3ULBA

Crystal structure of the pleckstrin homology domain of saccharomyces cerevisiae avo1, a torc2 subunit, in the p212121 crystal form
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
109
structure length
102
Chain Sequence
YHKYKVWRRQQMSFINKHERTLAIDGDYIYIVPPENVKTKSLHISQVVLVKKSKRVPEHFKIFVRREGQDDIKRYYFEAVSGQECTEIVTRLQNLLSAYRMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Target of rapamycin complex 2 subunit AVO1
publication title Structures of the pleckstrin homology domain of Saccharomyces cerevisiae Avo1 and its human orthologue Sin1, an essential subunit of TOR complex 2
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Membrane protein
total genus 20
structure length 102
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16979 SIN1_PH SAPK-interacting protein 1 (Sin1), Pleckstrin-homology
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3ulbA01
3HW2B 3AU5A 4GPTB 2EJ8A 1H10A 1J19A 1WI1A 4F7UP 2ADZA 1UNPA 2R0DA 1NTYA 4ZRJA 2RVBB 1U5GA 1XD4A 2M38A 5EFXA 5HE3A 2H7EA 4H8SA 2K2JA 2EC1A 2RGNB 3D8FA 3ODXA 2LOZA 3MPXA 4K17A 4HDQA 3TO1A 1Y5OA 1W1DA 1U5EA 1BTNA 1AQCA 3A98B 3T06A 5HE2A 1BAKA 1SHCA 4K2OA 3QIJA 2DLWA 2ELBA 3PSCA 3ODOA 3VIAA 1MAIA 2DTCA 4HAZB 3ULBA 3PZDA 1N3HA 4HB3B 3IVFA 4HHVA 3M1IB 2P0FA 1OQNA 4WSFA 2I5CA 2RUKB 2UVMA 4GXBA 3WA0A 2VSZA 2ELAA 1FHOA 5GOWB 1DDWA 3SUZA 3O96A 5D27A 4A5KA 2D9WA 2MWNB 2J59M 1TXDA 4NSWA 2DKPA 2YT1A 4KAXB 1DDMA 1EGXA 2ZPYA 2KUPA 2YF0A 1P3RA 1BTKA 1QC6A 4D0NB 2MKRA 1Z87A 3U7DA 2M14A 4KVGB 2COFA 2ROZB 1W1HA 5D3VA 1XR0B 4A6KA 2JP2A 3D8DA 5DHAB 1ZC3B 4HB2B 5C6RA 1W1GA 3RCPA 4HB0B 1V5UA 2I1KA 5KQ4A 5CLQB 2I1JA 5DIFB 1MK9B 2W2WA 1WVHA 2N0YA 2YS3A 3F0WA 2D11A 3DXEA 4ZRKA 1UNRA 2Y8FA 3FEHA 2N23A 4MT7A 2RNRB 3MDBC 3SO6A 4GMVA 1BWNA 1K5GB 3BINA 2CAYA 2VRWB 1X05A 1ZM0A 2OTXA 1OMWA 5HE0A 1TJ6A 3A8PA 2K00A 2J0KA 4DX90 3TCAA 1B55A 1XODA 4GMXB 1UNQA 3PEGA 1WG7A 3G9WA 3DXDA 3HK0A 1PMSA 4IOYX 1X86A 2OQBA 1M7EA 2VKIA 3HQCA 1FB8A 3N7CA 2COAA 2GCLA 2V76A 2D9YA 4HAUB 2D10A 3D8EA 3OANA 2IFSA 1WGQA 1AWEA 2Y7BA 3DXCA 4A6FB 3F5RA 5JHHA 4A6HA 2EMSA 3UZTA 2Z0OA 2YVCA 1U2BA 2YSZA 4F7HA 2P8VA 1LB1A 4TYZA 4YONA 1MIXA 5J3YA 1FHWA 1DBHA 2P0HA 2YS5A 1E5WA 1P5TA 4TKNA 1WJ1A 1EF1A 4EJNA 4Z2MB 4B6HA 4DXAB 1I2HA 2DYNA 2XQNM 1PLSA 2L1CA 2AL6A 4ZRIA 4A6FA 5DHFB 2Q13A 1WJMA 2UZSA 4EMOA 2GS0A 3PG7A 2CY5A 2D4QA 2KCJA 1FGYA 1FOEA 2NMBA 1V5PA 2R09A 5CLLB 3GYPA 2GJYA 2DFKA 3P7ZA 3PVUA 2DHJA 1KZ7A 3KRXA 1X11A 5DI9B 1X1GA 1QQGA 2LKOA 