3ULBA

Crystal structure of the pleckstrin homology domain of saccharomyces cerevisiae avo1, a torc2 subunit, in the p212121 crystal form
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
109
structure length
102
Chain Sequence
b'YHKYKVWRRQQMSFINKHERTLAIDGDYIYIVPPENVKTKSLHISQVVLVKKSKRVPEHFKIFVRREGQDDIKRYYFEAVSGQECTEIVTRLQNLLSAYRMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Target of rapamycin complex 2 subunit AVO1
molecule tags Membrane protein
source organism Saccharomyces cerevisiae
publication title Structures of the pleckstrin homology domain of Saccharomyces cerevisiae Avo1 and its human orthologue Sin1, an essential subunit of TOR complex 2
pubmed doi rcsb
total genus 20
structure length 102
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16979 SIN1_PH SAPK-interacting protein 1 (Sin1), Pleckstrin-homology
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3ulbA01
4A6HA 4IOYX 2YS5A 2W2WA 3CIKA 4HDQA 4A5KA 4ZRJA 2BCJA 3VIAA 4DBBA 2DFKA 1X11A 2P0HA 2L1CA 2RUKB 2UVMA 4HDOA 2H7EA 2EMSA 1ZC4B 2YRYA 1WGUA 3ZVRA 2D4QA 1Q67A 1OMWA 4WSFA 1GC6A 1NI2A 2MKRA 1U2BA 2D9WA 4MY6A 2QKLA 1NU2A 1ZVRA 1TQZA 2DX5A 4H8SA 1MPHA 5DI9B 4CHMA 2P8VA 2DHKA 3PG7A 4EKUA 5CLLB 4IFSA 5LONB 2XQNM 1UNPA 3V5WA 3TW1A 4TKNA 2DX1A 5LOPB 3SV1A 2ADZA 1ZC3B 4GMVA 1X05A 1PLSA 2YS1A 1EF1A 5DIFB 2D10A 1RRPB 2W2XC 4ZRIA 2D2QA 1TJ6A 2OTXA 4KHOA 3TCAA 1X1GA 4K2PA 3ODWA 3ODXA 1W1HA 2CRFA 4Y94A 1KZ7A 5C79A 2LOZA 2K2JA 5C6RA 2COAA 1KI1B 1H4RA 5D3VA 3PSCA 2M38A 2Z0PA 4K17A 1EAZA 2DKQA 1I7AA 2I5FA 5GOWB 2KCJA 2CY4A 1U5FA 5JP4A 5D3YA 3IVFA 4NY0A 2D9VA 2DLWA 2VSZA 3MDBC 2JP2A 1UPQA 3QIJA 1FHXA 1NTVA 3BJIA 5D3XA 2DTCA 3KSYA 3X23A 3KY9A 5KQ4A 1DROA 4HAYB 1MKEA 4P7IA 1K5GB 1GC7A 2RGNB 2UZSA 3N7CA 1FAOA 1OY2A 5J3QA 2Z0QA 1U27A 5HE0A 1V5MA 2G35A 2GCJA 2VKIA 1V5UA 2VRWB 3TVVA 3LJUX 3NSUA 3ODOA 4CHJA 3HQCA 1FB8A 2V76A 2YVCA 1SGHA 3D8DA 4IAPA 1DDWA 2LYDA 1RJ2A 2NZ8B 1WJ1A 1LW3A 1FGYA 3F5RA 3TFMA 3ULCA 2D9YA 1P3RA 4YONA 4DX8A 2LULA 3O96A 1WVHA 4K81A 2D9XA 4YL8A 1B55A 4HATB 5DH9B 2HTHB 1V88A 2K2UA 1GG3A 1WGQA 2GJYA 2UZRA 5HE1A 5FI0A 3TO1A 1OQNA 1FHOA 3P6AA 2YSZA 2K00A 2DHIA 2X18A 4HAXB 4GXBA 2DKPA 1ZSQA 4BBKA 1U5DA 2RSGA 2MDXA 2CAYA 5JHGA 3D8EA 1X1FA 3PP2A 2EC1A 1ISNA 4HAZB 2FJLA 1MK7B 5CLQB 4F7GA 1XX0A 4Z2NA 5C5BB 3KRXA 3U7DA 2DHJA 2Y8GA 4GN1A 2DYNA 5JHHA 3T06A 1Y5OA 4GMXB 1P5TA 2I1KA 4HB4B 1SHCA 3BINA 1BAKA 3A8QA 1X86A 4F7UP 1P6SA 4KHAA 3DXEA 1M7RA 2DYQA 4A6KA 1DDVA 4Z2MB 2ROZB 4PQ0A 4A6FA 4KAXB 2AL6A 2I5CA 3D8FA 1UNQA 3AJ4A 2IFSA 1MAIA 4HAVB 1AQCA 5HE2A 3ZDTA 3FM8C 2EMTA 2NMBA 4MK0A 4WJ7A 2D11A 4F7HA 1PFJA 3SO6A 4EMOA 1W1DA 5EFXA 3QWMA 1Z87A 3GYOA 5DHAB 2ROVA 3MPXA 1UEFA 1XODA 2LKOA 2YF0A 2Q13A 2D9ZA 3DXDA 2I1JA 1W1GA 2W2XD 1WJMA 2MFQA 1U29A 1V89A 1XD4A 1NTYA 3SUZA 2GS0A 2IYBA 1FHWA 4HB3B 4GZUA 1PMSA 1LB1A 3HK0A 1Y19B 1J19A 4HB0B 3A8PA 2H7DA 4EJNA 3ULBA 2COFA 3HW2B 3ML4A 2DN6A 1N3HA 1AWEA 2N0YA 2ZPYA 1QQGA 2CODA 