4HB0B

Crystal structure of crm1 inhibitor leptomycin b in complex with crm1(k541q,k542q,r543s,k545q,k548q,k579q)-ran-ranbp1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
121
structure length
121
Chain Sequence
EEDEEVLYKVRAKLFRFDKDAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/antibiotic
total genus 36
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4hb0B00
2D9XA 3O96A 2UVMA 2D9YA 4PQ0A 5KQ1A 2DFKA 2MFQA 2D9WA 5EFXA 4K17A 1XX0A 4Z2MB 2X18A 2D9VA 1WJMA 1Z87A 1W1GA 2NZ8B 5HE2A 4WSFA 2R0DA 1WGUA 1H10A 4F7UP 1MK7B 3ZVRA 3RCPA 2MKRA 1X1GA 2I5FA 5D3WA 2K2UA 4L6EA 2P0DA 1B55A 2YS1A 2P0FA 3KZ1A 3ULCA 4EJNA 1UPQA 2I1KA 1E5WA 1P3RA 3DXDA 4A6FA 2Y7BA 2Z0OA 2VRWB 4K2OA 2LOZA 1AQCA 1H4RA 1LB1A 1X86A 2HTHB 2W2XD 2D10A 3UZTA 1I2HA 4DX8A 1V88A 4GZUA 1X1FA 2AL6A 4A6KA 1FHWA 4HAVB 1P5TA 1W1DA 4TKNA 4WJ7A 2D9ZA 4BBKA 3ODXA 3SO6A 1UEFA 3G9WA 1V5MA 4PNKA 1DDWA 1FHXA 1NTYA 4A5KA 4KHAA 1LW3A 5DHAB 5JLJB 2LOXA 3CIKA 2DKPA 1U5EA 4DX90 2MWNB 2UZSA 2XQNM 2P0HA 4GPTB 3DXCA 2ELAA 5HE3A 4A6FB 1NTVA 1RRPB 2COAA 3VOQA 2D11A 1P6SA 4HB2B 2OTXA 4A6HA 2J59M 1DYNA 4DXAB 2R09A 3PP2A 3P6AA 1WI1A 3ODWA 1WGQA 4DBBA 1M7EA 2KGXB 3PVLA 1N3HA 2DTCA 5C5BA 5C16A 1GC6A 1TQZA 1FGZA 3V5WA 2LG1A 2QKMA 4HHVA 2Y8FA 3NSUA 4KAXB 1V5PA 1Q67A 4C0AA 1ZC3B 2ZPYA 2I1JA 2CY5A 2RVBB 1BWNA 1J0WA 3FSSA 1SGHA 3WA0A 2M38A 3TVVA 3KY9A 3IVFA 3CXBB 1M7RA 1MIZB 3PVUA 2RSGA 1GG3A 5L81A 2MDXA 1ZM0A 2J0MA 2YVCA 2EC1A 1DDMA 1Y19B 1XKEA 1ZSQA 2YF0A 3SUZA 2ROZB 4WVFB 3SV1A 1NI2A 3TCAA 1BTNA 3SYXA 2N0YA 3FEHA 5C5BB 1TJ6A 4GMXB 3D8EA 1EAZA 5FI1A 2RLOA 1MK9B 2DA0A 1Y5OA 2JP2A 1WJ1A 1ISNA 3U7DA 2IYBA 1WVHA 1U27A 2GS0A 2OQBA 2VKIA 2DYQA 3T06A 4HAXB 4D0NB 2LYDA 1GC7A 1KI1B 5J3YA 2HE7A 3GYOA 3ZDTA 4KHBB 5J3TA 3F0WA 3FM8C 4EKUA 2EMSA 3HW2B 4F7HA 1ZVRA 4HAYB 1K5DB 1IRSA 1XR0B 3WYFB 3ODOA 2RGNB 2CRFA 2M14A 3QWMA 1PFJA 4ZRKA 4HB4B 3X23A 2QKLA 4IAPA 5GOWB 2P8VA 4B6HA 3OANA 2UZRA 5JHGA 5C79A 4K81A 5C6RA 1KZGA 4Y94A 2J0JA 2DN6A 4ZRIA 4K2PA 4CHMA 4HAWB 5CLLB 1PLSA 1BAKA 3D8DA 5KCVA 3TW1A 2COFA 1X05A 5D3XA 5DIFB 1U2BA 3KRWA 2GCLA 3HK0A 5LONB 1TXDA 1U5FA 1MPHA 2DKQA 1EVHA 1QC6A 2YRYA 2ADZA 1WG7A 5DHFB 3AU5A 4KVGB 2J0KA 3LJUX 2YS3A 3PZDA 4CHJA 2YT0A 1EF1A 1U29A 2ROVA 4F7GA 2G35A 3M1IB 2DHJA 2DHKA 4HAUB 2W2WA 3QBVB 1AWEA 3ML4A 2COCA 4IFSA 4YL8A 5LOPB 1MAIA 1V89A 3U8ZA 3N7CA 2I5CA 2GCJA 1FHOA 2E2XA 1DDVA 3MDBC 3D8FA 4MT7A 4HDQA 5HE1A 2LKOA 1QQGA 3GYPA 1UNRA 2YS5A 4KHOA 2NMBA 1U5GA 3AU4A 4MY6A 1FB8A 4CYEA 2L1CA 3BJIA 1UNQA 4ZRJA 1BTKA 1FAOA 1FGYA 4HB3B 4HB0B 2YSZA 1MIXA 4MK0A 2K2JA 2DX1A 2V76A 4GXBA 5DI9B 2DLWA 4Z2NA 3F5RA 1NU2A 1SHCA 5JHHA 4IOYX 3ULBA 5CLQB 3BINA 2CAYA 5J3QA 2GJYA 1K5GB 2DHIA 1I7AA 2BCJA 2D4QA 2CODA 1V5UA 3PEGA 2D2QA 5JP4A 1OMWA 1MKEA 5D3YA 3KSYA 2L2IA 1XODA 4HATB 2W2XC 4XWXA 2DYNA 4HAZB 4TYZA 2Z0PA 1X11A 2ELBA 1XCGA 5HE0A 3A98B 5FI0A 2Q13A 5D3VA 2KCJA 1DBHA 1KZ7A 4YONA 3VIAA 2AEHA 1DROA 2H7DA 3P7ZA 2H7EA 2EJ8A 4NSWA 4H8SA 4NY0A 1ZC4B 2YT1A 1W1HA 1EGXA 4GN1A 2DX5A 1RJ2A 3PSCA 3AJ4A 3HQCA 4EMOA 2FJLA 2VSZA 3SNHA 4HDOA 3MPXA 4P7IA 1PMSA 1V61A 3TFMA 2PZ1A 2RUKB 2EMTA 2K00A 3A8PA 4GMVA 3PG7A 3QIJA 2Y8GA 1OY2A 2KUPA 1UNPA 1XD4A 2LULA 1J19A 2IFSA 3DXEA 3KRXA 2Z0QA 2RNRB 2N23A 1U5DA 3TO1A 3A8QA 5D27A 3PVWA 1UPRA 1OQNA 1FOEA 5KQ4A 5DH9B 2CY4A
