4HB0B

Crystal structure of crm1 inhibitor leptomycin b in complex with crm1(k541q,k542q,r543s,k545q,k548q,k579q)-ran-ranbp1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
121
structure length
121
Chain Sequence
EEDEEVLYKVRAKLFRFDKDAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport/antibiotic
molecule keywords GTP-binding nuclear protein Ran
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4hb0B00
2I5FA 3SUZA 1V89A 5L81A 1I2HA 3KRXA 4HB2B 2Y7BA 1UNQA 4D0NB 1GG3A 2CODA 4DXAB 5C79A 2KGXB 3CIKA 5HE1A 3MPXA 2CY5A 2YVCA 2DA0A 2W2WA 2CAYA 4P7IA 5JHGA 4F7UP 3HW2B 3D8EA 5C6RA 3KZ1A 4BBKA 1MIXA 2LOZA 1QC6A 2DFKA 2LYDA 1XD4A 2D9WA 1DDWA 2Z0PA 3X23A 1MPHA 3DXEA 3BINA 1IRSA 1SGHA 1MIZB 1Z87A 3F5RA 2UZRA 3A8QA 2KUPA 3MDBC 3PSCA 3TVVA 4CHJA 2H7EA 5DIFB 3ODXA 4PNKA 4TKNA 1BAKA 4K2PA 2W2XC 4IFSA 2DX1A 1K5DB 2HTHB 2MKRA 2YSZA 2J0KA 2Z0QA 1P3RA 2COAA 2HE7A 1Y5OA 4GZUA 2MFQA 4B6HA 3GYOA 4MY6A 1SHCA 4L6EA 1RRPB 1GC7A 1N3HA 1X11A 2UVMA 2COFA 1AWEA 2EJ8A 2X18A 3SNHA 1J0WA 2DHIA 1U29A 3VOQA 2Z0OA 5HE3A 2RGNB 3WA0A 2P0DA 1FB8A 3ULBA 5LOPB 5J3QA 1U2BA 3P6AA 3ZDTA 1DDVA 4A5KA 1U5EA 1V5PA 3UZTA 1FHWA 2OTXA 2D9XA 4DBBA 3RCPA 3P7ZA 1Y19B 3PEGA 4WJ7A 1XX0A 1FGZA 2D9YA 1KZGA 1B55A 4GPTB 2DLWA 1U27A 2I1KA 1MK7B 2NZ8B 4HDOA 3ODOA 3ODWA 4IOYX 1WVHA 2P0FA 3KRWA 1OMWA 5JHHA 2L2IA 3AJ4A 5FI0A 3OANA 2QKMA 1LB1A 4DX8A 2COCA 1BTNA 2KCJA 5HE0A 3SYXA 2MWNB 1W1DA 1WI1A 2RSGA 5HE2A 2L1CA 1NU2A 3CXBB 3NSUA 5EFXA 1UNRA 1BTKA 2M38A 5GOWB 2GS0A 2Q13A 1TQZA 3PP2A 1ZM0A 5JP4A 1M7RA 1UPQA 3DXDA 4CYEA 3FM8C 1XKEA 1X1FA 1OQNA 2DX5A 4HATB 1H4RA 1ZC3B 4GN1A 4HAWB 3ULCA 2I1JA 2IFSA 3HQCA 2P0HA 2BCJA 1P6SA 2D2QA 4XWXA 4DX90 2VSZA 2AEHA 3A8PA 2GCLA 5LONB 1WGUA 4Y94A 4K2OA 2ELAA 2ELBA 2R0DA 1ZC4B 1UPRA 4EJNA 4HDQA 1EAZA 4GXBA 1EF1A 2R09A 2V76A 4A6HA 1WG7A 2EMTA 1U5DA 1X05A 2E2XA 1RJ2A 4MT7A 2D4QA 2K2UA 2OQBA 1WGQA 4EMOA 3TW1A 5DH9B 1PMSA 4HB4B 1M7EA 1KI1B 3G9WA 2YS3A 3F0WA 1AQCA 3U8ZA 3T06A 1DROA 3AU4A 2PZ1A 3SO6A 1V88A 2Y8GA 2N23A 2W2XD 1V5UA 4MK0A 5JLJB 5D27A 1TJ6A 2LOXA 1UNPA 3LJUX 4KAXB 1GC6A 2IYBA 3SV1A 4A6FA 1J19A 1X86A 3TO1A 4KHBB 2M14A 2EMSA 1XODA 2VKIA 1KZ7A 1E5WA 1FHXA 3M1IB 1U5GA 1ZSQA 1X1GA 3ML4A 2DHJA 1MAIA 1EGXA 4KHAA 4HB0B 4A6KA 2D11A 4C0AA 3AU5A 2EC1A 3PVWA 2D9VA 1DBHA 1NTYA 2YRYA 1XCGA 1QQGA 1W1HA 1MK9B 3U7DA 4KHOA 2GCJA 2ROZB 2LULA 2MDXA 5FI1A 2N0YA 3FEHA 2YS5A 4ZRKA 4YL8A 5CLQB 5D3YA 1FGYA 1W1GA 3D8FA 5CLLB 2DHKA 3IVFA 1FAOA 4PQ0A 3KY9A 1PLSA 2FJLA 3TFMA 5C16A 2UZSA 4F7HA 4HAZB 2K00A 1TXDA 5C5BB 2RNRB 1NI2A 3N7CA 4GMVA 1EVHA 4EKUA 4Z2NA 4HAXB 2XQNM 3BJIA 1P5TA 2YT1A 2P8VA 1OY2A 2H7DA 4CHMA 1LW3A 3QBVB 5D3VA 2K2JA 2YS1A 2VRWB 3O96A 4K17A 4TYZA 4WVFB 1BWNA 2LG1A 4HAUB 5DI9B 5C5BA 2LKOA 2DKPA 4IAPA 3V5WA 2CRFA 2DKQA 1ZVRA 3PVLA 3QWMA 5J3YA 5KQ1A 1NTVA 4HB3B 1I7AA 2J59M 2AL6A 3GYPA 3HK0A 1H10A 1PFJA 2DN6A 4HHVA 5J3TA 1WJ1A 3TCAA 4A6FB 1ISNA 4NSWA 2JP2A 1V5MA 2DYQA 2Y8FA 1V61A 4WSFA 2D10A 1UEFA 3D8DA 2D9ZA 5KCVA 2QKLA 5D3XA 4KVGB 5D3WA 1DYNA 2J0MA 4ZRIA 2ZPYA 2DTCA 3VIAA 2DYNA 3DXCA 4Z2MB 2I5CA 1WJMA 5KQ4A 1Q67A 4HAYB 3ZVRA 2RLOA 1U5FA 3QIJA 1DDMA 3A98B 1FHOA 2G35A 1K5GB 4YONA 2J0JA 4GMXB 2RUKB 4NY0A 2NMBA 4H8SA 2CY4A 3PG7A 4HAVB 3FSSA 4ZRJA 1XR0B 2ADZA 1FOEA 2GJYA 2RVBB 2ROVA 2YT0A 3KSYA 2YF0A 4F7GA 5DHAB 4K81A 1MKEA 3WYFB 3PVUA 3PZDA 5DHFB
