4HAYB

Crystal structure of crm1 inhibitor leptomycin b in complex with crm1(k548e,k579q)-ran-ranbp1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
121
structure length
121
Chain Sequence
EEDEEVLYKVRAKLFRFDKDAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport/antibiotic
molecule keywords GTP-binding nuclear protein Ran
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4hayB00
2J0KA 2M14A 5C5BA 4HATB 5D3XA 3QBVB 4YL8A 2K2JA 1V88A 4GMXB 3AJ4A 2E2XA 5JP4A 5D3VA 1V89A 2I1KA 3A8QA 3ODWA 2L2IA 1M7EA 1MIXA 4GMVA 3MDBC 2K00A 4MY6A 2YT1A 1ZSQA 4A6HA 2ROVA 3PP2A 3PEGA 2P0FA 4A6FA 2KCJA 4Z2MB 4CYEA 2CY5A 1K5GB 1XD4A 2ROZB 1XODA 2AL6A 1GC7A 5DH9B 3MPXA 1TQZA 4HDOA 1XKEA 3SUZA 2EMTA 2YSZA 1EGXA 3DXEA 2D9YA 2UZRA 2DHKA 5FI1A 2YVCA 3OANA 2DFKA 1UNQA 4Z2NA 1Z87A 2LG1A 2OTXA 4F7UP 1V5MA 3PSCA 4WSFA 1W1HA 3F0WA 3LJUX 2J0MA 5D27A 1KI1B 5HE3A 5HE0A 5HE1A 1XX0A 3GYPA 2YS5A 4MK0A 3GYOA 1LB1A 1EF1A 1RJ2A 4HAYB 1ZM0A 1Q67A 1KZ7A 3TFMA 4DX90 2Q13A 5C16A 2J0JA 2VKIA 1N3HA 3D8DA 1EAZA 2UZSA 4KVGB 2Z0QA 2DYQA 3ML4A 4WVFB 1MK7B 2IYBA 4HAWB 3PVUA 3IVFA 2Y8GA 1ZC3B 4NY0A 4HB2B 2DKQA 3SV1A 2YT0A 3KSYA 4IAPA 2ELBA 2D11A 1FHWA 1Y5OA 2Z0OA 2W2XD 2CRFA 1SHCA 4NSWA 4HB3B 5GOWB 1AQCA 1MPHA 4CHMA 4HB0B 2COAA 2EMSA 3ZDTA 2VRWB 5D3YA 1WJMA 2PZ1A 1XR0B 2YF0A 4PNKA 2Z0PA 3G9WA 2ELAA 2COCA 2D9WA 1U5EA 1V5PA 1UPQA 1TXDA 1DDWA 4BBKA 1X1FA 3D8EA 4MT7A 5KCVA 2H7DA 2H7EA 2JP2A 1ZC4B 1PFJA 1TJ6A 2LYDA 4IOYX 2R09A 4GXBA 1RRPB 3KRWA 4TKNA 3P6AA 1AWEA 4HAUB 2P0HA 1SGHA 1BWNA 1GC6A 5DIFB 4GPTB 1P6SA 3TW1A 1LW3A 1P5TA 4EKUA 2YRYA 1FGZA 2HE7A 1OY2A 2CY4A 3BINA 5J3TA 2KUPA 1W1GA 2W2WA 4HAXB 4KHAA 2AEHA 3ZVRA 5FI0A 3BJIA 2IFSA 5EFXA 4L6EA 3A8PA 2R0DA 5CLQB 4B6HA 1E5WA 3FM8C 2MWNB 2D4QA 2DX5A 5CLLB 3V5WA 1X1GA 2RGNB 2M38A 3PG7A 4H8SA 4GZUA 1NI2A 1WJ1A 3VOQA 2COFA 4KHBB 1UEFA 4KAXB 3RCPA 3KZ1A 3PVLA 3ULBA 2DA0A 2DKPA 1UPRA 4HHVA 3N7CA 2GS0A 4PQ0A 2RVBB 3CIKA 3TO1A 2D9ZA 2KGXB 1J19A 5C79A 1Y19B 2CAYA 2N0YA 1FOEA 1NTYA 4K2OA 3HK0A 1MK9B 3KY9A 3HW2B 1QQGA 1MKEA 4C0AA 2BCJA 2DHJA 3M1IB 5KQ4A 5D3WA 4ZRKA 2NZ8B 2LOXA 1I7AA 1MAIA 4YONA 5JHGA 2K2UA 2MKRA 1NU2A 4DBBA 1OMWA 3TCAA 2YS3A 2DTCA 4K81A 1FB8A 1MIZB 1FGYA 4HB4B 2D9XA 1PLSA 1WGUA 2D10A 3SYXA 2I5CA 1U5GA 4HDQA 4CHJA 4F7GA 5JHHA 3P7ZA 2RSGA 3AU5A 2DHIA 1DDVA 1M7RA 1KZGA 2GJYA 3FSSA 1IRSA 3AU4A 4XWXA 2OQBA 2X18A 1WVHA 4A6FB 2Y7BA 4Y94A 2XQNM 3T06A 5HE2A 1U5FA 2YS1A 4ZRIA 3A98B 2DX1A 1B55A 2RNRB 3TVVA 2ZPYA 4HAVB 1XCGA 2MDXA 3F5RA 1EVHA 4WJ7A 3HQCA 1FAOA 1V61A 1W1DA 2V76A 4K2PA 2N23A 3PVWA 3VIAA 2LOZA 2RUKB 5J3YA 2D9VA 3CXBB 1WGQA 2HTHB 1I2HA 2Y8FA 2LULA 1PMSA 1J0WA 1BAKA 4P7IA 5DHAB 1U5DA 2ADZA 1DYNA 3SNHA 1U27A 4A5KA 4F7HA 5L81A 2EJ8A 4DXAB 2P8VA 4ZRJA 4EMOA 4TYZA 1ZVRA 4IFSA 2DLWA 3QWMA 2MFQA 2QKLA 1FHXA 2EC1A 4EJNA 2W2XC 1DDMA 3O96A 3ODOA 5LONB 1ISNA 1GG3A 3UZTA 2RLOA 1DROA 1H4RA 5KQ1A 3SO6A 1UNRA 1DBHA 5DHFB 1H10A 5LOPB 1V5UA 3DXCA 2QKMA 2NMBA 3U7DA 1WG7A 3PZDA 4A6KA 2P0DA 5C6RA 5DI9B 1QC6A 3WA0A 4D0NB 1OQNA 4KHOA 4K17A 2GCLA 2UVMA 1X11A 2G35A 3ODXA 2J59M 3NSUA 5JLJB 1BTNA 2I1JA 3FEHA 3WYFB 5J3QA 4GN1A 1FHOA 3QIJA 2LKOA 5C5BB 3KRXA 1X86A 3DXDA 1K5DB 1NTVA 2I5FA 1BTKA 1U29A 2L1CA 1X05A 2DN6A 3X23A 4HAZB 3D8FA 2GCJA 4DX8A 2CODA 2VSZA 1UNPA 1WI1A 2DYNA 3U8ZA 1U2BA 2FJLA 2D2QA 3ULCA 1P3RA
chains in the Genus database with same CATH superfamily
2J0KA 2M14A 5C5BA 5I2MA 4HATB 5D3XA 4L1RA 3QBVB 4YL8A 2K2JA 1V88A 4GMXB 3AJ4A 2E2XA 5JP4A 5D3VA 1V89A 2I1KA 3A8QA 3ODWA 2R2YA 2L2IA 1M7EA 1MIXA 4GMVA 3MDBC 2K00A 4MY6A 2YT1A 1ZSQA 4A6HA 2ROVA 3PP2A 3PEGA 2P0FA 4A6FA 2KCJA 4Z2MB 4CYEA 2CY5A 1K5GB 2KIEA 1XD4A 2ROZB 1XODA 2AL6A 1GC7A 5DH9B 3MPXA 1TQZA 4HDOA 1XKEA 2Z14A 3SUZA 2EMTA 2YSZA 1EGXA 3DXEA 2D9YA 2UZRA 2DHKA 5FI1A 2YVCA 3OANA 2DFKA 2KUQA 4GOUA 1UNQA 4Z2NA 1Z87A 2LG1A 2OTXA 4F7UP 1V5MA 3DCXA 3PSCA 4WSFA 1W1HA 3F0WA 3LJUX 2J0MA 5D27A 1KI1B 2Z59A 5HE3A 5HE0A 5HE1A 3A58A 1XX0A 3GYPA 2YS5A 4MK0A 3GYOA 1LB1A 1EF1A 1RJ2A 4DIXA 4HAYB 3B77A 1ZM0A 1Q67A 1KZ7A 3TFMA 4DX90 2Q13A 5C16A 2J0JA 2VKIA 1N3HA 3D8DA 1EAZA 2UZSA 3HIEA 4KVGB 2Z0QA 3NWDA 2DYQA 2K8EA 3ML4A 4WVFB 1MK7B 2IYBA 4HAWB 3PVUA 3IVFA 2Y8GA 1ZC3B 4NY0A 4HB2B 2DKQA 3SV1A 2YT0A 3KSYA 4IAPA 2ELBA 2D11A 1FHWA 1Y5OA 2Z0OA 2W2XD 2CRFA 1SHCA 4NSWA 4HB3B 5GOWB 1AQCA 1MPHA 2KIGA 4CHMA 4HB0B 2COAA 2ZKMX 2EMSA 3ZDTA 2GUMA 2VRWB 5D3YA 1WJMA 2PZ1A 1XR0B 2YF0A 4PNKA 2Z0PA 3G9WA 2ELAA 2COCA 2D9WA 1U5EA 1V5PA 1UPQA 1TXDA 1DDWA 4BBKA 1X1FA 3D8EA 4MT7A 5KCVA 5IRSA 2H7DA 2H7EA 2JP2A 1ZC4B 1PFJA 1TJ6A 2LYDA 4IOYX 2R09A 4GXBA 1RRPB 3KRWA 4TKNA 3P6AA 1AWEA 4HAUB 2P0HA 1SGHA 1BWNA 1GC6A 5DIFB 4GPTB 1P6SA 3TW1A 1LW3A 1P5TA 4EKUA 2YRYA 4OT1A 1FGZA 2HE7A 1OY2A 3NWFA 2CY4A 3BINA 5J3TA 2KUPA 1W1GA 2W2WA 4HAXB 4KHAA 2AEHA 3ZVRA 5FI0A 3BJIA 2IFSA 5EFXA 4L6EA 3A8PA 5M4YB 2R0DA 5CLQB 4QXAB 4B6HA 1E5WA 3FM8C 2MWNB 2D4QA 2DX5A 5CLLB 3V5WA 1X1GA 2RGNB 2NBVA 2M38A 3PG7A 4H8SA 4GZUA 1NI2A 1WJ1A 3VOQA 2COFA 4KHBB 1UEFA 4KAXB 2Z4DA 3RCPA 3KZ1A 3PVLA 3ULBA 2DA0A 2DKPA 1UPRA 2RRFA 4HHVA 1ZYIA 3N7CA 2GS0A 4PQ0A 2RVBB 3CIKA 3TO1A 2D9ZA 2KGXB 1J19A 5C79A 1Y19B 2CAYA 2N0YA 1T77A 1FOEA 1NTYA 4K2OA 3HK0A 3HSAA 1MK9B 3KY9A 3HW2B 1QQGA 1MKEA 2KR0A 4C0AA 2BCJA 2DHJA 3M1IB 5KQ4A 5D3WA 4ZRKA 2NZ8B 2LOXA 1I7AA 1MAIA 4YONA 5JHGA 2K2UA 2MKRA 1NU2A 4DBBA 1OMWA 3TCAA 2YS3A 2DTCA 4K81A 1FB8A 1MIZB 1FGYA 4HB4B 2D9XA 1PLSA 1WGUA 2D10A 3SYXA 2I5CA 5I2SA 1U5GA 4HDQA 2YT2A 4CHJA 4F7GA 5JHHA 3P7ZA 2RSGA 3AU5A 2DHIA 1DDVA 1M7RA 1KZGA 4QJ5B 2GJYA 4QJ3B 3FSSA 1IRSA 3AU4A 4XWXA 3FVCA 2OQBA 2X18A 1WVHA 4A6FB 2Y7BA 4Y94A 2XQNM 4HSIA 3T06A 3NWAA 5HE2A 1U5FA 2YS1A 4ZRIA 3A98B 2DX1A 1B55A 2RNRB 3TVVA 2ZPYA 4HAVB 1XCGA 2MDXA 3F5RA 1EVHA 4WJ7A 3HQCA 1FAOA 1V61A 1W1DA 2V76A 4K2PA 2N23A 3PVWA 3VIAA 2LOZA 2RUKB 5J3YA 2D9VA 3CXBB 1WGQA 2HTHB 1I2HA 2Y8FA 4D6WA 