chains in the Genus database with same CATH superfamily
2D9XA 3O96A 2UVMA 3HIEA 2D9YA 4PQ0A 5KQ1A 2DFKA 2MFQA 2D9WA 5EFXA 4K17A 1XX0A 4Z2MB 2X18A 2D9VA 1WJMA 1Z87A 1W1GA 2NZ8B 5HE2A 4WSFA 2R0DA 1WGUA 1H10A 4F7UP 1MK7B 3ZVRA 3RCPA 2MKRA 1X1GA 2I5FA 5D3WA 2K2UA 4L6EA 4HSIA 2P0DA 1B55A 2YS1A 2P0FA 3KZ1A 3ULCA 4EJNA 1UPQA 2I1KA 1E5WA 1P3RA 3DXDA 4A6FA 2Y7BA 2Z0OA 2VRWB 4K2OA 3DCXA 2LOZA 1AQCA 1H4RA 1LB1A 1X86A 2HTHB 3OHMB 2W2XD 2D10A 3UZTA 1I2HA 4DX8A 1V88A 2Z4DA 4GZUA 1X1FA 2AL6A 4A6KA 1FHWA 4HAVB 1P5TA 1W1DA 4TKNA 4WJ7A 2D9ZA 4BBKA 3ODXA 3SO6A 1UEFA 3G9WA 1V5MA 4PNKA 1DDWA 1FHXA 1NTYA 4A5KA 4KHAA 1LW3A 5DHAB 5JLJB 2LOXA 3CIKA 2DKPA 1U5EA 4DX90 2MWNB 2UZSA 2XQNM 2P0HA 2KR0A 4GPTB 3DXCA 2ELAA 5HE3A 4A6FB 1NTVA 1RRPB 2COAA 3VOQA 2D11A 2FJUB 1P6SA 4HB2B 2OTXA 4A6HA 2J59M 1DYNA 4DXAB 2R09A 3PP2A 2Z13A 3P6AA 1WI1A 3ODWA 1WGQA 4DBBA 1M7EA 2KGXB 3PVLA 1N3HA 2DTCA 1MI1A 5C5BA 5C16A 2K49A 1GC6A 1TQZA 1FGZA 3V5WA 2LG1A 2QKMA 4HHVA 2Y8FA 5I2SA 3NSUA 4KAXB 1V5PA 1Q67A 4C0AA 1ZC3B 2ZPYA 2I1JA 2CY5A 2RVBB 1BWNA 1J0WA 2KUQA 4DIXA 3FSSA 1SGHA 3WA0A 2M38A 1ZYIA 3TVVA 3KY9A 3IVFA 2R2YA 3CXBB 4KHBA 1M7RA 3A58A 1MIZB 3PVUA 2RSGA 1GG3A 5L81A 2MDXA 1ZM0A 2J0MA 2YVCA 2EC1A 1DDMA 1Y19B 1XKEA 1ZSQA 2YF0A 3SUZA 2ROZB 4WVFB 3SV1A 1NI2A 3TCAA 1BTNA 3SYXA 2N0YA 3FEHA 5C5BB 1TJ6A 4GMXB 3D8EA 1EAZA 5FI1A 2RLOA 1MK9B 2DA0A 1Y5OA 2JP2A 1WJ1A 1ISNA 4OSNA 3U7DA 2IYBA 1WVHA 1U27A 2GS0A 5LG4B 2OQBA 2VKIA 2DYQA 3T06A 4HAXB 4D0NB 2LYDA 3NW8A 1GC7A 1KI1B 5J3YA 2HE7A 3GYOA 3ZDTA 4KHBB 5J3TA 3F0WA 3FM8C 4EKUA 2Z14A 2EMSA 3HW2B 4F7HA 1ZVRA 4HAYB 1K5DB 1IRSA 1XR0B 3WYFB 3ODOA 2RGNB 2CRFA 2M14A 3QWMA 1PFJA 4ZRKA 4HB4B 3X23A 3HSAA 4QJ5B 2QKLA 3NWFA 4IAPA 5GOWB 2P8VA 4B6HA 3OANA 2UZRA 5JHGA 5C79A 4K81A 5C6RA 1KZGA 4Y94A 2J0JA 2DN6A 4ZRIA 4K2PA 4CHMA 4HAWB 5CLLB 1PLSA 1BAKA 3FVCA 3D8DA 5KCVA 3TW1A 2COFA 4QJ3B 1X05A 4GNKB 5D3XA 2RRFA 5DIFB 1U2BA 3U12A 2KIGA 3KRWA 2GCLA 3HK0A 5LONB 1TXDA 1U5FA 1MPHA 2DKQA 1EVHA 1QC6A 1T77A 2ZKMX 2YRYA 2ADZA 1WG7A 5DHFB 3AU5A 4KVGB 2J0KA 3LJUX 2YS3A 3PZDA 4CHJA 2YT0A 1EF1A 1U29A 2ROVA 4F7GA 2G35A 3M1IB 2DHJA 2DHKA 4HAUB 2W2WA 3QBVB 1AWEA 3ML4A 2COCA 4IFSA 4YL8A 5LOPB 1MAIA 1V89A 3U8ZA 4D6WA 3N7CA 2I5CA 2GCJA 1FHOA 2E2XA 1DDVA 3MDBC 3D8FA 4MT7A 4HDQA 5HE1A 2LKOA 1QQGA 2Z59A 3GYPA 1UNRA 4L1RA 4QXAB 2YS5A 4KHOA 2NMBA 1U5GA 3AU4A 4MY6A 1FB8A 4CYEA 2L1CA 3BJIA 1UNQA 4ZRJA 1BTKA 1FAOA 1FGYA 4HB3B 4HB0B 2YSZA 1MIXA 4MK0A 2K2JA 2DX1A 2V76A 4GXBA 5DI9B 2DLWA 4Z2NA 3F5RA 1NU2A 1SHCA 