4HAYB

Crystal structure of crm1 inhibitor leptomycin b in complex with crm1(k548e,k579q)-ran-ranbp1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
121
structure length
121
Chain Sequence
EEDEEVLYKVRAKLFRFDKDAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/antibiotic
total genus 35
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4hayB00
1X86A 4WJ7A 1DDVA 3TFMA 4DX90 1XCGA 1V5PA 1P5TA 2CY4A 3P6AA 3ODWA 5JHHA 1TJ6A 2DA0A 3TCAA 1BTNA 1AWEA 2J59M 1V5UA 5KQ4A 1NTVA 2GCLA 4CYEA 4HDQA 2W2XC 3FEHA 5DHFB 1XX0A 2D10A 2K00A 2D2QA 1ZM0A 2X18A 4KHAA 2R0DA 5DHAB 2CODA 1TXDA 2AL6A 4GMXB 3HQCA 3MPXA 4WSFA 4MY6A 3U8ZA 5D3YA 1PLSA 2QKLA 5L81A 1FGZA 3A8QA 4GMVA 3ODXA 4F7HA 3SO6A 1H4RA 4HB2B 5DH9B 4HB4B 2YVCA 2UZSA 2MFQA 4HAZB 4NSWA 1MIZB 2M14A 1OQNA 2D9VA 2I1JA 4KHBB 2DFKA 1XR0B 2GJYA 4WVFB 4P7IA 3QBVB 4IOYX 4Z2NA 1EF1A 2DN6A 1XKEA 1M7RA 4CHMA 1EVHA 2FJLA 2J0MA 3PEGA 1U5EA 2RLOA 2YSZA 4HHVA 1QQGA 5D3WA 2D9WA 2DHKA 5JP4A 3NSUA 2EMTA 4MK0A 3ZVRA 2GCJA 4HAWB 2JP2A 4L6EA 3O96A 2Z0QA 4F7UP 1Y5OA 2IFSA 3PZDA 2LYDA 3T06A 4IAPA 2G35A 2K2JA 1FHXA 1FGYA 5C5BB 2YF0A 4HAXB 2D9ZA 2DKQA 2N0YA 4K17A 2PZ1A 4A6HA 3FSSA 1P3RA 2ZPYA 3VIAA 3TO1A 4MT7A 4ZRIA 2I1KA 3AU5A 2R09A 3OANA 1U5FA 3SYXA 2COAA 5J3TA 3BJIA 4KHOA 5KQ1A 3D8DA 2VSZA 5D3VA 4Y94A 2LOZA 2LULA 3F0WA 1H10A 3VOQA 3PVLA 3X23A 4GN1A 2CRFA 4YL8A 1UNPA 1BAKA 5LONB 3PP2A 2M38A 3BINA 2Z0PA 2RSGA 3GYOA 3PG7A 1PMSA 2Q13A 1M7EA 3AU4A 5FI0A 1J0WA 1NTYA 2MWNB 1UPQA 1B55A 5CLLB 1I7AA 4H8SA 1X1GA 3PVWA 1TQZA 2ROVA 1MK7B 4B6HA 2VRWB 4TYZA 1P6SA 2H7EA 3IVFA 5DI9B 5GOWB 5HE0A 3A98B 1EGXA 1MPHA 2MKRA 1K5GB 1NU2A 2DYQA 1IRSA 1W1DA 3TVVA 2YT0A 1UNQA 3LJUX 3P7ZA 2KCJA 1RRPB 5D3XA 1DBHA 3V5WA 3N7CA 1GC6A 1E5WA 1XODA 2YS3A 3SV1A 1MAIA 2OQBA 2L2IA 2DHIA 2NZ8B 2HTHB 2XQNM 2EMSA 1ZSQA 1SGHA 4ZRKA 2DX1A 5HE1A 4GZUA 1V88A 5C79A 1WVHA 1I2HA 4D0NB 2RUKB 4HB3B 3ZDTA 2D4QA 1OY2A 3SNHA 3F5RA 2W2WA 5C16A 4PQ0A 4KVGB 3KZ1A 2KGXB 2DTCA 4KAXB 2P0HA 5FI1A 2P8VA 4BBKA 3ULBA 2L1CA 3KRWA 2E2XA 1FHWA 2ELAA 4HB0B 2UZRA 1KZGA 2CY5A 2Y7BA 3D8EA 4K2PA 4PNKA 1MIXA 2MDXA 3CXBB 4YONA 3ODOA 2LKOA 3QWMA 5HE2A 3ML4A 3SUZA 3U7DA 2YT1A 1ISNA 3PVUA 5D27A 1WJMA 1Z87A 1ZC4B 4Z2MB 3TW1A 5CLQB 2RGNB 2K2UA 4XWXA 1BTKA 4A6FB 4GPTB 1WGQA 3M1IB 2LOXA 2Y8FA 3PSCA 2D9YA 2ROZB 2COFA 2ELBA 3DXCA 3GYPA 3KSYA 4K81A 1DDWA 1NI2A 1DROA 2YS1A 4HAVB 2RNRB 1DYNA 3WA0A 1EAZA 2LG1A 4HAYB 5C6RA 5LOPB 1X1FA 5HE3A 2DKPA 3FM8C 1V89A 2W2XD 2YRYA 2I5CA 4A6FA 5KCVA 1BWNA 1FOEA 3DXDA 1DDMA 1FB8A 2ADZA 1LW3A 2J0JA 2OTXA 2DLWA 2RVBB 3KRXA 2VKIA 4ZRJA 1K5DB 1PFJA 1UPRA 4CHJA 4HATB 1KZ7A 2EC1A 4DXAB 2P0DA 2Y8GA 2H7DA 4TKNA 1GG3A 2N23A 3QIJA 1GC7A 2AEHA 2COCA 1ZVRA 1MK9B 4DBBA 2BCJA 3RCPA 4F7GA 4HDOA 1OMWA 1V5MA 3UZTA 1V61A 1U5GA 3WYFB 1QC6A 5JLJB 1X05A 4NY0A 3A8PA 1J19A 3CIKA 5JHGA 2D9XA 3ULCA 3AJ4A 3DXEA 1FHOA 3HW2B 1WI1A 1W1GA 4DX8A 1LB1A 2I5FA 1WJ1A 1KI1B 2V76A 2IYBA 4A6KA 2P0FA 2DHJA 4EMOA 1XD4A 2KUPA 1MKEA 5DIFB 3KY9A 1X11A 4EJNA 1UEFA 1U2BA 1RJ2A 4K2OA 1W1HA 1WG7A 1U5DA 2DYNA 1ZC3B 2D11A 1U29A 2YS5A 1Y19B 1WGUA 2EJ8A 2UVMA 2GS0A 3G9WA 5J3QA 1FAOA 1UNRA 4EKUA 3D8FA 1AQCA 2QKMA 4C0AA 2Z0OA 4IFSA 2DX5A 3HK0A 4GXBA 2NMBA 5EFXA 1SHCA 2J0KA 1Q67A 3MDBC 2CAYA 4A5KA 1N3HA 1U27A 5J3YA 5C5BA 4HAUB 2HE7A
