3ULBA

Crystal structure of the pleckstrin homology domain of saccharomyces cerevisiae avo1, a torc2 subunit, in the p212121 crystal form
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
109
structure length
102
Chain Sequence
YHKYKVWRRQQMSFINKHERTLAIDGDYIYIVPPENVKTKSLHISQVVLVKKSKRVPEHFKIFVRREGQDDIKRYYFEAVSGQECTEIVTRLQNLLSAYRMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Target of rapamycin complex 2 subunit AVO1
publication title Structures of the pleckstrin homology domain of Saccharomyces cerevisiae Avo1 and its human orthologue Sin1, an essential subunit of TOR complex 2
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Membrane protein
total genus 20
structure length 102
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16979 SIN1_PH SAPK-interacting protein 1 (Sin1), Pleckstrin-homology
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3ulbA01
1WGUA 1TXDA 2P0FA 1IRSA 2CRFA 1FHWA 1WVHA 2ROVA 3ULCA 2LOXA 2LOZA 2J0MA 4IAPA 3FSSA 1I7AA 2D4QA 2EJ8A 3X23A 3U7DA 4HHVA 5JP4A 1Y19B 1UPQA 4P7IA 4WJ7A 1X05A 5D3XA 3PVLA 3D8FA 2EMTA 2NMBA 2DHIA 4EJNA 2M14A 2NZ8B 1AQCA 1K5DB 2Z0QA 4HB2B 1V89A 4NY0A 3DXDA 1NU2A 3WYFB 5CLLB 5FI1A 1FB8A 1V5MA 1ZC3B 1KZ7A 3KSYA 2BCJA 2K2JA 3KRXA 4KAXB 2V76A 2DA0A 5LONB 3PG7A 1EGXA 1J19A 2CAYA 4C0AA 2D11A 1ZM0A 4EKUA 2GCJA 4XWXA 2ROZB 3D8EA 2DYQA 1OY2A 3WA0A 1XX0A 1BTNA 1LB1A 5HE2A 5HE1A 3CXBB 4K81A 1XKEA 3ODOA 1PMSA 3PVUA 4IFSA 3ML4A 4GMXB 3FEHA 1Q67A 2UZRA 4HDQA 2D9VA 4DX90 3MDBC 1ZVRA 1X1FA 2ELAA 2YSZA 4CHJA 2DX1A 1X1GA 2JP2A 2W2XC 4A6FA 3PSCA 5D3VA 2G35A 5DI9B 2K00A 1DDMA 1BWNA 4B6HA 4L6EA 5DHAB 3N7CA 3ULBA 4WSFA 1E5WA 2MWNB 4K2PA 4F7UP 4HB4B 5C16A 1U5GA 4PNKA 2YS1A 3KRWA 1WJ1A 1DROA 1ZSQA 5D3YA 3SUZA 1Z87A 4DXAB 1TJ6A 4ZRKA 2EC1A 2W2XD 3AU4A 5DIFB 1WI1A 1UNRA 1J0WA 2IFSA 1ZC4B 1XR0B 4PQ0A 3VOQA 3A8PA 1WGQA 4GPTB 2R0DA 5DH9B 1GC7A 1NTVA 2CODA 1ISNA 2DFKA 5FI0A 3T06A 4H8SA 1GG3A 4HAWB 1SGHA 1SHCA 3DXCA 2PZ1A 4KHOA 2N23A 1FHXA 2I1KA 3PP2A 1FOEA 3AU5A 1W1HA 3QBVB 2VRWB 4GXBA 3G9WA 2YVCA 2ADZA 3GYOA 1PFJA 2COCA 1FHOA 3SNHA 2HE7A 1AWEA 5D3WA 4HAVB 2LYDA 1UNPA 3FM8C 3F0WA 3SYXA 1XD4A 3KY9A 4ZRIA 3IVFA 1RRPB 2CY5A 2YRYA 1W1GA 1U5DA 1UPRA 4TYZA 1WJMA 4Z2MB 2DHKA 2VSZA 4YONA 4KHAA 1GC6A 2Q13A 2UZSA 2H7DA 2RGNB 5C6RA 4WVFB 3A8QA 1V5PA 2COFA 3RCPA 4GMVA 1V5UA 1V88A 1I2HA 4K2OA 5JHHA 3QWMA 1FGZA 4A6FB 1KZGA 2LG1A 2GCLA 4HAXB 3SV1A 2Z0PA 1MK9B 3QIJA 2UVMA 2EMSA 3ODWA 2AEHA 5EFXA 2RLOA 2P0HA 3ZVRA 3TCAA 2AL6A 2P8VA 4HB3B 2D2QA 2GS0A 4NSWA 3TO1A 3PEGA 2J0JA 2DKPA 3TVVA 1X86A 2ELBA 1V61A 3BJIA 4GZUA 1EAZA 4GN1A 3AJ4A 1WG7A 4YL8A 2J59M 2DKQA 1OQNA 3P6AA 1K5GB 4F7HA 1MKEA 1P3RA 2RUKB 2D9YA 1Y5OA 2DYNA 1EVHA 4HB0B 1MIXA 1EF1A 2D9ZA 5D27A 1LW3A 3DXEA 5DHFB 3VIAA 2W2WA 5KQ4A 4Y94A 4BBKA 4Z2NA 2DX5A 5L81A 2OQBA 2XQNM 2M38A 5GOWB 2YS5A 4HAZB 5JHGA 3PZDA 3BINA 2L2IA 3M1IB 1NI2A 2P0DA 2DTCA 2HTHB 2LKOA 5KCVA 4MY6A 2Y8GA 1P5TA 4MK0A 4EMOA 3NSUA 2FJLA 3GYPA 