5JHHA 4IOYX 3ULBA 5CLQB 3BINA 2CAYA 5J3QA 2GJYA 1K5GB 2NBVA 2DHIA 1I7AA 2BCJA 2D4QA 2CODA 1V5UA 3PEGA 4OT1A 4CSQA 2D2QA 5JP4A 1OMWA 1MKEA 5D3YA 3KSYA 2L2IA 1XODA 4HATB 2W2XC 4XWXA 2DYNA 4HAZB 4TYZA 2Z0PA 2GUMA 2K8EA 1X11A 2ELBA 1XCGA 5HE0A 3A98B 5FI0A 2Q13A 5D3VA 2KCJA 1DBHA 1KZ7A 4YONA 4QJ4B 3VIAA 2AEHA 1DROA 2H7DA 3P7ZA 4GOUA 2H7EA 2EJ8A 4NSWA 4H8SA 4NY0A 1ZC4B 2YT2A 2YT1A 1W1HA 1EGXA 4GN1A 2DX5A 1RJ2A 3PSCA 5IRSA 3AJ4A 3HQCA 4EMOA 2FJLA 2VSZA 3SNHA 4HDOA 3MPXA 4P7IA 5I2MA 1PMSA 1V61A 3TFMA 5M4YB 2PZ1A 2RUKB 2EMTA 2K00A 3A8PA 4GMVA 3PG7A 3QIJA 2Y8GA 1OY2A 2KUPA 1UNPA 1XD4A 2LULA 1J19A 2IFSA 3DXEA 3KRXA 2Z0QA 2RNRB 2N23A 1U5DA 3TO1A 3A8QA 5D27A 3PVWA 3B77A 1UPRA 2KIEA 1OQNA 3NWDA 1FOEA 5KQ4A 3NWAA 5DH9B 2CY4A
chains in the Genus database with same CATH topology
2D9XA 3O96A 2UVMA 2D9YA 4PQ0A 5KQ1A 2DFKA 2MFQA 2D9WA 5EFXA 4K17A 1XX0A 4Z2MB 2X18A 2D9VA 1WJMA 1Z87A 1W1GA 2NZ8B 5HE2A 4WSFA 2R0DA 1WGUA 1H10A 4F7UP 1MK7B 3ZVRA 3RCPA 2MKRA 1X1GA 2I5FA 5D3WA 2K2UA 4L6EA 2P0DA 1B55A 2YS1A 2P0FA 3KZ1A 3ULCA 4EJNA 1UPQA 2I1KA 1E5WA 1P3RA 3DXDA 4A6FA 2Y7BA 2Z0OA 2VRWB 4K2OA 2LOZA 1AQCA 1H4RA 1LB1A 1X86A 2HTHB 2W2XD 2D10A 3UZTA 1I2HA 4DX8A 1V88A 4GZUA 1X1FA 2AL6A 4A6KA 1FHWA 4HAVB 1P5TA 1W1DA 4TKNA 4WJ7A 2D9ZA 4BBKA 3ODXA 3SO6A 1UEFA 3G9WA 1V5MA 4PNKA 1DDWA 1FHXA 1NTYA 4A5KA 4KHAA 1LW3A 5DHAB 5JLJB 2LOXA 3CIKA 2DKPA 1U5EA 4DX90 2MWNB 2UZSA 2XQNM 2P0HA 4GPTB 3DXCA 2ELAA 5HE3A 4A6FB 1NTVA 1RRPB 2COAA 3VOQA 2D11A 1P6SA 4HB2B 2OTXA 4A6HA 2J59M 1DYNA 4DXAB 2R09A 3PP2A 3P6AA 1WI1A 3ODWA 1WGQA 4DBBA 1M7EA 2KGXB 3PVLA 1N3HA 2DTCA 5C5BA 5C16A 1GC6A 1TQZA 1FGZA 3V5WA 2LG1A 2QKMA 4HHVA 2Y8FA 3NSUA 4KAXB 1V5PA 1Q67A 4C0AA 1ZC3B 2ZPYA 2I1JA 2CY5A 2RVBB 1BWNA 1J0WA 3FSSA 1SGHA 3WA0A 2M38A 3TVVA 3KY9A 3IVFA 3CXBB 1M7RA 1MIZB 3PVUA 2RSGA 1GG3A 5L81A 2MDXA 1ZM0A 2J0MA 2YVCA 2EC1A 1DDMA 1Y19B 1XKEA 1ZSQA 2YF0A 3SUZA 2ROZB 4WVFB 3SV1A 1NI2A 3TCAA 1BTNA 3SYXA 2N0YA 3FEHA 5C5BB 1TJ6A 4GMXB 3D8EA 1EAZA 5FI1A 2RLOA 1MK9B 2DA0A 1Y5OA 2JP2A 1WJ1A 1ISNA 3U7DA 2IYBA 1WVHA 1U27A 2GS0A 2OQBA 2VKIA 2DYQA 3T06A 4HAXB 4D0NB 2LYDA 1GC7A 1KI1B 5J3YA 2HE7A 3GYOA 3ZDTA 4KHBB 5J3TA 3F0WA 3FM8C 4EKUA 2EMSA 3HW2B 4F7HA 1ZVRA 4HAYB 1K5DB 1IRSA 1XR0B 3WYFB 3ODOA 2RGNB 2CRFA 2M14A 3QWMA 1PFJA 4ZRKA 4HB4B 3X23A 2QKLA 4IAPA 5GOWB 2P8VA 4B6HA 3OANA 2UZRA 5JHGA 5C79A 4K81A 5C6RA 1KZGA 4Y94A 2J0JA 2DN6A 4ZRIA 4K2PA 4CHMA 4HAWB 5CLLB 1PLSA 1BAKA 3D8DA 5KCVA 3TW1A 2COFA 1X05A 5D3XA 5DIFB 1U2BA 3KRWA 2GCLA 3HK0A 5LONB 1TXDA 1U5FA 1MPHA 2DKQA 1EVHA 1QC6A 2YRYA 2ADZA 1WG7A 5DHFB 3AU5A 4KVGB 2J0KA 3LJUX 2YS3A 3PZDA 4CHJA 2YT0A 1EF1A 1U29A 2ROVA 4F7GA 2G35A 3M1IB 2DHJA 2DHKA 4HAUB 2W2WA 3QBVB 1AWEA 3ML4A 2COCA 4IFSA 4YL8A 5LOPB 1MAIA 1V89A 3U8ZA 3N7CA 2I5CA 2GCJA 1FHOA 2E2XA 1DDVA 3MDBC 3D8FA 4MT7A 4HDQA 5HE1A 2LKOA 1QQGA 3GYPA 1UNRA 2YS5A 4KHOA 2NMBA 1U5GA 3AU4A 4MY6A 1FB8A 4CYEA 