3ULBA

Crystal structure of the pleckstrin homology domain of saccharomyces cerevisiae avo1, a torc2 subunit, in the p212121 crystal form
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
109
structure length
102
Chain Sequence
YHKYKVWRRQQMSFINKHERTLAIDGDYIYIVPPENVKTKSLHISQVVLVKKSKRVPEHFKIFVRREGQDDIKRYYFEAVSGQECTEIVTRLQNLLSAYRMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of the pleckstrin homology domain of Saccharomyces cerevisiae Avo1 and its human orthologue Sin1, an essential subunit of TOR complex 2
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Membrane protein
molecule keywords Target of rapamycin complex 2 subunit AVO1
total genus 20
structure length 102
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16979 SIN1_PH SAPK-interacting protein 1 (Sin1), Pleckstrin-homology
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3ulbA01
4PNKA 2JP2A 3O96A 2P0DA 4HAVB 1V5PA 3PVLA 3KZ1A 4TYZA 2W2WA 4HAUB 2ZPYA 2LKOA 2ELBA 1UNRA 1U2BA 3ODWA 2GCJA 1UPRA 1W1HA 1U29A 1DYNA 5DHAB 2H7EA 4A5KA 4ZRIA 1MKEA 5D27A 2Z0QA 2K00A 3F0WA 1XD4A 2J0KA 1WI1A 4HB4B 2RGNB 1XCGA 1PFJA 5CLLB 1RRPB 1PMSA 2DYNA 2MFQA 4B6HA 3F5RA 2VRWB 5DIFB 5GOWB 2DA0A 5D3VA 2N0YA 2YSZA 3P6AA 2RUKB 1U5FA 2Q13A 3ODXA 4DX90 2YS1A 2LYDA 5KCVA 2OQBA 3ODOA 3BJIA 1J19A 2R09A 1EF1A 3GYPA 2D9ZA 3AU4A 1PLSA 3TFMA 4H8SA 2YS3A 2DX5A 3TW1A 3AJ4A 2D10A 1FGZA 2K2JA 1Y5OA 3ULCA 4A6FB 4NY0A 1Y19B 4ZRJA 2YF0A 3A8PA 2Z0PA 4HAYB 1M7RA 1MAIA 2ELAA 2CY5A 1GC7A 4Y94A 3VOQA 4HATB 1E5WA 5DH9B 3X23A 3KY9A 2M38A 2AL6A 2D9VA 2R0DA 1UEFA 4GN1A 5JHHA 4F7HA 4F7GA 3ULBA 4YONA 4C0AA 4KAXB 2QKLA 1M7EA 3LJUX 2P0FA 4WJ7A 3MDBC 2YS5A 1XR0B 3PEGA 1Q67A 5C5BB 3FM8C 2D4QA 5C16A 1MIZB 5HE1A 2D2QA 1X05A 1N3HA 2DHJA 3ZDTA 3CIKA 1XODA 1FOEA 2ADZA 2UVMA 5JLJB 1EVHA 4A6KA 1ZC4B 1SGHA 2NMBA 1X86A 3U8ZA 2MKRA 1GC6A 1ZSQA 4HB0B 1I7AA 1V89A 5EFXA 2DHKA 3N7CA 4DX8A 5C6RA 1H10A 3PZDA 1FB8A 3GYOA 2CY4A 2VKIA 3ML4A 2GCLA 2L1CA 2EJ8A 2DFKA 2I1JA 1W1DA 3FEHA 1KZ7A 2QKMA 3KRXA 4TKNA 1W1GA 2J0MA 4D0NB 2EMSA 2ROZB 5D3YA 3SUZA 3PP2A 1K5GB 1P5TA 2VSZA 4CYEA 2D9XA 2D11A 1EAZA 1V88A 1NI2A 3HQCA 4XWXA 2UZRA 1GG3A 3A98B 2DN6A 4IFSA 1WG7A 1XKEA 2Z0OA 2COFA 1DDWA 2X18A 3U7DA 1MPHA 3CXBB 2KCJA 1FHOA 1BAKA 1WJMA 1I2HA 3G9WA 3A8QA 3DXCA 2K2UA 3HW2B 3WA0A 2RSGA 2E2XA 5LONB 4CHJA 5J3YA 3SNHA 2UZSA 1OY2A 3TCAA 1QQGA 4HDOA 1TXDA 5J3QA 1NTVA 2EMTA 2OTXA 3DXEA 4A6FA 4GMVA 5JHGA 5L81A 4MK0A 4K81A 1K5DB 1ZM0A 4GPTB 2DX1A 2J59M 1P6SA 3DXDA 1BTKA 2D9WA 1TQZA 1U27A 4CHMA 2COAA 1V5UA 4KHBB 4L6EA 2EC1A 1OMWA 5KQ1A 1FGYA 5CLQB 3IVFA 4KHOA 1EGXA 4K2OA 1XX0A 2RLOA 1J0WA 2H7DA 1WGUA 2YT1A 1KI1B 1UPQA 2M14A 4MY6A 2YRYA 4P7IA 1NTYA 2AEHA 4A6HA 4EJNA 4PQ0A 4KVGB 3D8DA 2RVBB 4HHVA 4Z2NA 1DBHA 4EKUA 3RCPA 4HDQA 3KSYA 2W2XD 3PG7A 3QBVB 1MK7B 4BBKA 2CODA 4HB2B 1DROA 4KHAA 2DYQA 3PVWA 1DDMA 3BINA 1FHWA 3WYFB 3AU5A 3FSSA 1OQNA 2DKQA 2XQNM 4HAWB 4HAZB 1U5DA 2LOXA 2P8VA 1U5EA 4Z2MB 4EMOA 3SYXA 