2D9WA 2IYBA 4D0NB 5LOPB 2K2UA 3O96A 1QQGA 4HATB 4MT7A 3CIKA 4TKNA 4HAYB 3ZDTA 2MDXA 1DDVA 4A6KA 3TFMA 2J0KA 2I5CA 2KGXB 3OANA 2YF0A 3P7ZA 1OMWA 2R09A 5HE3A 2D9XA 4HDOA 5J3QA 2OTXA 3U8ZA 5CLQB 4HAUB 4A6HA 1XCGA 4KHBB 2GJYA 5J3YA 2MFQA 2DLWA 1U2BA 2I1JA 2E2XA 2LULA 2CY4A 1BAKA 1QC6A 2KUPA 1M7EA 1MIZB 4CYEA 1X11A 3HW2B 2COAA 2RSGA 1XODA 2YT0A 5C79A 2KCJA 3ODXA 2H7EA 3KZ1A 4IOYX 3PVWA 4A5KA 1H10A 5KQ1A 1U27A 2YS3A 1FGYA 1MK7B 4ZRJA 1DBHA 1P6SA 2ZPYA 1KI1B 1MAIA 2MKRA 1TQZA 1RJ2A 1M7RA 1U5FA 1BTKA 2DN6A 2DHJA 1UNQA 3V5WA 4DBBA 4K17A 2L1CA 2Y7BA 5J3TA 1DYNA 1PLSA 1H4RA 5C5BB 2X18A 1DDWA 4DX8A 1N3HA 3LJUX 3HK0A 4F7GA 1UEFA 2Y8FA 5HE0A 3UZTA 1W1DA 3D8DA 2I5FA 1U29A 1U5EA 3MPXA 3A98B 4CHMA 1MPHA 2YT1A 2QKMA 2D10A 2RVBB 2Z0OA 2VKIA 3F5RA 5JLJB 2QKLA 2N0YA 5C5BA 3HQCA 3TW1A 3SO6A 2RNRB 1NTYA 1B55A 1FAOA 4KVGB
chains in the Genus database with same CATH superfamily
1WGUA 1TXDA 3NWAA 2P0FA 1IRSA 2CRFA 1FHWA 1WVHA 2ROVA 3ULCA 2LOXA 2LOZA 2J0MA 4IAPA 3FSSA 1I7AA 2D4QA 2EJ8A 3X23A 3U7DA 4HHVA 5JP4A 1Y19B 1UPQA 4P7IA 4WJ7A 1X05A 5D3XA 3PVLA 3D8FA 2EMTA 2NMBA 2DHIA 4EJNA 2M14A 2NZ8B 1AQCA 1K5DB 2Z0QA 4HB2B 1V89A 4NY0A 3DXDA 1NU2A 3WYFB 5CLLB 5FI1A 1FB8A 1V5MA 4QJ4B 1ZC3B 1KZ7A 3KSYA 2BCJA 2K2JA 3KRXA 4KAXB 2V76A 2DA0A 4OSNA 5LONB 3PG7A 1EGXA 1J19A 2CAYA 4C0AA 2D11A 1ZM0A 4EKUA 2GCJA 4XWXA 2K8EA 2ROZB 3D8EA 2DYQA 2YT2A 1OY2A 3WA0A 1XX0A 1BTNA 1LB1A 5HE2A 5HE1A 3CXBB 1ZYIA 4K81A 1XKEA 3ODOA 1PMSA 3PVUA 4IFSA 3ML4A 2KUQA 4GMXB 3FEHA 1Q67A 2UZRA 4HDQA 2D9VA 4DX90 3MDBC 1ZVRA 1X1FA 2ELAA 4QXAB 2YSZA 4CHJA 2DX1A 1X1GA 2JP2A 2W2XC 1MI1A 4A6FA 3PSCA 5D3VA 2G35A 2FJUB 5DI9B 2KR0A 2K00A 1DDMA 1BWNA 4B6HA 4L6EA 5DHAB 3N7CA 3ULBA 4WSFA 1E5WA 2MWNB 4K2PA 4F7UP 4HB4B 5C16A 1U5GA 4PNKA 2YS1A 3KRWA 1WJ1A 1DROA 1ZSQA 5D3YA 3SUZA 1Z87A 4DXAB 5LG4B 1TJ6A 4ZRKA 2EC1A 2W2XD 3AU4A 5DIFB 1WI1A 1UNRA 2KIGA 1J0WA 2IFSA 1ZC4B 1XR0B 4PQ0A 3VOQA 3A8PA 1WGQA 4GPTB 2R0DA 5DH9B 1GC7A 1NTVA 2CODA 3B77A 5I2MA 1ISNA 2DFKA 5FI0A 3T06A 4H8SA 1GG3A 4HAWB 1SGHA 1SHCA 3DXCA 2PZ1A 4KHOA 2N23A 1FHXA 2I1KA 2Z59A 3PP2A 1FOEA 3AU5A 1W1HA 3OHMB 3QBVB 2GUMA 2VRWB 4GXBA 3G9WA 2YVCA 2ADZA 3GYOA 1PFJA 2COCA 1FHOA 3SNHA 3FVCA 2HE7A 1AWEA 5D3WA 4HAVB 2LYDA 1UNPA 3FM8C 3F0WA 3SYXA 5IRSA 1XD4A 3KY9A 4ZRIA 3IVFA 1RRPB 2CY5A 2YRYA 1W1GA 1U5DA 1UPRA 4TYZA 1WJMA 4Z2MB 2DHKA 2VSZA 4YONA 4KHAA 1GC6A 2Q13A 2UZSA 2H7DA 2RGNB 5C6RA 4WVFB 4QJ5B 3A8QA 1V5PA 2COFA 3RCPA 4GMVA 1V5UA 1V88A 1I2HA 4K2OA 5JHHA 3QWMA 1FGZA 4A6FB 4QJ3B 1KZGA 2LG1A 2GCLA 4HAXB 3SV1A 2Z0PA 1MK9B 3QIJA 4L1RA 2UVMA 2EMSA 3ODWA 2AEHA 2RRFA 5EFXA 2RLOA 2P0HA 3ZVRA 3TCAA 2AL6A 2P8VA 4HB3B 2D2QA 2GS0A 4NSWA 3TO1A 3PEGA 4KHBA 2J0JA 2DKPA 3TVVA 1X86A 2ELBA 1V61A 3BJIA 4GZUA 1EAZA 4GN1A 3AJ4A 1WG7A 4YL8A 2J59M 2DKQA 1OQNA 3P6AA 1K5GB 4F7HA 3HIEA 1MKEA 4OT1A 1P3RA 2RUKB 2D9YA 1Y5OA 2DYNA 1EVHA 4HB0B 1MIXA 1EF1A 2D9ZA 5D27A 1LW3A 4GOUA 3DXEA 5DHFB 3VIAA 1T77A 2W2WA 5KQ4A 4Y94A 3NWFA 4BBKA 4Z2NA 