2L1CA 3BJIA 1UNQA 4ZRJA 1BTKA 1FAOA 1FGYA 4HB3B 4HB0B 2YSZA 1MIXA 4MK0A 2K2JA 2DX1A 2V76A 4GXBA 5DI9B 2DLWA 4Z2NA 3F5RA 1NU2A 1SHCA 5JHHA 4IOYX 3ULBA 5CLQB 3BINA 2CAYA 5J3QA 2GJYA 1K5GB 2DHIA 1I7AA 2BCJA 2D4QA 2CODA 1V5UA 3PEGA 2D2QA 5JP4A 1OMWA 1MKEA 5D3YA 3KSYA 2L2IA 1XODA 4HATB 2W2XC 4XWXA 2DYNA 4HAZB 4TYZA 2Z0PA 1X11A 2ELBA 1XCGA 5HE0A 3A98B 5FI0A 2Q13A 5D3VA 2KCJA 1DBHA 1KZ7A 4YONA 3VIAA 2AEHA 1DROA 2H7DA 3P7ZA 2H7EA 2EJ8A 4NSWA 4H8SA 4NY0A 1ZC4B 2YT1A 1W1HA 1EGXA 4GN1A 2DX5A 1RJ2A 3PSCA 3AJ4A 3HQCA 4EMOA 2FJLA 2VSZA 3SNHA 4HDOA 3MPXA 4P7IA 1PMSA 1V61A 3TFMA 2PZ1A 2RUKB 2EMTA 2K00A 3A8PA 4GMVA 3PG7A 3QIJA 2Y8GA 1OY2A 2KUPA 1UNPA 1XD4A 2LULA 1J19A 2IFSA 3DXEA 3KRXA 2Z0QA 2RNRB 2N23A 1U5DA 3TO1A 3A8QA 5D27A 3PVWA 1UPRA 1OQNA 1FOEA 5KQ4A 5DH9B 2CY4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D9X A;  3O96 A;  2UVM A;  2D9Y A;  4PQ0 A;  5KQ1 A;  2DFK A;  2MFQ A;  2D9W A;  5EFX A;  4K17 A;  1XX0 A;  4Z2M B;  2X18 A;  2D9V A;  1WJM A;  1Z87 A;  1W1G A;  2NZ8 B;  5HE2 A;  4WSF A;  2R0D A;  1WGU A;  1H10 A;  4F7U P;  1MK7 B;  3ZVR A;  3RCP A;  2MKR A;  1X1G A;  2I5F A;  5D3W A;  2K2U A;  4L6E A;  2P0D A;  1B55 A;  2YS1 A;  2P0F A;  3KZ1 A;  3ULC A;  4EJN A;  1UPQ A;  2I1K A;  1E5W A;  1P3R A;  3DXD A;  4A6F A;  2Y7B A;  2Z0O A;  2VRW B;  4K2O A;  2LOZ A;  1AQC A;  1H4R A;  1LB1 A;  1X86 A;  2HTH B;  2W2X D;  2D10 A;  3UZT A;  1I2H A;  4DX8 A;  1V88 A;  4GZU A;  1X1F A;  2AL6 A;  4A6K A;  1FHW A;  4HAV B;  1P5T A;  1W1D A;  4TKN A;  4WJ7 A;  2D9Z A;  4BBK A;  3ODX A;  3SO6 A;  1UEF A;  3G9W A;  1V5M A;  4PNK A;  1DDW A;  1FHX A;  1NTY A;  4A5K A;  4KHA A;  1LW3 A;  5DHA B;  5JLJ B;  2LOX A;  3CIK A;  2DKP A;  1U5E A;  4DX9 0;  2MWN B;  2UZS A;  2XQN M;  2P0H A;  4GPT B;  3DXC A;  2ELA A;  5HE3 A;  4A6F B;  1NTV A;  1RRP B;  2COA A;  3VOQ A;  2D11 A;  1P6S A;  4HB2 B;  2OTX A;  4A6H A;  2J59 M;  1DYN A;  4DXA B;  2R09 A;  3PP2 A;  3P6A A;  1WI1 A;  3ODW A;  1WGQ A;  4DBB A;  1M7E A;  2KGX B;  3PVL A;  1N3H A;  2DTC A;  5C5B A;  5C16 A;  1GC6 A;  1TQZ A;  1FGZ A;  3V5W A;  2LG1 A;  2QKM A;  4HHV A;  2Y8F A;  3NSU A;  4KAX B;  1V5P A;  1Q67 A;  4C0A A;  1ZC3 B;  2ZPY A;  2I1J A;  2CY5 A;  2RVB B;  1BWN A;  1J0W A;  3FSS A;  1SGH A;  3WA0 A;  2M38 A;  3TVV A;  3KY9 A;  3IVF A;  3CXB B;  1M7R A;  1MIZ B;  3PVU A;  2RSG A;  1GG3 A;  5L81 A;  2MDX A;  1ZM0 A;  2J0M A;  2YVC A;  2EC1 A;  1DDM A;  1Y19 B;  1XKE A;  1ZSQ A;  2YF0 A;  3SUZ A;  2ROZ B;  4WVF B;  3SV1 A;  1NI2 A;  3TCA A;  1BTN A;  3SYX A;  2N0Y A;  3FEH A;  5C5B B;  1TJ6 A;  4GMX B;  3D8E A;  1EAZ A;  5FI1 A;  2RLO A;  1MK9 B;  2DA0 A;  1Y5O A;  2JP2 A;  1WJ1 A;  1ISN A;  3U7D A;  2IYB A;  1WVH A;  1U27 A;  2GS0 A;  2OQB A;  2VKI A;  2DYQ A;  3T06 A;  4HAX B;  4D0N B;  2LYD A;  1GC7 A;  1KI1 B;  5J3Y A;  2HE7 A;  3GYO A;  3ZDT A;  4KHB B;  5J3T A;  3F0W A;  