4HB0B

Crystal structure of crm1 inhibitor leptomycin b in complex with crm1(k541q,k542q,r543s,k545q,k548q,k579q)-ran-ranbp1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
121
structure length
121
Chain Sequence
b'EEDEEVLYKVRAKLFRFDKDAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/antibiotic
total genus 36
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4hb0B00
2DX1A 3F0WA 4KHAA 4GPTB 2AL6A 4MY6A 2RNRB 1FB8A 3IVFA 2Y8GA 1DROA 3TW1A 5HE3A 2OTXA 1NTYA 2EC1A 2LYDA 2YS5A 4Y94A 1V5UA 1ZC4B 3PG7A 5FI1A 5LOPB 2I5CA 2KCJA 4EKUA 2V76A 1LB1A 3DXCA 3OANA 3PVUA 4HAUB 4IFSA 1SHCA 2D10A 1U5EA 2M38A 3MDBC 1U5GA 2NZ8B 1WVHA 1DDWA 4B6HA 2MFQA 5J3YA 2D9YA 2DHKA 2ZPYA 3ULBA 3ULCA 4EMOA 1BTKA 1SGHA 1TQZA 1UEFA 3PEGA 1MK9B 1RJ2A 4HATB 2DKPA 3FSSA 2YT0A 4F7UP 4A6HA 5JHGA 2DHJA 1H10A 4HDQA 2HE7A 3KSYA 3TCAA 2COAA 5D3YA 3PSCA 1N3HA 4CHJA 4GZUA 1U5FA 1EAZA 4K2PA 1X11A 1MKEA 1MK7B 1W1GA 1EGXA 4GMXB 1MIXA 1XR0B 2RGNB 5DHFB 2NMBA 1I2HA 3D8EA 4KAXB 1M7EA 3KZ1A 4GMVA 4YONA 1QC6A 4HB0B 2OQBA 2N23A 4P7IA 2L1CA 4PQ0A 1WJMA 3CIKA 2MDXA 5LONB 2UZSA 1NI2A 1I7AA 4A6FA 1P5TA 1X05A 2K00A 1UPQA 2DN6A 1GG3A 1M7RA 5KCVA 1XODA 1ZC3B 2XQNM 5D3XA 2LULA 1Y5OA 1ISNA 2LG1A 2Y8FA 4Z2NA 4HAZB 4IOYX 1GC7A 2RLOA 2COFA 4NY0A 2EJ8A 1W1HA 1WJ1A 3GYPA 2VKIA 2YVCA 4XWXA 2GCLA 3X23A 4EJNA 2DX5A 4Z2MB 2YT1A 3PP2A 1MIZB 3BJIA 1RRPB 2CRFA 3ODXA 1WGQA 3PVWA 3FM8C 1OY2A 2W2WA 2ELBA 2RVBB 2ROVA 5D3WA 4ZRJA 2LKOA 2YF0A 2PZ1A 1TXDA 5J3TA 1MPHA 1ZM0A 4A6FB 1FOEA 1Y19B 3KY9A 2IFSA 3KRWA 4HAYB 2DYNA 2D4QA 2GCJA 3SO6A 1PMSA 2H7DA 3BINA 2R09A 2GS0A 1MAIA 2YS1A 5JP4A 3TO1A 2DHIA 3AJ4A 1BWNA 1X86A 3A8PA 4IAPA 1QQGA 1WGUA 1UPRA 2W2XD 1UNRA 5HE0A 1XX0A 2KGXB 5L81A 2DYQA 4DX8A 2QKLA 2YRYA 3D8FA 4HB4B 3U8ZA 2EMSA 4ZRKA 4PNKA 2CAYA 5J3QA 2J0JA 4TKNA 4H8SA 1OQNA 2GJYA 4KHBB 4K17A 2LOXA 2I1KA 4MK0A 1V61A 2P0HA 4HDOA 5DIFB 3P7ZA 5C6RA 3UZTA 2DFKA 2EMTA 3WYFB 5DI9B 4A5KA 2Z0QA 3V5WA 5FI0A 5C16A 1KI1B 2H7EA 1PLSA 3FEHA 2P0DA 3WA0A 1P3RA 1ZSQA 1FHXA 1LW3A 3N7CA 3PZDA 2HTHB 2N0YA 4DBBA 3P6AA 1Q67A 4K2OA 5DHAB 2G35A 3HQCA 4BBKA 2FJLA 1FHWA 2J0KA 2KUPA 2Z0OA 5D3VA 3A98B 3NSUA 2Z0PA 5CLQB 1DBHA 2LOZA 2Q13A 1XKEA 3SUZA 2DLWA 3SYXA 1ZVRA 2BCJA 4GXBA 4F7HA 5C5BA 4KVGB 3T06A 2IYBA 1FGYA 1EVHA 1XD4A 2D9WA 4CYEA 3DXDA 3PVLA 2CODA 2D9VA 3AU5A 2CY4A 3TFMA 1WI1A 2R0DA 1IRSA 2DKQA 2RUKB 2ROZB 4HAWB 2D9XA 3MPXA 2J59M 2L2IA 4HB3B 5KQ1A 2COCA 1U2BA 4F7GA 4DXAB 3O96A 2X18A 1GC6A 2M14A 5GOWB 2Y7BA 5HE1A 5DH9B 1U29A 1NTVA 4WVFB 2D2QA 5JLJB 3QBVB 3QWMA 1EF1A 2D9ZA 2I5FA 4YL8A 3ODWA 2K2UA 3VIAA 4C0AA 5C5BB 1Z87A 3LJUX 1AQCA 4CHMA 3ZVRA 1KZGA 1B55A 4MT7A 2VSZA 3ML4A 1OMWA 4HB2B 1AWEA 3GYOA 2ELAA 1K5GB 4A6KA 1X1GA 1KZ7A 1V88A 3G9WA 1X1FA 5KQ4A 3KRXA 2P8VA 3HW2B 3ODOA 4NSWA 3SV1A 3U7DA 3F5RA 3SNHA 1XCGA 2E2XA 1P6SA 1U5DA 1DDVA 3TVVA 1BAKA 1WG7A 4KHOA 4HHVA 1J19A 3A8QA 3HK0A 1FAOA 2D11A 1UNQA 4WJ7A 2AEHA 3VOQA 3RCPA 1J0WA 2JP2A 2MKRA 5D27A 1V5PA 1PFJA 2I1JA 1DYNA 4HAVB 2W2XC 1H4RA 1K5DB 1U27A 2DTCA 3QIJA 4L6EA 5C79A 3CXBB 1FGZA 4ZRIA 2DA0A 1BTNA 3D8DA 1NU2A 2K2JA 2CY5A 4D0NB 1DDMA 2QKMA 3AU4A 1E5WA 2UVMA 1W1DA 1V5MA 2YSZA 3DXEA 4TYZA 2J0MA 5HE2A 4WSFA 2VRWB 5EFXA 2P0FA 4DX90 5JHHA 3ZDTA 4K81A 4HAXB 1FHOA 1TJ6A 1UNPA 2RSGA 5CLLB 2ADZA 2YS3A 3M1IB 2MWNB 4GN1A 2UZRA 1V89A