2CY4A 4BBKA 4C0AA 2FJLA 2K2UA 2MFQA 3AJ4A 3TW1A 2LG1A 3WYFB 4HDOA 5D3YA 1FAOA 1ZVRA 5FI0A 1K5DB 5HE1A 1XKEA 2RSGA 3BJIA 4IAPA 2CRFA 1PFJA 1MIZB 3KY9A 4XWXA 1ZSQA 2UZRA 3NSUA 2ROVA 1WGUA 5KCVA 2YS1A 3GYOA 1NI2A 1ISNA 3U8ZA 2D2QA 1M7RA 2YT0A 3SYXA 1RJ2A 1U29A 2PZ1A 4DX8A 4CHMA 1XX0A 2LYDA 4MY6A 3PVWA 1GC6A 1Y19B 2Z0PA 1LW3A 3ZVRA 4YL8A 3FSSA 3P6AA 2H7DA 1MPHA 2P0DA 5JP4A 2G35A 5L81A 1U5DA 4KHBB 2I5FA 2QKLA 4WJ7A 3ODWA 2DN6A 2DYQA 3SNHA 1FGZA 1MKEA 3V5WA 3TFMA 4NY0A 2GCJA 2CODA 4K2PA 2DHIA 5D3XA 2QKMA 2J0JA 1DDVA 3CIKA 2DX1A 3KRWA 1TQZA 1EVHA 1J0WA 2YRYA 2EMTA 1UEFA 2E2XA 4IFSA 1UPQA 2DKQA 1UPRA 1XCGA 2IYBA 3LJUX 4KHAA 2LULA 1RRPB 4K81A 2HTHB 3X23A 4HATB 5C79A 5JHGA 5J3TA 3SV1A 4HAYB 2Z0QA 3QWMA 4CYEA 3KZ1A 2D9XA 1DYNA 5LONB 4L6EA 5J3QA 4Z2NA 2MDXA 1NU2A 4Y94A 3QBVB 4PQ0A 2X18A 1DROA 3A8QA 1V5MA 4CHJA 2NZ8B 1GC7A 2L2IA 4MK0A 1KI1B 2D9VA 2DHKA 2LOXA 4DBBA 1FHXA 2W2XD 1I7AA 4HAXB 3ML4A 1OY2A 3KSYA 3ULCA 5KQ1A 1KZGA 2AEHA 1SGHA 1IRSA 4HB4B 1X1FA 2HE7A 5FI1A 1EAZA 2J0MA 1ZC4B 4KHOA 1U5FA 1U27A 5C5BB 2RLOA 1P6SA 4HAWB 2KGXB 3ZDTA 2COCA 3PVLA 4PNKA 2DX5A 2Y8GA 3AU4A 1V61A 5LOPB 2D9ZA 3VOQA 4P7IA 1V88A 4GN1A 2W2XC 5C16A 3CXBB 5D3WA 2DA0A 4GZUA 5DH9B 5C5BA 4F7GA 1NTVA 2BCJA 1MK7B 1V89A 1Q67A 1H4RA 3PP2A 4WVFB 4EKUA 4HAVB 3FM8C 5JLJB 3TVVA 1GG3A
chains in the Genus database with same CATH superfamily
2Z59A 3HW2B 3AU5A 4GPTB 2EJ8A 1H10A 1J19A 1WI1A 4F7UP 2ADZA 1UNPA 2R0DA 1NTYA 4ZRJA 2RVBB 1U5GA 1XD4A 2M38A 5EFXA 5HE3A 2H7EA 4GOUA 4H8SA 2K2JA 2EC1A 2RGNB 3D8FA 3ODXA 2LOZA 3MPXA 4K17A 4QJ5B 4HDQA 3TO1A 1Y5OA 1W1DA 1U5EA 1BTNA 1AQCA 3A98B 3DCXA 3T06A 5HE2A 1BAKA 1SHCA 4K2OA 3QIJA 1T77A 2DLWA 2ELBA 2YT2A 3ODOA 3PSCA 3VIAA 1MAIA 3NWAA 5M4YB 2DTCA 4HAZB 3ULBA 3PZDA 1N3HA 4HB3B 3IVFA 4HHVA 3M1IB 2P0FA 1OQNA 4WSFA 2I5CA 2RUKB 2UVMA 4GXBA 3WA0A 2VSZA 2ELAA 5IRSA 1FHOA 5GOWB 1DDWA 3SUZA 3O96A 5D27A 4QXAB 4A5KA 2D9WA 2MWNB 2J59M 3NW8A 1TXDA 4NSWA 3NWDA 2DKPA 2YT1A 4KAXB 1DDMA 1EGXA 2ZPYA 2KUPA 2YF0A 1P3RA 4DIXA 1BTKA 1QC6A 4D0NB 2MKRA 1Z87A 2Z13A 3U7DA 1MI1A 2M14A 4KVGB 2COFA 4QJ4B 2ROZB 1W1HA 5D3VA 1XR0B 4A6KA 2JP2A 3D8DA 5DHAB 1ZC3B 4HB2B 5C6RA 1W1GA 3RCPA 4HB0B 1V5UA 2I1KA 5KQ4A 5CLQB 2I1JA 5DIFB 2Z4DA 1MK9B 2W2WA 1WVHA 2N0YA 2KUQA 2YS3A 3F0WA 2D11A 3DXEA 4ZRKA 1UNRA 2Y8FA 3FEHA 2N23A 4MT7A 2RNRB 3MDBC 3SO6A 4GMVA 1BWNA 1K5GB 3BINA 2CAYA 2VRWB 1X05A 1ZM0A 3OHMB 2OTXA 3HIEA 1OMWA 5HE0A 1TJ6A 3A8PA 2K00A 2J0KA 4DX90 3TCAA 1B55A 1XODA 4GMXB 1UNQA 3PEGA 1WG7A 