3TO1A 5DI9B 3SV1A 1U5GA 1AWEA 1FAOA 2ROVA 1DDVA 2FJLA 1TJ6A 1V61A 2NZ8B 3M1IB 3PSCA 5HE3A 3TVVA 2BCJA 2IFSA 4MT7A 3VIAA 2I5CA 5HE0A 2YT0A 3SO6A 2W2XC 2CAYA 2IYBA 5JP4A 1B55A 5J3TA 1MK9B 2DTCA 4GXBA 4GMXB 1MIXA 3QIJA 2MDXA 3UZTA 1WGQA 4ZRKA 1NU2A 1Z87A 1RJ2A 2GJYA 1V5MA 2LG1A 2KUPA 1WJ1A 5C79A 4IOYX 1SHCA 2I5FA 3P7ZA 5HE2A 1BTNA 3ZVRA 5C5BA 1P3RA 4NSWA 4IAPA 2MWNB 3MPXA 2Y8GA 2P0HA 1AQCA 2KGXB 4WVFB 2G35A 1ZC3B 1ZVRA 2L2IA 5LOPB 2DLWA 2Y7BA 1KZGA 2PZ1A 4YL8A 5DHFB 2I1KA 5KQ4A 3KRWA 2Y8FA 1UNPA 1ISNA 2DKPA 1UNQA 1WVHA 5FI0A 3D8EA 2GS0A 1IRSA 5FI1A 1X11A 4K2PA 2RNRB 2V76A 4HAXB 3QWMA 1QC6A 1X1GA 4K17A 2CRFA 3PVUA 4DXAB 4F7UP 3T06A 1X1FA 2LOZA 5D3WA 3OANA 3V5WA 5D3XA 2HE7A 2N23A 2LULA 3HK0A 4DBBA 1LB1A 2YVCA 2J0JA 1LW3A 4HB3B 1FHXA 2DHIA 4GZUA 1BWNA 1H4RA 3NSUA 4WSFA 3D8FA 2HTHB 2COCA 2D9YA
chains in the Genus database with same CATH superfamily
4PNKA 2JP2A 3O96A 2P0DA 4HAVB 1V5PA 3PVLA 3KZ1A 4OT1A 4TYZA 4OSNA 2W2WA 4HAUB 2ZPYA 2LKOA 2ELBA 1UNRA 1U2BA 3ODWA 2GCJA 1UPRA 2ZKMX 1W1HA 4D6WA 1U29A 1DYNA 5DHAB 2H7EA 4A5KA 2KIGA 4ZRIA 1MKEA 5D27A 2Z0QA 2K00A 3F0WA 1XD4A 2J0KA 1WI1A 4HB4B 2RGNB 1XCGA 1PFJA 5CLLB 1RRPB 1PMSA 2DYNA 2MFQA 4B6HA 4QJ4B 3F5RA 2VRWB 5DIFB 5GOWB 2DA0A 5D3VA 2N0YA 2YSZA 3P6AA 2RUKB 1U5FA 2Q13A 3ODXA 4DX90 2YS1A 2LYDA 5KCVA 2OQBA 3ODOA 3BJIA 1J19A 2R09A 3NWFA 1EF1A 3GYPA 2D9ZA 3AU4A 1PLSA 3TFMA 4H8SA 2YS3A 4L1RA 3A58A 2DX5A 3NWAA 3TW1A 3AJ4A 2D10A 1FGZA 2K2JA 1Y5OA 3ULCA 4A6FB 4NY0A 1Y19B 4ZRJA 2YF0A 3A8PA 2Z0PA 4HAYB 1MI1A 1M7RA 1MAIA 2ELAA 2CY5A 1GC7A 4Y94A 3VOQA 4QJ5B 4HATB 1E5WA 5DH9B 3X23A 3KY9A 2M38A 2AL6A 2D9VA 2R0DA 1UEFA 3HIEA 4GN1A 5JHHA 4F7HA 4F7GA 3ULBA 4YONA 4C0AA 4KAXB 2QKLA 1M7EA 3LJUX 2P0FA 4WJ7A 3MDBC 2YS5A 1XR0B 3PEGA 1Q67A 5C5BB 3FM8C 2D4QA 5C16A 1MIZB 5HE1A 2D2QA 1X05A 1N3HA 2DHJA 3ZDTA 3CIKA 1XODA 1FOEA 2ADZA 2UVMA 5JLJB 1EVHA 4A6KA 1ZC4B 1SGHA 2NMBA 1X86A 3U8ZA 2Z13A 2MKRA 3U12A 1GC6A 1ZSQA 4HB0B 1I7AA 1V89A 5EFXA 2DHKA 4CSQA 3N7CA 4DX8A 5C6RA 1H10A 3PZDA 1FB8A 3GYOA 2CY4A 2VKIA 3ML4A 2GCLA 2L1CA 2EJ8A 4GNKB 2DFKA 2I1JA 1W1DA 3FEHA 1KZ7A 2QKMA 3KRXA 4TKNA 1W1GA 2J0MA 5M4YB 3OHMB 4D0NB 2EMSA 2ROZB 5D3YA 3SUZA 3PP2A 1K5GB 1P5TA 2VSZA 4CYEA 2D9XA 2D11A 1EAZA 1V88A 1NI2A 3HQCA 4XWXA 2UZRA 1GG3A 3A98B 2DN6A 4IFSA 1WG7A 1XKEA 2Z59A 2Z0OA 2COFA 1DDWA 2X18A 4QJ3B 3U7DA 1MPHA 3CXBB 2KCJA 1FHOA 1BAKA 1WJMA 1I2HA 3G9WA 3A8QA 3DXCA 2K2UA 3HW2B 3WA0A 2RSGA 3DCXA 2E2XA 5LONB 4CHJA 5J3YA 3SNHA 2UZSA 1OY2A 3TCAA 1QQGA 4HDOA 1TXDA 5J3QA 1NTVA 2EMTA 2OTXA 3DXEA 4A6FA 4QXAB 4GMVA 5JHGA 5L81A 4MK0A 4K81A 1K5DB 1ZM0A 4GPTB 2DX1A 2J59M 1P6SA 2RRFA 3DXDA 1BTKA 3B77A 2D9WA 1TQZA 1U27A 4CHMA 2COAA 1V5UA 4KHBB 4L6EA 2EC1A 1OMWA 5KQ1A 1FGYA 5CLQB 3IVFA 4KHOA 1EGXA 4K2OA 1XX0A 2RLOA 1J0WA 2NBVA 2H7DA 1WGUA 2YT1A 3NW8A 1KI1B 1UPQA 2M14A 4MY6A 2YRYA 4P7IA 1NTYA 2AEHA 4A6HA 3HSAA 2KIEA 4PQ0A 4KVGB 4EJNA 3D8DA 2RVBB 2FJUB 3NWDA 4HHVA 4Z2NA 1DBHA 4EKUA 3RCPA 4HDQA 3KSYA 