2DX5A 5L81A 2OQBA 2XQNM 2M38A 5GOWB 2YS5A 4HAZB 3HSAA 5JHGA 3PZDA 3BINA 2L2IA 3M1IB 2KIEA 3DCXA 1NI2A 2P0DA 2DTCA 2HTHB 2K49A 2LKOA 5KCVA 4MY6A 2Y8GA 1P5TA 4GNKB 4MK0A 4EMOA 3NSUA 2FJLA 3GYPA 2D9WA 5I2SA 2IYBA 2Z14A 4D0NB 5LOPB 2K2UA 3O96A 4CSQA 1QQGA 4HATB 4MT7A 3CIKA 4TKNA 4HAYB 3ZDTA 4DIXA 2MDXA 1DDVA 4A6KA 3TFMA 2NBVA 2J0KA 2I5CA 2KGXB 3OANA 2YF0A 3P7ZA 1OMWA 2R09A 5HE3A 2D9XA 4HDOA 5J3QA 2OTXA 3U8ZA 5CLQB 4HAUB 2R2YA 4A6HA 1XCGA 4KHBB 2GJYA 5J3YA 2MFQA 2DLWA 1U2BA 2I1JA 2E2XA 2LULA 2CY4A 1BAKA 1QC6A 2KUPA 3NW8A 1M7EA 1MIZB 4CYEA 1X11A 3HW2B 4D6WA 2COAA 2RSGA 1XODA 2YT0A 5C79A 2KCJA 3ODXA 2H7EA 3KZ1A 4IOYX 2Z13A 3PVWA 4A5KA 1H10A 5KQ1A 1U27A 4HSIA 2YS3A 1FGYA 3U12A 1MK7B 4ZRJA 1DBHA 1P6SA 2ZPYA 1KI1B 1MAIA 2MKRA 1TQZA 1RJ2A 1M7RA 1U5FA 1BTKA 2DN6A 2DHJA 1UNQA 3V5WA 4DBBA 4K17A 2L1CA 2Y7BA 5J3TA 1DYNA 2ZKMX 1PLSA 1H4RA 5C5BB 2X18A 1DDWA 4DX8A 1N3HA 3LJUX 3HK0A 3NWDA 4F7GA 1UEFA 2Y8FA 5HE0A 3UZTA 1W1DA 3D8DA 2I5FA 1U29A 1U5EA 3MPXA 3A98B 3A58A 4CHMA 1MPHA 2YT1A 2Z4DA 2QKMA 2D10A 2RVBB 5M4YB 2Z0OA 2VKIA 3F5RA 5JLJB 2QKLA 2N0YA 5C5BA 3HQCA 3TW1A 3SO6A 2RNRB 1NTYA 1B55A 1FAOA 4KVGB
chains in the Genus database with same CATH topology
1WGUA 1TXDA 2P0FA 1IRSA 2CRFA 1FHWA 1WVHA 2ROVA 3ULCA 2LOXA 2LOZA 2J0MA 4IAPA 3FSSA 1I7AA 2D4QA 2EJ8A 3X23A 3U7DA 4HHVA 5JP4A 1Y19B 1UPQA 4P7IA 4WJ7A 1X05A 5D3XA 3PVLA 3D8FA 2EMTA 2NMBA 2DHIA 4EJNA 2M14A 2NZ8B 1AQCA 1K5DB 2Z0QA 4HB2B 1V89A 4NY0A 3DXDA 1NU2A 3WYFB 5CLLB 5FI1A 1FB8A 1V5MA 1ZC3B 1KZ7A 3KSYA 2BCJA 2K2JA 3KRXA 4KAXB 2V76A 2DA0A 5LONB 3PG7A 1EGXA 1J19A 2CAYA 4C0AA 2D11A 1ZM0A 4EKUA 2GCJA 4XWXA 2ROZB 3D8EA 2DYQA 1OY2A 3WA0A 1XX0A 1BTNA 1LB1A 5HE2A 5HE1A 3CXBB 4K81A 1XKEA 3ODOA 1PMSA 3PVUA 4IFSA 3ML4A 4GMXB 3FEHA 1Q67A 2UZRA 4HDQA 2D9VA 4DX90 3MDBC 1ZVRA 1X1FA 2ELAA 2YSZA 4CHJA 2DX1A 1X1GA 2JP2A 2W2XC 4A6FA 3PSCA 5D3VA 2G35A 5DI9B 2K00A 1DDMA 1BWNA 4B6HA 4L6EA 5DHAB 3N7CA 3ULBA 4WSFA 1E5WA 2MWNB 4K2PA 4F7UP 4HB4B 5C16A 1U5GA 4PNKA 2YS1A 3KRWA 1WJ1A 1DROA 1ZSQA 5D3YA 3SUZA 1Z87A 4DXAB 1TJ6A 4ZRKA 2EC1A 2W2XD 3AU4A 5DIFB 1WI1A 1UNRA 1J0WA 2IFSA 1ZC4B 1XR0B 4PQ0A 3VOQA 3A8PA 1WGQA 4GPTB 2R0DA 5DH9B 1GC7A 1NTVA 2CODA 1ISNA 2DFKA 5FI0A 3T06A 4H8SA 1GG3A 4HAWB 1SGHA 1SHCA 3DXCA 2PZ1A 4KHOA 2N23A 1FHXA 2I1KA 3PP2A 1FOEA 3AU5A 1W1HA 3QBVB 2VRWB 4GXBA 3G9WA 2YVCA 2ADZA 3GYOA 1PFJA 2COCA 1FHOA 3SNHA 2HE7A 1AWEA 5D3WA 4HAVB 2LYDA 1UNPA 3FM8C 3F0WA 3SYXA 1XD4A 3KY9A 4ZRIA 3IVFA 1RRPB 2CY5A 2YRYA 1W1GA 1U5DA 1UPRA 4TYZA 1WJMA 4Z2MB 2DHKA 2VSZA 4YONA 4KHAA 1GC6A 2Q13A 2UZSA 2H7DA 2RGNB 5C6RA 4WVFB 3A8QA 1V5PA 2COFA 3RCPA 4GMVA 1V5UA 1V88A 1I2HA 4K2OA 5JHHA 3QWMA 1FGZA 4A6FB 1KZGA 2LG1A 2GCLA 4HAXB 3SV1A 2Z0PA 1MK9B 3QIJA 2UVMA 2EMSA 3ODWA 2AEHA 5EFXA 2RLOA 2P0HA 3ZVRA 3TCAA 2AL6A 2P8VA 4HB3B 2D2QA 2GS0A 4NSWA 3TO1A 3PEGA 2J0JA 2DKPA 3TVVA 1X86A 2ELBA 1V61A 3BJIA 4GZUA 1EAZA 4GN1A 3AJ4A 1WG7A 4YL8A 2J59M 2DKQA 1OQNA 3P6AA 1K5GB 4F7HA 1MKEA 1P3RA 2RUKB 2D9YA 