3FM8 C;  4EKU A;  2EMS A;  3HW2 B;  4F7H A;  1ZVR A;  4HAY B;  1K5D B;  1IRS A;  1XR0 B;  3WYF B;  3ODO A;  2RGN B;  2CRF A;  2M14 A;  3QWM A;  1PFJ A;  4ZRK A;  4HB4 B;  3X23 A;  2QKL A;  4IAP A;  5GOW B;  2P8V A;  4B6H A;  3OAN A;  2UZR A;  5JHG A;  5C79 A;  4K81 A;  5C6R A;  1KZG A;  4Y94 A;  2J0J A;  2DN6 A;  4ZRI A;  4K2P A;  4CHM A;  4HAW B;  5CLL B;  1PLS A;  1BAK A;  3D8D A;  5KCV A;  3TW1 A;  2COF A;  1X05 A;  5D3X A;  5DIF B;  1U2B A;  3KRW A;  2GCL A;  3HK0 A;  5LON B;  1TXD A;  1U5F A;  1MPH A;  2DKQ A;  1EVH A;  1QC6 A;  2YRY A;  2ADZ A;  1WG7 A;  5DHF B;  3AU5 A;  4KVG B;  2J0K A;  3LJU X;  2YS3 A;  3PZD A;  4CHJ A;  2YT0 A;  1EF1 A;  1U29 A;  2ROV A;  4F7G A;  2G35 A;  3M1I B;  2DHJ A;  2DHK A;  4HAU B;  2W2W A;  3QBV B;  1AWE A;  3ML4 A;  2COC A;  4IFS A;  4YL8 A;  5LOP B;  1MAI A;  1V89 A;  3U8Z A;  3N7C A;  2I5C A;  2GCJ A;  1FHO A;  2E2X A;  1DDV A;  3MDB C;  3D8F A;  4MT7 A;  4HDQ A;  5HE1 A;  2LKO A;  1QQG A;  3GYP A;  1UNR A;  2YS5 A;  4KHO A;  2NMB A;  1U5G A;  3AU4 A;  4MY6 A;  1FB8 A;  4CYE A;  2L1C A;  3BJI A;  1UNQ A;  4ZRJ A;  1BTK A;  1FAO A;  1FGY A;  4HB3 B;  4HB0 B;  2YSZ A;  1MIX A;  4MK0 A;  2K2J A;  2DX1 A;  2V76 A;  4GXB A;  5DI9 B;  2DLW A;  4Z2N A;  3F5R A;  1NU2 A;  1SHC A;  5JHH A;  4IOY X;  3ULB A;  5CLQ B;  3BIN A;  2CAY A;  5J3Q A;  2GJY A;  1K5G B;  2DHI A;  1I7A A;  2BCJ A;  2D4Q A;  2COD A;  1V5U A;  3PEG A;  2D2Q A;  5JP4 A;  1OMW A;  1MKE A;  5D3Y A;  3KSY A;  2L2I A;  1XOD A;  4HAT B;  2W2X C;  4XWX A;  2DYN A;  4HAZ B;  4TYZ A;  2Z0P A;  1X11 A;  2ELB A;  1XCG A;  5HE0 A;  3A98 B;  5FI0 A;  2Q13 A;  5D3V A;  2KCJ A;  1DBH A;  1KZ7 A;  4YON A;  3VIA A;  2AEH A;  1DRO A;  2H7D A;  3P7Z A;  2H7E A;  2EJ8 A;  4NSW A;  4H8S A;  4NY0 A;  1ZC4 B;  2YT1 A;  1W1H A;  1EGX A;  4GN1 A;  2DX5 A;  1RJ2 A;  3PSC A;  3AJ4 A;  3HQC A;  4EMO A;  2FJL A;  2VSZ A;  3SNH A;  4HDO A;  3MPX A;  4P7I A;  1PMS A;  1V61 A;  3TFM A;  2PZ1 A;  2RUK B;  2EMT A;  2K00 A;  3A8P A;  4GMV A;  3PG7 A;  3QIJ A;  2Y8G A;  1OY2 A;  2KUP A;  1UNP A;  1XD4 A;  2LUL A;  1J19 A;  2IFS A;  3DXE A;  3KRX A;  2Z0Q A;  2RNR B;  2N23 A;  1U5D A;  3TO1 A;  3A8Q A;  5D27 A;  3PVW A;  1UPR A;  1OQN A;  1FOE A;  5KQ4 A;  5DH9 B;  2CY4 A; 
#chains in the Genus database with same CATH topology
 2D9X A;  3O96 A;  2UVM A;  3HIE A;  2D9Y A;  4PQ0 A;  5KQ1 A;  2DFK A;  2MFQ A;  2D9W A;  5EFX A;  4K17 A;  1XX0 A;  4Z2M B;  2X18 A;  2D9V A;  1WJM A;  1Z87 A;  1W1G A;  2NZ8 B;  5HE2 A;  4WSF A;  2R0D A;  1WGU A;  1H10 A;  4F7U P;  1MK7 B;  3ZVR A;  3RCP A;  2MKR A;  1X1G A;  2I5F A;  5D3W A;  2K2U A;  4L6E A;  4HSI A;  2P0D A;  1B55 A;  2YS1 A;  2P0F A;  3KZ1 A;  3ULC A;  4EJN A;  1UPQ A;  2I1K A;  1E5W A;  1P3R A;  3DXD A;  4A6F A;  2Y7B A;  2Z0O A;  2VRW B;  4K2O A;  3DCX A;  2LOZ A;  1AQC A;  1H4R A;  1LB1 A;  1X86 A;  