1KZGA 4B6HA 5KCVA 1XCGA 3CXBB 3DXCA 3WA0A 5L81A 1QC6A 1ZM0A 5D27A 3FEHA 2YT1A 2LG1A 1U5GA 5KQ1A 1U5EA 4HB2B 2E2XA 4KHBB 1I2HA 2COCA 3UZTA 4DX90 2J0JA 4MT7A 1J0WA 3AU5A 1WG7A 3SNHA 1E5WA 3G9WA 5J3TA 3KRWA 3PVUA 5FI1A 1DDMA 2QKMA 3RCPA 2CY5A 2RLOA 4DXAB 1BTKA 2R09A 4GPTB 1WI1A 5C5BA 3QBVB 3FSSA 2P0DA 1H10A 1UPRA 4CYEA 4ZRKA 1XR0B 3M1IB 3F0WA 2AEHA 2PZ1A 3PVWA 1FOEA 1MK9B 1V61A 5C16A 2ELAA 2OQBA 1TXDA 4D0NB 2M14A 1BWNA 2EJ8A 2YT0A 1K5DB 2HE7A 2GCLA 1XKEA 1DYNA 2LOXA 3KZ1A 3PVLA 3WYFB 2J0MA 2KUPA 1MIZB 2J0KA 4HAUB 3P7ZA 2Y7BA 4PNKA 1EGXA 1BTNA 4HHVA 4C0AA 1DBHA 3AU4A 2RNRB 4XWXA 2MWNB 1UNRA 5HE3A 5J3YA 2J59M 2DA0A 4WVFB 2R0DA 3PZDA 5JLJB 2N23A 3A98B 4NSWA 4A6FB 1IRSA 1V5PA 3U8ZA 3VOQA 4L6EA 3SYXA 2ELBA 2KGXB 2L2IA 4KVGB 5D3WA 3GYPA 3PEGA 1EVHA 4TYZA 3OANA 5DHFB 2Y8FA 2YS3A 2P0FA 1FGZA 1MIXA 1M7EA 4HAWB 4K2OA 2RVBB 2Z0OA
chains in the Genus database with same CATH superfamily
4A6HA 4IOYX 2YS5A 2W2WA 3CIKA 4HDQA 4A5KA 4ZRJA 2BCJA 3VIAA 4DBBA 2DFKA 1X11A 2P0HA 2L1CA 2RUKB 2UVMA 4HDOA 2H7EA 2EMSA 2ZKMX 1ZC4B 4QXAB 2YRYA 1WGUA 3ZVRA 2Z13A 2D4QA 1Q67A 1OMWA 4GNKB 5LG4B 4WSFA 1GC6A 1NI2A 2MKRA 1U2BA 2D9WA 4MY6A 2QKLA 1NU2A 1ZVRA 1TQZA 2DX5A 4H8SA 1MPHA 5DI9B 4CHMA 2P8VA 2DHKA 3PG7A 4EKUA 5CLLB 4IFSA 5LONB 2XQNM 1UNPA 3V5WA 3TW1A 4TKNA 2DX1A 5LOPB 3SV1A 4QJ4B 2ADZA 1ZC3B 1MI1A 4GMVA 1X05A 5M4YB 3B77A 1PLSA 2YS1A 1EF1A 2KIGA 5DIFB 2D10A 1RRPB 2W2XC 4ZRIA 4L1RA 2D2QA 1TJ6A 2OTXA 4KHOA 3TCAA 1X1GA 4K2PA 3ODWA 3ODXA 1W1HA 2CRFA 4Y94A 1KZ7A 5C79A 2LOZA 2K2JA 5C6RA 2COAA 1KI1B 1H4RA 5D3VA 3PSCA 2M38A 2Z0PA 4K17A 1EAZA 2DKQA 5I2SA 1I7AA 2I5FA 5GOWB 2KCJA 2CY4A 1U5FA 5JP4A 5D3YA 3IVFA 4NY0A 2D9VA 2DLWA 2VSZA 2R2YA 3MDBC 2JP2A 1UPQA 3QIJA 1FHXA 1NTVA 3BJIA 5D3XA 2DTCA 3KSYA 3X23A 3KY9A 5KQ4A 1DROA 4HAYB 1MKEA 4P7IA 5IRSA 2K8EA 1K5GB 2Z4DA 1GC7A 2RGNB 2UZSA 3N7CA 1FAOA 1OY2A 5J3QA 2Z0QA 1U27A 5HE0A 1V5MA 2G35A 2GCJA 2VKIA 1V5UA 2VRWB 3TVVA 3LJUX 3NSUA 3ODOA 4CHJA 3HQCA 1FB8A 2V76A 2YVCA 1SGHA 3D8DA 4IAPA 1DDWA 2LYDA 1RJ2A 2KUQA 1WJ1A 1LW3A 2NZ8B 1FGYA 3F5RA 3TFMA 3ULCA 2D9YA 1P3RA 4YONA 4DX8A 2LULA 3O96A 1WVHA 4K81A 2D9XA 4YL8A 1B55A 4HATB 5DH9B 2HTHB 4CSQA 1V88A 2K2UA 1GG3A 1WGQA 2GJYA 2UZRA 5HE1A 5FI0A 3TO1A 2KR0A 1OQNA 1FHOA 3P6AA 2RRFA 3FVCA 2YSZA 2K00A 2DHIA 2X18A 4HAXB 4GXBA 4GOUA 2DKPA 1ZSQA 4BBKA 1U5DA 2RSGA 2MDXA 3NWAA 2CAYA 5JHGA 3D8EA 3HIEA 4DIXA 1X1FA 3PP2A 2EC1A 1ISNA 4OT1A 4HAZB 2FJLA 1MK7B 5CLQB 4F7GA 1XX0A 4Z2NA 5C5BB 3KRXA 3DCXA 3U7DA 2DHJA 2Y8GA 4GN1A 2DYNA 5JHHA 3T06A 1Y5OA 4QJ3B 4GMXB 1P5TA 3OHMB 3HSAA 2I1KA 4HB4B 1SHCA 3BINA 1BAKA 3A8QA 1X86A 4F7UP 1P6SA 4KHAA 3DXEA 1M7RA 2DYQA 3A58A 4A6KA 1DDVA 4Z2MB 4KHBA 2ROZB 4PQ0A 4A6FA 4KAXB 2AL6A 2I5CA 3D8FA 1UNQA 3AJ4A 2IFSA 2YT2A 1MAIA 4HAVB 1AQCA 5HE2A 3ZDTA 3FM8C 2EMTA 2NMBA 4MK0A 4WJ7A 1T77A 2D11A 2Z59A 4F7HA 1PFJA 3SO6A 4EMOA 1W1DA 5EFXA 4D6WA 3QWMA 1Z87A 3GYOA 3NW8A 4HSIA 5DHAB 3NWDA 2ROVA 3MPXA 1UEFA 1XODA 2LKOA 2YF0A 2Q13A 2GUMA 2D9ZA 