3G9WA 3DXDA 3HK0A 1PMSA 4IOYX 1X86A 2OQBA 3U12A 1M7EA 2VKIA 3HQCA 1FB8A 3N7CA 2COAA 2GCLA 2V76A 2D9YA 4HAUB 2D10A 2GUMA 3D8EA 3OANA 2IFSA 1WGQA 2FJUB 1AWEA 2Y7BA 3DXCA 4A6FB 3F5RA 5JHHA 4A6HA 2EMSA 3UZTA 2Z0OA 2YVCA 1U2BA 2YSZA 4F7HA 2P8VA 1LB1A 4TYZA 4KHBA 4YONA 1MIXA 5J3YA 1FHWA 3A58A 1DBHA 2P0HA 2YS5A 1E5WA 1P5TA 4TKNA 1WJ1A 1EF1A 4EJNA 4Z2MB 4B6HA 4DXAB 1I2HA 2DYNA 2XQNM 1PLSA 2L1CA 2AL6A 4ZRIA 4A6FA 5DHFB 2R2YA 2Q13A 1ZYIA 1WJMA 2UZSA 4EMOA 2GS0A 3PG7A 2CY5A 3NWFA 2D4QA 2KCJA 1FGYA 1FOEA 2NMBA 1V5PA 2R09A 5CLLB 3GYPA 2GJYA 2DFKA 3P7ZA 3PVUA 2DHJA 1KZ7A 3KRXA 1X11A 5DI9B 1X1GA 3FVCA 1QQGA 2Z14A 2LKOA 2RRFA 2CY4A 4BBKA 4OT1A 4C0AA 2FJLA 2K2UA 2MFQA 3AJ4A 3TW1A 2LG1A 3WYFB 4HDOA 5D3YA 1FAOA 1ZVRA 5FI0A 1K5DB 5HE1A 1XKEA 2RSGA 3BJIA 4IAPA 2CRFA 1PFJA 1MIZB 3KY9A 2KR0A 4XWXA 1ZSQA 2UZRA 3NSUA 2ROVA 1WGUA 5KCVA 2YS1A 3GYOA 1NI2A 1ISNA 3U8ZA 2D2QA 1M7RA 2YT0A 3SYXA 1RJ2A 1U29A 2PZ1A 4DX8A 4CHMA 1XX0A 2LYDA 2NBVA 4MY6A 3PVWA 1GC6A 1Y19B 2Z0PA 1LW3A 3ZVRA 4OSNA 4YL8A 3FSSA 3P6AA 4HSIA 2H7DA 1MPHA 2P0DA 5JP4A 2G35A 5L81A 1U5DA 4QJ3B 4KHBB 2I5FA 5LG4B 2QKLA 2KIEA 4WJ7A 3ODWA 2DN6A 2DYQA 3SNHA 1FGZA 1MKEA 3V5WA 3TFMA 4NY0A 2GCJA 2CODA 4K2PA 2DHIA 5D3XA 2QKMA 2J0JA 1DDVA 3CIKA 2DX1A 3KRWA 4GNKB 1TQZA 1EVHA 1J0WA 2YRYA 2EMTA 1UEFA 2E2XA 4IFSA 1UPQA 2DKQA 1UPRA 4L1RA 1XCGA 2IYBA 3LJUX 4KHAA 2LULA 1RRPB 2K8EA 4K81A 2HTHB 3X23A 4HATB 5C79A 5JHGA 5J3TA 3SV1A 4HAYB 2Z0QA 3QWMA 4CYEA 3KZ1A 2D9XA 1DYNA 5LONB 4L6EA 5J3QA 4Z2NA 2MDXA 1NU2A 4Y94A 3QBVB 4PQ0A 2X18A 1DROA 3A8QA 1V5MA 4CHJA 2NZ8B 1GC7A 2ZKMX 2L2IA 4MK0A 4CSQA 1KI1B 2D9VA 2DHKA 2KIGA 2LOXA 4DBBA 1FHXA 2W2XD 1I7AA 4HAXB 3ML4A 1OY2A 3HSAA 3KSYA 3ULCA 3B77A 5KQ1A 1KZGA 2AEHA 1SGHA 1IRSA 4HB4B 5I2MA 1X1FA 2HE7A 5FI1A 1EAZA 2J0MA 1ZC4B 4KHOA 1U5FA 1U27A 5C5BB 2RLOA 1P6SA 4HAWB 2K49A 2KGXB 3ZDTA 2COCA 3PVLA 4PNKA 2DX5A 2Y8GA 3AU4A 5I2SA 1V61A 5LOPB 2D9ZA 4D6WA 3VOQA 4P7IA 1V88A 4GN1A 2W2XC 5C16A 3CXBB 5D3WA 2DA0A 4GZUA 5DH9B 5C5BA 4F7GA 1NTVA 2BCJA 1MK7B 1V89A 1Q67A 1H4RA 3PP2A 4WVFB 4EKUA 4HAVB 3FM8C 5JLJB 3TVVA 1GG3A
chains in the Genus database with same CATH topology