chains in the Genus database with same CATH superfamily
2DX1A 3F0WA 4QJ3B 4HSIA 4KHAA 4D6WA 4GPTB 4CSQA 2AL6A 5I2MA 4MY6A 2RNRB 1FB8A 3IVFA 2Y8GA 4DIXA 1DROA 4GNKB 3TW1A 5HE3A 2OTXA 1NTYA 4KHBA 2Z14A 2EC1A 2LYDA 2YS5A 4Y94A 5IRSA 1V5UA 1ZC4B 3PG7A 5FI1A 5LOPB 2I5CA 2KCJA 4EKUA 2V76A 1LB1A 3DXCA 3OANA 3PVUA 4HAUB 4IFSA 1SHCA 2D10A 1U5EA 2M38A 3MDBC 1U5GA 2NZ8B 1WVHA 1DDWA 4B6HA 2MFQA 5J3YA 2D9YA 2DHKA 2ZPYA 3ULBA 3ULCA 4EMOA 1BTKA 1SGHA 1TQZA 2GUMA 1UEFA 2KIGA 3PEGA 1MK9B 1RJ2A 4HATB 4OSNA 2DKPA 3FSSA 2YT0A 4F7UP 4A6HA 5JHGA 2DHJA 1H10A 4HDQA 2HE7A 3KSYA 3B77A 3TCAA 2COAA 5D3YA 3PSCA 1N3HA 4CHJA 4GZUA 1U5FA 1EAZA 4K2PA 1X11A 1MKEA 1MK7B 1W1GA 1EGXA 4GMXB 1MIXA 1XR0B 1T77A 2RGNB 5DHFB 2NMBA 1I2HA 2KIEA 2K49A 3D8EA 4KAXB 1M7EA 3KZ1A 4GMVA 4YONA 1QC6A 4HB0B 2OQBA 2N23A 4P7IA 2L1CA 4PQ0A 5LG4B 1WJMA 3CIKA 2MDXA 5LONB 2UZSA 1NI2A 1I7AA 4A6FA 1P5TA 1X05A 2K00A 1UPQA 2DN6A 1GG3A 1M7RA 5KCVA 1XODA 1ZC3B 2XQNM 5D3XA 2LULA 1Y5OA 1ISNA 2LG1A 2Y8FA 4Z2NA 3NW8A 4HAZB 4IOYX 1GC7A 2RLOA 2COFA 4NY0A 2EJ8A 1W1HA 1WJ1A 2Z4DA 3GYPA 2VKIA 2YVCA 4XWXA 2GCLA 4L1RA 3X23A 4EJNA 2DX5A 4Z2MB 2YT1A 3PP2A 1MIZB 3U12A 3BJIA 1RRPB 2CRFA 3ODXA 3OHMB 1WGQA 3PVWA 3FM8C 1OY2A 3A58A 2W2WA 2ELBA 2RVBB 2ROVA 5D3WA 4ZRJA 2LKOA 2YF0A 2PZ1A 1TXDA 5J3TA 1MPHA 1ZM0A 4A6FB 1FOEA 1Y19B 3KY9A 2IFSA 3KRWA 4HAYB 2DYNA 2D4QA 2GCJA 3SO6A 1PMSA 2H7DA 3BINA 2R09A 2GS0A 1MAIA 2YS1A 5JP4A 3TO1A 2DHIA 3AJ4A 2RRFA 1BWNA 1X86A 3A8PA 4IAPA 1QQGA 1WGUA 1UPRA 2W2XD 1UNRA 5HE0A 1XX0A 2KGXB 5L81A 2DYQA 4DX8A 2QKLA 2YRYA 3D8FA 4HB4B 3U8ZA 2EMSA 4ZRKA 4PNKA 2CAYA 5J3QA 2J0JA 2YT2A 4TKNA 4H8SA 2R2YA 1OQNA 2GJYA 4KHBB 4K17A 2LOXA 2I1KA 4MK0A 1V61A 2P0HA 4HDOA 5DIFB 3P7ZA 5C6RA 3UZTA 2DFKA 2EMTA 3WYFB 5DI9B 4A5KA 2FJUB 2Z0QA 3V5WA 5FI0A 5C16A 1KI1B 2H7EA 1PLSA 3FEHA 2P0DA 3WA0A 1P3RA 1ZSQA 1FHXA 1LW3A 3N7CA 3PZDA 2HTHB 2N0YA 4DBBA 3P6AA 1Q67A 4K2OA 5DHAB 3FVCA 2G35A 3HQCA 4OT1A 4BBKA 2FJLA 1FHWA 2J0KA 2KUPA 2Z0OA 5D3VA 3A98B 3NSUA 2Z0PA 5CLQB 1DBHA 2LOZA 2Q13A 1XKEA 3SUZA 2DLWA 3SYXA 1ZVRA 2BCJA 4GXBA 4F7HA 5C5BA 4KVGB 3T06A 2IYBA 1FGYA 1EVHA 1XD4A 2D9WA 4CYEA 3DXDA 3PVLA 2CODA 2D9VA 3AU5A 2CY4A 3TFMA 1WI1A 2R0DA 2NBVA 1IRSA 2DKQA 2RUKB 2ROZB 4HAWB 2D9XA 3MPXA 2J59M 2L2IA 4HB3B 5KQ1A 2COCA 1U2BA 4F7GA 4DXAB 3O96A 2X18A 1GC6A 2M14A 5GOWB 2Y7BA 5HE1A 5DH9B 1U29A 1NTVA 4WVFB 2D2QA 5JLJB 3QBVB 3QWMA 1EF1A 2D9ZA 2I5FA 4YL8A 3ODWA 2K2UA 2KR0A 3VIAA 4C0AA 5C5BB 1Z87A 3LJUX 3HIEA 2Z13A 1AQCA 4CHMA 3ZVRA 1KZGA 1B55A 4MT7A 2VSZA 