4HAYB

Crystal structure of crm1 inhibitor leptomycin b in complex with crm1(k548e,k579q)-ran-ranbp1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
121
structure length
121
Chain Sequence
b'EEDEEVLYKVRAKLFRFDKDAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
molecule tags Protein transport/antibiotic
source organism Homo sapiens
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
total genus 35
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4hayB00
2YRYA 2H7DA 2RSGA 4HAXB 3PP2A 5EFXA 3MPXA 5CLQB 3PVLA 2HE7A 3ML4A 1XR0B 5L81A 3X23A 1ZC3B 1Y5OA 2D4QA 1MK9B 5GOWB 1V88A 4HAVB 3BJIA 4CYEA 2NMBA 4ZRJA 3SUZA 1EF1A 4WVFB 2COCA 1PLSA 2DKPA 3SO6A 2LOZA 5JLJB 2UZSA 3CXBB 1WI1A 4GMXB 4KHOA 1KZGA 5DIFB 4HB0B 1NTYA 4EJNA 4F7UP 5DHFB 5CLLB 1XODA 1H4RA 2LOXA 2CODA 2OTXA 4GMVA 4A6FA 2EC1A 1LB1A 1UNQA 1QQGA 2RGNB 3QBVB 4HAZB 2E2XA 5DHAB 5LONB 4MT7A 2N0YA 4Z2MB 2YT0A 1UNPA 2EMTA 3ODWA 2Z0PA 2CY4A 5KCVA 1SGHA 1FHWA 3ULCA 1DROA 2D9VA 3O96A 2M14A 4HB4B 4KVGB 2LULA 1DDMA 2Z0QA 2YS1A 1Y19B 2YSZA 5J3YA 2KCJA 5FI0A 2GS0A 1J19A 2P8VA 3TCAA 3A8PA 2DLWA 3ODOA 2KUPA 1GC7A 1NI2A 1EAZA 4GZUA 2DHJA 2COAA 4EKUA 4ZRIA 2Y7BA 2GJYA 5C5BB 3QWMA 2EJ8A 1W1DA 1W1HA 1ZM0A 5DI9B 1V89A 4L6EA 2DN6A 1GC6A 2VKIA 4Z2NA 1OY2A 1U5FA 1ZVRA 5DH9B 2D9ZA 1WGQA 1ZSQA 4GN1A 2AEHA 2J0MA 2LYDA 3KRWA 1B55A 2ADZA 3ODXA 1W1GA 3P7ZA 1FGZA 2RLOA 2OQBA 3P6AA 2V76A 2NZ8B 3CIKA 4HAWB 2YVCA 2YS3A 4Y94A 2DA0A 2P0HA 1V5UA 4DBBA 4DXAB 2MFQA 1OMWA 1P5TA 2D11A 3SYXA 3PZDA 1H10A 2MKRA 4DX8A 4WJ7A 5J3QA 2DYNA 3DXDA 4IAPA 1WVHA 1V5PA 2I1JA 1SHCA 3FM8C 5KQ1A 1EVHA 1FHXA 1XCGA 2ELAA 1UNRA 2RUKB 4HDQA 2EMSA 1ZC4B 2MDXA 3TW1A 5C6RA 3TO1A 2COFA 1RJ2A 1FB8A 3MDBC 5D3YA 5C5BA 1P6SA 4PQ0A 1LW3A 2QKMA 3HW2B 2DX1A 3GYOA 5C79A 4F7GA 3SNHA 5FI1A 2L1CA 3FEHA 3ULBA 1E5WA 1MIXA 1V61A 4K81A 4C0AA 2ZPYA 1MPHA 4NY0A 1M7RA 1X86A 3LJUX 2H7EA 2DHIA 4YL8A 4GPTB 2P0FA 1N3HA 2QKLA 1DDVA 1I7AA 2HTHB 2I5FA 3BINA 3AU5A 4B6HA 1TQZA 1X1GA 1Q67A 3A8QA 4A6KA 5J3TA 1M7EA 2DFKA 4HDOA 2J0JA 3V5WA 1WJMA 3F5RA 4HB2B 2IYBA 3KRXA 4DX90 1DYNA 2GCJA 5HE1A 4TKNA 2LKOA 1X1FA 1XX0A 3GYPA 2CY5A 3NSUA 1FAOA 3RCPA 3A98B 1BAKA 5HE2A 3ZDTA 4IOYX 4CHJA 2CAYA 1U5GA 1PMSA 2R0DA 2RVBB 2YF0A 1X05A 4H8SA 1WGUA 1PFJA 2VSZA 1U2BA 3HK0A 2M38A 1BWNA 1MIZB 2W2XC 1MAIA 3IVFA 1KZ7A 1TXDA 1RRPB 2DYQA 2YT1A 2UZRA 4HHVA 4HAYB 2D9YA 2K2JA 2KGXB 3HQCA 2DX5A 3DXCA 3ZVRA 1J0WA 3OANA 3KY9A 1AQCA 2VRWB 3U7DA 4A6HA 3VIAA 2JP2A 2W2XD 4XWXA 3KSYA 2I5CA 1DDWA 4EMOA 3D8EA 2Y8FA 4K2PA 1TJ6A 1K5DB 1U5DA 3PVUA 2CRFA 3D8DA 4PNKA 1XKEA 1QC6A 4WSFA 5LOPB 3SV1A 2K2UA 3TFMA 4ZRKA 1EGXA 2ROVA 1UPQA 3N7CA 4TYZA 1UEFA 3U8ZA 2Z0OA 2R09A 2X18A 1NTVA 5C16A 2DHKA 1FGYA 2AL6A 2N23A 2I1KA 2J59M 2D10A 4P7IA 2D9WA 5JP4A 4CHMA 2Q13A 3PEGA 1WG7A 2RNRB 1DBHA 2XQNM 4K17A 5JHGA 3UZTA 4HATB 5HE0A 2W2WA 5JHHA 1GG3A 3TVVA 4NSWA 2ROZB 5HE3A 2P0DA 1XD4A 4KHBB 5D3XA 4D0NB 2IFSA 1BTKA 