chains in the Genus database with same CATH superfamily
2I5FA 3SUZA 2Z4DA 1V89A 5L81A 1I2HA 3KRXA 2YT2A 4HB2B 2Y7BA 1UNQA 4D0NB 1GG3A 2CODA 4DXAB 5C79A 2KGXB 3CIKA 4CSQA 5HE1A 3MPXA 2CY5A 2YVCA 2DA0A 2W2WA 2CAYA 4P7IA 5JHGA 4QJ3B 4F7UP 3HW2B 4HSIA 3D8EA 5C6RA 3KZ1A 4BBKA 1MIXA 2LOZA 1QC6A 1ZYIA 2DFKA 2LYDA 1XD4A 2D9WA 1DDWA 2Z0PA 3X23A 1MPHA 3DXEA 3BINA 1IRSA 1SGHA 1MIZB 1Z87A 3F5RA 2UZRA 3A8QA 2KUPA 3MDBC 3PSCA 3TVVA 4CHJA 2H7EA 5DIFB 3ODXA 4PNKA 4TKNA 1BAKA 4K2PA 2W2XC 4IFSA 2DX1A 1K5DB 2HTHB 2MKRA 2K8EA 2YSZA 2J0KA 2Z0QA 1P3RA 2COAA 2HE7A 1Y5OA 4GZUA 2MFQA 4B6HA 3GYOA 4MY6A 1SHCA 4L6EA 1RRPB 1GC7A 1N3HA 1X11A 2UVMA 2COFA 1AWEA 2EJ8A 2X18A 3SNHA 1J0WA 2DHIA 1MI1A 1U29A 3VOQA 2Z0OA 3NWDA 5HE3A 2RGNB 3WA0A 2P0DA 1FB8A 3A58A 3ULBA 5LOPB 5J3QA 1U2BA 3P6AA 3ZDTA 1DDVA 4A5KA 1U5EA 1V5PA 3UZTA 1FHWA 2OTXA 2D9XA 4DBBA 3RCPA 3P7ZA 1Y19B 3PEGA 4D6WA 4WJ7A 1XX0A 1FGZA 2D9YA 1KZGA 1B55A 4GPTB 2DLWA 1U27A 2I1KA 1MK7B 2NZ8B 4HDOA 3ODOA 3ODWA 4IOYX 1WVHA 2P0FA 3KRWA 1OMWA 5JHHA 2L2IA 3AJ4A 5FI0A 3OANA 2QKMA 1LB1A 4DX8A 2COCA 1BTNA 2KCJA 5HE0A 3SYXA 2MWNB 1W1DA 1WI1A 2RSGA 5HE2A 2L1CA 1NU2A 3CXBB 3NSUA 5EFXA 1UNRA 3NWFA 1BTKA 2M38A 5GOWB 2GS0A 2Q13A 1TQZA 3PP2A 1ZM0A 5JP4A 1M7RA 1UPQA 3DXDA 4CYEA 3FM8C 1XKEA 1X1FA 1OQNA 2DX5A 4HATB 1H4RA 1ZC3B 4GN1A 4HAWB 3ULCA 2I1JA 2IFSA 3HQCA 2P0HA 2BCJA 1P6SA 2D2QA 4XWXA 4DX90 2VSZA 2AEHA 3A8PA 2GCLA 3NWAA 5LONB 1WGUA 4Y94A 4K2OA 2ELAA 2ELBA 2R0DA 2Z59A 1ZC4B 1UPRA 4EJNA 4HDQA 1EAZA 4GXBA 4QXAB 1EF1A 2FJUB 2R09A 2V76A 4A6HA 1WG7A 2EMTA 1U5DA 1X05A 2E2XA 1RJ2A 4MT7A 2D4QA 5I2SA 2K2UA 2OQBA 1WGQA 4EMOA 2Z14A 3TW1A 3B77A 5DH9B 1PMSA 4HB4B 1M7EA 1KI1B 3G9WA 2YS3A 3F0WA 1AQCA 3U8ZA 3T06A 1DROA 3AU4A 2PZ1A 4OSNA 3SO6A 1V88A 5I2MA 2Y8GA 4QJ5B 2N23A 2W2XD 1V5UA 4MK0A 5JLJB 5D27A 1TJ6A 2LOXA 1UNPA 3LJUX 4KAXB 1GC6A 2IYBA 3DCXA 3SV1A 4A6FA 1J19A 1X86A 3TO1A 1T77A 3OHMB 4KHBB 2M14A 2EMSA 1XODA 2VKIA 1KZ7A 1E5WA 1FHXA 3M1IB 1U5GA 1ZSQA 1X1GA 2K49A 3ML4A 2DHJA 1MAIA 1EGXA 5IRSA 4KHAA 4HB0B 4A6KA 2D11A 4C0AA 3AU5A 2EC1A 3PVWA 2D9VA 1DBHA 1NTYA 2YRYA 4KHBA 1XCGA 4GNKB 1QQGA 1W1HA 1MK9B 3U7DA 4KHOA 2GCJA 2ROZB 2LULA 2MDXA 5FI1A 2N0YA 3HIEA 3FEHA 2YS5A 4ZRKA 5M4YB 4YL8A 5CLQB 5D3YA 1FGYA 1W1GA 3D8FA 5CLLB 2DHKA 3IVFA 1FAOA 4PQ0A 3KY9A 1PLSA 2FJLA 3TFMA 2Z13A 5C16A 2UZSA 4F7HA 4HAZB 2K00A 1TXDA 5C5BB 2RNRB 1NI2A 3N7CA 4GMVA 1EVHA 4EKUA 4Z2NA 4HAXB 4QJ4B 2XQNM 3BJIA 4DIXA 1P5TA 3FVCA 4OT1A 2YT1A 2P8VA 1OY2A 2H7DA 4CHMA 