2LULA 1PMSA 1J0WA 1BAKA 2Z13A 4P7IA 1U5DA 5DHAB 2ADZA 1DYNA 3SNHA 1U27A 4A5KA 4F7HA 5L81A 2EJ8A 4DXAB 2P8VA 4ZRJA 4EMOA 4TYZA 1ZVRA 4IFSA 4CSQA 2DLWA 3QWMA 2MFQA 3U12A 2QKLA 1FHXA 2EC1A 4EJNA 2W2XC 1DDMA 3O96A 3ODOA 5LONB 1ISNA 1GG3A 3UZTA 2RLOA 1DROA 1H4RA 5KQ1A 3SO6A 1UNRA 1DBHA 5DHFB 4QJ4B 1H10A 5LOPB 1V5UA 3DXCA 2QKMA 2NMBA 3U7DA 1WG7A 3PZDA 4A6KA 2P0DA 5C6RA 5DI9B 1QC6A 3WA0A 4D0NB 1OQNA 4KHBA 4KHOA 4K17A 3NW8A 2GCLA 2UVMA 1X11A 2G35A 3ODXA 2J59M 5LG4B 3NSUA 5JLJB 1BTNA 2I1JA 3FEHA 3WYFB 5J3QA 4GN1A 3OHMB 1FHOA 1MI1A 3QIJA 2LKOA 5C5BB 3KRXA 1X86A 3DXDA 1K5DB 2FJUB 1NTVA 2I5FA 1BTKA 2K49A 1U29A 2L1CA 1X05A 2DN6A 3X23A 4HAZB 3D8FA 4GNKB 2GCJA 4DX8A 2CODA 2VSZA 4OSNA 1UNPA 1WI1A 2DYNA 3U8ZA 1U2BA 2FJLA 2D2QA 3ULCA 1P3RA
chains in the Genus database with same CATH topology
2J0KA 2M14A 5C5BA 4HATB 5D3XA 3QBVB 4YL8A 2K2JA 1V88A 4GMXB 3AJ4A 2E2XA 5JP4A 5D3VA 1V89A 2I1KA 3A8QA 3ODWA 2L2IA 1M7EA 1MIXA 4GMVA 3MDBC 2K00A 4MY6A 2YT1A 1ZSQA 4A6HA 2ROVA 3PP2A 3PEGA 2P0FA 4A6FA 2KCJA 4Z2MB 4CYEA 2CY5A 1K5GB 1XD4A 2ROZB 1XODA 2AL6A 1GC7A 5DH9B 3MPXA 1TQZA 4HDOA 1XKEA 3SUZA 2EMTA 2YSZA 1EGXA 3DXEA 2D9YA 2UZRA 2DHKA 5FI1A 2YVCA 3OANA 2DFKA 1UNQA 4Z2NA 1Z87A 2LG1A 2OTXA 4F7UP 1V5MA 3PSCA 4WSFA 1W1HA 3F0WA 3LJUX 2J0MA 5D27A 1KI1B 5HE3A 5HE0A 5HE1A 1XX0A 3GYPA 2YS5A 4MK0A 3GYOA 1LB1A 1EF1A 1RJ2A 4HAYB 1ZM0A 1Q67A 1KZ7A 3TFMA 4DX90 2Q13A 5C16A 2J0JA 2VKIA 1N3HA 3D8DA 1EAZA 2UZSA 4KVGB 2Z0QA 2DYQA 3ML4A 4WVFB 1MK7B 2IYBA 4HAWB 3PVUA 3IVFA 2Y8GA 1ZC3B 4NY0A 4HB2B 2DKQA 3SV1A 2YT0A 3KSYA 4IAPA 2ELBA 2D11A 1FHWA 1Y5OA 2Z0OA 2W2XD 2CRFA 1SHCA 4NSWA 4HB3B 5GOWB 1AQCA 1MPHA 4CHMA 4HB0B 2COAA 2EMSA 3ZDTA 2VRWB 5D3YA 1WJMA 2PZ1A 1XR0B 2YF0A 4PNKA 2Z0PA 3G9WA 2ELAA 2COCA 2D9WA 1U5EA 1V5PA 1UPQA 1TXDA 1DDWA 4BBKA 1X1FA 3D8EA 4MT7A 5KCVA 2H7DA 2H7EA 2JP2A 1ZC4B 1PFJA 1TJ6A 2LYDA 4IOYX 2R09A 4GXBA 1RRPB 3KRWA 4TKNA 3P6AA 1AWEA 4HAUB 2P0HA 1SGHA 1BWNA 1GC6A 5DIFB 4GPTB 1P6SA 3TW1A 1LW3A 1P5TA 4EKUA 2YRYA 1FGZA 2HE7A 1OY2A 2CY4A 3BINA 5J3TA 2KUPA 1W1GA 2W2WA 4HAXB 4KHAA 2AEHA 3ZVRA 5FI0A 3BJIA 2IFSA 5EFXA 4L6EA 3A8PA 2R0DA 5CLQB 4B6HA 1E5WA 3FM8C 2MWNB 2D4QA 2DX5A 5CLLB 3V5WA 1X1GA 2RGNB 2M38A 3PG7A 4H8SA 4GZUA 1NI2A 1WJ1A 3VOQA 2COFA 4KHBB 1UEFA 4KAXB 3RCPA 3KZ1A 3PVLA 3ULBA 2DA0A 2DKPA 1UPRA 4HHVA 3N7CA 2GS0A 4PQ0A 2RVBB 3CIKA 3TO1A 2D9ZA 2KGXB 1J19A 5C79A 1Y19B 2CAYA 2N0YA 1FOEA 1NTYA 4K2OA 3HK0A 1MK9B 3KY9A 3HW2B 1QQGA 1MKEA 4C0AA 2BCJA 2DHJA 3M1IB 5KQ4A 5D3WA 4ZRKA 2NZ8B 2LOXA 1I7AA 1MAIA 4YONA 5JHGA 2K2UA 2MKRA 1NU2A 4DBBA 1OMWA 3TCAA 2YS3A 2DTCA 4K81A 1FB8A 1MIZB 1FGYA 4HB4B 2D9XA 1PLSA 1WGUA 2D10A 3SYXA 2I5CA 1U5GA 4HDQA 4CHJA 4F7GA 5JHHA 3P7ZA 2RSGA 3AU5A 2DHIA 1DDVA 1M7RA 1KZGA 2GJYA 3FSSA 1IRSA 3AU4A 4XWXA 2OQBA 2X18A 1WVHA 4A6FB 2Y7BA 4Y94A 2XQNM 3T06A 5HE2A 1U5FA 2YS1A 4ZRIA 3A98B 2DX1A 1B55A 2RNRB 3TVVA 2ZPYA 4HAVB 1XCGA 2MDXA 3F5RA 