5I2SA 3ML4A 4QXAB 1OMWA 3NWFA 4HB2B 1AWEA 3GYOA 2ELAA 1K5GB 4A6KA 1X1GA 1KZ7A 1V88A 3NWDA 3G9WA 1X1FA 4QJ4B 5KQ4A 3KRXA 2P8VA 3HW2B 3ODOA 4NSWA 3SV1A 3U7DA 3F5RA 3SNHA 4QJ5B 1XCGA 2E2XA 1P6SA 1U5DA 1DDVA 3TVVA 1BAKA 1WG7A 4KHOA 4HHVA 1J19A 3A8QA 3HSAA 3HK0A 1FAOA 2D11A 1UNQA 4WJ7A 2AEHA 4GOUA 3VOQA 3RCPA 1J0WA 2JP2A 2MKRA 5D27A 1V5PA 1PFJA 2I1JA 1DYNA 4HAVB 2W2XC 5M4YB 1H4RA 1K5DB 1U27A 2DTCA 2ZKMX 3QIJA 4L6EA 5C79A 3CXBB 1FGZA 4ZRIA 2KUQA 2DA0A 1BTNA 3DCXA 3NWAA 3D8DA 1NU2A 2K2JA 2CY5A 4D0NB 1DDMA 2QKMA 3AU4A 1E5WA 2UVMA 1W1DA 1MI1A 1V5MA 2YSZA 3DXEA 1ZYIA 4TYZA 2J0MA 5HE2A 4WSFA 2VRWB 5EFXA 2P0FA 4DX90 5JHHA 3ZDTA 2K8EA 4K81A 4HAXB 1FHOA 1TJ6A 1UNPA 2RSGA 5CLLB 2ADZA 2YS3A 3M1IB 2Z59A 2MWNB 4GN1A 2UZRA 1V89A
chains in the Genus database with same CATH topology
2DX1A 3F0WA 4KHAA 4GPTB 2AL6A 4MY6A 2RNRB 1FB8A 3IVFA 2Y8GA 1DROA 3TW1A 5HE3A 2OTXA 1NTYA 2EC1A 2LYDA 2YS5A 4Y94A 1V5UA 1ZC4B 3PG7A 5FI1A 5LOPB 2I5CA 2KCJA 4EKUA 2V76A 1LB1A 3DXCA 3OANA 3PVUA 4HAUB 4IFSA 1SHCA 2D10A 1U5EA 2M38A 3MDBC 1U5GA 2NZ8B 1WVHA 1DDWA 4B6HA 2MFQA 5J3YA 2D9YA 2DHKA 2ZPYA 3ULBA 3ULCA 4EMOA 1BTKA 1SGHA 1TQZA 1UEFA 3PEGA 1MK9B 1RJ2A 4HATB 2DKPA 3FSSA 2YT0A 4F7UP 4A6HA 5JHGA 2DHJA 1H10A 4HDQA 2HE7A 3KSYA 3TCAA 2COAA 5D3YA 3PSCA 1N3HA 4CHJA 4GZUA 1U5FA 1EAZA 4K2PA 1X11A 1MKEA 1MK7B 1W1GA 1EGXA 4GMXB 1MIXA 1XR0B 2RGNB 5DHFB 2NMBA 1I2HA 3D8EA 4KAXB 1M7EA 3KZ1A 4GMVA 4YONA 1QC6A 4HB0B 2OQBA 2N23A 4P7IA 2L1CA 4PQ0A 1WJMA 3CIKA 2MDXA 5LONB 2UZSA 1NI2A 1I7AA 4A6FA 1P5TA 1X05A 2K00A 1UPQA 2DN6A 1GG3A 1M7RA 5KCVA 1XODA 1ZC3B 2XQNM 5D3XA 2LULA 1Y5OA 1ISNA 2LG1A 2Y8FA 4Z2NA 4HAZB 4IOYX 1GC7A 2RLOA 2COFA 4NY0A 2EJ8A 1W1HA 1WJ1A 3GYPA 2VKIA 2YVCA 4XWXA 2GCLA 3X23A 4EJNA 2DX5A 4Z2MB 2YT1A 3PP2A 1MIZB 3BJIA 1RRPB 2CRFA 3ODXA 1WGQA 3PVWA 3FM8C 1OY2A 2W2WA 2ELBA 2RVBB 2ROVA 5D3WA 4ZRJA 2LKOA 2YF0A 2PZ1A 1TXDA 5J3TA 1MPHA 1ZM0A 4A6FB 1FOEA 1Y19B 3KY9A 2IFSA 3KRWA 4HAYB 2DYNA 2D4QA 2GCJA 3SO6A 1PMSA 2H7DA 3BINA 2R09A 2GS0A 1MAIA 2YS1A 5JP4A 3TO1A 2DHIA 3AJ4A 1BWNA 1X86A 3A8PA 4IAPA 1QQGA 1WGUA 1UPRA 2W2XD 1UNRA 5HE0A 1XX0A 2KGXB 5L81A 2DYQA 4DX8A 2QKLA 2YRYA 3D8FA 4HB4B 3U8ZA 2EMSA 4ZRKA 4PNKA 2CAYA 5J3QA 2J0JA 4TKNA 4H8SA 1OQNA 2GJYA 4KHBB 4K17A 2LOXA 2I1KA 4MK0A 1V61A 2P0HA 4HDOA 5DIFB 3P7ZA 5C6RA 3UZTA 2DFKA 2EMTA 3WYFB 5DI9B 4A5KA 2Z0QA 3V5WA 5FI0A 5C16A 1KI1B 2H7EA 1PLSA 3FEHA 2P0DA 3WA0A 1P3RA 1ZSQA 1FHXA 1LW3A 3N7CA 3PZDA 2HTHB 2N0YA 4DBBA 3P6AA 1Q67A 4K2OA 5DHAB 2G35A 3HQCA 4BBKA 2FJLA 1FHWA 2J0KA 2KUPA 2Z0OA 5D3VA 3A98B 3NSUA 2Z0PA 5CLQB 1DBHA 2LOZA 2Q13A 1XKEA 3SUZA 2DLWA 3SYXA 1ZVRA 2BCJA 4GXBA 4F7HA 5C5BA 4KVGB 3T06A 2IYBA 1FGYA 1EVHA 1XD4A 2D9WA 4CYEA 3DXDA 3PVLA 2CODA 2D9VA 3AU5A 2CY4A 3TFMA 1WI1A 2R0DA 1IRSA 2DKQA 2RUKB 2ROZB 4HAWB 2D9XA 3MPXA 2J59M 2L2IA 4HB3B 5KQ1A 2COCA 1U2BA 4F7GA 4DXAB 3O96A 2X18A 1GC6A 2M14A 5GOWB 2Y7BA 5HE1A 5DH9B 1U29A 