3HW2B 3AU5A 4GPTB 2EJ8A 1H10A 1J19A 1WI1A 4F7UP 2ADZA 1UNPA 2R0DA 1NTYA 4ZRJA 2RVBB 1U5GA 1XD4A 2M38A 5EFXA 5HE3A 2H7EA 4H8SA 2K2JA 2EC1A 2RGNB 3D8FA 3ODXA 2LOZA 3MPXA 4K17A 4HDQA 3TO1A 1Y5OA 1W1DA 1U5EA 1BTNA 1AQCA 3A98B 3T06A 5HE2A 1BAKA 1SHCA 4K2OA 3QIJA 2DLWA 2ELBA 3PSCA 3ODOA 3VIAA 1MAIA 2DTCA 4HAZB 3ULBA 3PZDA 1N3HA 4HB3B 3IVFA 4HHVA 3M1IB 2P0FA 1OQNA 4WSFA 2I5CA 2RUKB 2UVMA 4GXBA 3WA0A 2VSZA 2ELAA 1FHOA 5GOWB 1DDWA 3SUZA 3O96A 5D27A 4A5KA 2D9WA 2MWNB 2J59M 1TXDA 4NSWA 2DKPA 2YT1A 4KAXB 1DDMA 1EGXA 2ZPYA 2KUPA 2YF0A 1P3RA 1BTKA 1QC6A 4D0NB 2MKRA 1Z87A 3U7DA 2M14A 4KVGB 2COFA 2ROZB 1W1HA 5D3VA 1XR0B 4A6KA 2JP2A 3D8DA 5DHAB 1ZC3B 4HB2B 5C6RA 1W1GA 3RCPA 4HB0B 1V5UA 2I1KA 5KQ4A 5CLQB 2I1JA 5DIFB 1MK9B 2W2WA 1WVHA 2N0YA 2YS3A 3F0WA 2D11A 3DXEA 4ZRKA 1UNRA 2Y8FA 3FEHA 2N23A 4MT7A 2RNRB 3MDBC 3SO6A 4GMVA 1BWNA 1K5GB 3BINA 2CAYA 2VRWB 1X05A 1ZM0A 2OTXA 1OMWA 5HE0A 1TJ6A 3A8PA 2K00A 2J0KA 4DX90 3TCAA 1B55A 1XODA 4GMXB 1UNQA 3PEGA 1WG7A 3G9WA 3DXDA 3HK0A 1PMSA 4IOYX 1X86A 2OQBA 1M7EA 2VKIA 3HQCA 1FB8A 3N7CA 2COAA 2GCLA 2V76A 2D9YA 4HAUB 2D10A 3D8EA 3OANA 2IFSA 1WGQA 1AWEA 2Y7BA 3DXCA 4A6FB 3F5RA 5JHHA 4A6HA 2EMSA 3UZTA 2Z0OA 2YVCA 1U2BA 2YSZA 4F7HA 2P8VA 1LB1A 4TYZA 4YONA 1MIXA 5J3YA 1FHWA 1DBHA 2P0HA 2YS5A 1E5WA 1P5TA 4TKNA 1WJ1A 1EF1A 4EJNA 4Z2MB 4B6HA 4DXAB 1I2HA 2DYNA 2XQNM 1PLSA 2L1CA 2AL6A 4ZRIA 4A6FA 5DHFB 2Q13A 1WJMA 2UZSA 4EMOA 2GS0A 3PG7A 2CY5A 2D4QA 2KCJA 1FGYA 1FOEA 2NMBA 1V5PA 2R09A 5CLLB 3GYPA 2GJYA 2DFKA 3P7ZA 3PVUA 2DHJA 1KZ7A 3KRXA 1X11A 5DI9B 1X1GA 1QQGA 2LKOA 2CY4A 4BBKA 4C0AA 2FJLA 2K2UA 2MFQA 3AJ4A 3TW1A 2LG1A 3WYFB 4HDOA 5D3YA 1FAOA 1ZVRA 5FI0A 1K5DB 5HE1A 1XKEA 2RSGA 3BJIA 4IAPA 2CRFA 1PFJA 1MIZB 3KY9A 4XWXA 1ZSQA 2UZRA 3NSUA 2ROVA 1WGUA 5KCVA 2YS1A 3GYOA 1NI2A 1ISNA 3U8ZA 2D2QA 1M7RA 2YT0A 3SYXA 1RJ2A 1U29A 2PZ1A 4DX8A 4CHMA 1XX0A 2LYDA 4MY6A 3PVWA 1GC6A 1Y19B 2Z0PA 1LW3A 3ZVRA 4YL8A 3FSSA 3P6AA 2H7DA 1MPHA 2P0DA 5JP4A 2G35A 5L81A 1U5DA 4KHBB 2I5FA 2QKLA 4WJ7A 3ODWA 2DN6A 2DYQA 3SNHA 1FGZA 1MKEA 3V5WA 3TFMA 4NY0A 2GCJA 2CODA 4K2PA 2DHIA 5D3XA 2QKMA 2J0JA 1DDVA 3CIKA 2DX1A 3KRWA 1TQZA 1EVHA 1J0WA 2YRYA 2EMTA 1UEFA 2E2XA 4IFSA 1UPQA 2DKQA 1UPRA 1XCGA 2IYBA 3LJUX 4KHAA 2LULA 1RRPB 4K81A 2HTHB 3X23A 4HATB 5C79A 5JHGA 5J3TA 3SV1A 4HAYB 2Z0QA 3QWMA 4CYEA 3KZ1A 2D9XA 1DYNA 5LONB 4L6EA 5J3QA 4Z2NA 2MDXA 1NU2A 4Y94A 3QBVB 4PQ0A 2X18A 1DROA 3A8QA 1V5MA 4CHJA 2NZ8B 1GC7A 2L2IA 4MK0A 1KI1B 2D9VA 2DHKA 2LOXA 4DBBA 1FHXA 2W2XD 1I7AA 4HAXB 3ML4A 1OY2A 3KSYA 3ULCA 5KQ1A 1KZGA 2AEHA 1SGHA 1IRSA 4HB4B 1X1FA 2HE7A 5FI1A 1EAZA 2J0MA 1ZC4B 4KHOA 1U5FA 1U27A 5C5BB 2RLOA 1P6SA 4HAWB 2KGXB 3ZDTA 2COCA 3PVLA 4PNKA 2DX5A 2Y8GA 3AU4A 1V61A 5LOPB 2D9ZA 3VOQA 4P7IA 1V88A 4GN1A 2W2XC 5C16A 3CXBB 5D3WA 2DA0A 4GZUA 5DH9B 5C5BA 4F7GA 1NTVA 2BCJA 1MK7B 1V89A 1Q67A 1H4RA 3PP2A 4WVFB 4EKUA 