1EVHA 4WJ7A 3HQCA 1FAOA 1V61A 1W1DA 2V76A 4K2PA 2N23A 3PVWA 3VIAA 2LOZA 2RUKB 5J3YA 2D9VA 3CXBB 1WGQA 2HTHB 1I2HA 2Y8FA 2LULA 1PMSA 1J0WA 1BAKA 4P7IA 5DHAB 1U5DA 2ADZA 1DYNA 3SNHA 1U27A 4A5KA 4F7HA 5L81A 2EJ8A 4DXAB 2P8VA 4ZRJA 4EMOA 4TYZA 1ZVRA 4IFSA 2DLWA 3QWMA 2MFQA 2QKLA 1FHXA 2EC1A 4EJNA 2W2XC 1DDMA 3O96A 3ODOA 5LONB 1ISNA 1GG3A 3UZTA 2RLOA 1DROA 1H4RA 5KQ1A 3SO6A 1UNRA 1DBHA 5DHFB 1H10A 5LOPB 1V5UA 3DXCA 2QKMA 2NMBA 3U7DA 1WG7A 3PZDA 4A6KA 2P0DA 5C6RA 5DI9B 1QC6A 3WA0A 4D0NB 1OQNA 4KHOA 4K17A 2GCLA 2UVMA 1X11A 2G35A 3ODXA 2J59M 3NSUA 5JLJB 1BTNA 2I1JA 3FEHA 3WYFB 5J3QA 4GN1A 1FHOA 3QIJA 2LKOA 5C5BB 3KRXA 1X86A 3DXDA 1K5DB 1NTVA 2I5FA 1BTKA 1U29A 2L1CA 1X05A 2DN6A 3X23A 4HAZB 3D8FA 2GCJA 4DX8A 2CODA 2VSZA 1UNPA 1WI1A 2DYNA 3U8ZA 1U2BA 2FJLA 2D2QA 3ULCA 1P3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J0K A;  2M14 A;  5C5B A;  4HAT B;  5D3X A;  3QBV B;  4YL8 A;  2K2J A;  1V88 A;  4GMX B;  3AJ4 A;  2E2X A;  5JP4 A;  5D3V A;  1V89 A;  2I1K A;  3A8Q A;  3ODW A;  2L2I A;  1M7E A;  1MIX A;  4GMV A;  3MDB C;  2K00 A;  4MY6 A;  2YT1 A;  1ZSQ A;  4A6H A;  2ROV A;  3PP2 A;  3PEG A;  2P0F A;  4A6F A;  2KCJ A;  4Z2M B;  4CYE A;  2CY5 A;  1K5G B;  1XD4 A;  2ROZ B;  1XOD A;  2AL6 A;  1GC7 A;  5DH9 B;  3MPX A;  1TQZ A;  4HDO A;  1XKE A;  3SUZ A;  2EMT A;  2YSZ A;  1EGX A;  3DXE A;  2D9Y A;  2UZR A;  2DHK A;  5FI1 A;  2YVC A;  3OAN A;  2DFK A;  1UNQ A;  4Z2N A;  1Z87 A;  2LG1 A;  2OTX A;  4F7U P;  1V5M A;  3PSC A;  4WSF A;  1W1H A;  3F0W A;  3LJU X;  2J0M A;  5D27 A;  1KI1 B;  5HE3 A;  5HE0 A;  5HE1 A;  1XX0 A;  3GYP A;  2YS5 A;  4MK0 A;  3GYO A;  1LB1 A;  1EF1 A;  1RJ2 A;  4HAY B;  1ZM0 A;  1Q67 A;  1KZ7 A;  3TFM A;  4DX9 0;  2Q13 A;  5C16 A;  2J0J A;  2VKI A;  1N3H A;  3D8D A;  1EAZ A;  2UZS A;  4KVG B;  2Z0Q A;  2DYQ A;  3ML4 A;  4WVF B;  1MK7 B;  2IYB A;  4HAW B;  3PVU A;  3IVF A;  2Y8G A;  1ZC3 B;  4NY0 A;  4HB2 B;  2DKQ A;  3SV1 A;  2YT0 A;  3KSY A;  4IAP A;  2ELB A;  2D11 A;  1FHW A;  1Y5O A;  2Z0O A;  2W2X D;  2CRF A;  1SHC A;  4NSW A;  4HB3 B;  5GOW B;  1AQC A;  1MPH A;  4CHM A;  4HB0 B;  2COA A;  2EMS A;  3ZDT A;  2VRW B;  5D3Y A;  1WJM A;  2PZ1 A;  1XR0 B;  2YF0 A;  4PNK A;  2Z0P A;  3G9W A;  2ELA A;  2COC A;  2D9W A;  1U5E A;  1V5P A;  1UPQ A;  1TXD A;  1DDW A;  4BBK A;  1X1F A;  3D8E A;  4MT7 A;  5KCV A;  2H7D A;  2H7E A;  2JP2 A;  1ZC4 B;  1PFJ A;  1TJ6 A;  2LYD A;  4IOY X;  2R09 A;  4GXB A;  1RRP B;  3KRW A;  4TKN A;  3P6A A;  1AWE A;  4HAU B;  2P0H A;  1SGH A;  1BWN A;  1GC6 A;  5DIF B;  4GPT B;  1P6S A;  3TW1 A;  1LW3 A;  1P5T A;  4EKU A;  2YRY A;  1FGZ A;  2HE7 A;  1OY2 A;  2CY4 A;  3BIN A;  5J3T A;  2KUP A;  1W1G A;  2W2W A;  4HAX B;  4KHA A;  2AEH A;  3ZVR A;  5FI0 A;  3BJI A;  2IFS A;  5EFX A;  4L6E A;  3A8P A;  2R0D A;  5CLQ B;  4B6H A;  1E5W A;  3FM8 C;  2MWN B;  2D4Q A;  2DX5 A;  5CLL B;  3V5W A;  