2HTH B;  3OHM B;  2W2X D;  2D10 A;  3UZT A;  1I2H A;  4DX8 A;  1V88 A;  2Z4D A;  4GZU A;  1X1F A;  2AL6 A;  4A6K A;  1FHW A;  4HAV B;  1P5T A;  1W1D A;  4TKN A;  4WJ7 A;  2D9Z A;  4BBK A;  3ODX A;  3SO6 A;  1UEF A;  3G9W A;  1V5M A;  4PNK A;  1DDW A;  1FHX A;  1NTY A;  4A5K A;  4KHA A;  1LW3 A;  5DHA B;  5JLJ B;  2LOX A;  3CIK A;  2DKP A;  1U5E A;  4DX9 0;  2MWN B;  2UZS A;  2XQN M;  2P0H A;  2KR0 A;  4GPT B;  3DXC A;  2ELA A;  5HE3 A;  4A6F B;  1NTV A;  1RRP B;  2COA A;  3VOQ A;  2D11 A;  2FJU B;  1P6S A;  4HB2 B;  2OTX A;  4A6H A;  2J59 M;  1DYN A;  4DXA B;  2R09 A;  3PP2 A;  2Z13 A;  3P6A A;  1WI1 A;  3ODW A;  1WGQ A;  4DBB A;  1M7E A;  2KGX B;  3PVL A;  1N3H A;  2DTC A;  1MI1 A;  5C5B A;  5C16 A;  2K49 A;  1GC6 A;  1TQZ A;  1FGZ A;  3V5W A;  2LG1 A;  2QKM A;  4HHV A;  2Y8F A;  5I2S A;  3NSU A;  4KAX B;  1V5P A;  1Q67 A;  4C0A A;  1ZC3 B;  2ZPY A;  2I1J A;  2CY5 A;  2RVB B;  1BWN A;  1J0W A;  2KUQ A;  4DIX A;  3FSS A;  1SGH A;  3WA0 A;  2M38 A;  1ZYI A;  3TVV A;  3KY9 A;  3IVF A;  2R2Y A;  3CXB B;  4KHB A;  1M7R A;  3A58 A;  1MIZ B;  3PVU A;  2RSG A;  1GG3 A;  5L81 A;  2MDX A;  1ZM0 A;  2J0M A;  2YVC A;  2EC1 A;  1DDM A;  1Y19 B;  1XKE A;  1ZSQ A;  2YF0 A;  3SUZ A;  2ROZ B;  4WVF B;  3SV1 A;  1NI2 A;  3TCA A;  1BTN A;  3SYX A;  2N0Y A;  3FEH A;  5C5B B;  1TJ6 A;  4GMX B;  3D8E A;  1EAZ A;  5FI1 A;  2RLO A;  1MK9 B;  2DA0 A;  1Y5O A;  2JP2 A;  1WJ1 A;  1ISN A;  4OSN A;  3U7D A;  2IYB A;  1WVH A;  1U27 A;  2GS0 A;  5LG4 B;  2OQB A;  2VKI A;  2DYQ A;  3T06 A;  4HAX B;  4D0N B;  2LYD A;  3NW8 A;  1GC7 A;  1KI1 B;  5J3Y A;  2HE7 A;  3GYO A;  3ZDT A;  4KHB B;  5J3T A;  3F0W A;  3FM8 C;  4EKU A;  2Z14 A;  2EMS A;  3HW2 B;  4F7H A;  1ZVR A;  4HAY B;  1K5D B;  1IRS A;  1XR0 B;  3WYF B;  3ODO A;  2RGN B;  2CRF A;  2M14 A;  3QWM A;  1PFJ A;  4ZRK A;  4HB4 B;  3X23 A;  3HSA A;  4QJ5 B;  2QKL A;  3NWF A;  4IAP A;  5GOW B;  2P8V A;  4B6H A;  3OAN A;  2UZR A;  5JHG A;  5C79 A;  4K81 A;  5C6R A;  1KZG A;  4Y94 A;  2J0J A;  2DN6 A;  4ZRI A;  4K2P A;  4CHM A;  4HAW B;  5CLL B;  1PLS A;  1BAK A;  3FVC A;  3D8D A;  5KCV A;  3TW1 A;  2COF A;  4QJ3 B;  1X05 A;  4GNK B;  5D3X A;  2RRF A;  5DIF B;  1U2B A;  3U12 A;  2KIG A;  3KRW A;  2GCL A;  3HK0 A;  5LON B;  1TXD A;  1U5F A;  1MPH A;  2DKQ A;  1EVH A;  1QC6 A;  1T77 A;  2ZKM X;  2YRY A;  2ADZ A;  1WG7 A;  5DHF B;  3AU5 A;  4KVG B;  2J0K A;  3LJU X;  2YS3 A;  3PZD A;  4CHJ A;  2YT0 A;  1EF1 A;  1U29 A;  2ROV A;  4F7G A;  2G35 A;  3M1I B;  2DHJ A;  2DHK A;  4HAU B;  2W2W A;  3QBV B;  1AWE A;  3ML4 A;  2COC A;  4IFS A;  4YL8 A;  5LOP B;  1MAI A;  1V89 A;  3U8Z A;  4D6W A;  3N7C A;  2I5C A;  2GCJ A;  1FHO A;  2E2X A;  1DDV A;  3MDB C;  3D8F A;  4MT7 A;  4HDQ A;  5HE1 A;  2LKO A;  1QQG A;  2Z59 A;  3GYP A;  1UNR A;  4L1R A;  4QXA B;  2YS5 A;  4KHO A;  2NMB A;  1U5G A;  3AU4 A;  4MY6 A;  1FB8 