3DXDA 2I1JA 1W1GA 2W2XD 2NBVA 1WJMA 2MFQA 1U29A 1V89A 1XD4A 1NTYA 3SUZA 2GS0A 2IYBA 1FHWA 4HB3B 4GZUA 1PMSA 1LB1A 3HK0A 1Y19B 1J19A 2FJUB 3A8PA 2H7DA 4HB0B 4EJNA 3ULBA 2COFA 3HW2B 3ML4A 2DN6A 3U12A 1N3HA 1AWEA 2N0YA 2ZPYA 1QQGA 2CODA 1KZGA 4B6HA 5KCVA 1XCGA 3CXBB 3DXCA 3WA0A 5L81A 1QC6A 1ZM0A 5D27A 3FEHA 2YT1A 2LG1A 1U5GA 5KQ1A 1U5EA 4HB2B 2E2XA 4KHBB 1I2HA 2COCA 3UZTA 4DX90 2J0JA 2K49A 4MT7A 1J0WA 3AU5A 1WG7A 4OSNA 3SNHA 1E5WA 3G9WA 5J3TA 3KRWA 3PVUA 5FI1A 1DDMA 2QKMA 3RCPA 2CY5A 2RLOA 4DXAB 1BTKA 2R09A 4GPTB 1WI1A 5C5BA 3QBVB 3FSSA 2P0DA 1H10A 1UPRA 4CYEA 4ZRKA 1XR0B 3M1IB 3F0WA 2AEHA 3NWFA 2PZ1A 3PVWA 1FOEA 1MK9B 1V61A 5C16A 2ELAA 2OQBA 1TXDA 4D0NB 2M14A 1BWNA 2EJ8A 2YT0A 1K5DB 2HE7A 2GCLA 1XKEA 1DYNA 2LOXA 3KZ1A 3PVLA 3WYFB 2J0MA 2KUPA 1MIZB 2J0KA 4HAUB 3P7ZA 2Y7BA 4PNKA 1EGXA 1BTNA 4HHVA 4C0AA 2Z14A 1DBHA 3AU4A 2RNRB 4XWXA 2MWNB 1UNRA 5HE3A 5J3YA 2J59M 2DA0A 5I2MA 4WVFB 2R0DA 2KIEA 3PZDA 5JLJB 2N23A 3A98B 4NSWA 4A6FB 1IRSA 1V5PA 3U8ZA 3VOQA 4L6EA 3SYXA 2ELBA 2KGXB 2L2IA 4KVGB 5D3WA 3GYPA 3PEGA 1EVHA 4TYZA 1ZYIA 3OANA 5DHFB 2Y8FA 2YS3A 2P0FA 1FGZA 1MIXA 4QJ5B 1M7EA 4HAWB 4K2OA 2RVBB 2Z0OA
chains in the Genus database with same CATH topology
4A6HA 4IOYX 2YS5A 2W2WA 3CIKA 4HDQA 4A5KA 4ZRJA 2BCJA 3VIAA 4DBBA 2DFKA 1X11A 2P0HA 2L1CA 2RUKB 2UVMA 4HDOA 2H7EA 2EMSA 1ZC4B 2YRYA 1WGUA 3ZVRA 2D4QA 1Q67A 1OMWA 4WSFA 1GC6A 1NI2A 2MKRA 1U2BA 2D9WA 4MY6A 2QKLA 1NU2A 1ZVRA 1TQZA 2DX5A 4H8SA 1MPHA 5DI9B 4CHMA 2P8VA 2DHKA 3PG7A 4EKUA 5CLLB 4IFSA 5LONB 2XQNM 1UNPA 3V5WA 3TW1A 4TKNA 2DX1A 5LOPB 3SV1A 2ADZA 1ZC3B 4GMVA 1X05A 1PLSA 2YS1A 1EF1A 5DIFB 2D10A 1RRPB 2W2XC 4ZRIA 2D2QA 1TJ6A 2OTXA 4KHOA 3TCAA 1X1GA 4K2PA 3ODWA 3ODXA 1W1HA 2CRFA 4Y94A 1KZ7A 5C79A 2LOZA 2K2JA 5C6RA 2COAA 1KI1B 1H4RA 5D3VA 3PSCA 2M38A 2Z0PA 4K17A 1EAZA 2DKQA 1I7AA 2I5FA 5GOWB 2KCJA 2CY4A 1U5FA 5JP4A 5D3YA 3IVFA 4NY0A 2D9VA 2DLWA 2VSZA 3MDBC 2JP2A 1UPQA 3QIJA 1FHXA 1NTVA 3BJIA 5D3XA 2DTCA 3KSYA 3X23A 3KY9A 5KQ4A 1DROA 4HAYB 1MKEA 4P7IA 1K5GB 1GC7A 2RGNB 2UZSA 3N7CA 1FAOA 1OY2A 5J3QA 2Z0QA 1U27A 5HE0A 1V5MA 2G35A 2GCJA 2VKIA 1V5UA 2VRWB 3TVVA 3LJUX 3NSUA 3ODOA 4CHJA 3HQCA 1FB8A 2V76A 2YVCA 1SGHA 3D8DA 4IAPA 1DDWA 2LYDA 1RJ2A 2NZ8B 1WJ1A 1LW3A 1FGYA 3F5RA 3TFMA 3ULCA 2D9YA 1P3RA 4YONA 4DX8A 2LULA 3O96A 1WVHA 4K81A 2D9XA 4YL8A 1B55A 4HATB 5DH9B 2HTHB 1V88A 2K2UA 1GG3A 1WGQA 2GJYA 2UZRA 5HE1A 5FI0A 3TO1A 1OQNA 1FHOA 3P6AA 2YSZA 2K00A 2DHIA 2X18A 4HAXB 4GXBA 2DKPA 1ZSQA 4BBKA 1U5DA 2RSGA 2MDXA 2CAYA 5JHGA 3D8EA 1X1FA 3PP2A 2EC1A 1ISNA 4HAZB 2FJLA 1MK7B 5CLQB 4F7GA 1XX0A 4Z2NA 5C5BB 3KRXA 3U7DA 2DHJA 2Y8GA 4GN1A 2DYNA 5JHHA 3T06A 1Y5OA 4GMXB 1P5TA 2I1KA 4HB4B 1SHCA 3BINA 1BAKA 3A8QA 1X86A 4F7UP 1P6SA 4KHAA 3DXEA 1M7RA 2DYQA 4A6KA 1DDVA 4Z2MB 2ROZB 4PQ0A 4A6FA 4KAXB 2AL6A 2I5CA 3D8FA 1UNQA 3AJ4A 2IFSA 1MAIA 4HAVB 1AQCA 5HE2A 3ZDTA 3FM8C 2EMTA 2NMBA 4MK0A 4WJ7A 2D11A 4F7HA 1PFJA 3SO6A 4EMOA 1W1DA 5EFXA 3QWMA 1Z87A 3GYOA 5DHAB 2ROVA 