1X1G A;  2RGN B;  2M38 A;  3PG7 A;  4H8S A;  4GZU A;  1NI2 A;  1WJ1 A;  3VOQ A;  2COF A;  4KHB B;  1UEF A;  4KAX B;  3RCP A;  3KZ1 A;  3PVL A;  3ULB A;  2DA0 A;  2DKP A;  1UPR A;  4HHV A;  3N7C A;  2GS0 A;  4PQ0 A;  2RVB B;  3CIK A;  3TO1 A;  2D9Z A;  2KGX B;  1J19 A;  5C79 A;  1Y19 B;  2CAY A;  2N0Y A;  1FOE A;  1NTY A;  4K2O A;  3HK0 A;  1MK9 B;  3KY9 A;  3HW2 B;  1QQG A;  1MKE A;  4C0A A;  2BCJ A;  2DHJ A;  3M1I B;  5KQ4 A;  5D3W A;  4ZRK A;  2NZ8 B;  2LOX A;  1I7A A;  1MAI A;  4YON A;  5JHG A;  2K2U A;  2MKR A;  1NU2 A;  4DBB A;  1OMW A;  3TCA A;  2YS3 A;  2DTC A;  4K81 A;  1FB8 A;  1MIZ B;  1FGY A;  4HB4 B;  2D9X A;  1PLS A;  1WGU A;  2D10 A;  3SYX A;  2I5C A;  1U5G A;  4HDQ A;  4CHJ A;  4F7G A;  5JHH A;  3P7Z A;  2RSG A;  3AU5 A;  2DHI A;  1DDV A;  1M7R A;  1KZG A;  2GJY A;  3FSS A;  1IRS A;  3AU4 A;  4XWX A;  2OQB A;  2X18 A;  1WVH A;  4A6F B;  2Y7B A;  4Y94 A;  2XQN M;  3T06 A;  5HE2 A;  1U5F A;  2YS1 A;  4ZRI A;  3A98 B;  2DX1 A;  1B55 A;  2RNR B;  3TVV A;  2ZPY A;  4HAV B;  1XCG A;  2MDX A;  3F5R A;  1EVH A;  4WJ7 A;  3HQC A;  1FAO A;  1V61 A;  1W1D A;  2V76 A;  4K2P A;  2N23 A;  3PVW A;  3VIA A;  2LOZ A;  2RUK B;  5J3Y A;  2D9V A;  3CXB B;  1WGQ A;  2HTH B;  1I2H A;  2Y8F A;  2LUL A;  1PMS A;  1J0W A;  1BAK A;  4P7I A;  5DHA B;  1U5D A;  2ADZ A;  1DYN A;  3SNH A;  1U27 A;  4A5K A;  4F7H A;  5L81 A;  2EJ8 A;  4DXA B;  2P8V A;  4ZRJ A;  4EMO A;  4TYZ A;  1ZVR A;  4IFS A;  2DLW A;  3QWM A;  2MFQ A;  2QKL A;  1FHX A;  2EC1 A;  4EJN A;  2W2X C;  1DDM A;  3O96 A;  3ODO A;  5LON B;  1ISN A;  1GG3 A;  3UZT A;  2RLO A;  1DRO A;  1H4R A;  5KQ1 A;  3SO6 A;  1UNR A;  1DBH A;  5DHF B;  1H10 A;  5LOP B;  1V5U A;  3DXC A;  2QKM A;  2NMB A;  3U7D A;  1WG7 A;  3PZD A;  4A6K A;  2P0D A;  5C6R A;  5DI9 B;  1QC6 A;  3WA0 A;  4D0N B;  1OQN A;  4KHO A;  4K17 A;  2GCL A;  2UVM A;  1X11 A;  2G35 A;  3ODX A;  2J59 M;  3NSU A;  5JLJ B;  1BTN A;  2I1J A;  3FEH A;  3WYF B;  5J3Q A;  4GN1 A;  1FHO A;  3QIJ A;  2LKO A;  5C5B B;  3KRX A;  1X86 A;  3DXD A;  1K5D B;  1NTV A;  2I5F A;  1BTK A;  1U29 A;  2L1C A;  1X05 A;  2DN6 A;  3X23 A;  4HAZ B;  3D8F A;  2GCJ A;  4DX8 A;  2COD A;  2VSZ A;  1UNP A;  1WI1 A;  2DYN A;  3U8Z A;  1U2B A;  2FJL A;  2D2Q A;  3ULC A;  1P3R A; 
#chains in the Genus database with same CATH topology
 2J0K A;  2M14 A;  5C5B A;  5I2M A;  4HAT B;  5D3X A;  4L1R A;  3QBV B;  4YL8 A;  2K2J A;  1V88 A;  4GMX B;  3AJ4 A;  2E2X A;  5JP4 A;  5D3V A;  1V89 A;  2I1K A;  3A8Q A;  3ODW A;  2R2Y A;  2L2I A;  1M7E A;  1MIX A;  4GMV A;  3MDB C;  2K00 A;  4MY6 A;  2YT1 A;  1ZSQ A;  4A6H A;  2ROV A;  3PP2 A;  3PEG A;  2P0F A;  4A6F A;  2KCJ A;  4Z2M B;  4CYE A;  2CY5 A;  1K5G B;  2KIE A;  1XD4 A;  2ROZ B;  1XOD A;  2AL6 A;  1GC7 A;  5DH9 B;  3MPX A;  1TQZ A;  4HDO A;  1XKE A;  2Z14 A;  3SUZ A;  2EMT A;  2YSZ A;  1EGX A;  3DXE A;  2D9Y