A;  4CYE A;  2L1C A;  3BJI A;  1UNQ A;  4ZRJ A;  1BTK A;  1FAO A;  1FGY A;  4HB3 B;  4HB0 B;  2YSZ A;  1MIX A;  4MK0 A;  2K2J A;  2DX1 A;  2V76 A;  4GXB A;  5DI9 B;  2DLW A;  4Z2N A;  3F5R A;  1NU2 A;  1SHC A;  5JHH A;  4IOY X;  3ULB A;  5CLQ B;  3BIN A;  2CAY A;  5J3Q A;  2GJY A;  1K5G B;  2NBV A;  2DHI A;  1I7A A;  2BCJ A;  2D4Q A;  2COD A;  1V5U A;  3PEG A;  4OT1 A;  4CSQ A;  2D2Q A;  5JP4 A;  1OMW A;  1MKE A;  5D3Y A;  3KSY A;  2L2I A;  1XOD A;  4HAT B;  2W2X C;  4XWX A;  2DYN A;  4HAZ B;  4TYZ A;  2Z0P A;  2GUM A;  2K8E A;  1X11 A;  2ELB A;  1XCG A;  5HE0 A;  3A98 B;  5FI0 A;  2Q13 A;  5D3V A;  2KCJ A;  1DBH A;  1KZ7 A;  4YON A;  4QJ4 B;  3VIA A;  2AEH A;  1DRO A;  2H7D A;  3P7Z A;  4GOU A;  2H7E A;  2EJ8 A;  4NSW A;  4H8S A;  4NY0 A;  1ZC4 B;  2YT2 A;  2YT1 A;  1W1H A;  1EGX A;  4GN1 A;  2DX5 A;  1RJ2 A;  3PSC A;  5IRS A;  3AJ4 A;  3HQC A;  4EMO A;  2FJL A;  2VSZ A;  3SNH A;  4HDO A;  3MPX A;  4P7I A;  5I2M A;  1PMS A;  1V61 A;  3TFM A;  5M4Y B;  2PZ1 A;  2RUK B;  2EMT A;  2K00 A;  3A8P A;  4GMV A;  3PG7 A;  3QIJ A;  2Y8G A;  1OY2 A;  2KUP A;  1UNP A;  1XD4 A;  2LUL A;  1J19 A;  2IFS A;  3DXE A;  3KRX A;  2Z0Q A;  2RNR B;  2N23 A;  1U5D A;  3TO1 A;  3A8Q A;  5D27 A;  3PVW A;  3B77 A;  1UPR A;  2KIE A;  1OQN A;  3NWD A;  1FOE A;  5KQ4 A;  3NWA A;  5DH9 B;  2CY4 A; 
#chains in the Genus database with same CATH homology
 2D9X A;  3O96 A;  2UVM A;  2D9Y A;  4PQ0 A;  5KQ1 A;  2DFK A;  2MFQ A;  2D9W A;  5EFX A;  4K17 A;  1XX0 A;  4Z2M B;  2X18 A;  2D9V A;  1WJM A;  1Z87 A;  1W1G A;  2NZ8 B;  5HE2 A;  4WSF A;  2R0D A;  1WGU A;  1H10 A;  4F7U P;  1MK7 B;  3ZVR A;  3RCP A;  2MKR A;  1X1G A;  2I5F A;  5D3W A;  2K2U A;  4L6E A;  2P0D A;  1B55 A;  2YS1 A;  2P0F A;  3KZ1 A;  3ULC A;  4EJN A;  1UPQ A;  2I1K A;  1E5W A;  1P3R A;  3DXD A;  4A6F A;  2Y7B A;  2Z0O A;  2VRW B;  4K2O A;  2LOZ A;  1AQC A;  1H4R A;  1LB1 A;  1X86 A;  2HTH B;  2W2X D;  2D10 A;  3UZT A;  1I2H A;  4DX8 A;  1V88 A;  4GZU A;  1X1F A;  2AL6 A;  4A6K A;  1FHW A;  4HAV B;  1P5T A;  1W1D A;  4TKN A;  4WJ7 A;  2D9Z A;  4BBK A;  3ODX A;  3SO6 A;  1UEF A;  3G9W A;  1V5M A;  4PNK A;  1DDW A;  1FHX A;  1NTY A;  4A5K A;  4KHA A;  1LW3 A;  5DHA B;  5JLJ B;  2LOX A;  3CIK A;  2DKP A;  1U5E A;  4DX9 0;  2MWN B;  2UZS A;  2XQN M;  2P0H A;  4GPT B;  3DXC A;  2ELA A;  5HE3 A;  4A6F B;  1NTV A;  1RRP B;  2COA A;  3VOQ A;  2D11 A;  1P6S A;  4HB2 B;  2OTX A;  4A6H A;  2J59 M;  1DYN A;  4DXA B;  2R09 A;  3PP2 A;  3P6A A;  1WI1 A;  3ODW A;  1WGQ A;  4DBB A;  1M7E A;  2KGX B;  3PVL A;  1N3H A;  2DTC A;  5C5B A;  5C16 A;  1GC6 A;  1TQZ A;  1FGZ A;  3V5W A;  2LG1 A;  2QKM A;  4HHV A;  2Y8F A;  3NSU A;  4KAX B;  1V5P A;  1Q67 A;  4C0A A;  1ZC3 B;  2ZPY A;  2I1J A;  2CY5 A;  2RVB B;  1BWN A;  1J0W A;  3FSS A;  1SGH A;  3WA0 A;  2M38 A;  3TVV A;  3KY9 A;  3IVF A;  3CXB B;  1M7R