1Y5OA 2DYNA 1EVHA 4HB0B 1MIXA 1EF1A 2D9ZA 5D27A 1LW3A 3DXEA 5DHFB 3VIAA 2W2WA 5KQ4A 4Y94A 4BBKA 4Z2NA 2DX5A 5L81A 2OQBA 2XQNM 2M38A 5GOWB 2YS5A 4HAZB 5JHGA 3PZDA 3BINA 2L2IA 3M1IB 1NI2A 2P0DA 2DTCA 2HTHB 2LKOA 5KCVA 4MY6A 2Y8GA 1P5TA 4MK0A 4EMOA 3NSUA 2FJLA 3GYPA 2D9WA 2IYBA 4D0NB 5LOPB 2K2UA 3O96A 1QQGA 4HATB 4MT7A 3CIKA 4TKNA 4HAYB 3ZDTA 2MDXA 1DDVA 4A6KA 3TFMA 2J0KA 2I5CA 2KGXB 3OANA 2YF0A 3P7ZA 1OMWA 2R09A 5HE3A 2D9XA 4HDOA 5J3QA 2OTXA 3U8ZA 5CLQB 4HAUB 4A6HA 1XCGA 4KHBB 2GJYA 5J3YA 2MFQA 2DLWA 1U2BA 2I1JA 2E2XA 2LULA 2CY4A 1BAKA 1QC6A 2KUPA 1M7EA 1MIZB 4CYEA 1X11A 3HW2B 2COAA 2RSGA 1XODA 2YT0A 5C79A 2KCJA 3ODXA 2H7EA 3KZ1A 4IOYX 3PVWA 4A5KA 1H10A 5KQ1A 1U27A 2YS3A 1FGYA 1MK7B 4ZRJA 1DBHA 1P6SA 2ZPYA 1KI1B 1MAIA 2MKRA 1TQZA 1RJ2A 1M7RA 1U5FA 1BTKA 2DN6A 2DHJA 1UNQA 3V5WA 4DBBA 4K17A 2L1CA 2Y7BA 5J3TA 1DYNA 1PLSA 1H4RA 5C5BB 2X18A 1DDWA 4DX8A 1N3HA 3LJUX 3HK0A 4F7GA 1UEFA 2Y8FA 5HE0A 3UZTA 1W1DA 3D8DA 2I5FA 1U29A 1U5EA 3MPXA 3A98B 4CHMA 1MPHA 2YT1A 2QKMA 2D10A 2RVBB 2Z0OA 2VKIA 3F5RA 5JLJB 2QKLA 2N0YA 5C5BA 3HQCA 3TW1A 3SO6A 2RNRB 1NTYA 1B55A 1FAOA 4KVGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WGU A;  1TXD A;  2P0F A;  1IRS A;  2CRF A;  1FHW A;  1WVH A;  2ROV A;  3ULC A;  2LOX A;  2LOZ A;  2J0M A;  4IAP A;  3FSS A;  1I7A A;  2D4Q A;  2EJ8 A;  3X23 A;  3U7D A;  4HHV A;  5JP4 A;  1Y19 B;  1UPQ A;  4P7I A;  4WJ7 A;  1X05 A;  5D3X A;  3PVL A;  3D8F A;  2EMT A;  2NMB A;  2DHI A;  4EJN A;  2M14 A;  2NZ8 B;  1AQC A;  1K5D B;  2Z0Q A;  4HB2 B;  1V89 A;  4NY0 A;  3DXD A;  1NU2 A;  3WYF B;  5CLL B;  5FI1 A;  1FB8 A;  1V5M A;  1ZC3 B;  1KZ7 A;  3KSY A;  2BCJ A;  2K2J A;  3KRX A;  4KAX B;  2V76 A;  2DA0 A;  5LON B;  3PG7 A;  1EGX A;  1J19 A;  2CAY A;  4C0A A;  2D11 A;  1ZM0 A;  4EKU A;  2GCJ A;  4XWX A;  2ROZ B;  3D8E A;  2DYQ A;  1OY2 A;  3WA0 A;  1XX0 A;  1BTN A;  1LB1 A;  5HE2 A;  5HE1 A;  3CXB B;  4K81 A;  1XKE A;  3ODO A;  1PMS A;  3PVU A;  4IFS A;  3ML4 A;  4GMX B;  3FEH A;  1Q67 A;  2UZR A;  4HDQ A;  2D9V A;  4DX9 0;  3MDB C;  1ZVR A;  1X1F A;  2ELA A;  2YSZ A;  4CHJ A;  2DX1 A;  1X1G A;  2JP2 A;  2W2X C;  4A6F A;  3PSC A;  5D3V A;  2G35 A;  5DI9 B;  2K00 A;  1DDM A;  1BWN A;  4B6H A;  4L6E A;  5DHA B;  3N7C A;  3ULB A;  4WSF A;  1E5W A;  2MWN B;  4K2P A;  4F7U P;  4HB4 B;  5C16 A;  1U5G A;  4PNK A;  2YS1 A;  3KRW A;  1WJ1 A;  1DRO A;  1ZSQ A;  5D3Y A;  3SUZ A;  1Z87 A;  4DXA B;  1TJ6 A;  4ZRK A;  2EC1 A;  2W2X D;  3AU4 A;  5DIF B;  1WI1 A;  1UNR A;  1J0W A;  2IFS A;  1ZC4 B;  1XR0 B;  4PQ0 A;  3VOQ A;  3A8P A;  1WGQ A;  4GPT B;  2R0D A;  5DH9 B;  1GC7 A;  1NTV A;  2COD A;  1ISN A;  2DFK A;  5FI0 A;  3T06 A;  4H8S A;  1GG3 A;  4HAW B;  1SGH A;  1SHC A;  3DXC A;  2PZ1 A;  4KHO A;  2N23 A;  1FHX A;  2I1K A;  3PP2 A;  1FOE A;  3AU5 A;  1W1H A;  3QBV B;  2VRW B;  4GXB A;  3G9W A;  2YVC A;  2ADZ A;  3GYO A;  1PFJ A;  2COC A;  1FHO A;  3SNH A;  2HE7 A;  1AWE A;  5D3W A;  