4HAVB 3FM8C 5JLJB 3TVVA 1GG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HW2 B;  3AU5 A;  4GPT B;  2EJ8 A;  1H10 A;  1J19 A;  1WI1 A;  4F7U P;  2ADZ A;  1UNP A;  2R0D A;  1NTY A;  4ZRJ A;  2RVB B;  1U5G A;  1XD4 A;  2M38 A;  5EFX A;  5HE3 A;  2H7E A;  4H8S A;  2K2J A;  2EC1 A;  2RGN B;  3D8F A;  3ODX A;  2LOZ A;  3MPX A;  4K17 A;  4HDQ A;  3TO1 A;  1Y5O A;  1W1D A;  1U5E A;  1BTN A;  1AQC A;  3A98 B;  3T06 A;  5HE2 A;  1BAK A;  1SHC A;  4K2O A;  3QIJ A;  2DLW A;  2ELB A;  3PSC A;  3ODO A;  3VIA A;  1MAI A;  2DTC A;  4HAZ B;  3ULB A;  3PZD A;  1N3H A;  4HB3 B;  3IVF A;  4HHV A;  3M1I B;  2P0F A;  1OQN A;  4WSF A;  2I5C A;  2RUK B;  2UVM A;  4GXB A;  3WA0 A;  2VSZ A;  2ELA A;  1FHO A;  5GOW B;  1DDW A;  3SUZ A;  3O96 A;  5D27 A;  4A5K A;  2D9W A;  2MWN B;  2J59 M;  1TXD A;  4NSW A;  2DKP A;  2YT1 A;  4KAX B;  1DDM A;  1EGX A;  2ZPY A;  2KUP A;  2YF0 A;  1P3R A;  1BTK A;  1QC6 A;  4D0N B;  2MKR A;  1Z87 A;  3U7D A;  2M14 A;  4KVG B;  2COF A;  2ROZ B;  1W1H A;  5D3V A;  1XR0 B;  4A6K A;  2JP2 A;  3D8D A;  5DHA B;  1ZC3 B;  4HB2 B;  5C6R A;  1W1G A;  3RCP A;  4HB0 B;  1V5U A;  2I1K A;  5KQ4 A;  5CLQ B;  2I1J A;  5DIF B;  1MK9 B;  2W2W A;  1WVH A;  2N0Y A;  2YS3 A;  3F0W A;  2D11 A;  3DXE A;  4ZRK A;  1UNR A;  2Y8F A;  3FEH A;  2N23 A;  4MT7 A;  2RNR B;  3MDB C;  3SO6 A;  4GMV A;  1BWN A;  1K5G B;  3BIN A;  2CAY A;  2VRW B;  1X05 A;  1ZM0 A;  2OTX A;  1OMW A;  5HE0 A;  1TJ6 A;  3A8P A;  2K00 A;  2J0K A;  4DX9 0;  3TCA A;  1B55 A;  1XOD A;  4GMX B;  1UNQ A;  3PEG A;  1WG7 A;  3G9W A;  3DXD A;  3HK0 A;  1PMS A;  4IOY X;  1X86 A;  2OQB A;  1M7E A;  2VKI A;  3HQC A;  1FB8 A;  3N7C A;  2COA A;  2GCL A;  2V76 A;  2D9Y A;  4HAU B;  2D10 A;  3D8E A;  3OAN A;  2IFS A;  1WGQ A;  1AWE A;  2Y7B A;  3DXC A;  4A6F B;  3F5R A;  5JHH A;  4A6H A;  2EMS A;  3UZT A;  2Z0O A;  2YVC A;  1U2B A;  2YSZ A;  4F7H A;  2P8V A;  1LB1 A;  4TYZ A;  4YON A;  1MIX A;  5J3Y A;  1FHW A;  1DBH A;  2P0H A;  2YS5 A;  1E5W A;  1P5T A;  4TKN A;  1WJ1 A;  1EF1 A;  4EJN A;  4Z2M B;  4B6H A;  4DXA B;  1I2H A;  2DYN A;  2XQN M;  1PLS A;  2L1C A;  2AL6 A;  4ZRI A;  4A6F A;  5DHF B;  2Q13 A;  1WJM A;  2UZS A;  4EMO A;  2GS0 A;  3PG7 A;  2CY5 A;  2D4Q A;  2KCJ A;  1FGY A;  1FOE A;  2NMB A;  1V5P A;  2R09 A;  5CLL B;  3GYP A;  2GJY A;  2DFK A;  3P7Z A;  3PVU A;  2DHJ A;  1KZ7 A;  3KRX A;  1X11 A;  5DI9 B;  1X1G A;  1QQG A;  2LKO A;  2CY4 A;  4BBK A;  4C0A A;  2FJL A;  2K2U A;  2MFQ A;  3AJ4 A;  3TW1 A;  2LG1 A;  3WYF B;  4HDO A;  5D3Y A;  1FAO A;  1ZVR A;  5FI0 A;  1K5D B;  5HE1 A;  1XKE A;  2RSG A;  3BJI A;  4IAP A;  2CRF A;  1PFJ A;  1MIZ B;  3KY9 A;  4XWX A;  1ZSQ A;  2UZR A;  3NSU A;  2ROV A;  1WGU A;  5KCV A;  2YS1 A;  3GYO A;  1NI2 A;  1ISN A;  3U8Z A;  2D2Q A;  1M7R A;  2YT0 A;  3SYX A;  1RJ2 A;  1U29 A;  2PZ1 A;  4DX8 A;  4CHM A;  1XX0 A;  2LYD A;  4MY6 A;  3PVW A;  1GC6 A;  1Y19 B;  2Z0P A;  1LW3 A;  3ZVR A;  4YL8 A;  3FSS A;  3P6A A;  2H7D A;  1MPH A;  2P0D A;  5JP4 A;  2G35 A;  5L81 A;  1U5D A;  4KHB B;  2I5F A;  2QKL A;  4WJ7 A;  3ODW A;  2DN6 A;  2DYQ A;  3SNH A;  1FGZ A;  1MKE A;  3V5W A;  3TFM A;  4NY0 A;  2GCJ A;  2COD A;  4K2P A;  2DHI A;  5D3X A;  2QKM A;  2J0J A;  1DDV A;  3CIK A;  2DX1 A;  3KRW A;  1TQZ A;  1EVH A;  1J0W A;  2YRY A;  2EMT A;  1UEF A;  2E2X A;  4IFS A;  1UPQ A;  2DKQ A;  1UPR A;  1XCG A;  2IYB A;  3LJU X;  4KHA A;  2LUL A;  1RRP B;  4K81 A;  2HTH B;  3X23 A;  4HAT B;  5C79 A;  5JHG A;  5J3T A;  3SV1 A;  4HAY B;  2Z0Q A;  3QWM A;  4CYE A;  3KZ1 A;  2D9X A;  1DYN A;  5LON B;  4L6E A;  5J3Q A;  4Z2N A;  2MDX A;  1NU2 A;  4Y94 A;  3QBV B;  4PQ0 A;  2X18 A;  1DRO A;  3A8Q A;  1V5M A;  4CHJ A;  2NZ8 B;  1GC7 A;  2L2I A;  4MK0 A;  1KI1 B;  2D9V A;  2DHK A;  2LOX A;  4DBB A;  1FHX A;  2W2X D;  1I7A A;  4HAX B;  3ML4 A;  1OY2 A;  3KSY A;  3ULC A;  5KQ1 A;  1KZG A;  2AEH A;  1SGH A;  1IRS A;  4HB4 B;  1X1F A;  2HE7 A;  5FI1 A;  1EAZ A;  2J0M A;  1ZC4 B;  4KHO A;  1U5F A;  1U27 A;  5C5B B;  2RLO A;  1P6S A;  4HAW B;  2KGX B;  3ZDT A;  2COC A;  3PVL A;  4PNK A;  2DX5 A;  2Y8G A;  3AU4 A;  1V61 A;  5LOP B;  2D9Z A;  3VOQ A;  4P7I A;  1V88 A;  4GN1 A;  2W2X C;  5C16 A;  3CXB B;  5D3W A;  2DA0 A;  4GZU A;  5DH9 B;  5C5B A;  4F7G A;  1NTV A;  2BCJ A;  1MK7 B;  1V89 A;  1Q67 A;  1H4R A;  3PP2 A;  4WVF B;  4EKU A;  4HAV B;  3FM8 C;  5JLJ B;  3TVV A;  1GG3 A; 
#chains in the Genus database with same CATH topology
 2Z59 A;  3HW2 B;  3AU5 A;  4GPT B;  2EJ8 A;  1H10 A;  1J19 A;  1WI1 A;  4F7U P;  2ADZ A;  1UNP A;  2R0D A;  1NTY A;  4ZRJ A;  2RVB B;  1U5G A;  1XD4 A;  2M38 A;  5EFX A;  5HE3 A;  2H7E A;  4GOU A;  4H8S A;  2K2J A;  2EC1 A;  2RGN B;  3D8F A;  3ODX A;  2LOZ A;  3MPX A;  4K17 A;  4QJ5 B;  4HDQ A;  3TO1 A;  1Y5O A;  1W1D A;  1U5E A;  1BTN A;  1AQC A;  3A98 B;  3DCX A;  3T06 A;  5HE2 A;  1BAK A;  1SHC A;  4K2O A;  3QIJ A;  1T77 A;  2DLW A;  2ELB A;  2YT2 A;  3ODO A;  3PSC A;  3VIA A;  1MAI A;  