2YT2A 2W2XD 3PG7A 4HSIA 3QBVB 1MK7B 4BBKA 2KR0A 2CODA 4HB2B 1DROA 4KHAA 2DYQA 3PVWA 1DDMA 3BINA 1FHWA 3WYFB 3AU5A 3FSSA 1OQNA 2DKQA 2XQNM 4HAWB 4HAZB 1U5DA 2LOXA 2P8VA 1U5EA 2K8EA 4Z2MB 4EMOA 3SYXA 3TO1A 5DI9B 3SV1A 1U5GA 1AWEA 1FAOA 2ROVA 1DDVA 2FJLA 1TJ6A 1V61A 2NZ8B 3M1IB 3PSCA 5HE3A 3TVVA 5LG4B 2BCJA 4DIXA 2IFSA 4MT7A 3VIAA 2I5CA 5HE0A 2YT0A 1ZYIA 4GOUA 3SO6A 2W2XC 2CAYA 2IYBA 5JP4A 1B55A 5J3TA 1MK9B 2DTCA 4GXBA 4GMXB 1MIXA 3QIJA 2MDXA 3UZTA 1WGQA 4ZRKA 1NU2A 1Z87A 1RJ2A 2GJYA 1V5MA 2LG1A 2KUPA 2R2YA 1WJ1A 5C79A 4IOYX 1SHCA 2I5FA 2Z4DA 3P7ZA 5HE2A 1BTNA 3ZVRA 5C5BA 1P3RA 5I2MA 4NSWA 4IAPA 2Z14A 5I2SA 2MWNB 3MPXA 2Y8GA 2P0HA 5IRSA 1AQCA 2KGXB 2K49A 4WVFB 4KHBA 2G35A 1ZC3B 1ZVRA 2L2IA 5LOPB 2DLWA 2Y7BA 1KZGA 2PZ1A 4YL8A 5DHFB 2I1KA 5KQ4A 1T77A 3KRWA 2Y8FA 1UNPA 1ISNA 2DKPA 1UNQA 1WVHA 5FI0A 3D8EA 2GS0A 1IRSA 5FI1A 1X11A 4K2PA 2RNRB 2V76A 4HAXB 3QWMA 1QC6A 1X1GA 4K17A 2CRFA 3PVUA 4DXAB 4F7UP 3T06A 1X1FA 2LOZA 5D3WA 3OANA 3V5WA 5D3XA 2HE7A 2N23A 2LULA 3HK0A 4DBBA 1LB1A 2YVCA 2J0JA 1LW3A 4HB3B 1FHXA 2DHIA 4GZUA 2GUMA 1BWNA 1H4RA 3FVCA 3NSUA 4WSFA 3D8FA 2HTHB 2KUQA 2COCA 2D9YA
chains in the Genus database with same CATH topology
4PNKA 2JP2A 3O96A 2P0DA 4HAVB 1V5PA 3PVLA 3KZ1A 4TYZA 2W2WA 4HAUB 2ZPYA 2LKOA 2ELBA 1UNRA 1U2BA 3ODWA 2GCJA 1UPRA 1W1HA 1U29A 1DYNA 5DHAB 2H7EA 4A5KA 4ZRIA 1MKEA 5D27A 2Z0QA 2K00A 3F0WA 1XD4A 2J0KA 1WI1A 4HB4B 2RGNB 1XCGA 1PFJA 5CLLB 1RRPB 1PMSA 2DYNA 2MFQA 4B6HA 3F5RA 2VRWB 5DIFB 5GOWB 2DA0A 5D3VA 2N0YA 2YSZA 3P6AA 2RUKB 1U5FA 2Q13A 3ODXA 4DX90 2YS1A 2LYDA 5KCVA 2OQBA 3ODOA 3BJIA 1J19A 2R09A 1EF1A 3GYPA 2D9ZA 3AU4A 1PLSA 3TFMA 4H8SA 2YS3A 2DX5A 3TW1A 3AJ4A 2D10A 1FGZA 2K2JA 1Y5OA 3ULCA 4A6FB 4NY0A 1Y19B 4ZRJA 2YF0A 3A8PA 2Z0PA 4HAYB 1M7RA 1MAIA 2ELAA 2CY5A 1GC7A 4Y94A 3VOQA 4HATB 1E5WA 5DH9B 3X23A 3KY9A 2M38A 2AL6A 2D9VA 2R0DA 1UEFA 4GN1A 5JHHA 4F7HA 4F7GA 3ULBA 4YONA 4C0AA 4KAXB 2QKLA 1M7EA 3LJUX 2P0FA 4WJ7A 3MDBC 2YS5A 1XR0B 3PEGA 1Q67A 5C5BB 3FM8C 2D4QA 5C16A 1MIZB 5HE1A 2D2QA 1X05A 1N3HA 2DHJA 3ZDTA 3CIKA 1XODA 1FOEA 2ADZA 2UVMA 5JLJB 1EVHA 4A6KA 1ZC4B 1SGHA 2NMBA 1X86A 3U8ZA 2MKRA 1GC6A 1ZSQA 4HB0B 1I7AA 1V89A 5EFXA 2DHKA 3N7CA 4DX8A 5C6RA 1H10A 3PZDA 1FB8A 3GYOA 2CY4A 2VKIA 3ML4A 2GCLA 2L1CA 2EJ8A 2DFKA 2I1JA 1W1DA 3FEHA 1KZ7A 2QKMA 3KRXA 4TKNA 1W1GA 2J0MA 4D0NB 2EMSA 2ROZB 5D3YA 3SUZA 3PP2A 1K5GB 1P5TA 2VSZA 4CYEA 2D9XA 2D11A 1EAZA 1V88A 1NI2A 3HQCA 4XWXA 2UZRA 1GG3A 3A98B 2DN6A 4IFSA 1WG7A 1XKEA 2Z0OA 2COFA 1DDWA 2X18A 3U7DA 1MPHA 3CXBB 2KCJA 1FHOA 1BAKA 1WJMA 1I2HA 3G9WA 3A8QA 3DXCA 2K2UA 3HW2B 3WA0A 2RSGA 2E2XA 5LONB 4CHJA 5J3YA 3SNHA 2UZSA 1OY2A 3TCAA 1QQGA 4HDOA 1TXDA 5J3QA 1NTVA 2EMTA 2OTXA 3DXEA 4A6FA 4GMVA 5JHGA 5L81A 4MK0A 4K81A 1K5DB 1ZM0A 4GPTB 2DX1A 2J59M 1P6SA 3DXDA 1BTKA 2D9WA 1TQZA 1U27A 4CHMA 2COAA 1V5UA 4KHBB 4L6EA 2EC1A 1OMWA 5KQ1A 1FGYA 5CLQB 3IVFA 4KHOA 1EGXA 4K2OA 1XX0A 2RLOA 1J0WA 2H7DA 1WGUA 2YT1A 1KI1B 1UPQA 2M14A 4MY6A 2YRYA 