chains in the Genus database with same CATH superfamily
1X86A 4WJ7A 1DDVA 3TFMA 4DX90 1XCGA 1V5PA 1P5TA 2CY4A 3P6AA 3ODWA 5JHHA 1TJ6A 2R2YA 2DA0A 3TCAA 1BTNA 1AWEA 2J59M 1V5UA 5KQ4A 1NTVA 2GCLA 4CYEA 4HDQA 2W2XC 3FEHA 5DHFB 1XX0A 2D10A 2K00A 2D2QA 1ZM0A 2X18A 4KHAA 2R0DA 5DHAB 2CODA 1TXDA 2AL6A 3NWFA 4GMXB 3NWAA 5M4YB 1MI1A 3HQCA 3MPXA 4WSFA 4MY6A 3U8ZA 5D3YA 1PLSA 2QKLA 5L81A 1FGZA 3A8QA 4GMVA 4L1RA 3ODXA 4F7HA 3SO6A 1H4RA 4HB2B 5DH9B 4HB4B 2YVCA 3NW8A 2UZSA 2MFQA 4HAZB 4NSWA 1MIZB 2M14A 1OQNA 2D9VA 2I1JA 4KHBB 2DFKA 1XR0B 2GJYA 4WVFB 4P7IA 3QBVB 4IOYX 4Z2NA 1EF1A 2DN6A 4DIXA 2K8EA 1XKEA 1M7RA 4CHMA 1EVHA 2FJLA 2J0MA 1U5EA 2RLOA 2YSZA 3PEGA 4HHVA 1QQGA 5D3WA 2D9WA 2DHKA 5JP4A 3NSUA 2EMTA 4MK0A 3ZVRA 4KHBA 2GCJA 4HAWB 2JP2A 4L6EA 3O96A 2Z0QA 4F7UP 1Y5OA 2IFSA 3PZDA 2LYDA 3T06A 4IAPA 2G35A 2K2JA 4OSNA 1FHXA 1FGYA 5C5BB 2YF0A 2YT2A 4HAXB 2D9ZA 2DKQA 2N0YA 4K17A 2PZ1A 4A6HA 3FSSA 1P3RA 2ZPYA 3VIAA 3TO1A 4MT7A 4ZRIA 2I1KA 3AU5A 2R09A 3OANA 1U5FA 1ZYIA 3SYXA 4QJ5B 2COAA 5J3TA 3BJIA 4KHOA 4QJ4B 5KQ1A 3D8DA 2VSZA 5D3VA 4Y94A 2LOZA 2LULA 3OHMB 3F0WA 1H10A 3VOQA 3PVLA 3X23A 4GN1A 2CRFA 3U12A 4YL8A 1UNPA 1BAKA 2NBVA 5LONB 2ZKMX 3PP2A 2M38A 3BINA 2Z0PA 2RSGA 3GYOA 3PG7A 1PMSA 2Q13A 1M7EA 3AU4A 5FI0A 1J0WA 1NTYA 2MWNB 1UPQA 1B55A 5CLLB 1I7AA 4H8SA 1X1GA 3PVWA 1TQZA 2ROVA 1MK7B 4B6HA 2VRWB 4TYZA 1P6SA 2H7EA 3IVFA 5DI9B 5GOWB 5HE0A 3A98B 1EGXA 2RRFA 1MPHA 2MKRA 1K5GB 1NU2A 2DYQA 1IRSA 1W1DA 3TVVA 2YT0A 5IRSA 1UNQA 3LJUX 3P7ZA 2KCJA 1RRPB 5D3XA 1DBHA 2Z4DA 3V5WA 3N7CA 1GC6A 1E5WA 1XODA 2YS3A 2KIEA 3SV1A 1MAIA 2OQBA 2L2IA 2DHIA 2NZ8B 2FJUB 2HTHB 2XQNM 3FVCA 2EMSA 1ZSQA 1SGHA 4ZRKA 2DX1A 5HE1A 4GZUA 1V88A 5C79A 3A58A 1WVHA 1I2HA 4D0NB 2RUKB 4HB3B 4QJ3B 3ZDTA 2D4QA 1OY2A 3SNHA 3F5RA 2W2WA 5C16A 4PQ0A 4KVGB 3KZ1A 2KGXB 4D6WA 2KIGA 2DTCA 4KAXB 2P0HA 5FI1A 3NWDA 2P8VA 4BBKA 3ULBA 2L1CA 3KRWA 2E2XA 1FHWA 2ELAA 4HB0B 3DCXA 2UZRA 1KZGA 2CY5A 2Y7BA 3B77A 3D8EA 4K2PA 4PNKA 1MIXA 2MDXA 4GOUA 5I2SA 3CXBB 4YONA 4CSQA 3ODOA 2LKOA 3QWMA 5HE2A 3ML4A 3SUZA 3U7DA 2YT1A 1ISNA 3PVUA 2Z59A 5D27A 1WJMA 1Z87A 1ZC4B 4Z2MB 3TW1A 5CLQB 2RGNB 2K2UA 4XWXA 1BTKA 4A6FB 4GPTB 1WGQA 3M1IB 2LOXA 2Y8FA 3PSCA 2D9YA 2ROZB 2COFA 2ELBA 2K49A 3DXCA 3GYPA 3KSYA 4K81A 1DDWA 1NI2A 1DROA 2YS1A 4HAVB 2RNRB 1DYNA 3WA0A 1EAZA 2LG1A 4HAYB 4OT1A 5C6RA 5LOPB 1X1FA 5HE3A 2DKPA 3FM8C 4HSIA 1V89A 2W2XD 2YRYA 2I5CA 4A6FA 5KCVA 1BWNA 1FOEA 3DXDA 1DDMA 1FB8A 2ADZA 1LW3A 2Z13A 2J0JA 2OTXA 2DLWA 2RVBB 3KRXA 2VKIA 4ZRJA 1K5DB 1PFJA 1UPRA 4CHJA 