4F7G A;  2DN6 A;  2R2Y A;  3DXD A;  4KVG B;  1DRO A;  5KQ1 A;  4Z2N A;  1V5M A;  1P3R A;  1DYN A;  3PEG A;  4CSQ A;  1WGQ A;  5D3X A;  2Z14 A;  4PQ0 A;  3FM8 C;  2JP2 A;  4GXB A;  3QWM A;  3NWF A;  1OY2 A;  2RGN B;  2MDX A;  2CAY A;  2VRW B;  1LB1 A;  3PVW A;  4EKU A;  4QJ3 B;  2FJU B;  2YT1 A;  3G9W A;  4K2P A;  1TJ6 A;  4ZRI A;  2J0J A;  3O96 A;  2HE7 A;  3D8E A;  1N3H A;  1U5D A;  1B55 A;  1X05 A;  2H7D A;  3PVL A;  5IRS A;  1ZSQ A;  1MIX A;  3ZVR A;  1K5G B;  5I2S A;  3KRX A;  2LUL A;  3KRW A;  1MPH A;  5C79 A;  1J19 A;  5L81 A;  3RCP A;  2GJY A;  5C5B B;  2RLO A;  2N0Y A;  2E2X A;  4HHV A;  2DA0 A;  3HIE A;  1H10 A;  3TW1 A;  2EC1 A;  5HE0 A;  4HB3 B;  3F5R A;  1MAI A;  2BCJ A;  2M38 A;  1SHC A;  2D9Y A;  2Z4D A;  3PVU A;  2W2X D;  2D9V A;  1WGU A;  2I1K A;  4EMO A;  1BAK A;  3VOQ A;  2OTX A;  2N23 A;  1LW3 A;  1W1G A;  4WJ7 A;  3ZDT A;  4D6W A;  1MI1 A;  1RJ2 A;  2D9X A;  3D8D A;  3M1I B;  2XQN M;  2Z0Q A;  2Z0P A;  4HSI A;  5GOW B;  3U8Z A;  3BIN A;  1IRS A;  4MY6 A;  2MFQ A;  4NSW A;  2VSZ A;  5CLQ B;  3A58 A;  2NBV A;  4HAX B;  4PNK A;  3ODO A;  1P6S A;  1DDM A;  2HTH B;  2Y8F A;  1KI1 B;  1X86 A;  2RNR B;  2V76 A;  4KHO A;  4IAP A;  4GMV A;  4HAT B;  1X1G A;  4GMX B;  1ZYI A; 
#chains in the Genus database with same CATH homology
 3P6A A;  4A6F B;  2H7E A;  3P7Z A;  2D9W A;  2P0D A;  1FGY A;  5DHF B;  1V88 A;  1UPQ A;  2ELA A;  2LOZ A;  1W1H A;  3OAN A;  2UVM A;  1X1F A;  2DX5 A;  2YSZ A;  2ROV A;  1BTN A;  3X23 A;  4YON A;  1UNP A;  3FEH A;  4HAV B;  2DX1 A;  4P7I A;  3SYX A;  1OQN A;  1FOE A;  1V5P A;  4NY0 A;  3SUZ A;  2UZS A;  2PZ1 A;  2ADZ A;  2UZR A;  3ML4 A;  1UNR A;  4TYZ A;  4GPT B;  1EAZ A;  3TCA A;  2D11 A;  4YL8 A;  4F7U P;  5DHA B;  3ULC A;  2K2U A;  1J0W A;  2DHJ A;  3IVF A;  2COF A;  1V89 A;  5HE3 A;  1MK7 B;  3HK0 A;  2COD A;  2COA A;  2P8V A;  1U29 A;  2M14 A;  1X11 A;  4IFS A;  5LON B;  1Z87 A;  1XOD A;  5C16 A;  1U27 A;  2K00 A;  1NTV A;  5KQ4 A;  2OQB A;  4B6H A;  1ZVR A;  3UZT A;  4H8S A;  2AEH A;  1MKE A;  1U5F A;  3PP2 A;  2I5C A;  5C5B A;  1UPR A;  3SNH A;  4DX9 0;  3AU4 A;  1ZC3 B;  1MK9 B;  2AL6 A;  2DLW A;  3CXB B;  1GC6 A;  1TQZ A;  1PFJ A;  4DXA B;  1NU2 A;  1XKE A;  4F7H A;  5KCV A;  4WSF A;  2ELB A;  2QKL A;  3ODW A;  2DFK A;  5D3Y A;  4EJN A;  3WYF B;  2Q13 A;  2Y7B A;  1SGH A;  4IOY X;  2YVC A;  5HE2 A;  2MWN B;  2DYQ A;  2P0H A;  4WVF B;  1WJ1 A;  1ZC4 B;  2W2W A;  1M7R A;  1MIZ B;  1DBH A;  1PMS A;  1EGX A;  1GC7 A;  3QBV B;  2DYN A;  2DTC A;  5LOP B;  1I2H A;  2KGX B;  3A98 B;  5DI9 B;  4TKN A;  3ODX A;  4ZRJ A;  2NZ8 B;  4HAZ B;  5JLJ B;  4XWX A;  1KZ7 A;  5EFX A;  2DKP A;  2DKQ A;  1TXD A;  1E5W A;  1WVH A;  4A5K A;  5D3W A;  3LJU X;  2EMT A;  3SO6 A;  3AU5 A;  1OMW A;  1PLS A;  2I5F A;  2W2X C;  4L6E A;  3BJI A;  1UNQ A;  