4HAV B;  2LYD A;  1UNP A;  3FM8 C;  3F0W A;  3SYX A;  1XD4 A;  3KY9 A;  4ZRI A;  3IVF A;  1RRP B;  2CY5 A;  2YRY A;  1W1G A;  1U5D A;  1UPR A;  4TYZ A;  1WJM A;  4Z2M B;  2DHK A;  2VSZ A;  4YON A;  4KHA A;  1GC6 A;  2Q13 A;  2UZS A;  2H7D A;  2RGN B;  5C6R A;  4WVF B;  3A8Q A;  1V5P A;  2COF A;  3RCP A;  4GMV A;  1V5U A;  1V88 A;  1I2H A;  4K2O A;  5JHH A;  3QWM A;  1FGZ A;  4A6F B;  1KZG A;  2LG1 A;  2GCL A;  4HAX B;  3SV1 A;  2Z0P A;  1MK9 B;  3QIJ A;  2UVM A;  2EMS A;  3ODW A;  2AEH A;  5EFX A;  2RLO A;  2P0H A;  3ZVR A;  3TCA A;  2AL6 A;  2P8V A;  4HB3 B;  2D2Q A;  2GS0 A;  4NSW A;  3TO1 A;  3PEG A;  2J0J A;  2DKP A;  3TVV A;  1X86 A;  2ELB A;  1V61 A;  3BJI A;  4GZU A;  1EAZ A;  4GN1 A;  3AJ4 A;  1WG7 A;  4YL8 A;  2J59 M;  2DKQ A;  1OQN A;  3P6A A;  1K5G B;  4F7H A;  1MKE A;  1P3R A;  2RUK B;  2D9Y A;  1Y5O A;  2DYN A;  1EVH A;  4HB0 B;  1MIX A;  1EF1 A;  2D9Z A;  5D27 A;  1LW3 A;  3DXE A;  5DHF B;  3VIA A;  2W2W A;  5KQ4 A;  4Y94 A;  4BBK A;  4Z2N A;  2DX5 A;  5L81 A;  2OQB A;  2XQN M;  2M38 A;  5GOW B;  2YS5 A;  4HAZ B;  5JHG A;  3PZD A;  3BIN A;  2L2I A;  3M1I B;  1NI2 A;  2P0D A;  2DTC A;  2HTH B;  2LKO A;  5KCV A;  4MY6 A;  2Y8G A;  1P5T A;  4MK0 A;  4EMO A;  3NSU A;  2FJL A;  3GYP A;  2D9W A;  2IYB A;  4D0N B;  5LOP B;  2K2U A;  3O96 A;  1QQG A;  4HAT B;  4MT7 A;  3CIK A;  4TKN A;  4HAY B;  3ZDT A;  2MDX A;  1DDV A;  4A6K A;  3TFM A;  2J0K A;  2I5C A;  2KGX B;  3OAN A;  2YF0 A;  3P7Z A;  1OMW A;  2R09 A;  5HE3 A;  2D9X A;  4HDO A;  5J3Q A;  2OTX A;  3U8Z A;  5CLQ B;  4HAU B;  4A6H A;  1XCG A;  4KHB B;  2GJY A;  5J3Y A;  2MFQ A;  2DLW A;  1U2B A;  2I1J A;  2E2X A;  2LUL A;  2CY4 A;  1BAK A;  1QC6 A;  2KUP A;  1M7E A;  1MIZ B;  4CYE A;  1X11 A;  3HW2 B;  2COA A;  2RSG A;  1XOD A;  2YT0 A;  5C79 A;  2KCJ A;  3ODX A;  2H7E A;  3KZ1 A;  4IOY X;  3PVW A;  4A5K A;  1H10 A;  5KQ1 A;  1U27 A;  2YS3 A;  1FGY A;  1MK7 B;  4ZRJ A;  1DBH A;  1P6S A;  2ZPY A;  1KI1 B;  1MAI A;  2MKR A;  1TQZ A;  1RJ2 A;  1M7R A;  1U5F A;  1BTK A;  2DN6 A;  2DHJ A;  1UNQ A;  3V5W A;  4DBB A;  4K17 A;  2L1C A;  2Y7B A;  5J3T A;  1DYN A;  1PLS A;  1H4R A;  5C5B B;  2X18 A;  1DDW A;  4DX8 A;  1N3H A;  3LJU X;  3HK0 A;  4F7G A;  1UEF A;  2Y8F A;  5HE0 A;  3UZT A;  1W1D A;  3D8D A;  2I5F A;  1U29 A;  1U5E A;  3MPX A;  3A98 B;  4CHM A;  1MPH A;  2YT1 A;  2QKM A;  2D10 A;  2RVB B;  2Z0O A;  2VKI A;  3F5R A;  5JLJ B;  2QKL A;  2N0Y A;  5C5B A;  3HQC A;  3TW1 A;  3SO6 A;  2RNR B;  1NTY A;  1B55 A;  1FAO A;  4KVG B; 
#chains in the Genus database with same CATH topology