5D27A 4IFSA 2BCJA 2L2IA 1K5GB 5KQ4A 2FJLA 4K2OA 2YS5A 4YONA 2Y8GA 4A6FB 3VOQA 1V5MA 1BTNA 3D8FA 2G35A 1FHOA 3PVWA 1P3RA 4HAUB 4F7HA 1NU2A 4MY6A 4BBKA 1AWEA 2UVMA 4HB3B 1MK7B 3FSSA 3F0WA 4A5KA 1WJ1A 3PSCA 2ELBA 3T06A 2GCLA 3AU4A 1U27A 3DXEA 2MWNB 1MKEA 3AJ4A 4MK0A 1I2HA 2J0KA 2LG1A 4KAXB 4GXBA 2PZ1A 3G9WA 3KZ1A 2K00A 5D3VA 1U5EA 3M1IB 1FOEA 1Z87A 3WA0A 2D9XA 2DKQA 1ISNA 1X11A 2DTCA 1KI1B 5D3WA 4KHAA 3PG7A 1OQNA 3WYFB 1U29A 1IRSA 1UPRA 2D2QA 3QIJA
chains in the Genus database with same CATH superfamily
2YRYA 2H7DA 2RSGA 4HAXB 3PP2A 5EFXA 3MPXA 5CLQB 3PVLA 2HE7A 3FVCA 3ML4A 1XR0B 5L81A 3X23A 1ZC3B 1Y5OA 2D4QA 1MK9B 5GOWB 1V88A 4HAVB 3BJIA 4CYEA 4DIXA 2NMBA 4ZRJA 3SUZA 1EF1A 2Z4DA 4WVFB 2COCA 1PLSA 2DKPA 3SO6A 2LOZA 5JLJB 2UZSA 3CXBB 1WI1A 4GMXB 4KHOA 1KZGA 5DIFB 3NWAA 3NWDA 4HB0B 1NTYA 4QJ5B 4EJNA 4F7UP 5DHFB 4OSNA 5CLLB 1XODA 1H4RA 2LOXA 2CODA 2OTXA 2YT2A 4GMVA 4GOUA 4A6FA 2EC1A 1LB1A 1UNQA 1QQGA 2RGNB 3QBVB 4HAZB 2E2XA 5DHAB 5LONB 4MT7A 2N0YA 4Z2MB 4L1RA 2YT0A 1UNPA 2EMTA 3ODWA 2Z0PA 2CY4A 5KCVA 1SGHA 1FHWA 3ULCA 1DROA 2D9VA 3O96A 2M14A 4HB4B 4KVGB 2LULA 1DDMA 2Z0QA 2YS1A 2Z59A 1Y19B 2YSZA 5J3YA 2KCJA 5FI0A 2GS0A 1J19A 2P8VA 3TCAA 3A8PA 2DLWA 3ODOA 2KUPA 1GC7A 1NI2A 1EAZA 4GZUA 2DHJA 2COAA 4EKUA 2KR0A 4ZRIA 2Y7BA 5I2SA 2GJYA 4KHBA 5C5BB 3QWMA 2EJ8A 1W1DA 1W1HA 1ZM0A 5DI9B 1V89A 4L6EA 3A58A 2DN6A 1GC6A 2VKIA 4Z2NA 1OY2A 1U5FA 1ZVRA 5DH9B 2KIGA 2D9ZA 1WGQA 1ZSQA 4GN1A 4QJ4B 2AEHA 2J0MA 2LYDA 3KRWA 1B55A 2ADZA 3ODXA 1W1GA 3P7ZA 1FGZA 2RLOA 2OQBA 3P6AA 2V76A 2NZ8B 3CIKA 4HAWB 2YVCA 2YS3A 2Z14A 4Y94A 2DA0A 2P0HA 1V5UA 4DBBA 4DXAB 2MFQA 1OMWA 1P5TA 2D11A 3SYXA 3PZDA 1H10A 2MKRA 4DX8A 4WJ7A 5J3QA 2DYNA 3DXDA 4IAPA 1WVHA 1V5PA 4CSQA 2I1JA 1SHCA 3FM8C 5KQ1A 1EVHA 4D6WA 1FHXA 1XCGA 2ELAA 1UNRA 2RUKB 4HDQA 2EMSA 1ZC4B 2MDXA 3TW1A 5C6RA 3TO1A 2COFA 1RJ2A 1FB8A 3MDBC 5D3YA 5C5BA 4OT1A 1P6SA 4PQ0A 1LW3A 2QKMA 3HW2B 2DX1A 4GNKB 3GYOA 5C79A 4F7GA 3SNHA 5FI1A 2L1CA 3FEHA 3ULBA 1E5WA 1MIXA 1V61A 4K81A 4C0AA 2ZPYA 1MPHA 4NY0A 1M7RA 1X86A 3LJUX 2H7EA 2DHIA 4YL8A 4GPTB 2P0FA 1N3HA 2QKLA 1DDVA 1I7AA 2HTHB 2I5FA 3BINA 3AU5A 4B6HA 1TQZA 1X1GA 1Q67A 3A8QA 4A6KA 5J3TA 1M7EA 2DFKA 2NBVA 4HDOA 2J0JA 3V5WA 1WJMA 3F5RA 4QXAB 4HB2B 2IYBA 3KRXA 4DX90 1DYNA 2GCJA 5HE1A 4TKNA 2LKOA 1X1FA 1XX0A 3GYPA 3HIEA 2CY5A 3NSUA 1FAOA 3RCPA 4QJ3B 3A98B 1BAKA 5HE2A 3ZDTA 4IOYX 4CHJA 2CAYA 5IRSA 1U5GA 1PMSA 2R0DA 2RVBB 2YF0A 1X05A 4H8SA 1WGUA 1PFJA 2VSZA 1U2BA 3HK0A 2M38A 1BWNA 1MIZB 2W2XC 1MAIA 5M4YB 3IVFA 1KZ7A 1TXDA 1RRPB 2DYQA 2YT1A 2K49A 2UZRA 4HHVA 4HSIA 4HAYB 2D9YA 2K2JA 2KGXB 3HQCA 2RRFA 1ZYIA 2DX5A 3DXCA 3ZVRA 1J0WA 3OANA 3KY9A 1AQCA 2VRWB 3HSAA 3U7DA 4A6HA 3VIAA 2JP2A 2W2XD 4XWXA 3KSYA 2I5CA 1DDWA 2R2YA 4EMOA 3D8EA 2Y8FA 4K2PA 1TJ6A 1K5DB 3B77A 1U5DA 3PVUA 3NWFA 2CRFA 3D8DA 4PNKA 1XKEA 1QC6A 4WSFA 5LOPB 3OHMB 3SV1A 2K2UA 3TFMA 4ZRKA 1EGXA 2Z13A 2ROVA 1UPQA 3N7CA 