2R2YA 1LW3A 3QBVB 3HSAA 5D3VA 2K2JA 2YS1A 2VRWB 3O96A 4K17A 4TYZA 4WVFB 1BWNA 2LG1A 4HAUB 5DI9B 5C5BA 2LKOA 2DKPA 4IAPA 3V5WA 2CRFA 2DKQA 1ZVRA 3PVLA 3QWMA 5J3YA 5KQ1A 2KIEA 1NTVA 4HB3B 1I7AA 2J59M 2AL6A 3GYPA 3HK0A 3U12A 1H10A 1PFJA 2DN6A 4HHVA 5J3TA 1WJ1A 3TCAA 4A6FB 1ISNA 4NSWA 2JP2A 1V5MA 2DYQA 2Y8FA 2ZKMX 1V61A 4WSFA 2D10A 1UEFA 3D8DA 2D9ZA 5KCVA 2QKLA 5D3XA 4KVGB 2KUQA 5D3WA 2GUMA 3NW8A 1DYNA 2J0MA 4L1RA 4ZRIA 2ZPYA 2DTCA 3VIAA 2KR0A 2DYNA 3DXCA 4Z2MB 2I5CA 1WJMA 5KQ4A 1Q67A 4HAYB 3ZVRA 4GOUA 2RLOA 1U5FA 3QIJA 1DDMA 3A98B 1FHOA 2G35A 1K5GB 4YONA 2RRFA 2J0JA 4GMXB 2RUKB 4NY0A 2NMBA 4H8SA 2CY4A 3PG7A 4HAVB 3FSSA 4ZRJA 1XR0B 2ADZA 1FOEA 2GJYA 2RVBB 2NBVA 2ROVA 2YT0A 5LG4B 3KSYA 2YF0A 4F7GA 5DHAB 2KIGA 4K81A 1MKEA 3WYFB 3PVUA 3PZDA 5DHFB
chains in the Genus database with same CATH topology
2I5FA 3SUZA 1V89A 5L81A 1I2HA 3KRXA 4HB2B 2Y7BA 1UNQA 4D0NB 1GG3A 2CODA 4DXAB 5C79A 2KGXB 3CIKA 5HE1A 3MPXA 2CY5A 2YVCA 2DA0A 2W2WA 2CAYA 4P7IA 5JHGA 4F7UP 3HW2B 3D8EA 5C6RA 3KZ1A 4BBKA 1MIXA 2LOZA 1QC6A 2DFKA 2LYDA 1XD4A 2D9WA 1DDWA 2Z0PA 3X23A 1MPHA 3DXEA 3BINA 1IRSA 1SGHA 1MIZB 1Z87A 3F5RA 2UZRA 3A8QA 2KUPA 3MDBC 3PSCA 3TVVA 4CHJA 2H7EA 5DIFB 3ODXA 4PNKA 4TKNA 1BAKA 4K2PA 2W2XC 4IFSA 2DX1A 1K5DB 2HTHB 2MKRA 2YSZA 2J0KA 2Z0QA 1P3RA 2COAA 2HE7A 1Y5OA 4GZUA 2MFQA 4B6HA 3GYOA 4MY6A 1SHCA 4L6EA 1RRPB 1GC7A 1N3HA 1X11A 2UVMA 2COFA 1AWEA 2EJ8A 2X18A 3SNHA 1J0WA 2DHIA 1U29A 3VOQA 2Z0OA 5HE3A 2RGNB 3WA0A 2P0DA 1FB8A 3ULBA 5LOPB 5J3QA 1U2BA 3P6AA 3ZDTA 1DDVA 4A5KA 1U5EA 1V5PA 3UZTA 1FHWA 2OTXA 2D9XA 4DBBA 3RCPA 3P7ZA 1Y19B 3PEGA 4WJ7A 1XX0A 1FGZA 2D9YA 1KZGA 1B55A 4GPTB 2DLWA 1U27A 2I1KA 1MK7B 2NZ8B 4HDOA 3ODOA 3ODWA 4IOYX 1WVHA 2P0FA 3KRWA 1OMWA 5JHHA 2L2IA 3AJ4A 5FI0A 3OANA 2QKMA 1LB1A 4DX8A 2COCA 1BTNA 2KCJA 5HE0A 3SYXA 2MWNB 1W1DA 1WI1A 2RSGA 5HE2A 2L1CA 1NU2A 3CXBB 3NSUA 5EFXA 1UNRA 1BTKA 2M38A 5GOWB 2GS0A 2Q13A 1TQZA 3PP2A 1ZM0A 5JP4A 1M7RA 1UPQA 3DXDA 4CYEA 3FM8C 1XKEA 1X1FA 1OQNA 2DX5A 4HATB 1H4RA 1ZC3B 4GN1A 4HAWB 3ULCA 2I1JA 2IFSA 3HQCA 2P0HA 2BCJA 1P6SA 2D2QA 4XWXA 4DX90 2VSZA 2AEHA 3A8PA 2GCLA 5LONB 1WGUA 4Y94A 4K2OA 2ELAA 2ELBA 2R0DA 1ZC4B 1UPRA 4EJNA 4HDQA 1EAZA 4GXBA 1EF1A 2R09A 2V76A 4A6HA 1WG7A 2EMTA 1U5DA 1X05A 2E2XA 1RJ2A 4MT7A 2D4QA 2K2UA 2OQBA 1WGQA 4EMOA 3TW1A 5DH9B 1PMSA 4HB4B 1M7EA 1KI1B 3G9WA 2YS3A 3F0WA 1AQCA 3U8ZA 3T06A 1DROA 3AU4A 2PZ1A 3SO6A 1V88A 2Y8GA 2N23A 2W2XD 1V5UA 4MK0A 5JLJB 5D27A 1TJ6A 2LOXA 1UNPA 3LJUX 4KAXB 1GC6A 2IYBA 3SV1A 4A6FA 1J19A 1X86A 3TO1A 4KHBB 2M14A 2EMSA 1XODA 2VKIA 1KZ7A 1E5WA 1FHXA 3M1IB 1U5GA 1ZSQA 1X1GA 3ML4A 2DHJA 1MAIA 1EGXA 4KHAA 4HB0B 4A6KA 2D11A 4C0AA 3AU5A 2EC1A 3PVWA 2D9VA 1DBHA 1NTYA 2YRYA 1XCGA 1QQGA 1W1HA 1MK9B 3U7DA 4KHOA 2GCJA 2ROZB 2LULA 2MDXA 5FI1A 2N0YA 3FEHA 2YS5A 4ZRKA 4YL8A 5CLQB 5D3YA 1FGYA 1W1GA 3D8FA 5CLLB 2DHKA 3IVFA 1FAOA 4PQ0A 3KY9A 1PLSA 2FJLA 3TFMA 5C16A 2UZSA 