4P7IA 1NTYA 2AEHA 4A6HA 4EJNA 4PQ0A 4KVGB 3D8DA 2RVBB 4HHVA 4Z2NA 1DBHA 4EKUA 3RCPA 4HDQA 3KSYA 2W2XD 3PG7A 3QBVB 1MK7B 4BBKA 2CODA 4HB2B 1DROA 4KHAA 2DYQA 3PVWA 1DDMA 3BINA 1FHWA 3WYFB 3AU5A 3FSSA 1OQNA 2DKQA 2XQNM 4HAWB 4HAZB 1U5DA 2LOXA 2P8VA 1U5EA 4Z2MB 4EMOA 3SYXA 3TO1A 5DI9B 3SV1A 1U5GA 1AWEA 1FAOA 2ROVA 1DDVA 2FJLA 1TJ6A 1V61A 2NZ8B 3M1IB 3PSCA 5HE3A 3TVVA 2BCJA 2IFSA 4MT7A 3VIAA 2I5CA 5HE0A 2YT0A 3SO6A 2W2XC 2CAYA 2IYBA 5JP4A 1B55A 5J3TA 1MK9B 2DTCA 4GXBA 4GMXB 1MIXA 3QIJA 2MDXA 3UZTA 1WGQA 4ZRKA 1NU2A 1Z87A 1RJ2A 2GJYA 1V5MA 2LG1A 2KUPA 1WJ1A 5C79A 4IOYX 1SHCA 2I5FA 3P7ZA 5HE2A 1BTNA 3ZVRA 5C5BA 1P3RA 4NSWA 4IAPA 2MWNB 3MPXA 2Y8GA 2P0HA 1AQCA 2KGXB 4WVFB 2G35A 1ZC3B 1ZVRA 2L2IA 5LOPB 2DLWA 2Y7BA 1KZGA 2PZ1A 4YL8A 5DHFB 2I1KA 5KQ4A 3KRWA 2Y8FA 1UNPA 1ISNA 2DKPA 1UNQA 1WVHA 5FI0A 3D8EA 2GS0A 1IRSA 5FI1A 1X11A 4K2PA 2RNRB 2V76A 4HAXB 3QWMA 1QC6A 1X1GA 4K17A 2CRFA 3PVUA 4DXAB 4F7UP 3T06A 1X1FA 2LOZA 5D3WA 3OANA 3V5WA 5D3XA 2HE7A 2N23A 2LULA 3HK0A 4DBBA 1LB1A 2YVCA 2J0JA 1LW3A 4HB3B 1FHXA 2DHIA 4GZUA 1BWNA 1H4RA 3NSUA 4WSFA 3D8FA 2HTHB 2COCA 2D9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PNK A;  2JP2 A;  3O96 A;  2P0D A;  4HAV B;  1V5P A;  3PVL A;  3KZ1 A;  4TYZ A;  2W2W A;  4HAU B;  2ZPY A;  2LKO A;  2ELB A;  1UNR A;  1U2B A;  3ODW A;  2GCJ A;  1UPR A;  1W1H A;  1U29 A;  1DYN A;  5DHA B;  2H7E A;  4A5K A;  4ZRI A;  1MKE A;  5D27 A;  2Z0Q A;  2K00 A;  3F0W A;  1XD4 A;  2J0K A;  1WI1 A;  4HB4 B;  2RGN B;  1XCG A;  1PFJ A;  5CLL B;  1RRP B;  1PMS A;  2DYN A;  2MFQ A;  4B6H A;  3F5R A;  2VRW B;  5DIF B;  5GOW B;  2DA0 A;  5D3V A;  2N0Y A;  2YSZ A;  3P6A A;  2RUK B;  1U5F A;  2Q13 A;  3ODX A;  4DX9 0;  2YS1 A;  2LYD A;  5KCV A;  2OQB A;  3ODO A;  3BJI A;  1J19 A;  2R09 A;  1EF1 A;  3GYP A;  2D9Z A;  3AU4 A;  1PLS A;  3TFM A;  4H8S A;  2YS3 A;  2DX5 A;  3TW1 A;  3AJ4 A;  2D10 A;  1FGZ A;  2K2J A;  1Y5O A;  3ULC A;  4A6F B;  4NY0 A;  1Y19 B;  4ZRJ A;  2YF0 A;  3A8P A;  2Z0P A;  4HAY B;  1M7R A;  1MAI A;  2ELA A;  2CY5 A;  1GC7 A;  4Y94 A;  3VOQ A;  4HAT B;  1E5W A;  5DH9 B;  3X23 A;  3KY9 A;  2M38 A;  2AL6 A;  2D9V A;  2R0D A;  1UEF A;  4GN1 A;  5JHH A;  4F7H A;  4F7G A;  3ULB A;  4YON A;  4C0A A;  4KAX B;  2QKL A;  1M7E A;  3LJU X;  2P0F A;  4WJ7 A;  3MDB C;  2YS5 A;  1XR0 B;  3PEG A;  1Q67 A;  5C5B B;  3FM8 C;  2D4Q A;  5C16 A;  1MIZ B;  5HE1 A;  2D2Q A;  1X05 A;  1N3H A;  2DHJ A;  3ZDT A;  3CIK A;  1XOD A;  1FOE A;  2ADZ A;  2UVM A;  5JLJ B;  1EVH A;  4A6K A;  1ZC4 B;  1SGH A;  2NMB A;  1X86 A;  3U8Z A;  2MKR A;  1GC6 A;  1ZSQ A;  4HB0 B;  1I7A A;  1V89 A;  5EFX A;  2DHK A;  3N7C A;  4DX8 A;  5C6R A;  1H10 A;  3PZD A;  1FB8 A;  3GYO A;  2CY4 A;  2VKI A;  3ML4 A;  2GCL A;  2L1C A;  2EJ8 A;  2DFK A;  2I1J A;  1W1D A;  3FEH A;  1KZ7 A;  2QKM A;  3KRX A;  4TKN A;  1W1G A;  2J0M A;  4D0N B;  2EMS A;  2ROZ B;  5D3Y A;  3SUZ A;  3PP2 A;  1K5G B;  1P5T A;  2VSZ A;  4CYE