3MPXA 1UEFA 1XODA 2LKOA 2YF0A 2Q13A 2D9ZA 3DXDA 2I1JA 1W1GA 2W2XD 1WJMA 2MFQA 1U29A 1V89A 1XD4A 1NTYA 3SUZA 2GS0A 2IYBA 1FHWA 4HB3B 4GZUA 1PMSA 1LB1A 3HK0A 1Y19B 1J19A 4HB0B 3A8PA 2H7DA 4EJNA 3ULBA 2COFA 3HW2B 3ML4A 2DN6A 1N3HA 1AWEA 2N0YA 2ZPYA 1QQGA 2CODA 1KZGA 4B6HA 5KCVA 1XCGA 3CXBB 3DXCA 3WA0A 5L81A 1QC6A 1ZM0A 5D27A 3FEHA 2YT1A 2LG1A 1U5GA 5KQ1A 1U5EA 4HB2B 2E2XA 4KHBB 1I2HA 2COCA 3UZTA 4DX90 2J0JA 4MT7A 1J0WA 3AU5A 1WG7A 3SNHA 1E5WA 3G9WA 5J3TA 3KRWA 3PVUA 5FI1A 1DDMA 2QKMA 3RCPA 2CY5A 2RLOA 4DXAB 1BTKA 2R09A 4GPTB 1WI1A 5C5BA 3QBVB 3FSSA 2P0DA 1H10A 1UPRA 4CYEA 4ZRKA 1XR0B 3M1IB 3F0WA 2AEHA 2PZ1A 3PVWA 1FOEA 1MK9B 1V61A 5C16A 2ELAA 2OQBA 1TXDA 4D0NB 2M14A 1BWNA 2EJ8A 2YT0A 1K5DB 2HE7A 2GCLA 1XKEA 1DYNA 2LOXA 3KZ1A 3PVLA 3WYFB 2J0MA 2KUPA 1MIZB 2J0KA 4HAUB 3P7ZA 2Y7BA 4PNKA 1EGXA 1BTNA 4HHVA 4C0AA 1DBHA 3AU4A 2RNRB 4XWXA 2MWNB 1UNRA 5HE3A 5J3YA 2J59M 2DA0A 4WVFB 2R0DA 3PZDA 5JLJB 2N23A 3A98B 4NSWA 4A6FB 1IRSA 1V5PA 3U8ZA 3VOQA 4L6EA 3SYXA 2ELBA 2KGXB 2L2IA 4KVGB 5D3WA 3GYPA 3PEGA 1EVHA 4TYZA 3OANA 5DHFB 2Y8FA 2YS3A 2P0FA 1FGZA 1MIXA 1M7EA 4HAWB 4K2OA 2RVBB 2Z0OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A6H A;  4IOY X;  2YS5 A;  2W2W A;  3CIK A;  4HDQ A;  4A5K A;  4ZRJ A;  2BCJ A;  3VIA A;  4DBB A;  2DFK A;  1X11 A;  2P0H A;  2L1C A;  2RUK B;  2UVM A;  4HDO A;  2H7E A;  2EMS A;  1ZC4 B;  2YRY A;  1WGU A;  3ZVR A;  2D4Q A;  1Q67 A;  1OMW A;  4WSF A;  1GC6 A;  1NI2 A;  2MKR A;  1U2B A;  2D9W A;  4MY6 A;  2QKL A;  1NU2 A;  1ZVR A;  1TQZ A;  2DX5 A;  4H8S A;  1MPH A;  5DI9 B;  4CHM A;  2P8V A;  2DHK A;  3PG7 A;  4EKU A;  5CLL B;  4IFS A;  5LON B;  2XQN M;  1UNP A;  3V5W A;  3TW1 A;  4TKN A;  2DX1 A;  5LOP B;  3SV1 A;  2ADZ A;  1ZC3 B;  4GMV A;  1X05 A;  1PLS A;  2YS1 A;  1EF1 A;  5DIF B;  2D10 A;  1RRP B;  2W2X C;  4ZRI A;  2D2Q A;  1TJ6 A;  2OTX A;  4KHO A;  3TCA A;  1X1G A;  4K2P A;  3ODW A;  3ODX A;  1W1H A;  2CRF A;  4Y94 A;  1KZ7 A;  5C79 A;  2LOZ A;  2K2J A;  5C6R A;  2COA A;  1KI1 B;  1H4R A;  5D3V A;  3PSC A;  2M38 A;  2Z0P A;  4K17 A;  1EAZ A;  2DKQ A;  1I7A A;  2I5F A;  5GOW B;  2KCJ A;  2CY4 A;  1U5F A;  5JP4 A;  5D3Y A;  3IVF A;  4NY0 A;  2D9V A;  2DLW A;  2VSZ A;  3MDB C;  2JP2 A;  1UPQ A;  3QIJ A;  1FHX A;  1NTV A;  3BJI A;  5D3X A;  2DTC A;  3KSY A;  3X23 A;  3KY9 A;  5KQ4 A;  1DRO A;  4HAY B;  1MKE A;  4P7I A;  1K5G B;  1GC7 A;  2RGN B;  2UZS A;  3N7C A;  1FAO A;  1OY2 A;  5J3Q A;  2Z0Q A;  1U27 A;  5HE0 A;  1V5M A;  2G35 A;  2GCJ A;  2VKI A;  1V5U A;  2VRW B;  3TVV A;  3LJU X;  3NSU A;  3ODO A;  4CHJ A;  3HQC A;  1FB8 A;  2V76 A;  2YVC A;  1SGH A;  3D8D A;  4IAP A;  1DDW A;  2LYD A;  1RJ2 A;  2NZ8 B;  1WJ1 A;  1LW3 A;  1FGY A;  3F5R A;  3TFM A;  3ULC A;  2D9Y A;  1P3R A;  4YON A;  4DX8 A;  2LUL A;  3O96 A;  1WVH A;  4K81 A;  2D9X A;  4YL8 A;  1B55 A;  4HAT B;  5DH9 B;  2HTH B;  1V88 A;  2K2U A;  1GG3 A;  1WGQ A;  2GJY A;  2UZR A;  5HE1 A;  5FI0 A;  