4F7HA 4HAZB 2K00A 1TXDA 5C5BB 2RNRB 1NI2A 3N7CA 4GMVA 1EVHA 4EKUA 4Z2NA 4HAXB 2XQNM 3BJIA 1P5TA 2YT1A 2P8VA 1OY2A 2H7DA 4CHMA 1LW3A 3QBVB 5D3VA 2K2JA 2YS1A 2VRWB 3O96A 4K17A 4TYZA 4WVFB 1BWNA 2LG1A 4HAUB 5DI9B 5C5BA 2LKOA 2DKPA 4IAPA 3V5WA 2CRFA 2DKQA 1ZVRA 3PVLA 3QWMA 5J3YA 5KQ1A 1NTVA 4HB3B 1I7AA 2J59M 2AL6A 3GYPA 3HK0A 1H10A 1PFJA 2DN6A 4HHVA 5J3TA 1WJ1A 3TCAA 4A6FB 1ISNA 4NSWA 2JP2A 1V5MA 2DYQA 2Y8FA 1V61A 4WSFA 2D10A 1UEFA 3D8DA 2D9ZA 5KCVA 2QKLA 5D3XA 4KVGB 5D3WA 1DYNA 2J0MA 4ZRIA 2ZPYA 2DTCA 3VIAA 2DYNA 3DXCA 4Z2MB 2I5CA 1WJMA 5KQ4A 1Q67A 4HAYB 3ZVRA 2RLOA 1U5FA 3QIJA 1DDMA 3A98B 1FHOA 2G35A 1K5GB 4YONA 2J0JA 4GMXB 2RUKB 4NY0A 2NMBA 4H8SA 2CY4A 3PG7A 4HAVB 3FSSA 4ZRJA 1XR0B 2ADZA 1FOEA 2GJYA 2RVBB 2ROVA 2YT0A 3KSYA 2YF0A 4F7GA 5DHAB 4K81A 1MKEA 3WYFB 3PVUA 3PZDA 5DHFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I5F A;  3SUZ A;  1V89 A;  5L81 A;  1I2H A;  3KRX A;  4HB2 B;  2Y7B A;  1UNQ A;  4D0N B;  1GG3 A;  2COD A;  4DXA B;  5C79 A;  2KGX B;  3CIK A;  5HE1 A;  3MPX A;  2CY5 A;  2YVC A;  2DA0 A;  2W2W A;  2CAY A;  4P7I A;  5JHG A;  4F7U P;  3HW2 B;  3D8E A;  5C6R A;  3KZ1 A;  4BBK A;  1MIX A;  2LOZ A;  1QC6 A;  2DFK A;  2LYD A;  1XD4 A;  2D9W A;  1DDW A;  2Z0P A;  3X23 A;  1MPH A;  3DXE A;  3BIN A;  1IRS A;  1SGH A;  1MIZ B;  1Z87 A;  3F5R A;  2UZR A;  3A8Q A;  2KUP A;  3MDB C;  3PSC A;  3TVV A;  4CHJ A;  2H7E A;  5DIF B;  3ODX A;  4PNK A;  4TKN A;  1BAK A;  4K2P A;  2W2X C;  4IFS A;  2DX1 A;  1K5D B;  2HTH B;  2MKR A;  2YSZ A;  2J0K A;  2Z0Q A;  1P3R A;  2COA A;  2HE7 A;  1Y5O A;  4GZU A;  2MFQ A;  4B6H A;  3GYO A;  4MY6 A;  1SHC A;  4L6E A;  1RRP B;  1GC7 A;  1N3H A;  1X11 A;  2UVM A;  2COF A;  1AWE A;  2EJ8 A;  2X18 A;  3SNH A;  1J0W A;  2DHI A;  1U29 A;  3VOQ A;  2Z0O A;  5HE3 A;  2RGN B;  3WA0 A;  2P0D A;  1FB8 A;  3ULB A;  5LOP B;  5J3Q A;  1U2B A;  3P6A A;  3ZDT A;  1DDV A;  4A5K A;  1U5E A;  1V5P A;  3UZT A;  1FHW A;  2OTX A;  2D9X A;  4DBB A;  3RCP A;  3P7Z A;  1Y19 B;  3PEG A;  4WJ7 A;  1XX0 A;  1FGZ A;  2D9Y A;  1KZG A;  1B55 A;  4GPT B;  2DLW A;  1U27 A;  2I1K A;  1MK7 B;  2NZ8 B;  4HDO A;  3ODO A;  3ODW A;  4IOY X;  1WVH A;  2P0F A;  3KRW A;  1OMW A;  5JHH A;  2L2I A;  3AJ4 A;  5FI0 A;  3OAN A;  2QKM A;  1LB1 A;  4DX8 A;  2COC A;  1BTN A;  2KCJ A;  5HE0 A;  3SYX A;  2MWN B;  1W1D A;  1WI1 A;  2RSG A;  5HE2 A;  2L1C A;  1NU2 A;  3CXB B;  3NSU A;  5EFX A;  1UNR A;  1BTK A;  2M38 A;  5GOW B;  2GS0 A;  2Q13 A;  1TQZ A;  3PP2 A;  1ZM0 A;  5JP4 A;  1M7R A;  1UPQ A;  3DXD A;  4CYE A;  3FM8 C;  1XKE A;  1X1F A;  1OQN A;  2DX5 A;  4HAT B;  1H4R A;  1ZC3 B;  4GN1 A;  4HAW B;  3ULC A;  2I1J A;  2IFS A;  3HQC A;  2P0H A;  2BCJ A;  1P6S A;  2D2Q A;  4XWX A;  4DX9 0;  2VSZ A;  2AEH A;  3A8P A;  2GCL A;  5LON B;  1WGU A;  4Y94 A;  4K2O A;  2ELA A;  2ELB A;  2R0D A;  1ZC4 B;  1UPR A;  4EJN A;  4HDQ A;  1EAZ A;  