A;  2UZR A;  2DHK A;  5FI1 A;  2YVC A;  3OAN A;  2DFK A;  2KUQ A;  4GOU A;  1UNQ A;  4Z2N A;  1Z87 A;  2LG1 A;  2OTX A;  4F7U P;  1V5M A;  3DCX A;  3PSC A;  4WSF A;  1W1H A;  3F0W A;  3LJU X;  2J0M A;  5D27 A;  1KI1 B;  2Z59 A;  5HE3 A;  5HE0 A;  5HE1 A;  3A58 A;  1XX0 A;  3GYP A;  2YS5 A;  4MK0 A;  3GYO A;  1LB1 A;  1EF1 A;  1RJ2 A;  4DIX A;  4HAY B;  3B77 A;  1ZM0 A;  1Q67 A;  1KZ7 A;  3TFM A;  4DX9 0;  2Q13 A;  5C16 A;  2J0J A;  2VKI A;  1N3H A;  3D8D A;  1EAZ A;  2UZS A;  3HIE A;  4KVG B;  2Z0Q A;  3NWD A;  2DYQ A;  2K8E A;  3ML4 A;  4WVF B;  1MK7 B;  2IYB A;  4HAW B;  3PVU A;  3IVF A;  2Y8G A;  1ZC3 B;  4NY0 A;  4HB2 B;  2DKQ A;  3SV1 A;  2YT0 A;  3KSY A;  4IAP A;  2ELB A;  2D11 A;  1FHW A;  1Y5O A;  2Z0O A;  2W2X D;  2CRF A;  1SHC A;  4NSW A;  4HB3 B;  5GOW B;  1AQC A;  1MPH A;  2KIG A;  4CHM A;  4HB0 B;  2COA A;  2ZKM X;  2EMS A;  3ZDT A;  2GUM A;  2VRW B;  5D3Y A;  1WJM A;  2PZ1 A;  1XR0 B;  2YF0 A;  4PNK A;  2Z0P A;  3G9W A;  2ELA A;  2COC A;  2D9W A;  1U5E A;  1V5P A;  1UPQ A;  1TXD A;  1DDW A;  4BBK A;  1X1F A;  3D8E A;  4MT7 A;  5KCV A;  5IRS A;  2H7D A;  2H7E A;  2JP2 A;  1ZC4 B;  1PFJ A;  1TJ6 A;  2LYD A;  4IOY X;  2R09 A;  4GXB A;  1RRP B;  3KRW A;  4TKN A;  3P6A A;  1AWE A;  4HAU B;  2P0H A;  1SGH A;  1BWN A;  1GC6 A;  5DIF B;  4GPT B;  1P6S A;  3TW1 A;  1LW3 A;  1P5T A;  4EKU A;  2YRY A;  4OT1 A;  1FGZ A;  2HE7 A;  1OY2 A;  3NWF A;  2CY4 A;  3BIN A;  5J3T A;  2KUP A;  1W1G A;  2W2W A;  4HAX B;  4KHA A;  2AEH A;  3ZVR A;  5FI0 A;  3BJI A;  2IFS A;  5EFX A;  4L6E A;  3A8P A;  5M4Y B;  2R0D A;  5CLQ B;  4QXA B;  4B6H A;  1E5W A;  3FM8 C;  2MWN B;  2D4Q A;  2DX5 A;  5CLL B;  3V5W A;  1X1G A;  2RGN B;  2NBV A;  2M38 A;  3PG7 A;  4H8S A;  4GZU A;  1NI2 A;  1WJ1 A;  3VOQ A;  2COF A;  4KHB B;  1UEF A;  4KAX B;  2Z4D A;  3RCP A;  3KZ1 A;  3PVL A;  3ULB A;  2DA0 A;  2DKP A;  1UPR A;  2RRF A;  4HHV A;  1ZYI A;  3N7C A;  2GS0 A;  4PQ0 A;  2RVB B;  3CIK A;  3TO1 A;  2D9Z A;  2KGX B;  1J19 A;  5C79 A;  1Y19 B;  2CAY A;  2N0Y A;  1T77 A;  1FOE A;  1NTY A;  4K2O A;  3HK0 A;  3HSA A;  1MK9 B;  3KY9 A;  3HW2 B;  1QQG A;  1MKE A;  2KR0 A;  4C0A A;  2BCJ A;  2DHJ A;  3M1I B;  5KQ4 A;  5D3W A;  4ZRK A;  2NZ8 B;  2LOX A;  1I7A A;  1MAI A;  4YON A;  5JHG A;  2K2U A;  2MKR A;  1NU2 A;  4DBB A;  1OMW A;  3TCA A;  2YS3 A;  2DTC A;  4K81 A;  1FB8 A;  1MIZ B;  1FGY A;  4HB4 B;  2D9X A;  1PLS A;  1WGU A;  2D10 A;  3SYX A;  2I5C A;  5I2S A;  1U5G A;  4HDQ A;  2YT2 A;  4CHJ A;  4F7G A;  5JHH A;  3P7Z A;  2RSG A;  3AU5 A;  2DHI A;  1DDV A;  1M7R A;  1KZG A;  4QJ5 B;  2GJY A;  4QJ3 B;  3FSS A;  1IRS A;  3AU4 A;  4XWX A;  3FVC A;  2OQB A;  2X18 A;  1WVH A;  4A6F B;  2Y7B A;  4Y94 A;  2XQN M;  4HSI A;  3T06 A;  3NWA A;  5HE2 A;  1U5F A;  2YS1 A;  4ZRI A;  3A98 B;  2DX1 A;  1B55 A;  2RNR B;  3TVV A;  2ZPY A;  4HAV B;  1XCG A;  2MDX A;  