3NWA A;  5M4Y B;  2DTC A;  4HAZ B;  3ULB A;  3PZD A;  1N3H A;  4HB3 B;  3IVF A;  4HHV A;  3M1I B;  2P0F A;  1OQN A;  4WSF A;  2I5C A;  2RUK B;  2UVM A;  4GXB A;  3WA0 A;  2VSZ A;  2ELA A;  5IRS A;  1FHO A;  5GOW B;  1DDW A;  3SUZ A;  3O96 A;  5D27 A;  4QXA B;  4A5K A;  2D9W A;  2MWN B;  2J59 M;  3NW8 A;  1TXD A;  4NSW A;  3NWD A;  2DKP A;  2YT1 A;  4KAX B;  1DDM A;  1EGX A;  2ZPY A;  2KUP A;  2YF0 A;  1P3R A;  4DIX A;  1BTK A;  1QC6 A;  4D0N B;  2MKR A;  1Z87 A;  2Z13 A;  3U7D A;  1MI1 A;  2M14 A;  4KVG B;  2COF A;  4QJ4 B;  2ROZ B;  1W1H A;  5D3V A;  1XR0 B;  4A6K A;  2JP2 A;  3D8D A;  5DHA B;  1ZC3 B;  4HB2 B;  5C6R A;  1W1G A;  3RCP A;  4HB0 B;  1V5U A;  2I1K A;  5KQ4 A;  5CLQ B;  2I1J A;  5DIF B;  2Z4D A;  1MK9 B;  2W2W A;  1WVH A;  2N0Y A;  2KUQ A;  2YS3 A;  3F0W A;  2D11 A;  3DXE A;  4ZRK A;  1UNR A;  2Y8F A;  3FEH A;  2N23 A;  4MT7 A;  2RNR B;  3MDB C;  3SO6 A;  4GMV A;  1BWN A;  1K5G B;  3BIN A;  2CAY A;  2VRW B;  1X05 A;  1ZM0 A;  3OHM B;  2OTX A;  3HIE A;  1OMW A;  5HE0 A;  1TJ6 A;  3A8P A;  2K00 A;  2J0K A;  4DX9 0;  3TCA A;  1B55 A;  1XOD A;  4GMX B;  1UNQ A;  3PEG A;  1WG7 A;  3G9W A;  3DXD A;  3HK0 A;  1PMS A;  4IOY X;  1X86 A;  2OQB A;  3U12 A;  1M7E A;  2VKI A;  3HQC A;  1FB8 A;  3N7C A;  2COA A;  2GCL A;  2V76 A;  2D9Y A;  4HAU B;  2D10 A;  2GUM A;  3D8E A;  3OAN A;  2IFS A;  1WGQ A;  2FJU B;  1AWE A;  2Y7B A;  3DXC A;  4A6F B;  3F5R A;  5JHH A;  4A6H A;  2EMS A;  3UZT A;  2Z0O A;  2YVC A;  1U2B A;  2YSZ A;  4F7H A;  2P8V A;  1LB1 A;  4TYZ A;  4KHB A;  4YON A;  1MIX A;  5J3Y A;  1FHW A;  3A58 A;  1DBH A;  2P0H A;  2YS5 A;  1E5W A;  1P5T A;  4TKN A;  1WJ1 A;  1EF1 A;  4EJN A;  4Z2M B;  4B6H A;  4DXA B;  1I2H A;  2DYN A;  2XQN M;  1PLS A;  2L1C A;  2AL6 A;  4ZRI A;  4A6F A;  5DHF B;  2R2Y A;  2Q13 A;  1ZYI A;  1WJM A;  2UZS A;  4EMO A;  2GS0 A;  3PG7 A;  2CY5 A;  3NWF A;  2D4Q A;  2KCJ A;  1FGY A;  1FOE A;  2NMB A;  1V5P A;  2R09 A;  5CLL B;  3GYP A;  2GJY A;  2DFK A;  3P7Z A;  3PVU A;  2DHJ A;  1KZ7 A;  3KRX A;  1X11 A;  5DI9 B;  1X1G A;  3FVC A;  1QQG A;  2Z14 A;  2LKO A;  2RRF A;  2CY4 A;  4BBK A;  4OT1 A;  4C0A A;  2FJL A;  2K2U A;  2MFQ A;  3AJ4 A;  3TW1 A;  2LG1 A;  3WYF B;  4HDO A;  5D3Y A;  1FAO A;  1ZVR A;  5FI0 A;  1K5D B;  5HE1 A;  1XKE A;  2RSG A;  3BJI A;  4IAP A;  2CRF A;  1PFJ A;  1MIZ B;  3KY9 A;  2KR0 A;  4XWX A;  1ZSQ A;  2UZR A;  3NSU A;  2ROV A;  1WGU A;  5KCV A;  2YS1 A;  3GYO A;  1NI2 A;  1ISN A;  3U8Z A;  