4GXB A;  1EF1 A;  2R09 A;  2V76 A;  4A6H A;  1WG7 A;  2EMT A;  1U5D A;  1X05 A;  2E2X A;  1RJ2 A;  4MT7 A;  2D4Q A;  2K2U A;  2OQB A;  1WGQ A;  4EMO A;  3TW1 A;  5DH9 B;  1PMS A;  4HB4 B;  1M7E A;  1KI1 B;  3G9W A;  2YS3 A;  3F0W A;  1AQC A;  3U8Z A;  3T06 A;  1DRO A;  3AU4 A;  2PZ1 A;  3SO6 A;  1V88 A;  2Y8G A;  2N23 A;  2W2X D;  1V5U A;  4MK0 A;  5JLJ B;  5D27 A;  1TJ6 A;  2LOX A;  1UNP A;  3LJU X;  4KAX B;  1GC6 A;  2IYB A;  3SV1 A;  4A6F A;  1J19 A;  1X86 A;  3TO1 A;  4KHB B;  2M14 A;  2EMS A;  1XOD A;  2VKI A;  1KZ7 A;  1E5W A;  1FHX A;  3M1I B;  1U5G A;  1ZSQ A;  1X1G A;  3ML4 A;  2DHJ A;  1MAI A;  1EGX A;  4KHA A;  4HB0 B;  4A6K A;  2D11 A;  4C0A A;  3AU5 A;  2EC1 A;  3PVW A;  2D9V A;  1DBH A;  1NTY A;  2YRY A;  1XCG A;  1QQG A;  1W1H A;  1MK9 B;  3U7D A;  4KHO A;  2GCJ A;  2ROZ B;  2LUL A;  2MDX A;  5FI1 A;  2N0Y A;  3FEH A;  2YS5 A;  4ZRK A;  4YL8 A;  5CLQ B;  5D3Y A;  1FGY A;  1W1G A;  3D8F A;  5CLL B;  2DHK A;  3IVF A;  1FAO A;  4PQ0 A;  3KY9 A;  1PLS A;  2FJL A;  3TFM A;  5C16 A;  2UZS A;  4F7H A;  4HAZ B;  2K00 A;  1TXD A;  5C5B B;  2RNR B;  1NI2 A;  3N7C A;  4GMV A;  1EVH A;  4EKU A;  4Z2N A;  4HAX B;  2XQN M;  3BJI A;  1P5T A;  2YT1 A;  2P8V A;  1OY2 A;  2H7D A;  4CHM A;  1LW3 A;  3QBV B;  5D3V A;  2K2J A;  2YS1 A;  2VRW B;  3O96 A;  4K17 A;  4TYZ A;  4WVF B;  1BWN A;  2LG1 A;  4HAU B;  5DI9 B;  5C5B A;  2LKO A;  2DKP A;  4IAP A;  3V5W A;  2CRF A;  2DKQ A;  1ZVR A;  3PVL A;  3QWM A;  5J3Y A;  5KQ1 A;  1NTV A;  4HB3 B;  1I7A A;  2J59 M;  2AL6 A;  3GYP A;  3HK0 A;  1H10 A;  1PFJ A;  2DN6 A;  4HHV A;  5J3T A;  1WJ1 A;  3TCA A;  4A6F B;  1ISN A;  4NSW A;  2JP2 A;  1V5M A;  2DYQ A;  2Y8F A;  1V61 A;  4WSF A;  2D10 A;  1UEF A;  3D8D A;  2D9Z A;  5KCV A;  2QKL A;  5D3X A;  4KVG B;  5D3W A;  1DYN A;  2J0M A;  4ZRI A;  2ZPY A;  2DTC A;  3VIA A;  2DYN A;  3DXC A;  4Z2M B;  2I5C A;  1WJM A;  5KQ4 A;  1Q67 A;  4HAY B;  3ZVR A;  2RLO A;  1U5F A;  3QIJ A;  1DDM A;  3A98 B;  1FHO A;  2G35 A;  1K5G B;  4YON A;  2J0J A;  4GMX B;  2RUK B;  4NY0 A;  2NMB A;  4H8S A;  2CY4 A;  3PG7 A;  4HAV B;  3FSS A;  4ZRJ A;  1XR0 B;  2ADZ A;  1FOE A;  2GJY A;  2RVB B;  2ROV A;  2YT0 A;  3KSY A;  2YF0 A;  4F7G A;  5DHA B;  4K81 A;  1MKE A;  3WYF B;  3PVU A;  3PZD A;  5DHF B; 
#chains in the Genus database with same CATH topology
 2I5F A;  3SUZ A;  2Z4D A;  1V89 A;  5L81 A;  1I2H A;  3KRX A;  2YT2 A;  4HB2 B;  2Y7B A;  1UNQ A;  4D0N B;  1GG3 A;  2COD A;  4DXA B;  5C79 A;  2KGX B;  3CIK A;  4CSQ A;  5HE1 A;  3MPX A;  2CY5 A;  2YVC A;  2DA0 A;  2W2W A;  2CAY A;  4P7I A;  5JHG A;  4QJ3 B;  4F7U P;  3HW2 B;  4HSI A;  3D8E A;  5C6R A;  3KZ1 A;  4BBK A;  1MIX A;  2LOZ A;  1QC6 A;  1ZYI A;  2DFK A;  2LYD A;  1XD4 A;  2D9W A;  1DDW A;  2Z0P A;  3X23 A;  1MPH A;  3DXE A;  3BIN A;  1IRS A;  1SGH A;  1MIZ B;  1Z87 A;  3F5R A;  2UZR A;  3A8Q A;  2KUP A;  3MDB C;  3PSC A;  3TVV A;  4CHJ A;  2H7E A;  5DIF B;  3ODX A;  4PNK A;  4TKN A;  1BAK A;  4K2P A;  2W2X C;  4IFS A;  2DX1 A;  1K5D B;  2HTH B;  2MKR A;  2K8E A;  2YSZ A;  2J0K A;  2Z0Q A;  1P3R A;  2COA A;  2HE7 A;  1Y5O A;  4GZU A;  2MFQ A;  4B6H A;  3GYO A;  4MY6 A;  1SHC A;  4L6E A;  1RRP B;  1GC7 A;  1N3H A;  1X11 A;  2UVM A;  2COF A;  1AWE A;  2EJ8 A;  2X18 A;  3SNH A;  1J0W A;  2DHI A;  1MI1 A;  1U29 A;  3VOQ A;  2Z0O A;  3NWD A;  5HE3 A;  2RGN B;  3WA0 A;  2P0D A;  1FB8 A;  3A58 A;  3ULB A;  5LOP B;  5J3Q A;  1U2B A;  3P6A A;  3ZDT A;  1DDV A;  4A5K A;  1U5E A;  1V5P A;  3UZT A;  1FHW A;  2OTX A;  2D9X A;  4DBB A;  3RCP A;  3P7Z A;  1Y19 B;  3PEG A;  4D6W A;  4WJ7 A;  1XX0 A;  1FGZ A;  2D9Y A;  1KZG A;  1B55 A;  4GPT B;  2DLW A;  1U27 A;  2I1K A;  1MK7 B;  2NZ8 B;  4HDO A;  3ODO A;  3ODW A;  4IOY X;  1WVH A;  2P0F A;  3KRW A;  1OMW A;  5JHH A;  2L2I A;  3AJ4 A;  5FI0 A;  3OAN A;  2QKM A;  1LB1 A;  4DX8 A;  2COC A;  1BTN A;  2KCJ A;  5HE0 A;  3SYX A;  2MWN B;  1W1D A;  1WI1 A;  2RSG A;  5HE2 A;  2L1C A;  1NU2 A;  3CXB B;  3NSU A;  5EFX A;  1UNR A;  3NWF A;  1BTK A;  2M38 A;  5GOW B;  2GS0 A;  2Q13 A;  1TQZ A;  3PP2 A;  1ZM0 A;  5JP4 A;  1M7R A;  1UPQ A;  3DXD A;  4CYE A;  3FM8 C;  1XKE A;  1X1F A;  1OQN A;  2DX5 A;  4HAT B;  1H4R A;  1ZC3 B;  4GN1 A;  4HAW B;  3ULC A;  2I1J A;  2IFS A;  3HQC A;  2P0H A;  2BCJ A;  1P6S A;  2D2Q A;  4XWX A;  4DX9 0;  2VSZ A;  2AEH A;  3A8P A;  2GCL A;  3NWA A;  5LON B;  1WGU A;  4Y94 A;  4K2O A;  2ELA A;  2ELB A;  2R0D A;  2Z59 A;  1ZC4 B;  1UPR A;  4EJN A;  4HDQ A;  1EAZ A;  4GXB A;  4QXA B;  1EF1 A;  2FJU B;  2R09 A;  2V76 A;  4A6H A;  1WG7 A;  2EMT A;  1U5D A;  1X05 A;  2E2X A;  1RJ2 A;  4MT7 A;  2D4Q A;  5I2S A;  2K2U A;  2OQB A;  1WGQ A;  4EMO A;  2Z14 A;  3TW1 A;  3B77 A;  5DH9 B;  1PMS A;  4HB4 B;  1M7E A;  1KI1 B;  3G9W A;  2YS3 A;  3F0W A;  1AQC A;  3U8Z A;  3T06 A;  1DRO A;  3AU4 A;  2PZ1 A;  4OSN A;  3SO6 A;  1V88 A;  5I2M A;  2Y8G A;  4QJ5 B;  2N23 A;  2W2X D;  1V5U A;  4MK0 A;  5JLJ B;  5D27 A;  1TJ6 A;  2LOX A;  1UNP A;  3LJU X;  4KAX B;  1GC6 A;  2IYB A;  3DCX A;  3SV1 A;  4A6F A;  1J19 A;  1X86 A;  3TO1 A;  1T77 A;  3OHM B;  4KHB B;  2M14 A;  2EMS A;  1XOD A;  2VKI A;  1KZ7 A;  1E5W A;  1FHX A;  3M1I B;  1U5G A;  1ZSQ A;  1X1G A;  2K49 A;  3ML4 A;  2DHJ A;  1MAI A;  1EGX A;  5IRS A;  4KHA A;  4HB0 B;  4A6K A;  2D11 A;  4C0A A;  3AU5 A;  2EC1 A;  3PVW A;  2D9V A;  1DBH A;  1NTY A;  2YRY A;  4KHB A;  1XCG A;  4GNK B;  1QQG A;  1W1H A;  1MK9 B;  3U7D A;  4KHO A;  2GCJ A;  2ROZ B;  2LUL A;  2MDX A;  5FI1 A;  2N0Y A;  3HIE A;  3FEH A;  2YS5 A;  4ZRK A;  5M4Y B;  4YL8 A;  5CLQ B;  5D3Y A;  1FGY A;  1W1G A;  3D8F A;  5CLL B;  2DHK A;  3IVF A;  1FAO A;  4PQ0 A;  3KY9 A;  1PLS A;  2FJL A;  3TFM A;  2Z13 A;  5C16 A;  2UZS A;  4F7H A;  4HAZ B;  2K00 A;  1TXD A;  5C5B B;  