3TO1 A;  1OQN A;  1FHO A;  3P6A A;  2YSZ A;  2K00 A;  2DHI A;  2X18 A;  4HAX B;  4GXB A;  2DKP A;  1ZSQ A;  4BBK A;  1U5D A;  2RSG A;  2MDX A;  2CAY A;  5JHG A;  3D8E A;  1X1F A;  3PP2 A;  2EC1 A;  1ISN A;  4HAZ B;  2FJL A;  1MK7 B;  5CLQ B;  4F7G A;  1XX0 A;  4Z2N A;  5C5B B;  3KRX A;  3U7D A;  2DHJ A;  2Y8G A;  4GN1 A;  2DYN A;  5JHH A;  3T06 A;  1Y5O A;  4GMX B;  1P5T A;  2I1K A;  4HB4 B;  1SHC A;  3BIN A;  1BAK A;  3A8Q A;  1X86 A;  4F7U P;  1P6S A;  4KHA A;  3DXE A;  1M7R A;  2DYQ A;  4A6K A;  1DDV A;  4Z2M B;  2ROZ B;  4PQ0 A;  4A6F A;  4KAX B;  2AL6 A;  2I5C A;  3D8F A;  1UNQ A;  3AJ4 A;  2IFS A;  1MAI A;  4HAV B;  1AQC A;  5HE2 A;  3ZDT A;  3FM8 C;  2EMT A;  2NMB A;  4MK0 A;  4WJ7 A;  2D11 A;  4F7H A;  1PFJ A;  3SO6 A;  4EMO A;  1W1D A;  5EFX A;  3QWM A;  1Z87 A;  3GYO A;  5DHA B;  2ROV A;  3MPX A;  1UEF A;  1XOD A;  2LKO A;  2YF0 A;  2Q13 A;  2D9Z A;  3DXD A;  2I1J A;  1W1G A;  2W2X D;  1WJM A;  2MFQ A;  1U29 A;  1V89 A;  1XD4 A;  1NTY A;  3SUZ A;  2GS0 A;  2IYB A;  1FHW A;  4HB3 B;  4GZU A;  1PMS A;  1LB1 A;  3HK0 A;  1Y19 B;  1J19 A;  4HB0 B;  3A8P A;  2H7D A;  4EJN A;  3ULB A;  2COF A;  3HW2 B;  3ML4 A;  2DN6 A;  1N3H A;  1AWE A;  2N0Y A;  2ZPY A;  1QQG A;  2COD A;  1KZG A;  4B6H A;  5KCV A;  1XCG A;  3CXB B;  3DXC A;  3WA0 A;  5L81 A;  1QC6 A;  1ZM0 A;  5D27 A;  3FEH A;  2YT1 A;  2LG1 A;  1U5G A;  5KQ1 A;  1U5E A;  4HB2 B;  2E2X A;  4KHB B;  1I2H A;  2COC A;  3UZT A;  4DX9 0;  2J0J A;  4MT7 A;  1J0W A;  3AU5 A;  1WG7 A;  3SNH A;  1E5W A;  3G9W A;  5J3T A;  3KRW A;  3PVU A;  5FI1 A;  1DDM A;  2QKM A;  3RCP A;  2CY5 A;  2RLO A;  4DXA B;  1BTK A;  2R09 A;  4GPT B;  1WI1 A;  5C5B A;  3QBV B;  3FSS A;  2P0D A;  1H10 A;  1UPR A;  4CYE A;  4ZRK A;  1XR0 B;  3M1I B;  3F0W A;  2AEH A;  2PZ1 A;  3PVW A;  1FOE A;  1MK9 B;  1V61 A;  5C16 A;  2ELA A;  2OQB A;  1TXD A;  4D0N B;  2M14 A;  1BWN A;  2EJ8 A;  2YT0 A;  1K5D B;  2HE7 A;  2GCL A;  1XKE A;  1DYN A;  2LOX A;  3KZ1 A;  3PVL A;  3WYF B;  2J0M A;  2KUP A;  1MIZ B;  2J0K A;  4HAU B;  3P7Z A;  2Y7B A;  4PNK A;  1EGX A;  1BTN A;  4HHV A;  4C0A A;  1DBH A;  3AU4 A;  2RNR B;  4XWX A;  2MWN B;  1UNR A;  5HE3 A;  5J3Y A;  2J59 M;  2DA0 A;  4WVF B;  2R0D A;  3PZD A;  5JLJ B;  2N23 A;  3A98 B;  4NSW A;  4A6F B;  1IRS A;  1V5P A;  3U8Z A;  3VOQ A;  4L6E A;  3SYX A;  2ELB A;  2KGX B;  2L2I A;  4KVG B;  5D3W A;  3GYP A;  3PEG A;  1EVH A;  4TYZ A;  3OAN A;  5DHF B;  2Y8F A;  2YS3 A;  2P0F A;  1FGZ A;  1MIX A;  1M7E A;  4HAW B;  4K2O A;  2RVB B;  2Z0O A; 
#chains in the Genus database with same CATH topology