4HATB 1KZ7A 2EC1A 4DXAB 2P0DA 2Y8GA 2H7DA 4TKNA 1GG3A 2N23A 3QIJA 1GC7A 2AEHA 2COCA 1ZVRA 1MK9B 4DBBA 2BCJA 3RCPA 4F7GA 4HDOA 1OMWA 1T77A 1V5MA 3UZTA 1V61A 1U5GA 3WYFB 1QC6A 5JLJB 1X05A 4NY0A 3A8PA 1J19A 3CIKA 5JHGA 2D9XA 3ULCA 3AJ4A 3DXEA 1FHOA 3HW2B 1WI1A 1W1GA 4DX8A 1LB1A 2I5FA 1WJ1A 2GUMA 1KI1B 2V76A 2IYBA 4A6KA 4GNKB 2P0FA 2DHJA 4EMOA 1XD4A 2KUPA 3HSAA 1MKEA 5DIFB 3KY9A 1X11A 4EJNA 1UEFA 1U2BA 1RJ2A 4K2OA 1W1HA 1WG7A 1U5DA 2DYNA 1ZC3B 2D11A 1U29A 4QXAB 2YS5A 1Y19B 1WGUA 2KUQA 2EJ8A 2UVMA 2GS0A 3G9WA 5J3QA 1FAOA 1UNRA 4EKUA 5LG4B 3HIEA 2KR0A 5I2MA 3D8FA 1AQCA 2QKMA 4C0AA 2Z0OA 4IFSA 2DX5A 3HK0A 4GXBA 2NMBA 5EFXA 1SHCA 2J0KA 1Q67A 3MDBC 2CAYA 2Z14A 4A5KA 1N3HA 1U27A 5J3YA 5C5BA 4HAUB 2HE7A
chains in the Genus database with same CATH topology
1X86A 4WJ7A 1DDVA 3TFMA 4DX90 1XCGA 1V5PA 1P5TA 2CY4A 3P6AA 3ODWA 5JHHA 1TJ6A 2DA0A 3TCAA 1BTNA 1AWEA 2J59M 1V5UA 5KQ4A 1NTVA 2GCLA 4CYEA 4HDQA 2W2XC 3FEHA 5DHFB 1XX0A 2D10A 2K00A 2D2QA 1ZM0A 2X18A 4KHAA 2R0DA 5DHAB 2CODA 1TXDA 2AL6A 4GMXB 3HQCA 3MPXA 4WSFA 4MY6A 3U8ZA 5D3YA 1PLSA 2QKLA 5L81A 1FGZA 3A8QA 4GMVA 3ODXA 4F7HA 3SO6A 1H4RA 4HB2B 5DH9B 4HB4B 2YVCA 2UZSA 2MFQA 4HAZB 4NSWA 1MIZB 2M14A 1OQNA 2D9VA 2I1JA 4KHBB 2DFKA 1XR0B 2GJYA 4WVFB 4P7IA 3QBVB 4IOYX 4Z2NA 1EF1A 2DN6A 1XKEA 1M7RA 4CHMA 1EVHA 2FJLA 2J0MA 3PEGA 1U5EA 2RLOA 2YSZA 4HHVA 1QQGA 5D3WA 2D9WA 2DHKA 5JP4A 3NSUA 2EMTA 4MK0A 3ZVRA 2GCJA 4HAWB 2JP2A 4L6EA 3O96A 2Z0QA 4F7UP 1Y5OA 2IFSA 3PZDA 2LYDA 3T06A 4IAPA 2G35A 2K2JA 1FHXA 1FGYA 5C5BB 2YF0A 4HAXB 2D9ZA 2DKQA 2N0YA 4K17A 2PZ1A 4A6HA 3FSSA 1P3RA 2ZPYA 3VIAA 3TO1A 4MT7A 4ZRIA 2I1KA 3AU5A 2R09A 3OANA 1U5FA 3SYXA 2COAA 5J3TA 3BJIA 4KHOA 5KQ1A 3D8DA 2VSZA 5D3VA 4Y94A 2LOZA 2LULA 3F0WA 1H10A 3VOQA 3PVLA 3X23A 4GN1A 2CRFA 4YL8A 1UNPA 1BAKA 5LONB 3PP2A 2M38A 3BINA 2Z0PA 2RSGA 3GYOA 3PG7A 1PMSA 2Q13A 1M7EA 3AU4A 5FI0A 1J0WA 1NTYA 2MWNB 1UPQA 1B55A 5CLLB 1I7AA 4H8SA 1X1GA 3PVWA 1TQZA 2ROVA 1MK7B 4B6HA 2VRWB 4TYZA 1P6SA 2H7EA 3IVFA 5DI9B 5GOWB 5HE0A 3A98B 1EGXA 1MPHA 2MKRA 1K5GB 1NU2A 2DYQA 1IRSA 1W1DA 3TVVA 2YT0A 1UNQA 3LJUX 3P7ZA 2KCJA 1RRPB 5D3XA 1DBHA 3V5WA 3N7CA 1GC6A 1E5WA 1XODA 2YS3A 3SV1A 1MAIA 2OQBA 2L2IA 2DHIA 2NZ8B 2HTHB 2XQNM 2EMSA 1ZSQA 1SGHA 4ZRKA 2DX1A 5HE1A 4GZUA 1V88A 5C79A 1WVHA 1I2HA 4D0NB 2RUKB 4HB3B 3ZDTA 2D4QA 1OY2A 3SNHA 3F5RA 2W2WA 5C16A 4PQ0A 4KVGB 3KZ1A 2KGXB 2DTCA 4KAXB 2P0HA 5FI1A 2P8VA 4BBKA 3ULBA 2L1CA 3KRWA 2E2XA 1FHWA 2ELAA 4HB0B 2UZRA 1KZGA 2CY5A 2Y7BA 3D8EA 4K2PA 4PNKA 1MIXA 2MDXA 3CXBB 4YONA 3ODOA 2LKOA 3QWMA 5HE2A 3ML4A 3SUZA 3U7DA 2YT1A 1ISNA 3PVUA 5D27A 1WJMA 1Z87A 1ZC4B 4Z2MB 3TW1A 5CLQB 2RGNB 2K2UA 4XWXA 1BTKA 4A6FB 4GPTB 1WGQA 3M1IB 2LOXA 2Y8FA 3PSCA 2D9YA 2ROZB 2COFA 2ELBA 3DXCA 3GYPA 3KSYA 4K81A 1DDWA 1NI2A 1DROA 2YS1A 4HAVB 2RNRB 1DYNA 3WA0A 1EAZA 2LG1A 4HAYB 5C6RA 5LOPB 1X1FA 5HE3A 2DKPA 3FM8C 1V89A 2W2XD 2YRYA 2I5CA 4A6FA 