2RNR B;  1NI2 A;  3N7C A;  4GMV A;  1EVH A;  4EKU A;  4Z2N A;  4HAX B;  4QJ4 B;  2XQN M;  3BJI A;  4DIX A;  1P5T A;  3FVC A;  4OT1 A;  2YT1 A;  2P8V A;  1OY2 A;  2H7D A;  4CHM A;  2R2Y A;  1LW3 A;  3QBV B;  3HSA A;  5D3V A;  2K2J A;  2YS1 A;  2VRW B;  3O96 A;  4K17 A;  4TYZ A;  4WVF B;  1BWN A;  2LG1 A;  4HAU B;  5DI9 B;  5C5B A;  2LKO A;  2DKP A;  4IAP A;  3V5W A;  2CRF A;  2DKQ A;  1ZVR A;  3PVL A;  3QWM A;  5J3Y A;  5KQ1 A;  2KIE A;  1NTV A;  4HB3 B;  1I7A A;  2J59 M;  2AL6 A;  3GYP A;  3HK0 A;  3U12 A;  1H10 A;  1PFJ A;  2DN6 A;  4HHV A;  5J3T A;  1WJ1 A;  3TCA A;  4A6F B;  1ISN A;  4NSW A;  2JP2 A;  1V5M A;  2DYQ A;  2Y8F A;  2ZKM X;  1V61 A;  4WSF A;  2D10 A;  1UEF A;  3D8D A;  2D9Z A;  5KCV A;  2QKL A;  5D3X A;  4KVG B;  2KUQ A;  5D3W A;  2GUM A;  3NW8 A;  1DYN A;  2J0M A;  4L1R A;  4ZRI A;  2ZPY A;  2DTC A;  3VIA A;  2KR0 A;  2DYN A;  3DXC A;  4Z2M B;  2I5C A;  1WJM A;  5KQ4 A;  1Q67 A;  4HAY B;  3ZVR A;  4GOU A;  2RLO A;  1U5F A;  3QIJ A;  1DDM A;  3A98 B;  1FHO A;  2G35 A;  1K5G B;  4YON A;  2RRF A;  2J0J A;  4GMX B;  2RUK B;  4NY0 A;  2NMB A;  4H8S A;  2CY4 A;  3PG7 A;  4HAV B;  3FSS A;  4ZRJ A;  1XR0 B;  2ADZ A;  1FOE A;  2GJY A;  2RVB B;  2NBV A;  2ROV A;  2YT0 A;  5LG4 B;  3KSY A;  2YF0 A;  4F7G A;  5DHA B;  2KIG A;  4K81 A;  1MKE A;  3WYF B;  3PVU A;  3PZD A;  5DHF B; 
#chains in the Genus database with same CATH homology
 2I5F A;  3SUZ A;  1V89 A;  5L81 A;  1I2H A;  3KRX A;  4HB2 B;  2Y7B A;  1UNQ A;  4D0N B;  1GG3 A;  2COD A;  4DXA B;  5C79 A;  2KGX B;  3CIK A;  5HE1 A;  3MPX A;  2CY5 A;  2YVC A;  2DA0 A;  2W2W A;  2CAY A;  4P7I A;  5JHG A;  4F7U P;  3HW2 B;  3D8E A;  5C6R A;  3KZ1 A;  4BBK A;  1MIX A;  2LOZ A;  1QC6 A;  2DFK A;  2LYD A;  1XD4 A;  2D9W A;  1DDW A;  2Z0P A;  3X23 A;  1MPH A;  3DXE A;  3BIN A;  1IRS A;  1SGH A;  1MIZ B;  1Z87 A;  3F5R A;  2UZR A;  3A8Q A;  2KUP A;  3MDB C;  3PSC A;  3TVV A;  4CHJ A;  2H7E A;  5DIF B;  3ODX A;  4PNK A;  4TKN A;  1BAK A;  4K2P A;  2W2X C;  4IFS A;  2DX1 A;  1K5D B;  2HTH B;  2MKR A;  2YSZ A;  2J0K A;  2Z0Q A;  1P3R A;  2COA A;  2HE7 A;  1Y5O A;  4GZU A;  2MFQ A;  4B6H A;  3GYO A;  4MY6 A;  1SHC A;  4L6E A;  1RRP B;  1GC7 A;  1N3H A;  1X11 A;  2UVM A;  2COF A;  1AWE A;  2EJ8 A;  2X18 A;  3SNH A;  1J0W A;  2DHI A;  1U29 A;  3VOQ A;  2Z0O A;  5HE3 A;  2RGN B;  3WA0 A;  2P0D A;  1FB8 A;  3ULB A;  5LOP B;  5J3Q A;  1U2B A;  3P6A A;  3ZDT A;  1DDV A;  4A5K A;  1U5E A;  1V5P A;  3UZT A;  1FHW A;  2OTX A;  2D9X A;  4DBB A;  3RCP A;  3P7Z A;  1Y19 B;  3PEG A;  4WJ7 A;  1XX0 A;  1FGZ A;  2D9Y A;  1KZG A;  1B55 A;  4GPT B;  2DLW A;  1U27 A;  2I1K A;  1MK7 B;  2NZ8 B;  4HDO A;  3ODO A;  3ODW A;  4IOY X;  1WVH A;  2P0F A;  3KRW A;  1OMW A;  5JHH A;  2L2I A;  3AJ4 A;  5FI0 A;  3OAN A;  2QKM A;  1LB1 A;  4DX8 A;  2COC A;  1BTN A;  2KCJ A;  5HE0 A;  3SYX A;  2MWN B;  1W1D A;  