A;  2D9X A;  2D11 A;  1EAZ A;  1V88 A;  1NI2 A;  3HQC A;  4XWX A;  2UZR A;  1GG3 A;  3A98 B;  2DN6 A;  4IFS A;  1WG7 A;  1XKE A;  2Z0O A;  2COF A;  1DDW A;  2X18 A;  3U7D A;  1MPH A;  3CXB B;  2KCJ A;  1FHO A;  1BAK A;  1WJM A;  1I2H A;  3G9W A;  3A8Q A;  3DXC A;  2K2U A;  3HW2 B;  3WA0 A;  2RSG A;  2E2X A;  5LON B;  4CHJ A;  5J3Y A;  3SNH A;  2UZS A;  1OY2 A;  3TCA A;  1QQG A;  4HDO A;  1TXD A;  5J3Q A;  1NTV A;  2EMT A;  2OTX A;  3DXE A;  4A6F A;  4GMV A;  5JHG A;  5L81 A;  4MK0 A;  4K81 A;  1K5D B;  1ZM0 A;  4GPT B;  2DX1 A;  2J59 M;  1P6S A;  3DXD A;  1BTK A;  2D9W A;  1TQZ A;  1U27 A;  4CHM A;  2COA A;  1V5U A;  4KHB B;  4L6E A;  2EC1 A;  1OMW A;  5KQ1 A;  1FGY A;  5CLQ B;  3IVF A;  4KHO A;  1EGX A;  4K2O A;  1XX0 A;  2RLO A;  1J0W A;  2H7D A;  1WGU A;  2YT1 A;  1KI1 B;  1UPQ A;  2M14 A;  4MY6 A;  2YRY A;  4P7I A;  1NTY A;  2AEH A;  4A6H A;  4EJN A;  4PQ0 A;  4KVG B;  3D8D A;  2RVB B;  4HHV A;  4Z2N A;  1DBH A;  4EKU A;  3RCP A;  4HDQ A;  3KSY A;  2W2X D;  3PG7 A;  3QBV B;  1MK7 B;  4BBK A;  2COD A;  4HB2 B;  1DRO A;  4KHA A;  2DYQ A;  3PVW A;  1DDM A;  3BIN A;  1FHW A;  3WYF B;  3AU5 A;  3FSS A;  1OQN A;  2DKQ A;  2XQN M;  4HAW B;  4HAZ B;  1U5D A;  2LOX A;  2P8V A;  1U5E A;  4Z2M B;  4EMO A;  3SYX A;  3TO1 A;  5DI9 B;  3SV1 A;  1U5G A;  1AWE A;  1FAO A;  2ROV A;  1DDV A;  2FJL A;  1TJ6 A;  1V61 A;  2NZ8 B;  3M1I B;  3PSC A;  5HE3 A;  3TVV A;  2BCJ A;  2IFS A;  4MT7 A;  3VIA A;  2I5C A;  5HE0 A;  2YT0 A;  3SO6 A;  2W2X C;  2CAY A;  2IYB A;  5JP4 A;  1B55 A;  5J3T A;  1MK9 B;  2DTC A;  4GXB A;  4GMX B;  1MIX A;  3QIJ A;  2MDX A;  3UZT A;  1WGQ A;  4ZRK A;  1NU2 A;  1Z87 A;  1RJ2 A;  2GJY A;  1V5M A;  2LG1 A;  2KUP A;  1WJ1 A;  5C79 A;  4IOY X;  1SHC A;  2I5F A;  3P7Z A;  5HE2 A;  1BTN A;  3ZVR A;  5C5B A;  1P3R A;  4NSW A;  4IAP A;  2MWN B;  3MPX A;  2Y8G A;  2P0H A;  1AQC A;  2KGX B;  4WVF B;  2G35 A;  1ZC3 B;  1ZVR A;  2L2I A;  5LOP B;  2DLW A;  2Y7B A;  1KZG A;  2PZ1 A;  4YL8 A;  5DHF B;  2I1K A;  5KQ4 A;  3KRW A;  2Y8F A;  1UNP A;  1ISN A;  2DKP A;  1UNQ A;  1WVH A;  5FI0 A;  3D8E A;  2GS0 A;  1IRS A;  5FI1 A;  1X11 A;  4K2P A;  2RNR B;  2V76 A;  4HAX B;  3QWM A;  1QC6 A;  1X1G A;  4K17 A;  2CRF A;  3PVU A;  4DXA B;  4F7U P;  3T06 A;  1X1F A;  2LOZ A;  5D3W A;  3OAN A;  3V5W A;  5D3X A;  2HE7 A;  2N23 A;  2LUL A;  3HK0 A;  4DBB A;  1LB1 A;  2YVC A;  2J0J A;  1LW3 A;  4HB3 B;  1FHX A;  2DHI A;  4GZU A;  1BWN A;  1H4R A;  3NSU A;  4WSF A;  3D8F A;  2HTH B;  2COC A;  2D9Y A; 
#chains in the Genus database with same CATH topology