5KCVA 1BWNA 1FOEA 3DXDA 1DDMA 1FB8A 2ADZA 1LW3A 2J0JA 2OTXA 2DLWA 2RVBB 3KRXA 2VKIA 4ZRJA 1K5DB 1PFJA 1UPRA 4CHJA 4HATB 1KZ7A 2EC1A 4DXAB 2P0DA 2Y8GA 2H7DA 4TKNA 1GG3A 2N23A 3QIJA 1GC7A 2AEHA 2COCA 1ZVRA 1MK9B 4DBBA 2BCJA 3RCPA 4F7GA 4HDOA 1OMWA 1V5MA 3UZTA 1V61A 1U5GA 3WYFB 1QC6A 5JLJB 1X05A 4NY0A 3A8PA 1J19A 3CIKA 5JHGA 2D9XA 3ULCA 3AJ4A 3DXEA 1FHOA 3HW2B 1WI1A 1W1GA 4DX8A 1LB1A 2I5FA 1WJ1A 1KI1B 2V76A 2IYBA 4A6KA 2P0FA 2DHJA 4EMOA 1XD4A 2KUPA 1MKEA 5DIFB 3KY9A 1X11A 4EJNA 1UEFA 1U2BA 1RJ2A 4K2OA 1W1HA 1WG7A 1U5DA 2DYNA 1ZC3B 2D11A 1U29A 2YS5A 1Y19B 1WGUA 2EJ8A 2UVMA 2GS0A 3G9WA 5J3QA 1FAOA 1UNRA 4EKUA 3D8FA 1AQCA 2QKMA 4C0AA 2Z0OA 4IFSA 2DX5A 3HK0A 4GXBA 2NMBA 5EFXA 1SHCA 2J0KA 1Q67A 3MDBC 2CAYA 4A5KA 1N3HA 1U27A 5J3YA 5C5BA 4HAUB 2HE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X86 A;  4WJ7 A;  1DDV A;  3TFM A;  4DX9 0;  1XCG A;  1V5P A;  1P5T A;  2CY4 A;  3P6A A;  3ODW A;  5JHH A;  1TJ6 A;  2DA0 A;  3TCA A;  1BTN A;  1AWE A;  2J59 M;  1V5U A;  5KQ4 A;  1NTV A;  2GCL A;  4CYE A;  4HDQ A;  2W2X C;  3FEH A;  5DHF B;  1XX0 A;  2D10 A;  2K00 A;  2D2Q A;  1ZM0 A;  2X18 A;  4KHA A;  2R0D A;  5DHA B;  2COD A;  1TXD A;  2AL6 A;  4GMX B;  3HQC A;  3MPX A;  4WSF A;  4MY6 A;  3U8Z A;  5D3Y A;  1PLS A;  2QKL A;  5L81 A;  1FGZ A;  3A8Q A;  4GMV A;  3ODX A;  4F7H A;  3SO6 A;  1H4R A;  4HB2 B;  5DH9 B;  4HB4 B;  2YVC A;  2UZS A;  2MFQ A;  4HAZ B;  4NSW A;  1MIZ B;  2M14 A;  1OQN A;  2D9V A;  2I1J A;  4KHB B;  2DFK A;  1XR0 B;  2GJY A;  4WVF B;  4P7I A;  3QBV B;  4IOY X;  4Z2N A;  1EF1 A;  2DN6 A;  1XKE A;  1M7R A;  4CHM A;  1EVH A;  2FJL A;  2J0M A;  3PEG A;  1U5E A;  2RLO A;  2YSZ A;  4HHV A;  1QQG A;  5D3W A;  2D9W A;  2DHK A;  5JP4 A;  3NSU A;  2EMT A;  4MK0 A;  3ZVR A;  2GCJ A;  4HAW B;  2JP2 A;  4L6E A;  3O96 A;  2Z0Q A;  4F7U P;  1Y5O A;  2IFS A;  3PZD A;  2LYD A;  3T06 A;  4IAP A;  2G35 A;  2K2J A;  1FHX A;  1FGY A;  5C5B B;  2YF0 A;  4HAX B;  2D9Z A;  2DKQ A;  2N0Y A;  4K17 A;  2PZ1 A;  4A6H A;  3FSS A;  1P3R A;  2ZPY A;  3VIA A;  3TO1 A;  4MT7 A;  4ZRI A;  2I1K A;  3AU5 A;  2R09 A;  3OAN A;  1U5F A;  3SYX A;  2COA A;  5J3T A;  3BJI A;  4KHO A;  5KQ1 A;  3D8D A;  2VSZ A;  5D3V A;  4Y94 A;  2LOZ A;  2LUL A;  3F0W A;  1H10 A;  3VOQ A;  3PVL A;  3X23 A;  4GN1 A;  2CRF A;  4YL8 A;  1UNP A;  1BAK A;  5LON B;  3PP2 A;  2M38 A;  3BIN A;  2Z0P A;  2RSG A;  3GYO A;  3PG7 A;  1PMS A;  2Q13 A;  1M7E A;  3AU4 A;  5FI0 A;  1J0W A;  1NTY A;  2MWN B;  1UPQ A;  1B55 A;  5CLL B;  1I7A A;  4H8S A;  1X1G A;  3PVW A;  1TQZ A;  2ROV A;  1MK7 B;  4B6H A;  2VRW B;  4TYZ A;  1P6S A;  2H7E A;  3IVF A;  5DI9 B;  5GOW B;  5HE0 A;  3A98 B;  1EGX A;  1MPH A;  2MKR A;  1K5G B;  1NU2 A;  2DYQ A;  1IRS A;  1W1D A;  3TVV A;  2YT0 A;  1UNQ A;  3LJU X;  3P7Z A;  2KCJ A;  1RRP B;  5D3X A;  1DBH A;  3V5W A;  3N7C A;  1GC6 A;  1E5W A;  1XOD A;  2YS3 