 4A6H A;  4IOY X;  2YS5 A;  2W2W A;  3CIK A;  4HDQ A;  4A5K A;  4ZRJ A;  2BCJ A;  3VIA A;  4DBB A;  2DFK A;  1X11 A;  2P0H A;  2L1C A;  2RUK B;  2UVM A;  4HDO A;  2H7E A;  2EMS A;  2ZKM X;  1ZC4 B;  4QXA B;  2YRY A;  1WGU A;  3ZVR A;  2Z13 A;  2D4Q A;  1Q67 A;  1OMW A;  4GNK B;  5LG4 B;  4WSF A;  1GC6 A;  1NI2 A;  2MKR A;  1U2B A;  2D9W A;  4MY6 A;  2QKL A;  1NU2 A;  1ZVR A;  1TQZ A;  2DX5 A;  4H8S A;  1MPH A;  5DI9 B;  4CHM A;  2P8V A;  2DHK A;  3PG7 A;  4EKU A;  5CLL B;  4IFS A;  5LON B;  2XQN M;  1UNP A;  3V5W A;  3TW1 A;  4TKN A;  2DX1 A;  5LOP B;  3SV1 A;  4QJ4 B;  2ADZ A;  1ZC3 B;  1MI1 A;  4GMV A;  1X05 A;  5M4Y B;  3B77 A;  1PLS A;  2YS1 A;  1EF1 A;  2KIG A;  5DIF B;  2D10 A;  1RRP B;  2W2X C;  4ZRI A;  4L1R A;  2D2Q A;  1TJ6 A;  2OTX A;  4KHO A;  3TCA A;  1X1G A;  4K2P A;  3ODW A;  3ODX A;  1W1H A;  2CRF A;  4Y94 A;  1KZ7 A;  5C79 A;  2LOZ A;  2K2J A;  5C6R A;  2COA A;  1KI1 B;  1H4R A;  5D3V A;  3PSC A;  2M38 A;  2Z0P A;  4K17 A;  1EAZ A;  2DKQ A;  5I2S A;  1I7A A;  2I5F A;  5GOW B;  2KCJ A;  2CY4 A;  1U5F A;  5JP4 A;  5D3Y A;  3IVF A;  4NY0 A;  2D9V A;  2DLW A;  2VSZ A;  2R2Y A;  3MDB C;  2JP2 A;  1UPQ A;  3QIJ A;  1FHX A;  1NTV A;  3BJI A;  5D3X A;  2DTC A;  3KSY A;  3X23 A;  3KY9 A;  5KQ4 A;  1DRO A;  4HAY B;  1MKE A;  4P7I A;  5IRS A;  2K8E A;  1K5G B;  2Z4D A;  1GC7 A;  2RGN B;  2UZS A;  3N7C A;  1FAO A;  1OY2 A;  5J3Q A;  2Z0Q A;  1U27 A;  5HE0 A;  1V5M A;  2G35 A;  2GCJ A;  2VKI A;  1V5U A;  2VRW B;  3TVV A;  3LJU X;  3NSU A;  3ODO A;  4CHJ A;  3HQC A;  1FB8 A;  2V76 A;  2YVC A;  1SGH A;  3D8D A;  4IAP A;  1DDW A;  2LYD A;  1RJ2 A;  2KUQ A;  1WJ1 A;  1LW3 A;  2NZ8 B;  1FGY A;  3F5R A;  3TFM A;  3ULC A;  2D9Y A;  1P3R A;  4YON A;  4DX8 A;  2LUL A;  3O96 A;  1WVH A;  4K81 A;  2D9X A;  4YL8 A;  1B55 A;  4HAT B;  5DH9 B;  2HTH B;  4CSQ A;  1V88 A;  2K2U A;  1GG3 A;  1WGQ A;  2GJY A;  2UZR A;  5HE1 A;  5FI0 A;  3TO1 A;  2KR0 A;  1OQN A;  1FHO A;  3P6A A;  2RRF A;  3FVC A;  2YSZ A;  2K00 A;  2DHI A;  2X18 A;  4HAX B;  4GXB A;  4GOU A;  2DKP A;  1ZSQ A;  4BBK A;  1U5D A;  2RSG A;  2MDX A;  3NWA A;  2CAY A;  5JHG A;  3D8E A;  3HIE A;  4DIX A;  1X1F A;  3PP2 A;  2EC1 A;  1ISN A;  4OT1 A;  4HAZ B;  2FJL A;  1MK7 B;  5CLQ B;  4F7G A;  1XX0 A;  4Z2N A;  5C5B B;  3KRX A;  3DCX A;  3U7D A;  2DHJ A;  2Y8G A;  4GN1 A;  2DYN A;  5JHH A;  3T06 A;  1Y5O A;  4QJ3 B;  4GMX B;  1P5T A;  3OHM B;  3HSA A;  2I1K A;  4HB4 B;  1SHC A;  3BIN A;  1BAK A;  3A8Q A;  1X86 A;  4F7U P;  1P6S A;  4KHA A;  3DXE A;  1M7R A;  2DYQ A;  3A58 A;  4A6K A;  1DDV A;  4Z2M B;  4KHB A;  2ROZ B;  4PQ0 A;  4A6F A;  4KAX B;  2AL6 A;  2I5C A;  3D8F A;  1UNQ A;  3AJ4 A;  2IFS A;  2YT2 A;  1MAI A;  4HAV B;  1AQC A;  5HE2 A;  3ZDT A;  3FM8 C;  2EMT A;  2NMB A;  4MK0 A;  4WJ7 A;  1T77 A;  2D11 A;  2Z59 A;  4F7H A;  1PFJ A;  3SO6 A;  4EMO A;  1W1D A;  5EFX A;  4D6W A;  3QWM A;  1Z87 A;  3GYO A;  3NW8 A;  4HSI A;  5DHA B;  3NWD A;  2ROV A;  3MPX A;  1UEF A;  1XOD A;  2LKO A;  2YF0 A;  2Q13 A;  2GUM A;  2D9Z A;  3DXD A;  2I1J A;  1W1G A;  2W2X D;  2NBV A;  1WJM A;  2MFQ A;  1U29 A;  1V89 A;  1XD4 A;  1NTY A;  3SUZ A;  2GS0 A;  2IYB A;  1FHW A;  4HB3 B;  4GZU A;  1PMS A;  1LB1 A;  3HK0 A;  1Y19 B;  1J19 A;  2FJU B;  3A8P A;  2H7D A;  4HB0 B;  4EJN A;  