 1WGU A;  1TXD A;  3NWA A;  2P0F A;  1IRS A;  2CRF A;  1FHW A;  1WVH A;  2ROV A;  3ULC A;  2LOX A;  2LOZ A;  2J0M A;  4IAP A;  3FSS A;  1I7A A;  2D4Q A;  2EJ8 A;  3X23 A;  3U7D A;  4HHV A;  5JP4 A;  1Y19 B;  1UPQ A;  4P7I A;  4WJ7 A;  1X05 A;  5D3X A;  3PVL A;  3D8F A;  2EMT A;  2NMB A;  2DHI A;  4EJN A;  2M14 A;  2NZ8 B;  1AQC A;  1K5D B;  2Z0Q A;  4HB2 B;  1V89 A;  4NY0 A;  3DXD A;  1NU2 A;  3WYF B;  5CLL B;  5FI1 A;  1FB8 A;  1V5M A;  4QJ4 B;  1ZC3 B;  1KZ7 A;  3KSY A;  2BCJ A;  2K2J A;  3KRX A;  4KAX B;  2V76 A;  2DA0 A;  4OSN A;  5LON B;  3PG7 A;  1EGX A;  1J19 A;  2CAY A;  4C0A A;  2D11 A;  1ZM0 A;  4EKU A;  2GCJ A;  4XWX A;  2K8E A;  2ROZ B;  3D8E A;  2DYQ A;  2YT2 A;  1OY2 A;  3WA0 A;  1XX0 A;  1BTN A;  1LB1 A;  5HE2 A;  5HE1 A;  3CXB B;  1ZYI A;  4K81 A;  1XKE A;  3ODO A;  1PMS A;  3PVU A;  4IFS A;  3ML4 A;  2KUQ A;  4GMX B;  3FEH A;  1Q67 A;  2UZR A;  4HDQ A;  2D9V A;  4DX9 0;  3MDB C;  1ZVR A;  1X1F A;  2ELA A;  4QXA B;  2YSZ A;  4CHJ A;  2DX1 A;  1X1G A;  2JP2 A;  2W2X C;  1MI1 A;  4A6F A;  3PSC A;  5D3V A;  2G35 A;  2FJU B;  5DI9 B;  2KR0 A;  2K00 A;  1DDM A;  1BWN A;  4B6H A;  4L6E A;  5DHA B;  3N7C A;  3ULB A;  4WSF A;  1E5W A;  2MWN B;  4K2P A;  4F7U P;  4HB4 B;  5C16 A;  1U5G A;  4PNK A;  2YS1 A;  3KRW A;  1WJ1 A;  1DRO A;  1ZSQ A;  5D3Y A;  3SUZ A;  1Z87 A;  4DXA B;  5LG4 B;  1TJ6 A;  4ZRK A;  2EC1 A;  2W2X D;  3AU4 A;  5DIF B;  1WI1 A;  1UNR A;  2KIG A;  1J0W A;  2IFS A;  1ZC4 B;  1XR0 B;  4PQ0 A;  3VOQ A;  3A8P A;  1WGQ A;  4GPT B;  2R0D A;  5DH9 B;  1GC7 A;  1NTV A;  2COD A;  3B77 A;  5I2M A;  1ISN A;  2DFK A;  5FI0 A;  3T06 A;  4H8S A;  1GG3 A;  4HAW B;  1SGH A;  1SHC A;  3DXC A;  2PZ1 A;  4KHO A;  2N23 A;  1FHX A;  2I1K A;  2Z59 A;  3PP2 A;  1FOE A;  3AU5 A;  1W1H A;  3OHM B;  3QBV B;  2GUM A;  2VRW B;  4GXB A;  3G9W A;  2YVC A;  2ADZ A;  3GYO A;  1PFJ A;  2COC A;  1FHO A;  3SNH A;  3FVC A;  2HE7 A;  1AWE A;  5D3W A;  4HAV B;  2LYD A;  1UNP A;  3FM8 C;  3F0W A;  3SYX A;  5IRS A;  1XD4 A;  3KY9 A;  4ZRI A;  3IVF A;  1RRP B;  2CY5 A;  2YRY A;  1W1G A;  1U5D A;  1UPR A;  4TYZ A;  1WJM A;  4Z2M B;  2DHK A;  2VSZ A;  4YON A;  4KHA A;  1GC6 A;  2Q13 A;  2UZS A;  2H7D A;  2RGN B;  5C6R A;  4WVF B;  4QJ5 B;  3A8Q A;  1V5P A;  2COF A;  3RCP A;  4GMV A;  1V5U A;  1V88 A;  1I2H A;  4K2O A;  5JHH A;  3QWM A;  1FGZ A;  4A6F B;  4QJ3 B;  1KZG A;  2LG1 A;  2GCL A;  4HAX B;  3SV1 A;  2Z0P A;  1MK9 B;  3QIJ A;  4L1R A;  2UVM A;  2EMS A;  3ODW A;  2AEH A;  2RRF A;  5EFX A;  2RLO A;  2P0H A;  3ZVR A;  3TCA A;  2AL6 A;  2P8V A;  4HB3 B;  2D2Q A;  2GS0 A;  4NSW A;  3TO1 A;  3PEG A;  4KHB A;  2J0J A;  2DKP A;  3TVV A;  1X86 A;  2ELB A;  1V61 A;  3BJI A;  4GZU A;  1EAZ A;  4GN1 A;  3AJ4 A;  1WG7 A;  4YL8 A;  2J59 M;  2DKQ A;  1OQN A;  3P6A A;  1K5G B;  4F7H A;  3HIE A;  1MKE A;  4OT1 A;  1P3R A;  2RUK B;  2D9Y A;  1Y5O A;  2DYN A;  1EVH A;  4HB0 B;  1MIX A;  1EF1 A;  2D9Z A;  5D27 A;  1LW3 A;  4GOU A;  3DXE A;  5DHF B;  3VIA A;  1T77 A;  2W2W A;  5KQ4 A;  4Y94 A;  3NWF A;  4BBK A;  4Z2N A;  2DX5 A;  5L81 A;  2OQB A;  2XQN M;  2M38 A;  5GOW B;  2YS5 A;  4HAZ B;  3HSA A;  5JHG A;  3PZD A;  3BIN A;  2L2I A;  3M1I B;  2KIE A;  3DCX A;  1NI2 A;  2P0D A;  2DTC A;  2HTH B;  2K49 A;  2LKO A;  5KCV A;  4MY6 A;  2Y8G A;  1P5T