A;  3SV1 A;  1MAI A;  2OQB A;  2L2I A;  2DHI A;  2NZ8 B;  2HTH B;  2XQN M;  2EMS A;  1ZSQ A;  1SGH A;  4ZRK A;  2DX1 A;  5HE1 A;  4GZU A;  1V88 A;  5C79 A;  1WVH A;  1I2H A;  4D0N B;  2RUK B;  4HB3 B;  3ZDT A;  2D4Q A;  1OY2 A;  3SNH A;  3F5R A;  2W2W A;  5C16 A;  4PQ0 A;  4KVG B;  3KZ1 A;  2KGX B;  2DTC A;  4KAX B;  2P0H A;  5FI1 A;  2P8V A;  4BBK A;  3ULB A;  2L1C A;  3KRW A;  2E2X A;  1FHW A;  2ELA A;  4HB0 B;  2UZR A;  1KZG A;  2CY5 A;  2Y7B A;  3D8E A;  4K2P A;  4PNK A;  1MIX A;  2MDX A;  3CXB B;  4YON A;  3ODO A;  2LKO A;  3QWM A;  5HE2 A;  3ML4 A;  3SUZ A;  3U7D A;  2YT1 A;  1ISN A;  3PVU A;  5D27 A;  1WJM A;  1Z87 A;  1ZC4 B;  4Z2M B;  3TW1 A;  5CLQ B;  2RGN B;  2K2U A;  4XWX A;  1BTK A;  4A6F B;  4GPT B;  1WGQ A;  3M1I B;  2LOX A;  2Y8F A;  3PSC A;  2D9Y A;  2ROZ B;  2COF A;  2ELB A;  3DXC A;  3GYP A;  3KSY A;  4K81 A;  1DDW A;  1NI2 A;  1DRO A;  2YS1 A;  4HAV B;  2RNR B;  1DYN A;  3WA0 A;  1EAZ A;  2LG1 A;  4HAY B;  5C6R A;  5LOP B;  1X1F A;  5HE3 A;  2DKP A;  3FM8 C;  1V89 A;  2W2X D;  2YRY A;  2I5C A;  4A6F A;  5KCV A;  1BWN A;  1FOE A;  3DXD A;  1DDM A;  1FB8 A;  2ADZ A;  1LW3 A;  2J0J A;  2OTX A;  2DLW A;  2RVB B;  3KRX A;  2VKI A;  4ZRJ A;  1K5D B;  1PFJ A;  1UPR A;  4CHJ A;  4HAT B;  1KZ7 A;  2EC1 A;  4DXA B;  2P0D A;  2Y8G A;  2H7D A;  4TKN A;  1GG3 A;  2N23 A;  3QIJ A;  1GC7 A;  2AEH A;  2COC A;  1ZVR A;  1MK9 B;  4DBB A;  2BCJ A;  3RCP A;  4F7G A;  4HDO A;  1OMW A;  1V5M A;  3UZT A;  1V61 A;  1U5G A;  3WYF B;  1QC6 A;  5JLJ B;  1X05 A;  4NY0 A;  3A8P A;  1J19 A;  3CIK A;  5JHG A;  2D9X A;  3ULC A;  3AJ4 A;  3DXE A;  1FHO A;  3HW2 B;  1WI1 A;  1W1G A;  4DX8 A;  1LB1 A;  2I5F A;  1WJ1 A;  1KI1 B;  2V76 A;  2IYB A;  4A6K A;  2P0F A;  2DHJ A;  4EMO A;  1XD4 A;  2KUP A;  1MKE A;  5DIF B;  3KY9 A;  1X11 A;  4EJN A;  1UEF A;  1U2B A;  1RJ2 A;  4K2O A;  1W1H A;  1WG7 A;  1U5D A;  2DYN A;  1ZC3 B;  2D11 A;  1U29 A;  2YS5 A;  1Y19 B;  1WGU A;  2EJ8 A;  2UVM A;  2GS0 A;  3G9W A;  5J3Q A;  1FAO A;  1UNR A;  4EKU A;  3D8F A;  1AQC A;  2QKM A;  4C0A A;  2Z0O A;  4IFS A;  2DX5 A;  3HK0 A;  4GXB A;  2NMB A;  5EFX A;  1SHC A;  2J0K A;  1Q67 A;  3MDB C;  2CAY A;  4A5K A;  1N3H A;  1U27 A;  5J3Y A;  5C5B A;  4HAU B;  2HE7 A; 
#chains in the Genus database with same CATH topology
 1X86 A;  4WJ7 A;  1DDV A;  3TFM A;  4DX9 0;  1XCG A;  1V5P A;  1P5T A;  2CY4 A;  3P6A A;  3ODW A;  5JHH A;  1TJ6 A;  2R2Y A;  2DA0 A;  3TCA A;  1BTN A;  1AWE A;  2J59 M;  1V5U A;  5KQ4 A;  1NTV A;  2GCL A;  4CYE A;  4HDQ A;  2W2X C;  3FEH A;  5DHF B;  1XX0 A;  2D10 A;  2K00 A;  2D2Q A;  1ZM0 A;  2X18 A;  4KHA A;  2R0D A;  5DHA B;  2COD A;  1TXD A;  2AL6 A;  3NWF A;  4GMX B;  3NWA A;  5M4Y B;  1MI1 A;  3HQC A;  3MPX A;  4WSF A;  4MY6 A;  3U8Z A;  5D3Y A;  1PLS A;  2QKL A;  5L81 A;  1FGZ A;  3A8Q A;  4GMV A;  4L1R A;  3ODX A;  4F7H A;  