 4PNK A;  2JP2 A;  3O96 A;  2P0D A;  4HAV B;  1V5P A;  3PVL A;  3KZ1 A;  4OT1 A;  4TYZ A;  4OSN A;  2W2W A;  4HAU B;  2ZPY A;  2LKO A;  2ELB A;  1UNR A;  1U2B A;  3ODW A;  2GCJ A;  1UPR A;  2ZKM X;  1W1H A;  4D6W A;  1U29 A;  1DYN A;  5DHA B;  2H7E A;  4A5K A;  2KIG A;  4ZRI A;  1MKE A;  5D27 A;  2Z0Q A;  2K00 A;  3F0W A;  1XD4 A;  2J0K A;  1WI1 A;  4HB4 B;  2RGN B;  1XCG A;  1PFJ A;  5CLL B;  1RRP B;  1PMS A;  2DYN A;  2MFQ A;  4B6H A;  4QJ4 B;  3F5R A;  2VRW B;  5DIF B;  5GOW B;  2DA0 A;  5D3V A;  2N0Y A;  2YSZ A;  3P6A A;  2RUK B;  1U5F A;  2Q13 A;  3ODX A;  4DX9 0;  2YS1 A;  2LYD A;  5KCV A;  2OQB A;  3ODO A;  3BJI A;  1J19 A;  2R09 A;  3NWF A;  1EF1 A;  3GYP A;  2D9Z A;  3AU4 A;  1PLS A;  3TFM A;  4H8S A;  2YS3 A;  4L1R A;  3A58 A;  2DX5 A;  3NWA A;  3TW1 A;  3AJ4 A;  2D10 A;  1FGZ A;  2K2J A;  1Y5O A;  3ULC A;  4A6F B;  4NY0 A;  1Y19 B;  4ZRJ A;  2YF0 A;  3A8P A;  2Z0P A;  4HAY B;  1MI1 A;  1M7R A;  1MAI A;  2ELA A;  2CY5 A;  1GC7 A;  4Y94 A;  3VOQ A;  4QJ5 B;  4HAT B;  1E5W A;  5DH9 B;  3X23 A;  3KY9 A;  2M38 A;  2AL6 A;  2D9V A;  2R0D A;  1UEF A;  3HIE A;  4GN1 A;  5JHH A;  4F7H A;  4F7G A;  3ULB A;  4YON A;  4C0A A;  4KAX B;  2QKL A;  1M7E A;  3LJU X;  2P0F A;  4WJ7 A;  3MDB C;  2YS5 A;  1XR0 B;  3PEG A;  1Q67 A;  5C5B B;  3FM8 C;  2D4Q A;  5C16 A;  1MIZ B;  5HE1 A;  2D2Q A;  1X05 A;  1N3H A;  2DHJ A;  3ZDT A;  3CIK A;  1XOD A;  1FOE A;  2ADZ A;  2UVM A;  5JLJ B;  1EVH A;  4A6K A;  1ZC4 B;  1SGH A;  2NMB A;  1X86 A;  3U8Z A;  2Z13 A;  2MKR A;  3U12 A;  1GC6 A;  1ZSQ A;  4HB0 B;  1I7A A;  1V89 A;  5EFX A;  2DHK A;  4CSQ A;  3N7C A;  4DX8 A;  5C6R A;  1H10 A;  3PZD A;  1FB8 A;  3GYO A;  2CY4 A;  2VKI A;  3ML4 A;  2GCL A;  2L1C A;  2EJ8 A;  4GNK B;  2DFK A;  2I1J A;  1W1D A;  3FEH A;  1KZ7 A;  2QKM A;  3KRX A;  4TKN A;  1W1G A;  2J0M A;  5M4Y B;  3OHM B;  4D0N B;  2EMS A;  2ROZ B;  5D3Y A;  3SUZ A;  3PP2 A;  1K5G B;  1P5T A;  2VSZ A;  4CYE A;  2D9X A;  2D11 A;  1EAZ A;  1V88 A;  1NI2 A;  3HQC A;  4XWX A;  2UZR A;  1GG3 A;  3A98 B;  2DN6 A;  4IFS A;  1WG7 A;  1XKE A;  2Z59 A;  2Z0O A;  2COF A;  1DDW A;  2X18 A;  4QJ3 B;  3U7D A;  1MPH A;  3CXB B;  2KCJ A;  1FHO A;  1BAK A;  1WJM A;  1I2H A;  3G9W A;  3A8Q A;  3DXC A;  2K2U A;  3HW2 B;  3WA0 A;  2RSG A;  3DCX A;  2E2X A;  5LON B;  4CHJ A;  5J3Y A;  3SNH A;  2UZS A;  1OY2 A;  3TCA A;  1QQG A;  4HDO A;  1TXD A;  5J3Q A;  1NTV A;  2EMT A;  2OTX A;  3DXE A;  4A6F A;  4QXA B;  4GMV A;  5JHG A;  5L81 A;  4MK0 A;  4K81 A;  1K5D B;  1ZM0 A;  4GPT B;  2DX1 A;  2J59 M;  1P6S A;  2RRF A;  3DXD A;  1BTK A;  3B77 A;  2D9W A;  1TQZ A;  1U27 A;  4CHM A;  2COA A;  1V5U A;  4KHB B;  4L6E A;  2EC1 A;  1OMW A;  5KQ1 A;  1FGY A;  5CLQ B;  3IVF A;  4KHO A;  1EGX A;  4K2O A;  1XX0 A;  2RLO A;  1J0W A;  2NBV A;  2H7D A;  1WGU A;  2YT1 A;  3NW8 A;  1KI1 B;  1UPQ A;  2M14 A;  4MY6 A;  2YRY A;  4P7I A;  1NTY A;  2AEH A;  4A6H A;  3HSA A;  2KIE A;  4PQ0 A;  4KVG B;  4EJN A;  3D8D A;  2RVB B;  2FJU B;  3NWD A;  4HHV A;  4Z2N A;  1DBH A;  4EKU A;  3RCP A;  4HDQ A;  3KSY A;  2YT2 A;  2W2X D;  3PG7 A;  4HSI A;  3QBV B;  1MK7 B;  4BBK A;  2KR0 A;  2COD A;  4HB2 B;  1DRO A;  4KHA A;  2DYQ A;  3PVW A;  1DDM A;  3BIN A;  1FHW A;  3WYF B;  3AU5 A;  3FSS A;  1OQN A;  2DKQ A;  2XQN M;  4HAW B;  4HAZ B;  1U5D A;  2LOX A;  2P8V A;  1U5E A;  2K8E A;  4Z2M B;  4EMO A;  3SYX A;  3TO1 A;  5DI9 B;  3SV1 A;  1U5G A;  1AWE A;  1FAO A;  2ROV A;  1DDV A;  2FJL A;  1TJ6 A;  1V61 A;  2NZ8 B;  3M1I B;  3PSC A;  5HE3 A;  3TVV A;  5LG4 B;  2BCJ A;  4DIX A;  2IFS A;  4MT7 A;  3VIA A;  2I5C A;  5HE0 A;  2YT0 A;  1ZYI A;  4GOU A;  3SO6 A;  2W2X C;  2CAY A;  2IYB A;  5JP4 A;  1B55 A;  5J3T A;  1MK9 B;  2DTC A;  4GXB A;  4GMX B;  1MIX A;  3QIJ A;  2MDX A;  3UZT A;  1WGQ A;  4ZRK A;  1NU2 A;  1Z87 A;  1RJ2 A;  2GJY A;  1V5M A;  2LG1 A;  2KUP A;  2R2Y A;  1WJ1 A;  5C79 A;  4IOY X;  1SHC A;  2I5F A;  2Z4D A;  3P7Z A;  5HE2 A;  1BTN A;  3ZVR A;  5C5B A;  1P3R A;  5I2M A;  4NSW A;  4IAP A;  2Z14 A;  5I2S A;  2MWN B;  3MPX A;  2Y8G A;  2P0H A;  5IRS A;  1AQC A;  2KGX B;  2K49 A;  4WVF B;  4KHB A;  2G35 A;  1ZC3 B;  1ZVR A;  2L2I A;  5LOP B;  2DLW A;  2Y7B A;  1KZG A;  2PZ1 A;  4YL8 A;  5DHF B;  2I1K A;  5KQ4 A;  1T77 A;  3KRW A;  2Y8F A;  1UNP A;  1ISN A;  2DKP A;  1UNQ A;  1WVH A;  5FI0 A;  3D8E A;  2GS0 A;  1IRS A;  5FI1 A;  1X11 A;  4K2P A;  2RNR B;  2V76 A;  4HAX B;  3QWM A;  1QC6 A;  1X1G A;  4K17 A;  2CRF A;  3PVU A;  4DXA B;  4F7U P;  3T06 A;  1X1F A;  2LOZ A;  5D3W A;  3OAN A;  3V5W A;  5D3X A;  2HE7 A;  2N23 A;  2LUL A;  3HK0 A;  4DBB A;  1LB1 A;  2YVC A;  2J0J A;  1LW3 A;  4HB3 B;  1FHX A;  2DHI A;  4GZU A;  2GUM A;  1BWN A;  1H4R A;  3FVC A;  3NSU A;  4WSF A;  3D8F A;  2HTH B;  2KUQ A;  2COC A;  2D9Y A; 
#chains in the Genus database with same CATH homology
 4PNK A;  2JP2 A;  3O96 A;  2P0D A;  4HAV B;  1V5P A;  3PVL A;  3KZ1 A;  4TYZ A;  2W2W A;  4HAU B;  2ZPY A;  2LKO A;  2ELB A;  1UNR A;  1U2B A;  3ODW A;  2GCJ A;  1UPR A;  1W1H A;  1U29 A;  1DYN A;  5DHA B;  2H7E A;  4A5K A;  4ZRI A;  1MKE A;  5D27 A;  2Z0Q A;  2K00 A;  3F0W A;  1XD4 A;  2J0K A;  1WI1 A;  4HB4 B;  2RGN B;  1XCG A;  1PFJ A;  5CLL B;  1RRP B;  1PMS A;  2DYN A;  2MFQ A;  4B6H A;  3F5R A;  2VRW B;  5DIF B;  5GOW B;  2DA0 A;  5D3V A;  2N0Y A;  2YSZ A;  3P6A A;  2RUK B;  1U5F A;  2Q13 A;  3ODX A;  4DX9 0;  2YS1 A;  2LYD A;  5KCV A;  2OQB A;  3ODO A;  3BJI A;  1J19 A;  2R09 A;  1EF1 A;  3GYP A;  2D9Z A;  3AU4 A;  1PLS A;  3TFM A;  4H8S A;  2YS3 A;  2DX5 A;  3TW1 A;  3AJ4 A;  2D10 A;  1FGZ A;  2K2J A;  1Y5O A;  3ULC A;  4A6F B;  4NY0 A;  1Y19 B;  4ZRJ A;  2YF0 A;  3A8P A;  2Z0P A;  4HAY B;  1M7R A;  1MAI A;  2ELA A;  2CY5 A;  1GC7 A;  4Y94 A;  3VOQ A;  4HAT B;  1E5W A;  5DH9 B;  3X23 A;  3KY9 A;  2M38 A;  2AL6 A;  2D9V A;  2R0D A;  1UEF A;  4GN1 A;  5JHH A;  4F7H A;  4F7G A;  3ULB A;  4YON A;  4C0A A;  4KAX B;  2QKL A;  1M7E A;  3LJU X;  2P0F A;  4WJ7 A;  3MDB C;  2YS5 A;  1XR0 B;  3PEG A;  1Q67 A;  5C5B B;  3FM8 C;  2D4Q A;  5C16 A;  1MIZ B;  5HE1 A;  2D2Q A;  1X05 A;  1N3H A;  2DHJ A;  3ZDT A;  3CIK A;  1XOD A;  1FOE A;  2ADZ A;  2UVM A;  5JLJ B;  1EVH A;  4A6K A;  1ZC4 B;  1SGH A;  2NMB A;  1X86 A;  3U8Z A;  2MKR A;  1GC6 