3F5R A;  1EVH A;  4WJ7 A;  3HQC A;  1FAO A;  1V61 A;  1W1D A;  2V76 A;  4K2P A;  2N23 A;  3PVW A;  3VIA A;  2LOZ A;  2RUK B;  5J3Y A;  2D9V A;  3CXB B;  1WGQ A;  2HTH B;  1I2H A;  2Y8F A;  4D6W A;  2LUL A;  1PMS A;  1J0W A;  1BAK A;  2Z13 A;  4P7I A;  1U5D A;  5DHA B;  2ADZ A;  1DYN A;  3SNH A;  1U27 A;  4A5K A;  4F7H A;  5L81 A;  2EJ8 A;  4DXA B;  2P8V A;  4ZRJ A;  4EMO A;  4TYZ A;  1ZVR A;  4IFS A;  4CSQ A;  2DLW A;  3QWM A;  2MFQ A;  3U12 A;  2QKL A;  1FHX A;  2EC1 A;  4EJN A;  2W2X C;  1DDM A;  3O96 A;  3ODO A;  5LON B;  1ISN A;  1GG3 A;  3UZT A;  2RLO A;  1DRO A;  1H4R A;  5KQ1 A;  3SO6 A;  1UNR A;  1DBH A;  5DHF B;  4QJ4 B;  1H10 A;  5LOP B;  1V5U A;  3DXC A;  2QKM A;  2NMB A;  3U7D A;  1WG7 A;  3PZD A;  4A6K A;  2P0D A;  5C6R A;  5DI9 B;  1QC6 A;  3WA0 A;  4D0N B;  1OQN A;  4KHB A;  4KHO A;  4K17 A;  3NW8 A;  2GCL A;  2UVM A;  1X11 A;  2G35 A;  3ODX A;  2J59 M;  5LG4 B;  3NSU A;  5JLJ B;  1BTN A;  2I1J A;  3FEH A;  3WYF B;  5J3Q A;  4GN1 A;  3OHM B;  1FHO A;  1MI1 A;  3QIJ A;  2LKO A;  5C5B B;  3KRX A;  1X86 A;  3DXD A;  1K5D B;  2FJU B;  1NTV A;  2I5F A;  1BTK A;  2K49 A;  1U29 A;  2L1C A;  1X05 A;  2DN6 A;  3X23 A;  4HAZ B;  3D8F A;  4GNK B;  2GCJ A;  4DX8 A;  2COD A;  2VSZ A;  4OSN A;  1UNP A;  1WI1 A;  2DYN A;  3U8Z A;  1U2B A;  2FJL A;  2D2Q A;  3ULC A;  1P3R A; 
#chains in the Genus database with same CATH homology
 2J0K A;  2M14 A;  5C5B A;  4HAT B;  5D3X A;  3QBV B;  4YL8 A;  2K2J A;  1V88 A;  4GMX B;  3AJ4 A;  2E2X A;  5JP4 A;  5D3V A;  1V89 A;  2I1K A;  3A8Q A;  3ODW A;  2L2I A;  1M7E A;  1MIX A;  4GMV A;  3MDB C;  2K00 A;  4MY6 A;  2YT1 A;  1ZSQ A;  4A6H A;  2ROV A;  3PP2 A;  3PEG A;  2P0F A;  4A6F A;  2KCJ A;  4Z2M B;  4CYE A;  2CY5 A;  1K5G B;  1XD4 A;  2ROZ B;  1XOD A;  2AL6 A;  1GC7 A;  5DH9 B;  3MPX A;  1TQZ A;  4HDO A;  1XKE A;  3SUZ A;  2EMT A;  2YSZ A;  1EGX A;  3DXE A;  2D9Y A;  2UZR A;  2DHK A;  5FI1 A;  2YVC A;  3OAN A;  2DFK A;  1UNQ A;  4Z2N A;  1Z87 A;  2LG1 A;  2OTX A;  4F7U P;  1V5M A;  3PSC A;  4WSF A;  1W1H A;  3F0W A;  3LJU X;  2J0M A;  5D27 A;  1KI1 B;  5HE3 A;  5HE0 A;  5HE1 A;  1XX0 A;  3GYP A;  2YS5 A;  4MK0 A;  3GYO A;  1LB1 A;  1EF1 A;  1RJ2 A;  4HAY B;  1ZM0 A;  1Q67 A;  1KZ7 A;  3TFM A;  4DX9 0;  2Q13 A;  5C16 A;  2J0J A;  2VKI A;  1N3H A;  3D8D A;  1EAZ A;  2UZS A;  4KVG B;  2Z0Q A;  2DYQ A;  3ML4 A;  4WVF B;  1MK7 B;  2IYB A;  4HAW B;  3PVU A;  3IVF A;  2Y8G A;  1ZC3 B;  4NY0 A;  4HB2 B;  2DKQ A;  3SV1 A;  2YT0 A;  3KSY A;  4IAP A;  2ELB A;  2D11 A;  1FHW A;  1Y5O A;  2Z0O A;  2W2X D;  2CRF A;  1SHC A;  4NSW A;  4HB3 B;  5GOW B;  1AQC A;  1MPH A;  4CHM A;  4HB0 B;  2COA A;  2EMS A;  3ZDT A;  2VRW B;  5D3Y A;  1WJM A;  2PZ1 A;  1XR0 B;  2YF0 A;  4PNK A;  2Z0P A;  3G9W A;  2ELA A;  2COC A;  2D9W A;  1U5E A;  1V5P A;  1UPQ A;  1TXD A;  1DDW A;  4BBK A;  1X1F A;  3D8E A;  