3SO6 A;  1H4R A;  4HB2 B;  5DH9 B;  4HB4 B;  2YVC A;  3NW8 A;  2UZS A;  2MFQ A;  4HAZ B;  4NSW A;  1MIZ B;  2M14 A;  1OQN A;  2D9V A;  2I1J A;  4KHB B;  2DFK A;  1XR0 B;  2GJY A;  4WVF B;  4P7I A;  3QBV B;  4IOY X;  4Z2N A;  1EF1 A;  2DN6 A;  4DIX A;  2K8E A;  1XKE A;  1M7R A;  4CHM A;  1EVH A;  2FJL A;  2J0M A;  1U5E A;  2RLO A;  2YSZ A;  3PEG A;  4HHV A;  1QQG A;  5D3W A;  2D9W A;  2DHK A;  5JP4 A;  3NSU A;  2EMT A;  4MK0 A;  3ZVR A;  4KHB A;  2GCJ A;  4HAW B;  2JP2 A;  4L6E A;  3O96 A;  2Z0Q A;  4F7U P;  1Y5O A;  2IFS A;  3PZD A;  2LYD A;  3T06 A;  4IAP A;  2G35 A;  2K2J A;  4OSN A;  1FHX A;  1FGY A;  5C5B B;  2YF0 A;  2YT2 A;  4HAX B;  2D9Z A;  2DKQ A;  2N0Y A;  4K17 A;  2PZ1 A;  4A6H A;  3FSS A;  1P3R A;  2ZPY A;  3VIA A;  3TO1 A;  4MT7 A;  4ZRI A;  2I1K A;  3AU5 A;  2R09 A;  3OAN A;  1U5F A;  1ZYI A;  3SYX A;  4QJ5 B;  2COA A;  5J3T A;  3BJI A;  4KHO A;  4QJ4 B;  5KQ1 A;  3D8D A;  2VSZ A;  5D3V A;  4Y94 A;  2LOZ A;  2LUL A;  3OHM B;  3F0W A;  1H10 A;  3VOQ A;  3PVL A;  3X23 A;  4GN1 A;  2CRF A;  3U12 A;  4YL8 A;  1UNP A;  1BAK A;  2NBV A;  5LON B;  2ZKM X;  3PP2 A;  2M38 A;  3BIN A;  2Z0P A;  2RSG A;  3GYO A;  3PG7 A;  1PMS A;  2Q13 A;  1M7E A;  3AU4 A;  5FI0 A;  1J0W A;  1NTY A;  2MWN B;  1UPQ A;  1B55 A;  5CLL B;  1I7A A;  4H8S A;  1X1G A;  3PVW A;  1TQZ A;  2ROV A;  1MK7 B;  4B6H A;  2VRW B;  4TYZ A;  1P6S A;  2H7E A;  3IVF A;  5DI9 B;  5GOW B;  5HE0 A;  3A98 B;  1EGX A;  2RRF A;  1MPH A;  2MKR A;  1K5G B;  1NU2 A;  2DYQ A;  1IRS A;  1W1D A;  3TVV A;  2YT0 A;  5IRS A;  1UNQ A;  3LJU X;  3P7Z A;  2KCJ A;  1RRP B;  5D3X A;  1DBH A;  2Z4D A;  3V5W A;  3N7C A;  1GC6 A;  1E5W A;  1XOD A;  2YS3 A;  2KIE A;  3SV1 A;  1MAI A;  2OQB A;  2L2I A;  2DHI A;  2NZ8 B;  2FJU B;  2HTH B;  2XQN M;  3FVC A;  2EMS A;  1ZSQ A;  1SGH A;  4ZRK A;  2DX1 A;  5HE1 A;  4GZU A;  1V88 A;  5C79 A;  3A58 A;  1WVH A;  1I2H A;  4D0N B;  2RUK B;  4HB3 B;  4QJ3 B;  3ZDT A;  2D4Q A;  1OY2 A;  3SNH A;  3F5R A;  2W2W A;  5C16 A;  4PQ0 A;  4KVG B;  3KZ1 A;  2KGX B;  4D6W A;  2KIG A;  2DTC A;  4KAX B;  2P0H A;  5FI1 A;  3NWD A;  2P8V A;  4BBK A;  3ULB A;  2L1C A;  3KRW A;  2E2X A;  1FHW A;  2ELA A;  4HB0 B;  3DCX A;  2UZR A;  1KZG A;  2CY5 A;  2Y7B A;  3B77 A;  3D8E A;  4K2P A;  4PNK A;  1MIX A;  2MDX A;  4GOU A;  5I2S A;  3CXB B;  4YON A;  4CSQ A;  3ODO A;  2LKO A;  3QWM A;  5HE2 A;  3ML4 A;  3SUZ A;  3U7D A;  2YT1 A;  1ISN A;  3PVU A;  2Z59 A;  5D27 A;  1WJM A;  1Z87 A;  1ZC4 B;  4Z2M B;  3TW1 A;  5CLQ B;  2RGN B;  2K2U A;  4XWX A;  1BTK A;  4A6F B;  4GPT B;  1WGQ A;  3M1I B;  2LOX A;  2Y8F A;  3PSC A;  2D9Y A;  2ROZ B;  2COF A;  2ELB A;  2K49 A;  3DXC A;  3GYP A;  3KSY A;  4K81 A;  1DDW A;  1NI2 A;  1DRO A;  2YS1 A;  4HAV B;  2RNR B;  1DYN A;  3WA0 A;  1EAZ A;  2LG1 A;  4HAY B;  4OT1 A;  5C6R A;  5LOP B;  1X1F A;  5HE3 A;  2DKP A;  3FM8 C;  