A;  1MIZ B;  3PVU A;  2RSG A;  1GG3 A;  5L81 A;  2MDX A;  1ZM0 A;  2J0M A;  2YVC A;  2EC1 A;  1DDM A;  1Y19 B;  1XKE A;  1ZSQ A;  2YF0 A;  3SUZ A;  2ROZ B;  4WVF B;  3SV1 A;  1NI2 A;  3TCA A;  1BTN A;  3SYX A;  2N0Y A;  3FEH A;  5C5B B;  1TJ6 A;  4GMX B;  3D8E A;  1EAZ A;  5FI1 A;  2RLO A;  1MK9 B;  2DA0 A;  1Y5O A;  2JP2 A;  1WJ1 A;  1ISN A;  3U7D A;  2IYB A;  1WVH A;  1U27 A;  2GS0 A;  2OQB A;  2VKI A;  2DYQ A;  3T06 A;  4HAX B;  4D0N B;  2LYD A;  1GC7 A;  1KI1 B;  5J3Y A;  2HE7 A;  3GYO A;  3ZDT A;  4KHB B;  5J3T A;  3F0W A;  3FM8 C;  4EKU A;  2EMS A;  3HW2 B;  4F7H A;  1ZVR A;  4HAY B;  1K5D B;  1IRS A;  1XR0 B;  3WYF B;  3ODO A;  2RGN B;  2CRF A;  2M14 A;  3QWM A;  1PFJ A;  4ZRK A;  4HB4 B;  3X23 A;  2QKL A;  4IAP A;  5GOW B;  2P8V A;  4B6H A;  3OAN A;  2UZR A;  5JHG A;  5C79 A;  4K81 A;  5C6R A;  1KZG A;  4Y94 A;  2J0J A;  2DN6 A;  4ZRI A;  4K2P A;  4CHM A;  4HAW B;  5CLL B;  1PLS A;  1BAK A;  3D8D A;  5KCV A;  3TW1 A;  2COF A;  1X05 A;  5D3X A;  5DIF B;  1U2B A;  3KRW A;  2GCL A;  3HK0 A;  5LON B;  1TXD A;  1U5F A;  1MPH A;  2DKQ A;  1EVH A;  1QC6 A;  2YRY A;  2ADZ A;  1WG7 A;  5DHF B;  3AU5 A;  4KVG B;  2J0K A;  3LJU X;  2YS3 A;  3PZD A;  4CHJ A;  2YT0 A;  1EF1 A;  1U29 A;  2ROV A;  4F7G A;  2G35 A;  3M1I B;  2DHJ A;  2DHK A;  4HAU B;  2W2W A;  3QBV B;  1AWE A;  3ML4 A;  2COC A;  4IFS A;  4YL8 A;  5LOP B;  1MAI A;  1V89 A;  3U8Z A;  3N7C A;  2I5C A;  2GCJ A;  1FHO A;  2E2X A;  1DDV A;  3MDB C;  3D8F A;  4MT7 A;  4HDQ A;  5HE1 A;  2LKO A;  1QQG A;  3GYP A;  1UNR A;  2YS5 A;  4KHO A;  2NMB A;  1U5G A;  3AU4 A;  4MY6 A;  1FB8 A;  4CYE A;  2L1C A;  3BJI A;  1UNQ A;  4ZRJ A;  1BTK A;  1FAO A;  1FGY A;  4HB3 B;  4HB0 B;  2YSZ A;  1MIX A;  4MK0 A;  2K2J A;  2DX1 A;  2V76 A;  4GXB A;  5DI9 B;  2DLW A;  4Z2N A;  3F5R A;  1NU2 A;  1SHC A;  5JHH A;  4IOY X;  3ULB A;  5CLQ B;  3BIN A;  2CAY A;  5J3Q A;  2GJY A;  1K5G B;  2DHI A;  1I7A A;  2BCJ A;  2D4Q A;  2COD A;  1V5U A;  3PEG A;  2D2Q A;  5JP4 A;  1OMW A;  1MKE A;  5D3Y A;  3KSY A;  2L2I A;  1XOD A;  4HAT B;  2W2X C;  4XWX A;  2DYN A;  4HAZ B;  4TYZ A;  2Z0P A;  1X11 A;  2ELB A;  1XCG A;  5HE0 A;  3A98 B;  5FI0 A;  2Q13 A;  5D3V A;  2KCJ A;  1DBH A;  1KZ7 A;  4YON A;  3VIA A;  2AEH A;  1DRO A;  2H7D A;  3P7Z A;  2H7E A;  2EJ8 A;  4NSW A;  4H8S A;  4NY0 A;  1ZC4 B;  2YT1 A;  1W1H A;  1EGX A;  4GN1 A;  2DX5 A;  1RJ2 A;  3PSC A;  3AJ4 A;  3HQC A;  4EMO A;  2FJL A;  2VSZ A;  3SNH A;  4HDO A;  3MPX A;  4P7I A;  1PMS A;  1V61 A;  3TFM A;  2PZ1 A;  2RUK B;  2EMT A;  2K00 A;  3A8P A;  4GMV A;  3PG7 A;  3QIJ A;  2Y8G A;  1OY2 A;  2KUP A;  1UNP A;  1XD4 A;  2LUL A;  1J19 A;  2IFS A;  3DXE A;  3KRX A;  2Z0Q A;  2RNR B;  2N23 A;  1U5D A;  3TO1 A;  3A8Q A;  5D27 A;  3PVW A;  1UPR A;  1OQN A;  1FOE A;  5KQ4 A;  5DH9 B;  2CY4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...