4TYZA 1UEFA 3U8ZA 2Z0OA 2R09A 2X18A 1NTVA 5C16A 2DHKA 1FGYA 2AL6A 2N23A 2I1KA 2J59M 2D10A 2KIEA 5I2MA 4P7IA 2D9WA 5JP4A 5LG4B 4CHMA 2Q13A 3PEGA 1WG7A 2RNRB 1DBHA 3NW8A 2XQNM 4K17A 5JHGA 3UZTA 4HATB 5HE0A 2W2WA 5JHHA 1GG3A 3TVVA 4NSWA 2K8EA 2ROZB 5HE3A 2P0DA 1XD4A 4KHBB 5D3XA 4D0NB 2IFSA 1BTKA 5D27A 4IFSA 2BCJA 2L2IA 1K5GB 5KQ4A 2FJLA 2GUMA 4K2OA 2YS5A 4YONA 2Y8GA 4A6FB 1MI1A 3VOQA 1V5MA 1BTNA 3D8FA 2G35A 1FHOA 3PVWA 1P3RA 4HAUB 4F7HA 1NU2A 4MY6A 4BBKA 1AWEA 1T77A 2UVMA 4HB3B 1MK7B 3FSSA 3F0WA 4A5KA 2FJUB 1WJ1A 3PSCA 2ELBA 3T06A 2GCLA 3AU4A 1U27A 3DXEA 2MWNB 1MKEA 3AJ4A 4MK0A 1I2HA 2J0KA 2LG1A 3DCXA 4GXBA 2PZ1A 4KAXB 2KUQA 3G9WA 3KZ1A 2K00A 5D3VA 1U5EA 3M1IB 1FOEA 1Z87A 3WA0A 2ZKMX 2D9XA 2DKQA 1ISNA 1X11A 2DTCA 1KI1B 5D3WA 4KHAA 3PG7A 1OQNA 3WYFB 3U12A 1U29A 1IRSA 1UPRA 2D2QA 3QIJA
chains in the Genus database with same CATH topology
2YRYA 2H7DA 2RSGA 4HAXB 3PP2A 5EFXA 3MPXA 5CLQB 3PVLA 2HE7A 3ML4A 1XR0B 5L81A 3X23A 1ZC3B 1Y5OA 2D4QA 1MK9B 5GOWB 1V88A 4HAVB 3BJIA 4CYEA 2NMBA 4ZRJA 3SUZA 1EF1A 4WVFB 2COCA 1PLSA 2DKPA 3SO6A 2LOZA 5JLJB 2UZSA 3CXBB 1WI1A 4GMXB 4KHOA 1KZGA 5DIFB 4HB0B 1NTYA 4EJNA 4F7UP 5DHFB 5CLLB 1XODA 1H4RA 2LOXA 2CODA 2OTXA 4GMVA 4A6FA 2EC1A 1LB1A 1UNQA 1QQGA 2RGNB 3QBVB 4HAZB 2E2XA 5DHAB 5LONB 4MT7A 2N0YA 4Z2MB 2YT0A 1UNPA 2EMTA 3ODWA 2Z0PA 2CY4A 5KCVA 1SGHA 1FHWA 3ULCA 1DROA 2D9VA 3O96A 2M14A 4HB4B 4KVGB 2LULA 1DDMA 2Z0QA 2YS1A 1Y19B 2YSZA 5J3YA 2KCJA 5FI0A 2GS0A 1J19A 2P8VA 3TCAA 3A8PA 2DLWA 3ODOA 2KUPA 1GC7A 1NI2A 1EAZA 4GZUA 2DHJA 2COAA 4EKUA 4ZRIA 2Y7BA 2GJYA 5C5BB 3QWMA 2EJ8A 1W1DA 1W1HA 1ZM0A 5DI9B 1V89A 4L6EA 2DN6A 1GC6A 2VKIA 4Z2NA 1OY2A 1U5FA 1ZVRA 5DH9B 2D9ZA 1WGQA 1ZSQA 4GN1A 2AEHA 2J0MA 2LYDA 3KRWA 1B55A 2ADZA 3ODXA 1W1GA 3P7ZA 1FGZA 2RLOA 2OQBA 3P6AA 2V76A 2NZ8B 3CIKA 4HAWB 2YVCA 2YS3A 4Y94A 2DA0A 2P0HA 1V5UA 4DBBA 4DXAB 2MFQA 1OMWA 1P5TA 2D11A 3SYXA 3PZDA 1H10A 2MKRA 4DX8A 4WJ7A 5J3QA 2DYNA 3DXDA 4IAPA 1WVHA 1V5PA 2I1JA 1SHCA 3FM8C 5KQ1A 1EVHA 1FHXA 1XCGA 2ELAA 1UNRA 2RUKB 4HDQA 2EMSA 1ZC4B 2MDXA 3TW1A 5C6RA 3TO1A 2COFA 1RJ2A 1FB8A 3MDBC 5D3YA 5C5BA 1P6SA 4PQ0A 1LW3A 2QKMA 3HW2B 2DX1A 3GYOA 5C79A 4F7GA 3SNHA 5FI1A 2L1CA 3FEHA 3ULBA 1E5WA 1MIXA 1V61A 4K81A 4C0AA 2ZPYA 1MPHA 4NY0A 1M7RA 1X86A 3LJUX 2H7EA 2DHIA 4YL8A 4GPTB 2P0FA 1N3HA 2QKLA 1DDVA 1I7AA 2HTHB 2I5FA 3BINA 3AU5A 4B6HA 1TQZA 1X1GA 1Q67A 3A8QA 4A6KA 5J3TA 1M7EA 2DFKA 4HDOA 2J0JA 3V5WA 1WJMA 3F5RA 4HB2B 2IYBA 3KRXA 4DX90 1DYNA 2GCJA 5HE1A 4TKNA 2LKOA 1X1FA 1XX0A 3GYPA 2CY5A 3NSUA 1FAOA 3RCPA 3A98B 1BAKA 5HE2A 3ZDTA 4IOYX 4CHJA 2CAYA 1U5GA 1PMSA 2R0DA 2RVBB 2YF0A 1X05A 4H8SA 1WGUA 1PFJA 2VSZA 1U2BA 3HK0A 2M38A 1BWNA 1MIZB 2W2XC 1MAIA 3IVFA 1KZ7A 1TXDA 1RRPB 2DYQA 2YT1A 2UZRA 4HHVA 4HAYB 2D9YA 2K2JA 2KGXB 3HQCA 2DX5A 3DXCA 3ZVRA 1J0WA 3OANA 3KY9A 1AQCA 2VRWB 3U7DA 4A6HA 3VIAA 2JP2A 2W2XD 4XWXA 3KSYA 2I5CA 1DDWA 4EMOA 3D8EA 2Y8FA 4K2PA 1TJ6A 