A;  4GNK B;  4MK0 A;  4EMO A;  3NSU A;  2FJL A;  3GYP A;  2D9W A;  5I2S A;  2IYB A;  2Z14 A;  4D0N B;  5LOP B;  2K2U A;  3O96 A;  4CSQ A;  1QQG A;  4HAT B;  4MT7 A;  3CIK A;  4TKN A;  4HAY B;  3ZDT A;  4DIX A;  2MDX A;  1DDV A;  4A6K A;  3TFM A;  2NBV A;  2J0K A;  2I5C A;  2KGX B;  3OAN A;  2YF0 A;  3P7Z A;  1OMW A;  2R09 A;  5HE3 A;  2D9X A;  4HDO A;  5J3Q A;  2OTX A;  3U8Z A;  5CLQ B;  4HAU B;  2R2Y A;  4A6H A;  1XCG A;  4KHB B;  2GJY A;  5J3Y A;  2MFQ A;  2DLW A;  1U2B A;  2I1J A;  2E2X A;  2LUL A;  2CY4 A;  1BAK A;  1QC6 A;  2KUP A;  3NW8 A;  1M7E A;  1MIZ B;  4CYE A;  1X11 A;  3HW2 B;  4D6W A;  2COA A;  2RSG A;  1XOD A;  2YT0 A;  5C79 A;  2KCJ A;  3ODX A;  2H7E A;  3KZ1 A;  4IOY X;  2Z13 A;  3PVW A;  4A5K A;  1H10 A;  5KQ1 A;  1U27 A;  4HSI A;  2YS3 A;  1FGY A;  3U12 A;  1MK7 B;  4ZRJ A;  1DBH A;  1P6S A;  2ZPY A;  1KI1 B;  1MAI A;  2MKR A;  1TQZ A;  1RJ2 A;  1M7R A;  1U5F A;  1BTK A;  2DN6 A;  2DHJ A;  1UNQ A;  3V5W A;  4DBB A;  4K17 A;  2L1C A;  2Y7B A;  5J3T A;  1DYN A;  2ZKM X;  1PLS A;  1H4R A;  5C5B B;  2X18 A;  1DDW A;  4DX8 A;  1N3H A;  3LJU X;  3HK0 A;  3NWD A;  4F7G A;  1UEF A;  2Y8F A;  5HE0 A;  3UZT A;  1W1D A;  3D8D A;  2I5F A;  1U29 A;  1U5E A;  3MPX A;  3A98 B;  3A58 A;  4CHM A;  1MPH A;  2YT1 A;  2Z4D A;  2QKM A;  2D10 A;  2RVB B;  5M4Y B;  2Z0O A;  2VKI A;  3F5R A;  5JLJ B;  2QKL A;  2N0Y A;  5C5B A;  3HQC A;  3TW1 A;  3SO6 A;  2RNR B;  1NTY A;  1B55 A;  1FAO A;  4KVG B; 
#chains in the Genus database with same CATH homology
 1WGU A;  1TXD A;  2P0F A;  1IRS A;  2CRF A;  1FHW A;  1WVH A;  2ROV A;  3ULC A;  2LOX A;  2LOZ A;  2J0M A;  4IAP A;  3FSS A;  1I7A A;  2D4Q A;  2EJ8 A;  3X23 A;  3U7D A;  4HHV A;  5JP4 A;  1Y19 B;  1UPQ A;  4P7I A;  4WJ7 A;  1X05 A;  5D3X A;  3PVL A;  3D8F A;  2EMT A;  2NMB A;  2DHI A;  4EJN A;  2M14 A;  2NZ8 B;  1AQC A;  1K5D B;  2Z0Q A;  4HB2 B;  1V89 A;  4NY0 A;  3DXD A;  1NU2 A;  3WYF B;  5CLL B;  5FI1 A;  1FB8 A;  1V5M A;  1ZC3 B;  1KZ7 A;  3KSY A;  2BCJ A;  2K2J A;  3KRX A;  4KAX B;  2V76 A;  2DA0 A;  5LON B;  3PG7 A;  1EGX A;  1J19 A;  2CAY A;  4C0A A;  2D11 A;  1ZM0 A;  4EKU A;  2GCJ A;  4XWX A;  2ROZ B;  3D8E A;  2DYQ A;  1OY2 A;  3WA0 A;  1XX0 A;  1BTN A;  1LB1 A;  5HE2 A;  5HE1 A;  3CXB B;  4K81 A;  1XKE A;  3ODO A;  1PMS A;  3PVU A;  4IFS A;  3ML4 A;  4GMX B;  3FEH A;  1Q67 A;  2UZR A;  4HDQ A;  2D9V A;  4DX9 0;  3MDB C;  1ZVR A;  1X1F A;  2ELA A;  2YSZ A;  4CHJ A;  2DX1 A;  1X1G A;  2JP2 A;  2W2X C;  4A6F A;  3PSC A;  5D3V A;  2G35 A;  5DI9 B;  2K00 A;  1DDM A;  1BWN A;  4B6H A;  4L6E A;  5DHA B;  3N7C A;  3ULB A;  4WSF A;  1E5W A;  2MWN B;  4K2P A;  4F7U P;  4HB4 B;  5C16 A;  1U5G A;  4PNK A;  2YS1 A;  3KRW A;  1WJ1 A;  1DRO A;  1ZSQ A;  5D3Y A;  3SUZ A;  1Z87 A;  4DXA B;  1TJ6 A;  4ZRK A;  2EC1 A;  2W2X D;  3AU4 A;  5DIF B;  1WI1 A;  1UNR A;  1J0W A;  2IFS A;  1ZC4 B;  1XR0 B;  4PQ0 A;  3VOQ A;  3A8P A;  1WGQ A;  4GPT