3ULB A;  2COF A;  3HW2 B;  3ML4 A;  2DN6 A;  3U12 A;  1N3H A;  1AWE A;  2N0Y A;  2ZPY A;  1QQG A;  2COD A;  1KZG A;  4B6H A;  5KCV A;  1XCG A;  3CXB B;  3DXC A;  3WA0 A;  5L81 A;  1QC6 A;  1ZM0 A;  5D27 A;  3FEH A;  2YT1 A;  2LG1 A;  1U5G A;  5KQ1 A;  1U5E A;  4HB2 B;  2E2X A;  4KHB B;  1I2H A;  2COC A;  3UZT A;  4DX9 0;  2J0J A;  2K49 A;  4MT7 A;  1J0W A;  3AU5 A;  1WG7 A;  4OSN A;  3SNH A;  1E5W A;  3G9W A;  5J3T A;  3KRW A;  3PVU A;  5FI1 A;  1DDM A;  2QKM A;  3RCP A;  2CY5 A;  2RLO A;  4DXA B;  1BTK A;  2R09 A;  4GPT B;  1WI1 A;  5C5B A;  3QBV B;  3FSS A;  2P0D A;  1H10 A;  1UPR A;  4CYE A;  4ZRK A;  1XR0 B;  3M1I B;  3F0W A;  2AEH A;  3NWF A;  2PZ1 A;  3PVW A;  1FOE A;  1MK9 B;  1V61 A;  5C16 A;  2ELA A;  2OQB A;  1TXD A;  4D0N B;  2M14 A;  1BWN A;  2EJ8 A;  2YT0 A;  1K5D B;  2HE7 A;  2GCL A;  1XKE A;  1DYN A;  2LOX A;  3KZ1 A;  3PVL A;  3WYF B;  2J0M A;  2KUP A;  1MIZ B;  2J0K A;  4HAU B;  3P7Z A;  2Y7B A;  4PNK A;  1EGX A;  1BTN A;  4HHV A;  4C0A A;  2Z14 A;  1DBH A;  3AU4 A;  2RNR B;  4XWX A;  2MWN B;  1UNR A;  5HE3 A;  5J3Y A;  2J59 M;  2DA0 A;  5I2M A;  4WVF B;  2R0D A;  2KIE A;  3PZD A;  5JLJ B;  2N23 A;  3A98 B;  4NSW A;  4A6F B;  1IRS A;  1V5P A;  3U8Z A;  3VOQ A;  4L6E A;  3SYX A;  2ELB A;  2KGX B;  2L2I A;  4KVG B;  5D3W A;  3GYP A;  3PEG A;  1EVH A;  4TYZ A;  1ZYI A;  3OAN A;  5DHF B;  2Y8F A;  2YS3 A;  2P0F A;  1FGZ A;  1MIX A;  4QJ5 B;  1M7E A;  4HAW B;  4K2O A;  2RVB B;  2Z0O A; 
#chains in the Genus database with same CATH homology
 4A6H A;  4IOY X;  2YS5 A;  2W2W A;  3CIK A;  4HDQ A;  4A5K A;  4ZRJ A;  2BCJ A;  3VIA A;  4DBB A;  2DFK A;  1X11 A;  2P0H A;  2L1C A;  2RUK B;  2UVM A;  4HDO A;  2H7E A;  2EMS A;  1ZC4 B;  2YRY A;  1WGU A;  3ZVR A;  2D4Q A;  1Q67 A;  1OMW A;  4WSF A;  1GC6 A;  1NI2 A;  2MKR A;  1U2B A;  2D9W A;  4MY6 A;  2QKL A;  1NU2 A;  1ZVR A;  1TQZ A;  2DX5 A;  4H8S A;  1MPH A;  5DI9 B;  4CHM A;  2P8V A;  2DHK A;  3PG7 A;  4EKU A;  5CLL B;  4IFS A;  5LON B;  2XQN M;  1UNP A;  3V5W A;  3TW1 A;  4TKN A;  2DX1 A;  5LOP B;  3SV1 A;  2ADZ A;  1ZC3 B;  4GMV A;  1X05 A;  1PLS A;  2YS1 A;  1EF1 A;  5DIF B;  2D10 A;  1RRP B;  2W2X C;  4ZRI A;  2D2Q A;  1TJ6 A;  2OTX A;  4KHO A;  3TCA A;  1X1G A;  4K2P A;  3ODW A;  3ODX A;  1W1H A;  2CRF A;  4Y94 A;  1KZ7 A;  5C79 A;  2LOZ A;  2K2J A;  5C6R A;  2COA A;  1KI1 B;  1H4R A;  5D3V A;  3PSC A;  2M38 A;  2Z0P A;  4K17 A;  1EAZ A;  2DKQ A;  1I7A A;  2I5F A;  5GOW B;  2KCJ A;  2CY4 A;  1U5F A;  5JP4 A;  5D3Y A;  3IVF A;  4NY0 A;  2D9V A;  2DLW A;  2VSZ A;  3MDB C;  2JP2 A;  1UPQ A;  3QIJ A;  1FHX A;  1NTV A;  3BJI A;  5D3X A;  2DTC A;  3KSY A;  3X23 A;  3KY9 A;  5KQ4 A;  1DRO A;  4HAY B;  1MKE A;  4P7I A;  1K5G B;  1GC7 A;  2RGN B;  2UZS A;  3N7C A;  1FAO A;  1OY2 A;  5J3Q A;  2Z0Q A;  1U27 A;  5HE0 A;  1V5M A;  2G35 A;  2GCJ A;  2VKI A;  1V5U A;  2VRW B;  3TVV A;  3LJU X;  3NSU A;  3ODO A;  4CHJ A;  3HQC A;  