1NTVA 4WVFB 2D2QA 5JLJB 3QBVB 3QWMA 1EF1A 2D9ZA 2I5FA 4YL8A 3ODWA 2K2UA 3VIAA 4C0AA 5C5BB 1Z87A 3LJUX 1AQCA 4CHMA 3ZVRA 1KZGA 1B55A 4MT7A 2VSZA 3ML4A 1OMWA 4HB2B 1AWEA 3GYOA 2ELAA 1K5GB 4A6KA 1X1GA 1KZ7A 1V88A 3G9WA 1X1FA 5KQ4A 3KRXA 2P8VA 3HW2B 3ODOA 4NSWA 3SV1A 3U7DA 3F5RA 3SNHA 1XCGA 2E2XA 1P6SA 1U5DA 1DDVA 3TVVA 1BAKA 1WG7A 4KHOA 4HHVA 1J19A 3A8QA 3HK0A 1FAOA 2D11A 1UNQA 4WJ7A 2AEHA 3VOQA 3RCPA 1J0WA 2JP2A 2MKRA 5D27A 1V5PA 1PFJA 2I1JA 1DYNA 4HAVB 2W2XC 1H4RA 1K5DB 1U27A 2DTCA 3QIJA 4L6EA 5C79A 3CXBB 1FGZA 4ZRIA 2DA0A 1BTNA 3D8DA 1NU2A 2K2JA 2CY5A 4D0NB 1DDMA 2QKMA 3AU4A 1E5WA 2UVMA 1W1DA 1V5MA 2YSZA 3DXEA 4TYZA 2J0MA 5HE2A 4WSFA 2VRWB 5EFXA 2P0FA 4DX90 5JHHA 3ZDTA 4K81A 4HAXB 1FHOA 1TJ6A 1UNPA 2RSGA 5CLLB 2ADZA 2YS3A 3M1IB 2MWNB 4GN1A 2UZRA 1V89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DX1 A;  3F0W A;  4KHA A;  4GPT B;  2AL6 A;  4MY6 A;  2RNR B;  1FB8 A;  3IVF A;  2Y8G A;  1DRO A;  3TW1 A;  5HE3 A;  2OTX A;  1NTY A;  2EC1 A;  2LYD A;  2YS5 A;  4Y94 A;  1V5U A;  1ZC4 B;  3PG7 A;  5FI1 A;  5LOP B;  2I5C A;  2KCJ A;  4EKU A;  2V76 A;  1LB1 A;  3DXC A;  3OAN A;  3PVU A;  4HAU B;  4IFS A;  1SHC A;  2D10 A;  1U5E A;  2M38 A;  3MDB C;  1U5G A;  2NZ8 B;  1WVH A;  1DDW A;  4B6H A;  2MFQ A;  5J3Y A;  2D9Y A;  2DHK A;  2ZPY A;  3ULB A;  3ULC A;  4EMO A;  1BTK A;  1SGH A;  1TQZ A;  1UEF A;  3PEG A;  1MK9 B;  1RJ2 A;  4HAT B;  2DKP A;  3FSS A;  2YT0 A;  4F7U P;  4A6H A;  5JHG A;  2DHJ A;  1H10 A;  4HDQ A;  2HE7 A;  3KSY A;  3TCA A;  2COA A;  5D3Y A;  3PSC A;  1N3H A;  4CHJ A;  4GZU A;  1U5F A;  1EAZ A;  4K2P A;  1X11 A;  1MKE A;  1MK7 B;  1W1G A;  1EGX A;  4GMX B;  1MIX A;  1XR0 B;  2RGN B;  5DHF B;  2NMB A;  1I2H A;  3D8E A;  4KAX B;  1M7E A;  3KZ1 A;  4GMV A;  4YON A;  1QC6 A;  4HB0 B;  2OQB A;  2N23 A;  4P7I A;  2L1C A;  4PQ0 A;  1WJM A;  3CIK A;  2MDX A;  5LON B;  2UZS A;  1NI2 A;  1I7A A;  4A6F A;  1P5T A;  1X05 A;  2K00 A;  1UPQ A;  2DN6 A;  1GG3 A;  1M7R A;  5KCV A;  1XOD A;  1ZC3 B;  2XQN M;  5D3X A;  2LUL A;  1Y5O A;  1ISN A;  2LG1 A;  2Y8F A;  4Z2N A;  4HAZ B;  4IOY X;  1GC7 A;  2RLO A;  2COF A;  4NY0 A;  2EJ8 A;  1W1H A;  1WJ1 A;  3GYP A;  2VKI A;  2YVC A;  4XWX A;  2GCL A;  3X23 A;  4EJN A;  2DX5 A;  4Z2M B;  2YT1 A;  3PP2 A;  1MIZ B;  3BJI A;  1RRP B;  2CRF A;  3ODX A;  1WGQ A;  3PVW A;  3FM8 C;  1OY2 A;  2W2W A;  2ELB A;  2RVB B;  2ROV A;  5D3W A;  4ZRJ A;  2LKO A;  2YF0 A;  2PZ1 A;  1TXD A;  5J3T A;  1MPH A;  1ZM0 A;  4A6F B;  1FOE A;  1Y19 B;  3KY9 A;  2IFS A;  3KRW A;  4HAY B;  2DYN A;  2D4Q A;  2GCJ A;  3SO6 A;  1PMS A;  2H7D A;  3BIN A;  2R09 A;  2GS0 A;  1MAI A;  2YS1 A;  5JP4 A;  3TO1 A;  2DHI A;  3AJ4 A;  1BWN A;  1X86 A;  3A8P A;  4IAP A;  1QQG A;  1WGU A;  1UPR A;  2W2X D;  1UNR A;  5HE0 A;  1XX0 A;  2KGX B;  5L81 A;  2DYQ A;  4DX8 A;  2QKL A;  2YRY A;  3D8F A;  4HB4 B;  3U8Z A;  2EMS A;  