1K5DB 1U5DA 3PVUA 2CRFA 3D8DA 4PNKA 1XKEA 1QC6A 4WSFA 5LOPB 3SV1A 2K2UA 3TFMA 4ZRKA 1EGXA 2ROVA 1UPQA 3N7CA 4TYZA 1UEFA 3U8ZA 2Z0OA 2R09A 2X18A 1NTVA 5C16A 2DHKA 1FGYA 2AL6A 2N23A 2I1KA 2J59M 2D10A 4P7IA 2D9WA 5JP4A 4CHMA 2Q13A 3PEGA 1WG7A 2RNRB 1DBHA 2XQNM 4K17A 5JHGA 3UZTA 4HATB 5HE0A 2W2WA 5JHHA 1GG3A 3TVVA 4NSWA 2ROZB 5HE3A 2P0DA 1XD4A 4KHBB 5D3XA 4D0NB 2IFSA 1BTKA 5D27A 4IFSA 2BCJA 2L2IA 1K5GB 5KQ4A 2FJLA 4K2OA 2YS5A 4YONA 2Y8GA 4A6FB 3VOQA 1V5MA 1BTNA 3D8FA 2G35A 1FHOA 3PVWA 1P3RA 4HAUB 4F7HA 1NU2A 4MY6A 4BBKA 1AWEA 2UVMA 4HB3B 1MK7B 3FSSA 3F0WA 4A5KA 1WJ1A 3PSCA 2ELBA 3T06A 2GCLA 3AU4A 1U27A 3DXEA 2MWNB 1MKEA 3AJ4A 4MK0A 1I2HA 2J0KA 2LG1A 4KAXB 4GXBA 2PZ1A 3G9WA 3KZ1A 2K00A 5D3VA 1U5EA 3M1IB 1FOEA 1Z87A 3WA0A 2D9XA 2DKQA 1ISNA 1X11A 2DTCA 1KI1B 5D3WA 4KHAA 3PG7A 1OQNA 3WYFB 1U29A 1IRSA 1UPRA 2D2QA 3QIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YRY A;  2H7D A;  2RSG A;  4HAX B;  3PP2 A;  5EFX A;  3MPX A;  5CLQ B;  3PVL A;  2HE7 A;  3ML4 A;  1XR0 B;  5L81 A;  3X23 A;  1ZC3 B;  1Y5O A;  2D4Q A;  1MK9 B;  5GOW B;  1V88 A;  4HAV B;  3BJI A;  4CYE A;  2NMB A;  4ZRJ A;  3SUZ A;  1EF1 A;  4WVF B;  2COC A;  1PLS A;  2DKP A;  3SO6 A;  2LOZ A;  5JLJ B;  2UZS A;  3CXB B;  1WI1 A;  4GMX B;  4KHO A;  1KZG A;  5DIF B;  4HB0 B;  1NTY A;  4EJN A;  4F7U P;  5DHF B;  5CLL B;  1XOD A;  1H4R A;  2LOX A;  2COD A;  2OTX A;  4GMV A;  4A6F A;  2EC1 A;  1LB1 A;  1UNQ A;  1QQG A;  2RGN B;  3QBV B;  4HAZ B;  2E2X A;  5DHA B;  5LON B;  4MT7 A;  2N0Y A;  4Z2M B;  2YT0 A;  1UNP A;  2EMT A;  3ODW A;  2Z0P A;  2CY4 A;  5KCV A;  1SGH A;  1FHW A;  3ULC A;  1DRO A;  2D9V A;  3O96 A;  2M14 A;  4HB4 B;  4KVG B;  2LUL A;  1DDM A;  2Z0Q A;  2YS1 A;  1Y19 B;  2YSZ A;  5J3Y A;  2KCJ A;  5FI0 A;  2GS0 A;  1J19 A;  2P8V A;  3TCA A;  3A8P A;  2DLW A;  3ODO A;  2KUP A;  1GC7 A;  1NI2 A;  1EAZ A;  4GZU A;  2DHJ A;  2COA A;  4EKU A;  4ZRI A;  2Y7B A;  2GJY A;  5C5B B;  3QWM A;  2EJ8 A;  1W1D A;  1W1H A;  1ZM0 A;  5DI9 B;  1V89 A;  4L6E A;  2DN6 A;  1GC6 A;  2VKI A;  4Z2N A;  1OY2 A;  1U5F A;  1ZVR A;  5DH9 B;  2D9Z A;  1WGQ A;  1ZSQ A;  4GN1 A;  2AEH A;  2J0M A;  2LYD A;  3KRW A;  1B55 A;  2ADZ A;  3ODX A;  1W1G A;  3P7Z A;  1FGZ A;  2RLO A;  2OQB A;  3P6A A;  2V76 A;  2NZ8 B;  3CIK A;  4HAW B;  2YVC A;  2YS3 A;  4Y94 A;  2DA0 A;  2P0H A;  1V5U A;  4DBB A;  4DXA B;  2MFQ A;  1OMW A;  1P5T A;  2D11 A;  3SYX A;  3PZD A;  1H10 A;  2MKR A;  4DX8 A;  4WJ7 A;  5J3Q A;  2DYN A;  3DXD A;  4IAP A;  1WVH A;  1V5P A;  2I1J A;  1SHC A;  3FM8 C;  5KQ1 A;  1EVH A;  1FHX A;  1XCG A;  2ELA A;  1UNR A;  2RUK B;  4HDQ A;  2EMS A;  1ZC4 B;  2MDX A;  3TW1 A;  5C6R A;  3TO1 A;  2COF A;  1RJ2 A;  1FB8 A;  3MDB C;  5D3Y A;  5C5B A;  1P6S A;  4PQ0 A;  1LW3 A;  2QKM A;  3HW2 B;  2DX1 A;  3GYO A;  5C79 A;  4F7G A;  3SNH A;  5FI1 A;  2L1C A;  3FEH A;  3ULB A;  1E5W A;  1MIX A;  1V61 A;  