4HSI A;  1V89 A;  2W2X D;  2YRY A;  2I5C A;  4A6F A;  5KCV A;  1BWN A;  1FOE A;  3DXD A;  1DDM A;  1FB8 A;  2ADZ A;  1LW3 A;  2Z13 A;  2J0J A;  2OTX A;  2DLW A;  2RVB B;  3KRX A;  2VKI A;  4ZRJ A;  1K5D B;  1PFJ A;  1UPR A;  4CHJ A;  4HAT B;  1KZ7 A;  2EC1 A;  4DXA B;  2P0D A;  2Y8G A;  2H7D A;  4TKN A;  1GG3 A;  2N23 A;  3QIJ A;  1GC7 A;  2AEH A;  2COC A;  1ZVR A;  1MK9 B;  4DBB A;  2BCJ A;  3RCP A;  4F7G A;  4HDO A;  1OMW A;  1T77 A;  1V5M A;  3UZT A;  1V61 A;  1U5G A;  3WYF B;  1QC6 A;  5JLJ B;  1X05 A;  4NY0 A;  3A8P A;  1J19 A;  3CIK A;  5JHG A;  2D9X A;  3ULC A;  3AJ4 A;  3DXE A;  1FHO A;  3HW2 B;  1WI1 A;  1W1G A;  4DX8 A;  1LB1 A;  2I5F A;  1WJ1 A;  2GUM A;  1KI1 B;  2V76 A;  2IYB A;  4A6K A;  4GNK B;  2P0F A;  2DHJ A;  4EMO A;  1XD4 A;  2KUP A;  3HSA A;  1MKE A;  5DIF B;  3KY9 A;  1X11 A;  4EJN A;  1UEF A;  1U2B A;  1RJ2 A;  4K2O A;  1W1H A;  1WG7 A;  1U5D A;  2DYN A;  1ZC3 B;  2D11 A;  1U29 A;  4QXA B;  2YS5 A;  1Y19 B;  1WGU A;  2KUQ A;  2EJ8 A;  2UVM A;  2GS0 A;  3G9W A;  5J3Q A;  1FAO A;  1UNR A;  4EKU A;  5LG4 B;  3HIE A;  2KR0 A;  5I2M A;  3D8F A;  1AQC A;  2QKM A;  4C0A A;  2Z0O A;  4IFS A;  2DX5 A;  3HK0 A;  4GXB A;  2NMB A;  5EFX A;  1SHC A;  2J0K A;  1Q67 A;  3MDB C;  2CAY A;  2Z14 A;  4A5K A;  1N3H A;  1U27 A;  5J3Y A;  5C5B A;  4HAU B;  2HE7 A; 
#chains in the Genus database with same CATH homology
 1X86 A;  4WJ7 A;  1DDV A;  3TFM A;  4DX9 0;  1XCG A;  1V5P A;  1P5T A;  2CY4 A;  3P6A A;  3ODW A;  5JHH A;  1TJ6 A;  2DA0 A;  3TCA A;  1BTN A;  1AWE A;  2J59 M;  1V5U A;  5KQ4 A;  1NTV A;  2GCL A;  4CYE A;  4HDQ A;  2W2X C;  3FEH A;  5DHF B;  1XX0 A;  2D10 A;  2K00 A;  2D2Q A;  1ZM0 A;  2X18 A;  4KHA A;  2R0D A;  5DHA B;  2COD A;  1TXD A;  2AL6 A;  4GMX B;  3HQC A;  3MPX A;  4WSF A;  4MY6 A;  3U8Z A;  5D3Y A;  1PLS A;  2QKL A;  5L81 A;  1FGZ A;  3A8Q A;  4GMV A;  3ODX A;  4F7H A;  3SO6 A;  1H4R A;  4HB2 B;  5DH9 B;  4HB4 B;  2YVC A;  2UZS A;  2MFQ A;  4HAZ B;  4NSW A;  1MIZ B;  2M14 A;  1OQN A;  2D9V A;  2I1J A;  4KHB B;  2DFK A;  1XR0 B;  2GJY A;  4WVF B;  4P7I A;  3QBV B;  4IOY X;  4Z2N A;  1EF1 A;  2DN6 A;  1XKE A;  1M7R A;  4CHM A;  1EVH A;  2FJL A;  2J0M A;  3PEG A;  1U5E A;  2RLO A;  2YSZ A;  4HHV A;  1QQG A;  5D3W A;  2D9W A;  2DHK A;  5JP4 A;  3NSU A;  2EMT A;  4MK0 A;  3ZVR A;  2GCJ A;  4HAW B;  2JP2 A;  4L6E A;  3O96 A;  2Z0Q A;  4F7U P;  1Y5O A;  2IFS A;  3PZD A;  2LYD A;  3T06 A;  4IAP A;  2G35 A;  2K2J A;  1FHX A;  1FGY A;  5C5B B;  2YF0 A;  4HAX B;  2D9Z A;  2DKQ A;  2N0Y A;  4K17 A;  2PZ1 A;  4A6H A;  3FSS A;  1P3R A;  2ZPY A;  3VIA A;  3TO1 A;  4MT7 A;  4ZRI A;  2I1K A;  3AU5 A;  2R09 A;  3OAN A;  1U5F A;  3SYX A;  2COA A;  5J3T A;  3BJI A;  4KHO A;  5KQ1 A;  3D8D A;  2VSZ A;  5D3V A;  4Y94 A;  2LOZ A;  2LUL A;  3F0W A;  1H10 A;  3VOQ A;  3PVL A;  3X23 A;  4GN1 A;  2CRF A;  4YL8 