1WI1 A;  2RSG A;  5HE2 A;  2L1C A;  1NU2 A;  3CXB B;  3NSU A;  5EFX A;  1UNR A;  1BTK A;  2M38 A;  5GOW B;  2GS0 A;  2Q13 A;  1TQZ A;  3PP2 A;  1ZM0 A;  5JP4 A;  1M7R A;  1UPQ A;  3DXD A;  4CYE A;  3FM8 C;  1XKE A;  1X1F A;  1OQN A;  2DX5 A;  4HAT B;  1H4R A;  1ZC3 B;  4GN1 A;  4HAW B;  3ULC A;  2I1J A;  2IFS A;  3HQC A;  2P0H A;  2BCJ A;  1P6S A;  2D2Q A;  4XWX A;  4DX9 0;  2VSZ A;  2AEH A;  3A8P A;  2GCL A;  5LON B;  1WGU A;  4Y94 A;  4K2O A;  2ELA A;  2ELB A;  2R0D A;  1ZC4 B;  1UPR A;  4EJN A;  4HDQ A;  1EAZ A;  4GXB A;  1EF1 A;  2R09 A;  2V76 A;  4A6H A;  1WG7 A;  2EMT A;  1U5D A;  1X05 A;  2E2X A;  1RJ2 A;  4MT7 A;  2D4Q A;  2K2U A;  2OQB A;  1WGQ A;  4EMO A;  3TW1 A;  5DH9 B;  1PMS A;  4HB4 B;  1M7E A;  1KI1 B;  3G9W A;  2YS3 A;  3F0W A;  1AQC A;  3U8Z A;  3T06 A;  1DRO A;  3AU4 A;  2PZ1 A;  3SO6 A;  1V88 A;  2Y8G A;  2N23 A;  2W2X D;  1V5U A;  4MK0 A;  5JLJ B;  5D27 A;  1TJ6 A;  2LOX A;  1UNP A;  3LJU X;  4KAX B;  1GC6 A;  2IYB A;  3SV1 A;  4A6F A;  1J19 A;  1X86 A;  3TO1 A;  4KHB B;  2M14 A;  2EMS A;  1XOD A;  2VKI A;  1KZ7 A;  1E5W A;  1FHX A;  3M1I B;  1U5G A;  1ZSQ A;  1X1G A;  3ML4 A;  2DHJ A;  1MAI A;  1EGX A;  4KHA A;  4HB0 B;  4A6K A;  2D11 A;  4C0A A;  3AU5 A;  2EC1 A;  3PVW A;  2D9V A;  1DBH A;  1NTY A;  2YRY A;  1XCG A;  1QQG A;  1W1H A;  1MK9 B;  3U7D A;  4KHO A;  2GCJ A;  2ROZ B;  2LUL A;  2MDX A;  5FI1 A;  2N0Y A;  3FEH A;  2YS5 A;  4ZRK A;  4YL8 A;  5CLQ B;  5D3Y A;  1FGY A;  1W1G A;  3D8F A;  5CLL B;  2DHK A;  3IVF A;  1FAO A;  4PQ0 A;  3KY9 A;  1PLS A;  2FJL A;  3TFM A;  5C16 A;  2UZS A;  4F7H A;  4HAZ B;  2K00 A;  1TXD A;  5C5B B;  2RNR B;  1NI2 A;  3N7C A;  4GMV A;  1EVH A;  4EKU A;  4Z2N A;  4HAX B;  2XQN M;  3BJI A;  1P5T A;  2YT1 A;  2P8V A;  1OY2 A;  2H7D A;  4CHM A;  1LW3 A;  3QBV B;  5D3V A;  2K2J A;  2YS1 A;  2VRW B;  3O96 A;  4K17 A;  4TYZ A;  4WVF B;  1BWN A;  2LG1 A;  4HAU B;  5DI9 B;  5C5B A;  2LKO A;  2DKP A;  4IAP A;  3V5W A;  2CRF A;  2DKQ A;  1ZVR A;  3PVL A;  3QWM A;  5J3Y A;  5KQ1 A;  1NTV A;  4HB3 B;  1I7A A;  2J59 M;  2AL6 A;  3GYP A;  3HK0 A;  1H10 A;  1PFJ A;  2DN6 A;  4HHV A;  5J3T A;  1WJ1 A;  3TCA A;  4A6F B;  1ISN A;  4NSW A;  2JP2 A;  1V5M A;  2DYQ A;  2Y8F A;  1V61 A;  4WSF A;  2D10 A;  1UEF A;  3D8D A;  2D9Z A;  5KCV A;  2QKL A;  5D3X A;  4KVG B;  5D3W A;  1DYN A;  2J0M A;  4ZRI A;  2ZPY A;  2DTC A;  3VIA A;  2DYN A;  3DXC A;  4Z2M B;  2I5C A;  1WJM A;  5KQ4 A;  1Q67 A;  4HAY B;  3ZVR A;  2RLO A;  1U5F A;  3QIJ A;  1DDM A;  3A98 B;  1FHO A;  2G35 A;  1K5G B;  4YON A;  2J0J A;  4GMX B;  2RUK B;  4NY0 A;  2NMB A;  4H8S A;  2CY4 A;  3PG7 A;  4HAV B;  3FSS A;  4ZRJ A;  1XR0 B;  2ADZ A;  1FOE A;  2GJY A;  2RVB B;  2ROV A;  2YT0 A;  3KSY A;  2YF0 A;  4F7G A;  5DHA B;  4K81 A;  1MKE A;  3WYF B;  3PVU A;  3PZD A;  5DHF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...