4K81 A;  4C0A A;  2ZPY A;  1MPH A;  4NY0 A;  1M7R A;  1X86 A;  3LJU X;  2H7E A;  2DHI A;  4YL8 A;  4GPT B;  2P0F A;  1N3H A;  2QKL A;  1DDV A;  1I7A A;  2HTH B;  2I5F A;  3BIN A;  3AU5 A;  4B6H A;  1TQZ A;  1X1G A;  1Q67 A;  3A8Q A;  4A6K A;  5J3T A;  1M7E A;  2DFK A;  4HDO A;  2J0J A;  3V5W A;  1WJM A;  3F5R A;  4HB2 B;  2IYB A;  3KRX A;  4DX9 0;  1DYN A;  2GCJ A;  5HE1 A;  4TKN A;  2LKO A;  1X1F A;  1XX0 A;  3GYP A;  2CY5 A;  3NSU A;  1FAO A;  3RCP A;  3A98 B;  1BAK A;  5HE2 A;  3ZDT A;  4IOY X;  4CHJ A;  2CAY A;  1U5G A;  1PMS A;  2R0D A;  2RVB B;  2YF0 A;  1X05 A;  4H8S A;  1WGU A;  1PFJ A;  2VSZ A;  1U2B A;  3HK0 A;  2M38 A;  1BWN A;  1MIZ B;  2W2X C;  1MAI A;  3IVF A;  1KZ7 A;  1TXD A;  1RRP B;  2DYQ A;  2YT1 A;  2UZR A;  4HHV A;  4HAY B;  2D9Y A;  2K2J A;  2KGX B;  3HQC A;  2DX5 A;  3DXC A;  3ZVR A;  1J0W A;  3OAN A;  3KY9 A;  1AQC A;  2VRW B;  3U7D A;  4A6H A;  3VIA A;  2JP2 A;  2W2X D;  4XWX A;  3KSY A;  2I5C A;  1DDW A;  4EMO A;  3D8E A;  2Y8F A;  4K2P A;  1TJ6 A;  1K5D B;  1U5D A;  3PVU A;  2CRF A;  3D8D A;  4PNK A;  1XKE A;  1QC6 A;  4WSF A;  5LOP B;  3SV1 A;  2K2U A;  3TFM A;  4ZRK A;  1EGX A;  2ROV A;  1UPQ A;  3N7C A;  4TYZ A;  1UEF A;  3U8Z A;  2Z0O A;  2R09 A;  2X18 A;  1NTV A;  5C16 A;  2DHK A;  1FGY A;  2AL6 A;  2N23 A;  2I1K A;  2J59 M;  2D10 A;  4P7I A;  2D9W A;  5JP4 A;  4CHM A;  2Q13 A;  3PEG A;  1WG7 A;  2RNR B;  1DBH A;  2XQN M;  4K17 A;  5JHG A;  3UZT A;  4HAT B;  5HE0 A;  2W2W A;  5JHH A;  1GG3 A;  3TVV A;  4NSW A;  2ROZ B;  5HE3 A;  2P0D A;  1XD4 A;  4KHB B;  5D3X A;  4D0N B;  2IFS A;  1BTK A;  5D27 A;  4IFS A;  2BCJ A;  2L2I A;  1K5G B;  5KQ4 A;  2FJL A;  4K2O A;  2YS5 A;  4YON A;  2Y8G A;  4A6F B;  3VOQ A;  1V5M A;  1BTN A;  3D8F A;  2G35 A;  1FHO A;  3PVW A;  1P3R A;  4HAU B;  4F7H A;  1NU2 A;  4MY6 A;  4BBK A;  1AWE A;  2UVM A;  4HB3 B;  1MK7 B;  3FSS A;  3F0W A;  4A5K A;  1WJ1 A;  3PSC A;  2ELB A;  3T06 A;  2GCL A;  3AU4 A;  1U27 A;  3DXE A;  2MWN B;  1MKE A;  3AJ4 A;  4MK0 A;  1I2H A;  2J0K A;  2LG1 A;  4KAX B;  4GXB A;  2PZ1 A;  3G9W A;  3KZ1 A;  2K00 A;  5D3V A;  1U5E A;  3M1I B;  1FOE A;  1Z87 A;  3WA0 A;  2D9X A;  2DKQ A;  1ISN A;  1X11 A;  2DTC A;  1KI1 B;  5D3W A;  4KHA A;  3PG7 A;  1OQN A;  3WYF B;  1U29 A;  1IRS A;  1UPR A;  2D2Q A;  3QIJ A; 
#chains in the Genus database with same CATH topology
 2YRY A;  2H7D A;  2RSG A;  4HAX B;  3PP2 A;  5EFX A;  3MPX A;  5CLQ B;  3PVL A;  2HE7 A;  3FVC A;  3ML4 A;  1XR0 B;  5L81 A;  3X23 A;  1ZC3 B;  1Y5O A;  2D4Q A;  1MK9 B;  5GOW B;  1V88 A;  4HAV B;  3BJI A;  4CYE A;  4DIX A;  2NMB A;  4ZRJ A;  3SUZ A;  1EF1 A;  2Z4D A;  4WVF B;  2COC A;  1PLS A;  2DKP A;  3SO6 A;  2LOZ A;  5JLJ B;  2UZS A;  3CXB B;  1WI1 A;  4GMX B;  4KHO A;  1KZG A;  5DIF B;  3NWA A;  3NWD A;  4HB0 B;  1NTY A;  4QJ5 B;  4EJN A;  4F7U P;  5DHF B;  4OSN A;  5CLL B;  1XOD A;  1H4R A;  2LOX A;  2COD A;  2OTX A;  2YT2 A;  4GMV A;  4GOU A;  4A6F A;  2EC1 A;  1LB1 A;  1UNQ A;  1QQG A;  2RGN B;  3QBV B;  4HAZ B;  2E2X A;  5DHA B;  5LON B;  4MT7 A;  2N0Y A;  4Z2M B;  4L1R A;  2YT0 A;  1UNP A;  2EMT A;  3ODW A;  2Z0P A;  2CY4 A;  5KCV A;  1SGH A;  1FHW A;  3ULC A;  1DRO A;  2D9V A;  3O96 A;  2M14 A;  4HB4 B;  4KVG B;  2LUL A;  1DDM A;  2Z0Q A;  2YS1 A;  2Z59 A;  1Y19 B;  2YSZ A;  5J3Y A;  2KCJ A;  5FI0 A;  2GS0 A;  1J19 A;  2P8V A;  3TCA A;  3A8P A;  2DLW A;  3ODO A;  2KUP A;  1GC7 A;  1NI2 A;  1EAZ A;  4GZU A;  2DHJ A;  2COA A;  4EKU A;  2KR0 A;  4ZRI A;  2Y7B A;  5I2S A;  2GJY A;  4KHB A;  5C5B B;  3QWM A;  2EJ8 A;  1W1D A;  1W1H A;  1ZM0 A;  5DI9 B;  1V89 A;  4L6E A;  3A58 A;  2DN6 A;  1GC6 A;  2VKI A;  4Z2N A;  1OY2 A;  1U5F A;  1ZVR A;  5DH9 B;  2KIG A;  2D9Z A;  1WGQ A;  1ZSQ A;  4GN1 A;  4QJ4 B;  2AEH A;  2J0M A;  2LYD A;  3KRW A;  1B55 A;  2ADZ A;  3ODX A;  1W1G A;  3P7Z A;  1FGZ A;  2RLO A;  2OQB A;  3P6A A;  2V76 A;  2NZ8 B;  3CIK A;  4HAW B;  2YVC A;  2YS3 A;  2Z14 A;  4Y94 A;  2DA0 A;  2P0H A;  1V5U A;  4DBB A;  4DXA B;  2MFQ A;  1OMW A;  1P5T A;  2D11 A;  3SYX A;  3PZD A;  1H10 A;  2MKR A;  4DX8 A;  4WJ7 A;  5J3Q A;  2DYN A;  3DXD A;  4IAP A;  1WVH A;  1V5P A;  4CSQ A;  2I1J A;  1SHC A;  3FM8 C;  5KQ1 A;  1EVH A;  4D6W A;  1FHX A;  1XCG A;  2ELA A;  1UNR A;  2RUK B;  4HDQ A;  2EMS A;  1ZC4 B;  2MDX A;  3TW1 A;  5C6R A;  3TO1 A;  2COF A;  1RJ2 A;  1FB8 A;  3MDB C;  5D3Y A;  5C5B A;  4OT1 A;  1P6S A;  4PQ0 A;  1LW3 A;  2QKM A;  3HW2 B;  2DX1 A;  4GNK B;  3GYO A;  5C79 A;  4F7G A;  3SNH A;  5FI1 A;  2L1C A;  3FEH A;  3ULB A;  1E5W A;  1MIX A;  1V61 A;  4K81 A;  4C0A A;  2ZPY A;  1MPH A;  4NY0 A;  1M7R A;  1X86 A;  3LJU X;  2H7E A;  2DHI A;  4YL8 A;  4GPT B;  2P0F A;  1N3H A;  2QKL A;  1DDV A;  1I7A A;  2HTH B;  2I5F A;  3BIN A;  3AU5 A;  4B6H A;  1TQZ A;  1X1G A;  1Q67 A;  3A8Q A;  4A6K A;  5J3T A;  1M7E A;  2DFK A;  2NBV A;  4HDO A;  2J0J A;  3V5W A;  1WJM A;  3F5R A;  4QXA B;  4HB2 B;  2IYB A;  3KRX A;  4DX9 0;  1DYN A;  2GCJ A;  5HE1 A;  4TKN A;  2LKO A;  1X1F A;  1XX0 A;  3GYP A;  3HIE A;  2CY5 A;  3NSU A;  1FAO A;  3RCP A;  4QJ3 B;  3A98 B;  1BAK A;  5HE2 A;  3ZDT A;  4IOY X;  4CHJ A;  2CAY A;  5IRS A;  1U5G A;  1PMS A;  2R0D A;  2RVB B;  2YF0 A;  1X05 A;  4H8S A;  1WGU A;  1PFJ A;  2VSZ A;  1U2B A;  3HK0 A;  2M38 A;  1BWN A;  1MIZ B;  2W2X C;  1MAI A;  5M4Y B;  3IVF A;  1KZ7 A;  1TXD A;  1RRP B;  2DYQ A;  2YT1 A;  2K49 A;  2UZR A;  4HHV A;  4HSI A;  4HAY B;  2D9Y A;  2K2J A;  2KGX B;  3HQC A;  2RRF A;  1ZYI A;  2DX5 A;  3DXC A;  3ZVR A;  1J0W A;  3OAN A;  3KY9 A;  1AQC A;  2VRW B;  3HSA A;  3U7D A;  4A6H A;  3VIA A;  2JP2 A;  2W2X D;  4XWX A;  3KSY A;  2I5C A;  1DDW A;  2R2Y A;  4EMO A;  3D8E A;  2Y8F A;  4K2P A;  1TJ6 A;  1K5D B;  3B77 A;  1U5D A;  3PVU A;  3NWF A;  2CRF A;  3D8D A;  4PNK