4ZRK A;  4PNK A;  2CAY A;  5J3Q A;  2J0J A;  4TKN A;  4H8S A;  1OQN A;  2GJY A;  4KHB B;  4K17 A;  2LOX A;  2I1K A;  4MK0 A;  1V61 A;  2P0H A;  4HDO A;  5DIF B;  3P7Z A;  5C6R A;  3UZT A;  2DFK A;  2EMT A;  3WYF B;  5DI9 B;  4A5K A;  2Z0Q A;  3V5W A;  5FI0 A;  5C16 A;  1KI1 B;  2H7E A;  1PLS A;  3FEH A;  2P0D A;  3WA0 A;  1P3R A;  1ZSQ A;  1FHX A;  1LW3 A;  3N7C A;  3PZD A;  2HTH B;  2N0Y A;  4DBB A;  3P6A A;  1Q67 A;  4K2O A;  5DHA B;  2G35 A;  3HQC A;  4BBK A;  2FJL A;  1FHW A;  2J0K A;  2KUP A;  2Z0O A;  5D3V A;  3A98 B;  3NSU A;  2Z0P A;  5CLQ B;  1DBH A;  2LOZ A;  2Q13 A;  1XKE A;  3SUZ A;  2DLW A;  3SYX A;  1ZVR A;  2BCJ A;  4GXB A;  4F7H A;  5C5B A;  4KVG B;  3T06 A;  2IYB A;  1FGY A;  1EVH A;  1XD4 A;  2D9W A;  4CYE A;  3DXD A;  3PVL A;  2COD A;  2D9V A;  3AU5 A;  2CY4 A;  3TFM A;  1WI1 A;  2R0D A;  1IRS A;  2DKQ A;  2RUK B;  2ROZ B;  4HAW B;  2D9X A;  3MPX A;  2J59 M;  2L2I A;  4HB3 B;  5KQ1 A;  2COC A;  1U2B A;  4F7G A;  4DXA B;  3O96 A;  2X18 A;  1GC6 A;  2M14 A;  5GOW B;  2Y7B A;  5HE1 A;  5DH9 B;  1U29 A;  1NTV A;  4WVF B;  2D2Q A;  5JLJ B;  3QBV B;  3QWM A;  1EF1 A;  2D9Z A;  2I5F A;  4YL8 A;  3ODW A;  2K2U A;  3VIA A;  4C0A A;  5C5B B;  1Z87 A;  3LJU X;  1AQC A;  4CHM A;  3ZVR A;  1KZG A;  1B55 A;  4MT7 A;  2VSZ A;  3ML4 A;  1OMW A;  4HB2 B;  1AWE A;  3GYO A;  2ELA A;  1K5G B;  4A6K A;  1X1G A;  1KZ7 A;  1V88 A;  3G9W A;  1X1F A;  5KQ4 A;  3KRX A;  2P8V A;  3HW2 B;  3ODO A;  4NSW A;  3SV1 A;  3U7D A;  3F5R A;  3SNH A;  1XCG A;  2E2X A;  1P6S A;  1U5D A;  1DDV A;  3TVV A;  1BAK A;  1WG7 A;  4KHO A;  4HHV A;  1J19 A;  3A8Q A;  3HK0 A;  1FAO A;  2D11 A;  1UNQ A;  4WJ7 A;  2AEH A;  3VOQ A;  3RCP A;  1J0W A;  2JP2 A;  2MKR A;  5D27 A;  1V5P A;  1PFJ A;  2I1J A;  1DYN A;  4HAV B;  2W2X C;  1H4R A;  1K5D B;  1U27 A;  2DTC A;  3QIJ A;  4L6E A;  5C79 A;  3CXB B;  1FGZ A;  4ZRI A;  2DA0 A;  1BTN A;  3D8D A;  1NU2 A;  2K2J A;  2CY5 A;  4D0N B;  1DDM A;  2QKM A;  3AU4 A;  1E5W A;  2UVM A;  1W1D A;  1V5M A;  2YSZ A;  3DXE A;  4TYZ A;  2J0M A;  5HE2 A;  4WSF A;  2VRW B;  5EFX A;  2P0F A;  4DX9 0;  5JHH A;  3ZDT A;  4K81 A;  4HAX B;  1FHO A;  1TJ6 A;  1UNP A;  2RSG A;  5CLL B;  2ADZ A;  2YS3 A;  3M1I B;  2MWN B;  4GN1 A;  2UZR A;  1V89 A; 
#chains in the Genus database with same CATH topology
 2DX1 A;  3F0W A;  4QJ3 B;  4HSI A;  4KHA A;  4D6W A;  4GPT B;  4CSQ A;  2AL6 A;  5I2M A;  4MY6 A;  2RNR B;  1FB8 A;  3IVF A;  2Y8G A;  4DIX A;  1DRO A;  4GNK B;  3TW1 A;  5HE3 A;  2OTX A;  1NTY A;  4KHB A;  2Z14 A;  2EC1 A;  2LYD A;  2YS5 A;  4Y94 A;  5IRS A;  1V5U A;  1ZC4 B;  3PG7 A;  5FI1 A;  5LOP B;  2I5C A;  2KCJ A;  4EKU A;  2V76 A;  1LB1 A;  3DXC A;  3OAN A;  3PVU A;  4HAU B;  4IFS A;  1SHC A;  2D10 A;  1U5E A;  2M38 A;  3MDB C;  1U5G A;  2NZ8 B;  1WVH A;  1DDW A;  4B6H A;  2MFQ A;  5J3Y A;  2D9Y A;  2DHK A;  2ZPY A;  