B;  2R0D A;  5DH9 B;  1GC7 A;  1NTV A;  2COD A;  1ISN A;  2DFK A;  5FI0 A;  3T06 A;  4H8S A;  1GG3 A;  4HAW B;  1SGH A;  1SHC A;  3DXC A;  2PZ1 A;  4KHO A;  2N23 A;  1FHX A;  2I1K A;  3PP2 A;  1FOE A;  3AU5 A;  1W1H A;  3QBV B;  2VRW B;  4GXB A;  3G9W A;  2YVC A;  2ADZ A;  3GYO A;  1PFJ A;  2COC A;  1FHO A;  3SNH A;  2HE7 A;  1AWE A;  5D3W A;  4HAV B;  2LYD A;  1UNP A;  3FM8 C;  3F0W A;  3SYX A;  1XD4 A;  3KY9 A;  4ZRI A;  3IVF A;  1RRP B;  2CY5 A;  2YRY A;  1W1G A;  1U5D A;  1UPR A;  4TYZ A;  1WJM A;  4Z2M B;  2DHK A;  2VSZ A;  4YON A;  4KHA A;  1GC6 A;  2Q13 A;  2UZS A;  2H7D A;  2RGN B;  5C6R A;  4WVF B;  3A8Q A;  1V5P A;  2COF A;  3RCP A;  4GMV A;  1V5U A;  1V88 A;  1I2H A;  4K2O A;  5JHH A;  3QWM A;  1FGZ A;  4A6F B;  1KZG A;  2LG1 A;  2GCL A;  4HAX B;  3SV1 A;  2Z0P A;  1MK9 B;  3QIJ A;  2UVM A;  2EMS A;  3ODW A;  2AEH A;  5EFX A;  2RLO A;  2P0H A;  3ZVR A;  3TCA A;  2AL6 A;  2P8V A;  4HB3 B;  2D2Q A;  2GS0 A;  4NSW A;  3TO1 A;  3PEG A;  2J0J A;  2DKP A;  3TVV A;  1X86 A;  2ELB A;  1V61 A;  3BJI A;  4GZU A;  1EAZ A;  4GN1 A;  3AJ4 A;  1WG7 A;  4YL8 A;  2J59 M;  2DKQ A;  1OQN A;  3P6A A;  1K5G B;  4F7H A;  1MKE A;  1P3R A;  2RUK B;  2D9Y A;  1Y5O A;  2DYN A;  1EVH A;  4HB0 B;  1MIX A;  1EF1 A;  2D9Z A;  5D27 A;  1LW3 A;  3DXE A;  5DHF B;  3VIA A;  2W2W A;  5KQ4 A;  4Y94 A;  4BBK A;  4Z2N A;  2DX5 A;  5L81 A;  2OQB A;  2XQN M;  2M38 A;  5GOW B;  2YS5 A;  4HAZ B;  5JHG A;  3PZD A;  3BIN A;  2L2I A;  3M1I B;  1NI2 A;  2P0D A;  2DTC A;  2HTH B;  2LKO A;  5KCV A;  4MY6 A;  2Y8G A;  1P5T A;  4MK0 A;  4EMO A;  3NSU A;  2FJL A;  3GYP A;  2D9W A;  2IYB A;  4D0N B;  5LOP B;  2K2U A;  3O96 A;  1QQG A;  4HAT B;  4MT7 A;  3CIK A;  4TKN A;  4HAY B;  3ZDT A;  2MDX A;  1DDV A;  4A6K A;  3TFM A;  2J0K A;  2I5C A;  2KGX B;  3OAN A;  2YF0 A;  3P7Z A;  1OMW A;  2R09 A;  5HE3 A;  2D9X A;  4HDO A;  5J3Q A;  2OTX A;  3U8Z A;  5CLQ B;  4HAU B;  4A6H A;  1XCG A;  4KHB B;  2GJY A;  5J3Y A;  2MFQ A;  2DLW A;  1U2B A;  2I1J A;  2E2X A;  2LUL A;  2CY4 A;  1BAK A;  1QC6 A;  2KUP A;  1M7E A;  1MIZ B;  4CYE A;  1X11 A;  3HW2 B;  2COA A;  2RSG A;  1XOD A;  2YT0 A;  5C79 A;  2KCJ A;  3ODX A;  2H7E A;  3KZ1 A;  4IOY X;  3PVW A;  4A5K A;  1H10 A;  5KQ1 A;  1U27 A;  2YS3 A;  1FGY A;  1MK7 B;  4ZRJ A;  1DBH A;  1P6S A;  2ZPY A;  1KI1 B;  1MAI A;  2MKR A;  1TQZ A;  1RJ2 A;  1M7R A;  1U5F A;  1BTK A;  2DN6 A;  2DHJ A;  1UNQ A;  3V5W A;  4DBB A;  4K17 A;  2L1C A;  2Y7B A;  5J3T A;  1DYN A;  1PLS A;  1H4R A;  5C5B B;  2X18 A;  1DDW A;  4DX8 A;  1N3H A;  3LJU X;  3HK0 A;  4F7G A;  1UEF A;  2Y8F A;  5HE0 A;  3UZT A;  1W1D A;  3D8D A;  2I5F A;  1U29 A;  1U5E A;  3MPX A;  3A98 B;  4CHM A;  1MPH A;  2YT1 A;  2QKM A;  2D10 A;  2RVB B;  2Z0O A;  2VKI A;  3F5R A;  5JLJ B;  2QKL A;  2N0Y A;  5C5B A;  3HQC A;  3TW1 A;  3SO6 A;  2RNR B;  1NTY A;  1B55 A;  1FAO A;  4KVG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...