A;  1XKE A;  1QC6 A;  4WSF A;  5LOP B;  3OHM B;  3SV1 A;  2K2U A;  3TFM A;  4ZRK A;  1EGX A;  2Z13 A;  2ROV A;  1UPQ A;  3N7C A;  4TYZ A;  1UEF A;  3U8Z A;  2Z0O A;  2R09 A;  2X18 A;  1NTV A;  5C16 A;  2DHK A;  1FGY A;  2AL6 A;  2N23 A;  2I1K A;  2J59 M;  2D10 A;  2KIE A;  5I2M A;  4P7I A;  2D9W A;  5JP4 A;  5LG4 B;  4CHM A;  2Q13 A;  3PEG A;  1WG7 A;  2RNR B;  1DBH A;  3NW8 A;  2XQN M;  4K17 A;  5JHG A;  3UZT A;  4HAT B;  5HE0 A;  2W2W A;  5JHH A;  1GG3 A;  3TVV A;  4NSW A;  2K8E A;  2ROZ B;  5HE3 A;  2P0D A;  1XD4 A;  4KHB B;  5D3X A;  4D0N B;  2IFS A;  1BTK A;  5D27 A;  4IFS A;  2BCJ A;  2L2I A;  1K5G B;  5KQ4 A;  2FJL A;  2GUM A;  4K2O A;  2YS5 A;  4YON A;  2Y8G A;  4A6F B;  1MI1 A;  3VOQ A;  1V5M A;  1BTN A;  3D8F A;  2G35 A;  1FHO A;  3PVW A;  1P3R A;  4HAU B;  4F7H A;  1NU2 A;  4MY6 A;  4BBK A;  1AWE A;  1T77 A;  2UVM A;  4HB3 B;  1MK7 B;  3FSS A;  3F0W A;  4A5K A;  2FJU B;  1WJ1 A;  3PSC A;  2ELB A;  3T06 A;  2GCL A;  3AU4 A;  1U27 A;  3DXE A;  2MWN B;  1MKE A;  3AJ4 A;  4MK0 A;  1I2H A;  2J0K A;  2LG1 A;  3DCX A;  4GXB A;  2PZ1 A;  4KAX B;  2KUQ A;  3G9W A;  3KZ1 A;  2K00 A;  5D3V A;  1U5E A;  3M1I B;  1FOE A;  1Z87 A;  3WA0 A;  2ZKM X;  2D9X A;  2DKQ A;  1ISN A;  1X11 A;  2DTC A;  1KI1 B;  5D3W A;  4KHA A;  3PG7 A;  1OQN A;  3WYF B;  3U12 A;  1U29 A;  1IRS A;  1UPR A;  2D2Q A;  3QIJ A; 
#chains in the Genus database with same CATH homology
 2YRY A;  2H7D A;  2RSG A;  4HAX B;  3PP2 A;  5EFX A;  3MPX A;  5CLQ B;  3PVL A;  2HE7 A;  3ML4 A;  1XR0 B;  5L81 A;  3X23 A;  1ZC3 B;  1Y5O A;  2D4Q A;  1MK9 B;  5GOW B;  1V88 A;  4HAV B;  3BJI A;  4CYE A;  2NMB A;  4ZRJ A;  3SUZ A;  1EF1 A;  4WVF B;  2COC A;  1PLS A;  2DKP A;  3SO6 A;  2LOZ A;  5JLJ B;  2UZS A;  3CXB B;  1WI1 A;  4GMX B;  4KHO A;  1KZG A;  5DIF B;  4HB0 B;  1NTY A;  4EJN A;  4F7U P;  5DHF B;  5CLL B;  1XOD A;  1H4R A;  2LOX A;  2COD A;  2OTX A;  4GMV A;  4A6F A;  2EC1 A;  1LB1 A;  1UNQ A;  1QQG A;  2RGN B;  3QBV B;  4HAZ B;  2E2X A;  5DHA B;  5LON B;  4MT7 A;  2N0Y A;  4Z2M B;  2YT0 A;  1UNP A;  2EMT A;  3ODW A;  2Z0P A;  2CY4 A;  5KCV A;  1SGH A;  1FHW A;  3ULC A;  1DRO A;  2D9V A;  3O96 A;  2M14 A;  4HB4 B;  4KVG B;  2LUL A;  1DDM A;  2Z0Q A;  2YS1 A;  1Y19 B;  2YSZ A;  5J3Y A;  2KCJ A;  5FI0 A;  2GS0 A;  1J19 A;  2P8V A;  3TCA A;  3A8P A;  2DLW A;  3ODO A;  2KUP A;  1GC7 A;  1NI2 A;  1EAZ A;  4GZU A;  2DHJ A;  2COA A;  4EKU A;  4ZRI A;  2Y7B A;  2GJY A;  5C5B B;  3QWM A;  2EJ8 A;  1W1D A;  1W1H A;  1ZM0 A;  5DI9 B;  1V89 A;  4L6E A;  2DN6 A;  1GC6 A;  2VKI A;  4Z2N A;  1OY2 A;  1U5F A;  1ZVR A;  5DH9 B;  2D9Z A;  1WGQ A;  1ZSQ A;  4GN1 A;  2AEH A;  2J0M A;  2LYD A;  3KRW A;  1B55 A;  2ADZ A;  3ODX A;  1W1G A;  3P7Z A;  1FGZ A;  2RLO A;  2OQB A;  3P6A A;  2V76 A;  2NZ8 B;  3CIK A;  4HAW B;  2YVC A;  2YS3 A;  4Y94 A;  2DA0 A;  2P0H A;  1V5U A;  4DBB A;  4DXA B;  