3ULB A;  3ULC A;  4EMO A;  1BTK A;  1SGH A;  1TQZ A;  2GUM A;  1UEF A;  2KIG A;  3PEG A;  1MK9 B;  1RJ2 A;  4HAT B;  4OSN A;  2DKP A;  3FSS A;  2YT0 A;  4F7U P;  4A6H A;  5JHG A;  2DHJ A;  1H10 A;  4HDQ A;  2HE7 A;  3KSY A;  3B77 A;  3TCA A;  2COA A;  5D3Y A;  3PSC A;  1N3H A;  4CHJ A;  4GZU A;  1U5F A;  1EAZ A;  4K2P A;  1X11 A;  1MKE A;  1MK7 B;  1W1G A;  1EGX A;  4GMX B;  1MIX A;  1XR0 B;  1T77 A;  2RGN B;  5DHF B;  2NMB A;  1I2H A;  2KIE A;  2K49 A;  3D8E A;  4KAX B;  1M7E A;  3KZ1 A;  4GMV A;  4YON A;  1QC6 A;  4HB0 B;  2OQB A;  2N23 A;  4P7I A;  2L1C A;  4PQ0 A;  5LG4 B;  1WJM A;  3CIK A;  2MDX A;  5LON B;  2UZS A;  1NI2 A;  1I7A A;  4A6F A;  1P5T A;  1X05 A;  2K00 A;  1UPQ A;  2DN6 A;  1GG3 A;  1M7R A;  5KCV A;  1XOD A;  1ZC3 B;  2XQN M;  5D3X A;  2LUL A;  1Y5O A;  1ISN A;  2LG1 A;  2Y8F A;  4Z2N A;  3NW8 A;  4HAZ B;  4IOY X;  1GC7 A;  2RLO A;  2COF A;  4NY0 A;  2EJ8 A;  1W1H A;  1WJ1 A;  2Z4D A;  3GYP A;  2VKI A;  2YVC A;  4XWX A;  2GCL A;  4L1R A;  3X23 A;  4EJN A;  2DX5 A;  4Z2M B;  2YT1 A;  3PP2 A;  1MIZ B;  3U12 A;  3BJI A;  1RRP B;  2CRF A;  3ODX A;  3OHM B;  1WGQ A;  3PVW A;  3FM8 C;  1OY2 A;  3A58 A;  2W2W A;  2ELB A;  2RVB B;  2ROV A;  5D3W A;  4ZRJ A;  2LKO A;  2YF0 A;  2PZ1 A;  1TXD A;  5J3T A;  1MPH A;  1ZM0 A;  4A6F B;  1FOE A;  1Y19 B;  3KY9 A;  2IFS A;  3KRW A;  4HAY B;  2DYN A;  2D4Q A;  2GCJ A;  3SO6 A;  1PMS A;  2H7D A;  3BIN A;  2R09 A;  2GS0 A;  1MAI A;  2YS1 A;  5JP4 A;  3TO1 A;  2DHI A;  3AJ4 A;  2RRF A;  1BWN A;  1X86 A;  3A8P A;  4IAP A;  1QQG A;  1WGU A;  1UPR A;  2W2X D;  1UNR A;  5HE0 A;  1XX0 A;  2KGX B;  5L81 A;  2DYQ A;  4DX8 A;  2QKL A;  2YRY A;  3D8F A;  4HB4 B;  3U8Z A;  2EMS A;  4ZRK A;  4PNK A;  2CAY A;  5J3Q A;  2J0J A;  2YT2 A;  4TKN A;  4H8S A;  2R2Y A;  1OQN A;  2GJY A;  4KHB B;  4K17 A;  2LOX A;  2I1K A;  4MK0 A;  1V61 A;  2P0H A;  4HDO A;  5DIF B;  3P7Z A;  5C6R A;  3UZT A;  2DFK A;  2EMT A;  3WYF B;  5DI9 B;  4A5K A;  2FJU B;  2Z0Q A;  3V5W A;  5FI0 A;  5C16 A;  1KI1 B;  2H7E A;  1PLS A;  3FEH A;  2P0D A;  3WA0 A;  1P3R A;  1ZSQ A;  1FHX A;  1LW3 A;  3N7C A;  3PZD A;  2HTH B;  2N0Y A;  4DBB A;  3P6A A;  1Q67 A;  4K2O A;  5DHA B;  3FVC A;  2G35 A;  3HQC A;  4OT1 A;  4BBK A;  2FJL A;  1FHW A;  2J0K A;  2KUP A;  2Z0O A;  5D3V A;  3A98 B;  3NSU A;  2Z0P A;  5CLQ B;  1DBH A;  2LOZ A;  2Q13 A;  1XKE A;  3SUZ A;  2DLW A;  3SYX A;  1ZVR A;  2BCJ A;  4GXB A;  4F7H A;  5C5B A;  4KVG B;  3T06 A;  2IYB A;  1FGY A;  1EVH A;  1XD4 A;  2D9W A;  4CYE A;  3DXD A;  3PVL A;  2COD A;  2D9V A;  3AU5 A;  2CY4 A;  3TFM A;  1WI1 A;  2R0D A;  2NBV A;  1IRS A;  2DKQ A;  2RUK B;  2ROZ B;  4HAW B;  2D9X A;  3MPX A;  2J59 M;  2L2I A;  4HB3 B;  5KQ1 A;  2COC A;  1U2B A;  4F7G A;  4DXA B;  3O96 A;  2X18 A;  1GC6 A;  2M14 A;  5GOW B;  2Y7B A;  5HE1 A;  5DH9 B;  1U29 A;  1NTV A;  4WVF B;  2D2Q A;  