4MT7 A;  5KCV A;  2H7D A;  2H7E A;  2JP2 A;  1ZC4 B;  1PFJ A;  1TJ6 A;  2LYD A;  4IOY X;  2R09 A;  4GXB A;  1RRP B;  3KRW A;  4TKN A;  3P6A A;  1AWE A;  4HAU B;  2P0H A;  1SGH A;  1BWN A;  1GC6 A;  5DIF B;  4GPT B;  1P6S A;  3TW1 A;  1LW3 A;  1P5T A;  4EKU A;  2YRY A;  1FGZ A;  2HE7 A;  1OY2 A;  2CY4 A;  3BIN A;  5J3T A;  2KUP A;  1W1G A;  2W2W A;  4HAX B;  4KHA A;  2AEH A;  3ZVR A;  5FI0 A;  3BJI A;  2IFS A;  5EFX A;  4L6E A;  3A8P A;  2R0D A;  5CLQ B;  4B6H A;  1E5W A;  3FM8 C;  2MWN B;  2D4Q A;  2DX5 A;  5CLL B;  3V5W A;  1X1G A;  2RGN B;  2M38 A;  3PG7 A;  4H8S A;  4GZU A;  1NI2 A;  1WJ1 A;  3VOQ A;  2COF A;  4KHB B;  1UEF A;  4KAX B;  3RCP A;  3KZ1 A;  3PVL A;  3ULB A;  2DA0 A;  2DKP A;  1UPR A;  4HHV A;  3N7C A;  2GS0 A;  4PQ0 A;  2RVB B;  3CIK A;  3TO1 A;  2D9Z A;  2KGX B;  1J19 A;  5C79 A;  1Y19 B;  2CAY A;  2N0Y A;  1FOE A;  1NTY A;  4K2O A;  3HK0 A;  1MK9 B;  3KY9 A;  3HW2 B;  1QQG A;  1MKE A;  4C0A A;  2BCJ A;  2DHJ A;  3M1I B;  5KQ4 A;  5D3W A;  4ZRK A;  2NZ8 B;  2LOX A;  1I7A A;  1MAI A;  4YON A;  5JHG A;  2K2U A;  2MKR A;  1NU2 A;  4DBB A;  1OMW A;  3TCA A;  2YS3 A;  2DTC A;  4K81 A;  1FB8 A;  1MIZ B;  1FGY A;  4HB4 B;  2D9X A;  1PLS A;  1WGU A;  2D10 A;  3SYX A;  2I5C A;  1U5G A;  4HDQ A;  4CHJ A;  4F7G A;  5JHH A;  3P7Z A;  2RSG A;  3AU5 A;  2DHI A;  1DDV A;  1M7R A;  1KZG A;  2GJY A;  3FSS A;  1IRS A;  3AU4 A;  4XWX A;  2OQB A;  2X18 A;  1WVH A;  4A6F B;  2Y7B A;  4Y94 A;  2XQN M;  3T06 A;  5HE2 A;  1U5F A;  2YS1 A;  4ZRI A;  3A98 B;  2DX1 A;  1B55 A;  2RNR B;  3TVV A;  2ZPY A;  4HAV B;  1XCG A;  2MDX A;  3F5R A;  1EVH A;  4WJ7 A;  3HQC A;  1FAO A;  1V61 A;  1W1D A;  2V76 A;  4K2P A;  2N23 A;  3PVW A;  3VIA A;  2LOZ A;  2RUK B;  5J3Y A;  2D9V A;  3CXB B;  1WGQ A;  2HTH B;  1I2H A;  2Y8F A;  2LUL A;  1PMS A;  1J0W A;  1BAK A;  4P7I A;  5DHA B;  1U5D A;  2ADZ A;  1DYN A;  3SNH A;  1U27 A;  4A5K A;  4F7H A;  5L81 A;  2EJ8 A;  4DXA B;  2P8V A;  4ZRJ A;  4EMO A;  4TYZ A;  1ZVR A;  4IFS A;  2DLW A;  3QWM A;  2MFQ A;  2QKL A;  1FHX A;  2EC1 A;  4EJN A;  2W2X C;  1DDM A;  3O96 A;  3ODO A;  5LON B;  1ISN A;  1GG3 A;  3UZT A;  2RLO A;  1DRO A;  1H4R A;  5KQ1 A;  3SO6 A;  1UNR A;  1DBH A;  5DHF B;  1H10 A;  5LOP B;  1V5U A;  3DXC A;  2QKM A;  2NMB A;  3U7D A;  1WG7 A;  3PZD A;  4A6K A;  2P0D A;  5C6R A;  5DI9 B;  1QC6 A;  3WA0 A;  4D0N B;  1OQN A;  4KHO A;  4K17 A;  2GCL A;  2UVM A;  1X11 A;  2G35 A;  3ODX A;  2J59 M;  3NSU A;  5JLJ B;  1BTN A;  2I1J A;  3FEH A;  3WYF B;  5J3Q A;  4GN1 A;  1FHO A;  3QIJ A;  2LKO A;  5C5B B;  3KRX A;  1X86 A;  3DXD A;  1K5D B;  1NTV A;  2I5F A;  1BTK A;  1U29 A;  2L1C A;  1X05 A;  2DN6 A;  3X23 A;  4HAZ B;  3D8F A;  2GCJ A;  4DX8 A;  2COD A;  2VSZ A;  1UNP A;  1WI1 A;  2DYN A;  3U8Z A;  1U2B A;  2FJL A;  2D2Q A;  3ULC A;  1P3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...