A;  1ZSQ A;  4HB0 B;  1I7A A;  1V89 A;  5EFX A;  2DHK A;  3N7C A;  4DX8 A;  5C6R A;  1H10 A;  3PZD A;  1FB8 A;  3GYO A;  2CY4 A;  2VKI A;  3ML4 A;  2GCL A;  2L1C A;  2EJ8 A;  2DFK A;  2I1J A;  1W1D A;  3FEH A;  1KZ7 A;  2QKM A;  3KRX A;  4TKN A;  1W1G A;  2J0M A;  4D0N B;  2EMS A;  2ROZ B;  5D3Y A;  3SUZ A;  3PP2 A;  1K5G B;  1P5T A;  2VSZ A;  4CYE A;  2D9X A;  2D11 A;  1EAZ A;  1V88 A;  1NI2 A;  3HQC A;  4XWX A;  2UZR A;  1GG3 A;  3A98 B;  2DN6 A;  4IFS A;  1WG7 A;  1XKE A;  2Z0O A;  2COF A;  1DDW A;  2X18 A;  3U7D A;  1MPH A;  3CXB B;  2KCJ A;  1FHO A;  1BAK A;  1WJM A;  1I2H A;  3G9W A;  3A8Q A;  3DXC A;  2K2U A;  3HW2 B;  3WA0 A;  2RSG A;  2E2X A;  5LON B;  4CHJ A;  5J3Y A;  3SNH A;  2UZS A;  1OY2 A;  3TCA A;  1QQG A;  4HDO A;  1TXD A;  5J3Q A;  1NTV A;  2EMT A;  2OTX A;  3DXE A;  4A6F A;  4GMV A;  5JHG A;  5L81 A;  4MK0 A;  4K81 A;  1K5D B;  1ZM0 A;  4GPT B;  2DX1 A;  2J59 M;  1P6S A;  3DXD A;  1BTK A;  2D9W A;  1TQZ A;  1U27 A;  4CHM A;  2COA A;  1V5U A;  4KHB B;  4L6E A;  2EC1 A;  1OMW A;  5KQ1 A;  1FGY A;  5CLQ B;  3IVF A;  4KHO A;  1EGX A;  4K2O A;  1XX0 A;  2RLO A;  1J0W A;  2H7D A;  1WGU A;  2YT1 A;  1KI1 B;  1UPQ A;  2M14 A;  4MY6 A;  2YRY A;  4P7I A;  1NTY A;  2AEH A;  4A6H A;  4EJN A;  4PQ0 A;  4KVG B;  3D8D A;  2RVB B;  4HHV A;  4Z2N A;  1DBH A;  4EKU A;  3RCP A;  4HDQ A;  3KSY A;  2W2X D;  3PG7 A;  3QBV B;  1MK7 B;  4BBK A;  2COD A;  4HB2 B;  1DRO A;  4KHA A;  2DYQ A;  3PVW A;  1DDM A;  3BIN A;  1FHW A;  3WYF B;  3AU5 A;  3FSS A;  1OQN A;  2DKQ A;  2XQN M;  4HAW B;  4HAZ B;  1U5D A;  2LOX A;  2P8V A;  1U5E A;  4Z2M B;  4EMO A;  3SYX A;  3TO1 A;  5DI9 B;  3SV1 A;  1U5G A;  1AWE A;  1FAO A;  2ROV A;  1DDV A;  2FJL A;  1TJ6 A;  1V61 A;  2NZ8 B;  3M1I B;  3PSC A;  5HE3 A;  3TVV A;  2BCJ A;  2IFS A;  4MT7 A;  3VIA A;  2I5C A;  5HE0 A;  2YT0 A;  3SO6 A;  2W2X C;  2CAY A;  2IYB A;  5JP4 A;  1B55 A;  5J3T A;  1MK9 B;  2DTC A;  4GXB A;  4GMX B;  1MIX A;  3QIJ A;  2MDX A;  3UZT A;  1WGQ A;  4ZRK A;  1NU2 A;  1Z87 A;  1RJ2 A;  2GJY A;  1V5M A;  2LG1 A;  2KUP A;  1WJ1 A;  5C79 A;  4IOY X;  1SHC A;  2I5F A;  3P7Z A;  5HE2 A;  1BTN A;  3ZVR A;  5C5B A;  1P3R A;  4NSW A;  4IAP A;  2MWN B;  3MPX A;  2Y8G A;  2P0H A;  1AQC A;  2KGX B;  4WVF B;  2G35 A;  1ZC3 B;  1ZVR A;  2L2I A;  5LOP B;  2DLW A;  2Y7B A;  1KZG A;  2PZ1 A;  4YL8 A;  5DHF B;  2I1K A;  5KQ4 A;  3KRW A;  2Y8F A;  1UNP A;  1ISN A;  2DKP A;  1UNQ A;  1WVH A;  5FI0 A;  3D8E A;  2GS0 A;  1IRS A;  5FI1 A;  1X11 A;  4K2P A;  2RNR B;  2V76 A;  4HAX B;  3QWM A;  1QC6 A;  1X1G A;  4K17 A;  2CRF A;  3PVU A;  4DXA B;  4F7U P;  3T06 A;  1X1F A;  2LOZ A;  5D3W A;  3OAN A;  3V5W A;  5D3X A;  2HE7 A;  2N23 A;  2LUL A;  3HK0 A;  4DBB A;  1LB1 A;  2YVC A;  2J0J A;  1LW3 A;  4HB3 B;  1FHX A;  2DHI A;  4GZU A;  1BWN A;  1H4R A;  3NSU A;  4WSF A;  3D8F A;  2HTH B;  2COC A;  2D9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...