1FB8 A;  2V76 A;  2YVC A;  1SGH A;  3D8D A;  4IAP A;  1DDW A;  2LYD A;  1RJ2 A;  2NZ8 B;  1WJ1 A;  1LW3 A;  1FGY A;  3F5R A;  3TFM A;  3ULC A;  2D9Y A;  1P3R A;  4YON A;  4DX8 A;  2LUL A;  3O96 A;  1WVH A;  4K81 A;  2D9X A;  4YL8 A;  1B55 A;  4HAT B;  5DH9 B;  2HTH B;  1V88 A;  2K2U A;  1GG3 A;  1WGQ A;  2GJY A;  2UZR A;  5HE1 A;  5FI0 A;  3TO1 A;  1OQN A;  1FHO A;  3P6A A;  2YSZ A;  2K00 A;  2DHI A;  2X18 A;  4HAX B;  4GXB A;  2DKP A;  1ZSQ A;  4BBK A;  1U5D A;  2RSG A;  2MDX A;  2CAY A;  5JHG A;  3D8E A;  1X1F A;  3PP2 A;  2EC1 A;  1ISN A;  4HAZ B;  2FJL A;  1MK7 B;  5CLQ B;  4F7G A;  1XX0 A;  4Z2N A;  5C5B B;  3KRX A;  3U7D A;  2DHJ A;  2Y8G A;  4GN1 A;  2DYN A;  5JHH A;  3T06 A;  1Y5O A;  4GMX B;  1P5T A;  2I1K A;  4HB4 B;  1SHC A;  3BIN A;  1BAK A;  3A8Q A;  1X86 A;  4F7U P;  1P6S A;  4KHA A;  3DXE A;  1M7R A;  2DYQ A;  4A6K A;  1DDV A;  4Z2M B;  2ROZ B;  4PQ0 A;  4A6F A;  4KAX B;  2AL6 A;  2I5C A;  3D8F A;  1UNQ A;  3AJ4 A;  2IFS A;  1MAI A;  4HAV B;  1AQC A;  5HE2 A;  3ZDT A;  3FM8 C;  2EMT A;  2NMB A;  4MK0 A;  4WJ7 A;  2D11 A;  4F7H A;  1PFJ A;  3SO6 A;  4EMO A;  1W1D A;  5EFX A;  3QWM A;  1Z87 A;  3GYO A;  5DHA B;  2ROV A;  3MPX A;  1UEF A;  1XOD A;  2LKO A;  2YF0 A;  2Q13 A;  2D9Z A;  3DXD A;  2I1J A;  1W1G A;  2W2X D;  1WJM A;  2MFQ A;  1U29 A;  1V89 A;  1XD4 A;  1NTY A;  3SUZ A;  2GS0 A;  2IYB A;  1FHW A;  4HB3 B;  4GZU A;  1PMS A;  1LB1 A;  3HK0 A;  1Y19 B;  1J19 A;  4HB0 B;  3A8P A;  2H7D A;  4EJN A;  3ULB A;  2COF A;  3HW2 B;  3ML4 A;  2DN6 A;  1N3H A;  1AWE A;  2N0Y A;  2ZPY A;  1QQG A;  2COD A;  1KZG A;  4B6H A;  5KCV A;  1XCG A;  3CXB B;  3DXC A;  3WA0 A;  5L81 A;  1QC6 A;  1ZM0 A;  5D27 A;  3FEH A;  2YT1 A;  2LG1 A;  1U5G A;  5KQ1 A;  1U5E A;  4HB2 B;  2E2X A;  4KHB B;  1I2H A;  2COC A;  3UZT A;  4DX9 0;  2J0J A;  4MT7 A;  1J0W A;  3AU5 A;  1WG7 A;  3SNH A;  1E5W A;  3G9W A;  5J3T A;  3KRW A;  3PVU A;  5FI1 A;  1DDM A;  2QKM A;  3RCP A;  2CY5 A;  2RLO A;  4DXA B;  1BTK A;  2R09 A;  4GPT B;  1WI1 A;  5C5B A;  3QBV B;  3FSS A;  2P0D A;  1H10 A;  1UPR A;  4CYE A;  4ZRK A;  1XR0 B;  3M1I B;  3F0W A;  2AEH A;  2PZ1 A;  3PVW A;  1FOE A;  1MK9 B;  1V61 A;  5C16 A;  2ELA A;  2OQB A;  1TXD A;  4D0N B;  2M14 A;  1BWN A;  2EJ8 A;  2YT0 A;  1K5D B;  2HE7 A;  2GCL A;  1XKE A;  1DYN A;  2LOX A;  3KZ1 A;  3PVL A;  3WYF B;  2J0M A;  2KUP A;  1MIZ B;  2J0K A;  4HAU B;  3P7Z A;  2Y7B A;  4PNK A;  1EGX A;  1BTN A;  4HHV A;  4C0A A;  1DBH A;  3AU4 A;  2RNR B;  4XWX A;  2MWN B;  1UNR A;  5HE3 A;  5J3Y A;  2J59 M;  2DA0 A;  4WVF B;  2R0D A;  3PZD A;  5JLJ B;  2N23 A;  3A98 B;  4NSW A;  4A6F B;  1IRS A;  1V5P A;  3U8Z A;  3VOQ A;  4L6E A;  3SYX A;  2ELB A;  2KGX B;  2L2I A;  4KVG B;  5D3W A;  3GYP A;  3PEG A;  1EVH A;  4TYZ A;  3OAN A;  5DHF B;  2Y8F A;  2YS3 A;  2P0F A;  1FGZ A;  1MIX A;  1M7E A;  4HAW B;  4K2O A;  2RVB B;  2Z0O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...