2MFQ A;  1OMW A;  1P5T A;  2D11 A;  3SYX A;  3PZD A;  1H10 A;  2MKR A;  4DX8 A;  4WJ7 A;  5J3Q A;  2DYN A;  3DXD A;  4IAP A;  1WVH A;  1V5P A;  2I1J A;  1SHC A;  3FM8 C;  5KQ1 A;  1EVH A;  1FHX A;  1XCG A;  2ELA A;  1UNR A;  2RUK B;  4HDQ A;  2EMS A;  1ZC4 B;  2MDX A;  3TW1 A;  5C6R A;  3TO1 A;  2COF A;  1RJ2 A;  1FB8 A;  3MDB C;  5D3Y A;  5C5B A;  1P6S A;  4PQ0 A;  1LW3 A;  2QKM A;  3HW2 B;  2DX1 A;  3GYO A;  5C79 A;  4F7G A;  3SNH A;  5FI1 A;  2L1C A;  3FEH A;  3ULB A;  1E5W A;  1MIX A;  1V61 A;  4K81 A;  4C0A A;  2ZPY A;  1MPH A;  4NY0 A;  1M7R A;  1X86 A;  3LJU X;  2H7E A;  2DHI A;  4YL8 A;  4GPT B;  2P0F A;  1N3H A;  2QKL A;  1DDV A;  1I7A A;  2HTH B;  2I5F A;  3BIN A;  3AU5 A;  4B6H A;  1TQZ A;  1X1G A;  1Q67 A;  3A8Q A;  4A6K A;  5J3T A;  1M7E A;  2DFK A;  4HDO A;  2J0J A;  3V5W A;  1WJM A;  3F5R A;  4HB2 B;  2IYB A;  3KRX A;  4DX9 0;  1DYN A;  2GCJ A;  5HE1 A;  4TKN A;  2LKO A;  1X1F A;  1XX0 A;  3GYP A;  2CY5 A;  3NSU A;  1FAO A;  3RCP A;  3A98 B;  1BAK A;  5HE2 A;  3ZDT A;  4IOY X;  4CHJ A;  2CAY A;  1U5G A;  1PMS A;  2R0D A;  2RVB B;  2YF0 A;  1X05 A;  4H8S A;  1WGU A;  1PFJ A;  2VSZ A;  1U2B A;  3HK0 A;  2M38 A;  1BWN A;  1MIZ B;  2W2X C;  1MAI A;  3IVF A;  1KZ7 A;  1TXD A;  1RRP B;  2DYQ A;  2YT1 A;  2UZR A;  4HHV A;  4HAY B;  2D9Y A;  2K2J A;  2KGX B;  3HQC A;  2DX5 A;  3DXC A;  3ZVR A;  1J0W A;  3OAN A;  3KY9 A;  1AQC A;  2VRW B;  3U7D A;  4A6H A;  3VIA A;  2JP2 A;  2W2X D;  4XWX A;  3KSY A;  2I5C A;  1DDW A;  4EMO A;  3D8E A;  2Y8F A;  4K2P A;  1TJ6 A;  1K5D B;  1U5D A;  3PVU A;  2CRF A;  3D8D A;  4PNK A;  1XKE A;  1QC6 A;  4WSF A;  5LOP B;  3SV1 A;  2K2U A;  3TFM A;  4ZRK A;  1EGX A;  2ROV A;  1UPQ A;  3N7C A;  4TYZ A;  1UEF A;  3U8Z A;  2Z0O A;  2R09 A;  2X18 A;  1NTV A;  5C16 A;  2DHK A;  1FGY A;  2AL6 A;  2N23 A;  2I1K A;  2J59 M;  2D10 A;  4P7I A;  2D9W A;  5JP4 A;  4CHM A;  2Q13 A;  3PEG A;  1WG7 A;  2RNR B;  1DBH A;  2XQN M;  4K17 A;  5JHG A;  3UZT A;  4HAT B;  5HE0 A;  2W2W A;  5JHH A;  1GG3 A;  3TVV A;  4NSW A;  2ROZ B;  5HE3 A;  2P0D A;  1XD4 A;  4KHB B;  5D3X A;  4D0N B;  2IFS A;  1BTK A;  5D27 A;  4IFS A;  2BCJ A;  2L2I A;  1K5G B;  5KQ4 A;  2FJL A;  4K2O A;  2YS5 A;  4YON A;  2Y8G A;  4A6F B;  3VOQ A;  1V5M A;  1BTN A;  3D8F A;  2G35 A;  1FHO A;  3PVW A;  1P3R A;  4HAU B;  4F7H A;  1NU2 A;  4MY6 A;  4BBK A;  1AWE A;  2UVM A;  4HB3 B;  1MK7 B;  3FSS A;  3F0W A;  4A5K A;  1WJ1 A;  3PSC A;  2ELB A;  3T06 A;  2GCL A;  3AU4 A;  1U27 A;  3DXE A;  2MWN B;  1MKE A;  3AJ4 A;  4MK0 A;  1I2H A;  2J0K A;  2LG1 A;  4KAX B;  4GXB A;  2PZ1 A;  3G9W A;  3KZ1 A;  2K00 A;  5D3V A;  1U5E A;  3M1I B;  1FOE A;  1Z87 A;  3WA0 A;  2D9X A;  2DKQ A;  1ISN A;  1X11 A;  2DTC A;  1KI1 B;  5D3W A;  4KHA A;  3PG7 A;  1OQN A;  3WYF B;  1U29 A;  1IRS A;  1UPR A;  2D2Q A;  3QIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...