A;  1UNP A;  1BAK A;  5LON B;  3PP2 A;  2M38 A;  3BIN A;  2Z0P A;  2RSG A;  3GYO A;  3PG7 A;  1PMS A;  2Q13 A;  1M7E A;  3AU4 A;  5FI0 A;  1J0W A;  1NTY A;  2MWN B;  1UPQ A;  1B55 A;  5CLL B;  1I7A A;  4H8S A;  1X1G A;  3PVW A;  1TQZ A;  2ROV A;  1MK7 B;  4B6H A;  2VRW B;  4TYZ A;  1P6S A;  2H7E A;  3IVF A;  5DI9 B;  5GOW B;  5HE0 A;  3A98 B;  1EGX A;  1MPH A;  2MKR A;  1K5G B;  1NU2 A;  2DYQ A;  1IRS A;  1W1D A;  3TVV A;  2YT0 A;  1UNQ A;  3LJU X;  3P7Z A;  2KCJ A;  1RRP B;  5D3X A;  1DBH A;  3V5W A;  3N7C A;  1GC6 A;  1E5W A;  1XOD A;  2YS3 A;  3SV1 A;  1MAI A;  2OQB A;  2L2I A;  2DHI A;  2NZ8 B;  2HTH B;  2XQN M;  2EMS A;  1ZSQ A;  1SGH A;  4ZRK A;  2DX1 A;  5HE1 A;  4GZU A;  1V88 A;  5C79 A;  1WVH A;  1I2H A;  4D0N B;  2RUK B;  4HB3 B;  3ZDT A;  2D4Q A;  1OY2 A;  3SNH A;  3F5R A;  2W2W A;  5C16 A;  4PQ0 A;  4KVG B;  3KZ1 A;  2KGX B;  2DTC A;  4KAX B;  2P0H A;  5FI1 A;  2P8V A;  4BBK A;  3ULB A;  2L1C A;  3KRW A;  2E2X A;  1FHW A;  2ELA A;  4HB0 B;  2UZR A;  1KZG A;  2CY5 A;  2Y7B A;  3D8E A;  4K2P A;  4PNK A;  1MIX A;  2MDX A;  3CXB B;  4YON A;  3ODO A;  2LKO A;  3QWM A;  5HE2 A;  3ML4 A;  3SUZ A;  3U7D A;  2YT1 A;  1ISN A;  3PVU A;  5D27 A;  1WJM A;  1Z87 A;  1ZC4 B;  4Z2M B;  3TW1 A;  5CLQ B;  2RGN B;  2K2U A;  4XWX A;  1BTK A;  4A6F B;  4GPT B;  1WGQ A;  3M1I B;  2LOX A;  2Y8F A;  3PSC A;  2D9Y A;  2ROZ B;  2COF A;  2ELB A;  3DXC A;  3GYP A;  3KSY A;  4K81 A;  1DDW A;  1NI2 A;  1DRO A;  2YS1 A;  4HAV B;  2RNR B;  1DYN A;  3WA0 A;  1EAZ A;  2LG1 A;  4HAY B;  5C6R A;  5LOP B;  1X1F A;  5HE3 A;  2DKP A;  3FM8 C;  1V89 A;  2W2X D;  2YRY A;  2I5C A;  4A6F A;  5KCV A;  1BWN A;  1FOE A;  3DXD A;  1DDM A;  1FB8 A;  2ADZ A;  1LW3 A;  2J0J A;  2OTX A;  2DLW A;  2RVB B;  3KRX A;  2VKI A;  4ZRJ A;  1K5D B;  1PFJ A;  1UPR A;  4CHJ A;  4HAT B;  1KZ7 A;  2EC1 A;  4DXA B;  2P0D A;  2Y8G A;  2H7D A;  4TKN A;  1GG3 A;  2N23 A;  3QIJ A;  1GC7 A;  2AEH A;  2COC A;  1ZVR A;  1MK9 B;  4DBB A;  2BCJ A;  3RCP A;  4F7G A;  4HDO A;  1OMW A;  1V5M A;  3UZT A;  1V61 A;  1U5G A;  3WYF B;  1QC6 A;  5JLJ B;  1X05 A;  4NY0 A;  3A8P A;  1J19 A;  3CIK A;  5JHG A;  2D9X A;  3ULC A;  3AJ4 A;  3DXE A;  1FHO A;  3HW2 B;  1WI1 A;  1W1G A;  4DX8 A;  1LB1 A;  2I5F A;  1WJ1 A;  1KI1 B;  2V76 A;  2IYB A;  4A6K A;  2P0F A;  2DHJ A;  4EMO A;  1XD4 A;  2KUP A;  1MKE A;  5DIF B;  3KY9 A;  1X11 A;  4EJN A;  1UEF A;  1U2B A;  1RJ2 A;  4K2O A;  1W1H A;  1WG7 A;  1U5D A;  2DYN A;  1ZC3 B;  2D11 A;  1U29 A;  2YS5 A;  1Y19 B;  1WGU A;  2EJ8 A;  2UVM A;  2GS0 A;  3G9W A;  5J3Q A;  1FAO A;  1UNR A;  4EKU A;  3D8F A;  1AQC A;  2QKM A;  4C0A A;  2Z0O A;  4IFS A;  2DX5 A;  3HK0 A;  4GXB A;  2NMB A;  5EFX A;  1SHC A;  2J0K A;  1Q67 A;  3MDB C;  2CAY A;  4A5K A;  1N3H A;  1U27 A;  5J3Y A;  5C5B A;  4HAU B;  2HE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...