5JLJ B;  3QBV B;  3QWM A;  1EF1 A;  2D9Z A;  2I5F A;  4YL8 A;  3ODW A;  2K2U A;  2KR0 A;  3VIA A;  4C0A A;  5C5B B;  1Z87 A;  3LJU X;  3HIE A;  2Z13 A;  1AQC A;  4CHM A;  3ZVR A;  1KZG A;  1B55 A;  4MT7 A;  2VSZ A;  5I2S A;  3ML4 A;  4QXA B;  1OMW A;  3NWF A;  4HB2 B;  1AWE A;  3GYO A;  2ELA A;  1K5G B;  4A6K A;  1X1G A;  1KZ7 A;  1V88 A;  3NWD A;  3G9W A;  1X1F A;  4QJ4 B;  5KQ4 A;  3KRX A;  2P8V A;  3HW2 B;  3ODO A;  4NSW A;  3SV1 A;  3U7D A;  3F5R A;  3SNH A;  4QJ5 B;  1XCG A;  2E2X A;  1P6S A;  1U5D A;  1DDV A;  3TVV A;  1BAK A;  1WG7 A;  4KHO A;  4HHV A;  1J19 A;  3A8Q A;  3HSA A;  3HK0 A;  1FAO A;  2D11 A;  1UNQ A;  4WJ7 A;  2AEH A;  4GOU A;  3VOQ A;  3RCP A;  1J0W A;  2JP2 A;  2MKR A;  5D27 A;  1V5P A;  1PFJ A;  2I1J A;  1DYN A;  4HAV B;  2W2X C;  5M4Y B;  1H4R A;  1K5D B;  1U27 A;  2DTC A;  2ZKM X;  3QIJ A;  4L6E A;  5C79 A;  3CXB B;  1FGZ A;  4ZRI A;  2KUQ A;  2DA0 A;  1BTN A;  3DCX A;  3NWA A;  3D8D A;  1NU2 A;  2K2J A;  2CY5 A;  4D0N B;  1DDM A;  2QKM A;  3AU4 A;  1E5W A;  2UVM A;  1W1D A;  1MI1 A;  1V5M A;  2YSZ A;  3DXE A;  1ZYI A;  4TYZ A;  2J0M A;  5HE2 A;  4WSF A;  2VRW B;  5EFX A;  2P0F A;  4DX9 0;  5JHH A;  3ZDT A;  2K8E A;  4K81 A;  4HAX B;  1FHO A;  1TJ6 A;  1UNP A;  2RSG A;  5CLL B;  2ADZ A;  2YS3 A;  3M1I B;  2Z59 A;  2MWN B;  4GN1 A;  2UZR A;  1V89 A; 
#chains in the Genus database with same CATH homology
 2DX1 A;  3F0W A;  4KHA A;  4GPT B;  2AL6 A;  4MY6 A;  2RNR B;  1FB8 A;  3IVF A;  2Y8G A;  1DRO A;  3TW1 A;  5HE3 A;  2OTX A;  1NTY A;  2EC1 A;  2LYD A;  2YS5 A;  4Y94 A;  1V5U A;  1ZC4 B;  3PG7 A;  5FI1 A;  5LOP B;  2I5C A;  2KCJ A;  4EKU A;  2V76 A;  1LB1 A;  3DXC A;  3OAN A;  3PVU A;  4HAU B;  4IFS A;  1SHC A;  2D10 A;  1U5E A;  2M38 A;  3MDB C;  1U5G A;  2NZ8 B;  1WVH A;  1DDW A;  4B6H A;  2MFQ A;  5J3Y A;  2D9Y A;  2DHK A;  2ZPY A;  3ULB A;  3ULC A;  4EMO A;  1BTK A;  1SGH A;  1TQZ A;  1UEF A;  3PEG A;  1MK9 B;  1RJ2 A;  4HAT B;  2DKP A;  3FSS A;  2YT0 A;  4F7U P;  4A6H A;  5JHG A;  2DHJ A;  1H10 A;  4HDQ A;  2HE7 A;  3KSY A;  3TCA A;  2COA A;  5D3Y A;  3PSC A;  1N3H A;  4CHJ A;  4GZU A;  1U5F A;  1EAZ A;  4K2P A;  1X11 A;  1MKE A;  1MK7 B;  1W1G A;  1EGX A;  4GMX B;  1MIX A;  1XR0 B;  2RGN B;  5DHF B;  2NMB A;  1I2H A;  3D8E A;  4KAX B;  1M7E A;  3KZ1 A;  4GMV A;  4YON A;  1QC6 A;  4HB0 B;  2OQB A;  2N23 A;  4P7I A;  2L1C A;  4PQ0 A;  1WJM A;  3CIK A;  2MDX A;  5LON B;  2UZS A;  1NI2 A;  1I7A A;  4A6F A;  1P5T A;  1X05 A;  2K00 A;  1UPQ A;  2DN6 A;  1GG3 A;  1M7R A;  5KCV A;  1XOD A;  1ZC3 B;  2XQN M;  5D3X A;  2LUL A;  1Y5O A;  1ISN A;  2LG1 A;  2Y8F A;  4Z2N A;  4HAZ B;  4IOY X;  1GC7 A;  2RLO A;  2COF A;  4NY0 A;  2EJ8 A;  1W1H A;  1WJ1 A;  3GYP A;  2VKI A;  2YVC A;  4XWX A;  2GCL A;  3X23 A;  4EJN A;  2DX5 A;  4Z2M B;  2YT1 A;  3PP2 A;  1MIZ B;  3BJI A;  1RRP B;  2CRF A;  3ODX A;  1WGQ A;  3PVW A;  3FM8 C;  1OY2 A;  2W2W A;  2ELB A;  2RVB B;  2ROV A;  5D3W A;  4ZRJ A;  2LKO A;  2YF0 A;  2PZ1 A;  1TXD A;  5J3T A;  1MPH A;  1ZM0 A;  4A6F B;  1FOE A;  1Y19 B;  3KY9 A;  2IFS A;  3KRW A;  4HAY B;  2DYN A;  2D4Q A;  2GCJ A;  3SO6 A;  1PMS A;  2H7D A;  3BIN A;  2R09 A;  2GS0 A;  1MAI A;  2YS1 A;  5JP4 A;  3TO1 A;  2DHI A;  3AJ4 A;  1BWN A;  1X86 A;  3A8P A;  4IAP A;  1QQG A;  1WGU A;  1UPR A;  2W2X D;  1UNR A;  5HE0 A;  1XX0 A;  2KGX B;  5L81 A;  2DYQ A;  4DX8 A;  2QKL A;  2YRY A;  3D8F A;  4HB4 B;  3U8Z A;  2EMS A;  4ZRK A;  4PNK A;  2CAY A;  5J3Q A;  2J0J A;  4TKN A;  4H8S A;  1OQN A;  2GJY A;  4KHB B;  4K17 A;  2LOX A;  2I1K A;  4MK0 A;  1V61 A;  2P0H A;  4HDO A;  5DIF B;  3P7Z A;  5C6R A;  3UZT A;  2DFK A;  2EMT A;  3WYF B;  5DI9 B;  4A5K A;  2Z0Q A;  3V5W A;  5FI0 A;  5C16 A;  1KI1 B;  2H7E A;  1PLS A;  3FEH A;  2P0D A;  3WA0 A;  1P3R A;  1ZSQ A;  1FHX A;  1LW3 A;  3N7C A;  3PZD A;  2HTH B;  2N0Y A;  4DBB A;  3P6A A;  1Q67 A;  4K2O A;  5DHA B;  2G35 A;  3HQC A;  4BBK A;  2FJL A;  1FHW A;  2J0K A;  2KUP A;  2Z0O A;  5D3V A;  3A98 B;  3NSU A;  2Z0P A;  5CLQ B;  1DBH A;  2LOZ A;  2Q13 A;  1XKE A;  3SUZ A;  2DLW A;  3SYX A;  1ZVR A;  2BCJ A;  4GXB A;  4F7H A;  5C5B A;  4KVG B;  3T06 A;  2IYB A;  1FGY A;  1EVH A;  1XD4 A;  2D9W A;  4CYE A;  3DXD A;  3PVL A;  2COD A;  2D9V A;  3AU5 A;  2CY4 A;  3TFM A;  1WI1 A;  2R0D A;  1IRS A;  2DKQ A;  2RUK B;  2ROZ B;  4HAW B;  2D9X A;  3MPX A;  2J59 M;  2L2I A;  4HB3 B;  5KQ1 A;  2COC A;  1U2B A;  4F7G A;  4DXA B;  3O96 A;  2X18 A;  1GC6 A;  2M14 A;  5GOW B;  2Y7B A;  5HE1 A;  5DH9 B;  1U29 A;  1NTV A;  4WVF B;  2D2Q A;  5JLJ B;  3QBV B;  3QWM A;  1EF1 A;  2D9Z A;  2I5F A;  4YL8 A;  3ODW A;  2K2U A;  3VIA A;  4C0A A;  5C5B B;  1Z87 A;  3LJU X;  1AQC A;  4CHM A;  3ZVR A;  1KZG A;  1B55 A;  4MT7 A;  2VSZ A;  3ML4 A;  1OMW A;  4HB2 B;  1AWE A;  3GYO A;  2ELA A;  1K5G B;  4A6K A;  1X1G A;  1KZ7 A;  1V88 A;  3G9W A;  1X1F A;  5KQ4 A;  3KRX A;  2P8V A;  3HW2 B;  3ODO A;  4NSW A;  3SV1 A;  3U7D A;  3F5R A;  3SNH A;  1XCG A;  2E2X A;  1P6S A;  1U5D A;  1DDV A;  3TVV A;  1BAK A;  1WG7 A;  4KHO A;  4HHV A;  1J19 A;  3A8Q A;  3HK0 A;  1FAO A;  2D11 A;  1UNQ A;  4WJ7 A;  2AEH A;  3VOQ A;  3RCP A;  1J0W A;  2JP2 A;  2MKR A;  5D27 A;  1V5P A;  1PFJ A;  2I1J A;  1DYN A;  4HAV B;  2W2X C;  1H4R A;  1K5D B;  1U27 A;  2DTC A;  3QIJ A;  4L6E A;  5C79 A;  3CXB B;  1FGZ A;  4ZRI A;  2DA0 A;  1BTN A;  3D8D A;  1NU2 A;  2K2J A;  2CY5 A;  4D0N B;  1DDM A;  2QKM A;  3AU4 A;  1E5W A;  2UVM A;  1W1D A;  1V5M A;  2YSZ A;  3DXE A;  4TYZ A;  2J0M A;  5HE2 A;  4WSF A;  2VRW B;  5EFX A;  2P0F A;  4DX9 0;  5JHH A;  3ZDT A;  4K81 A;  4HAX B;  1FHO A;  1TJ6 A;  1UNP A;  2RSG A;  5CLL B;  2ADZ A;  2YS3 A;  3M1I B;  2MWN B;  4GN1 A;  2UZR A;  1V89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...