1WI1 A;  5JHH A;  4CHJ A;  1Q67 A;  3QIJ A;  3TO1 A;  4D0N B;  4K17 A;  4KHB B;  2R09 A;  2J0M A;  3VIA A;  2VKI A;  5D27 A;  1I7A A;  5J3Y A;  3A8P A;  1EF1 A;  1Y5O A;  4KAX B;  1M7E A;  3GYP A;  2K2J A;  5JP4 A;  3DXE A;  2J0K A;  3KZ1 A;  1FHX A;  1ISN A;  1NI2 A;  2LYD A;  4A6H A;  4KHA A;  4HDO A;  2KCJ A;  3CIK A;  2D10 A;  3FSS A;  4HAY B;  5J3T A;  3DXC A;  1U2B A;  3V5W A;  3GYO A;  5FI0 A;  4CHM A;  5DIF B;  3F0W A;  1AWE A;  3TVV A;  2D9Z A;  2IYB A;  3KSY A;  3N7C A;  1WJM A;  4DX8 A;  2GCL A;  2CRF A;  2CY4 A;  1H4R A;  1FHW A;  1V61 A;  3PG7 A;  4HAW B;  4HB2 B;  1K5D B;  2LG1 A;  2CY5 A;  1KZG A;  3U7D A;  4ZRK A;  1QC6 A;  4CYE A;  3TFM A;  1V5U A;  2LOX A;  2RSG A;  4HAU B;  1WG7 A;  2RVB B;  2YS1 A;  1ZM0 A;  2Z0O A;  2IFS A;  4HB4 B;  2D4Q A;  2R0D A;  3MPX A;  2YS3 A;  2YF0 A;  3PSC A;  1DDV A;  2EJ8 A;  1W1D A;  1XR0 B;  3AJ4 A;  1RRP B;  1DDW A;  4A6K A;  5J3Q A;  2RUK B;  2NMB A;  4MT7 A;  3WA0 A;  2J59 M;  5CLL B;  2QKM A;  1U5E A;  3MDB C;  3D8F A;  3NSU A;  3KY9 A;  1BTK A;  1FAO A;  1GG3 A;  2ROZ B;  1XCG A;  4BBK A;  2P0F A;  2GCJ A;  2LKO A;  2GS0 A;  5JHG A;  1NTY A;  2COC A;  3PZD A;  5C6R A;  2Y8G A;  2KUP A;  2L2I A;  3A8Q A;  3ULB A;  5D3V A;  2FJL A;  4MK0 A;  2ZPY A;  4DBB A;  5HE1 A;  2D2Q A;  2DHK A;  3HQC A;  4GZU A;  1FGZ A;  4Y94 A;  2MKR A;  4A6F A;  1FHO A;  1FB8 A;  2YRY A;  1Y19 B;  4K81 A;  5FI1 A;  2YS5 A;  2EMS A;  4C0A A;  1U5G A;  5DH9 B;  1AQC A;  4Z2M B;  1BWN A;  4K2O A;  3SV1 A;  1QQG A;  2L1C A;  4HDQ A;  3T06 A;  4GN1 A;  3HW2 B;  2I1J A;  1XD4 A;  2X18 A;  1XX0 A;  1P5T A;  1UEF A;  2G35 A;  2DHI A;  1EVH A;  2YT0 A;  4HB0 B;  4F7G A;  2DN6 A;  3DXD A;  4KVG B;  1DRO A;  5KQ1 A;  4Z2N A;  1V5M A;  1P3R A;  1DYN A;  3PEG A;  1WGQ A;  5D3X A;  4PQ0 A;  3FM8 C;  2JP2 A;  4GXB A;  3QWM A;  1OY2 A;  2RGN B;  2MDX A;  2CAY A;  2VRW B;  1LB1 A;  3PVW A;  4EKU A;  2YT1 A;  3G9W A;  4K2P A;  1TJ6 A;  4ZRI A;  2J0J A;  3O96 A;  2HE7 A;  3D8E A;  1N3H A;  1U5D A;  1B55 A;  1X05 A;  2H7D A;  3PVL A;  1ZSQ A;  1MIX A;  3ZVR A;  1K5G B;  3KRX A;  2LUL A;  3KRW A;  1MPH A;  5C79 A;  1J19 A;  5L81 A;  3RCP A;  2GJY A;  5C5B B;  2RLO A;  2N0Y A;  2E2X A;  4HHV A;  2DA0 A;  1H10 A;  3TW1 A;  2EC1 A;  5HE0 A;  4HB3 B;  3F5R A;  1MAI A;  2BCJ A;  2M38 A;  1SHC A;  2D9Y A;  3PVU A;  2W2X D;  2D9V A;  1WGU A;  2I1K A;  4EMO A;  1BAK A;  3VOQ A;  2OTX A;  2N23 A;  1LW3 A;  1W1G A;  4WJ7 A;  3ZDT A;  1RJ2 A;  2D9X A;  3D8D A;  3M1I B;  2XQN M;  2Z0Q A;  2Z0P A;  5GOW B;  3U8Z A;  3BIN A;  1IRS A;  4MY6 A;  2MFQ A;  4NSW A;  2VSZ A;  5CLQ B;  4HAX B;  4PNK A;  3ODO A;  1P6S A;  1DDM A;  2HTH B;  2Y8F A;  1KI1 B;  1X86 A;  2RNR B;  2V76 A;  4KHO A;  4IAP A;  4GMV A;  4HAT B;  1X1G A;  4GMX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...