2D2Q A;  1M7R A;  2YT0 A;  3SYX A;  1RJ2 A;  1U29 A;  2PZ1 A;  4DX8 A;  4CHM A;  1XX0 A;  2LYD A;  2NBV A;  4MY6 A;  3PVW A;  1GC6 A;  1Y19 B;  2Z0P A;  1LW3 A;  3ZVR A;  4OSN A;  4YL8 A;  3FSS A;  3P6A A;  4HSI A;  2H7D A;  1MPH A;  2P0D A;  5JP4 A;  2G35 A;  5L81 A;  1U5D A;  4QJ3 B;  4KHB B;  2I5F A;  5LG4 B;  2QKL A;  2KIE A;  4WJ7 A;  3ODW A;  2DN6 A;  2DYQ A;  3SNH A;  1FGZ A;  1MKE A;  3V5W A;  3TFM A;  4NY0 A;  2GCJ A;  2COD A;  4K2P A;  2DHI A;  5D3X A;  2QKM A;  2J0J A;  1DDV A;  3CIK A;  2DX1 A;  3KRW A;  4GNK B;  1TQZ A;  1EVH A;  1J0W A;  2YRY A;  2EMT A;  1UEF A;  2E2X A;  4IFS A;  1UPQ A;  2DKQ A;  1UPR A;  4L1R A;  1XCG A;  2IYB A;  3LJU X;  4KHA A;  2LUL A;  1RRP B;  2K8E A;  4K81 A;  2HTH B;  3X23 A;  4HAT B;  5C79 A;  5JHG A;  5J3T A;  3SV1 A;  4HAY B;  2Z0Q A;  3QWM A;  4CYE A;  3KZ1 A;  2D9X A;  1DYN A;  5LON B;  4L6E A;  5J3Q A;  4Z2N A;  2MDX A;  1NU2 A;  4Y94 A;  3QBV B;  4PQ0 A;  2X18 A;  1DRO A;  3A8Q A;  1V5M A;  4CHJ A;  2NZ8 B;  1GC7 A;  2ZKM X;  2L2I A;  4MK0 A;  4CSQ A;  1KI1 B;  2D9V A;  2DHK A;  2KIG A;  2LOX A;  4DBB A;  1FHX A;  2W2X D;  1I7A A;  4HAX B;  3ML4 A;  1OY2 A;  3HSA A;  3KSY A;  3ULC A;  3B77 A;  5KQ1 A;  1KZG A;  2AEH A;  1SGH A;  1IRS A;  4HB4 B;  5I2M A;  1X1F A;  2HE7 A;  5FI1 A;  1EAZ A;  2J0M A;  1ZC4 B;  4KHO A;  1U5F A;  1U27 A;  5C5B B;  2RLO A;  1P6S A;  4HAW B;  2K49 A;  2KGX B;  3ZDT A;  2COC A;  3PVL A;  4PNK A;  2DX5 A;  2Y8G A;  3AU4 A;  5I2S A;  1V61 A;  5LOP B;  2D9Z A;  4D6W A;  3VOQ A;  4P7I A;  1V88 A;  4GN1 A;  2W2X C;  5C16 A;  3CXB B;  5D3W A;  2DA0 A;  4GZU A;  5DH9 B;  5C5B A;  4F7G A;  1NTV A;  2BCJ A;  1MK7 B;  1V89 A;  1Q67 A;  1H4R A;  3PP2 A;  4WVF B;  4EKU A;  4HAV B;  3FM8 C;  5JLJ B;  3TVV A;  1GG3 A; 
#chains in the Genus database with same CATH homology
 3HW2 B;  3AU5 A;  4GPT B;  2EJ8 A;  1H10 A;  1J19 A;  1WI1 A;  4F7U P;  2ADZ A;  1UNP A;  2R0D A;  1NTY A;  4ZRJ A;  2RVB B;  1U5G A;  1XD4 A;  2M38 A;  5EFX A;  5HE3 A;  2H7E A;  4H8S A;  2K2J A;  2EC1 A;  2RGN B;  3D8F A;  3ODX A;  2LOZ A;  3MPX A;  4K17 A;  4HDQ A;  3TO1 A;  1Y5O A;  1W1D A;  1U5E A;  1BTN A;  1AQC A;  3A98 B;  3T06 A;  5HE2 A;  1BAK A;  1SHC A;  4K2O A;  3QIJ A;  2DLW A;  2ELB A;  3PSC A;  3ODO A;  3VIA A;  1MAI A;  2DTC A;  4HAZ B;  3ULB A;  3PZD A;  1N3H A;  4HB3 B;  3IVF A;  4HHV A;  3M1I B;  2P0F A;  1OQN A;  4WSF A;  2I5C A;  2RUK B;  2UVM A;  4GXB A;  3WA0 A;  2VSZ A;  2ELA A;  1FHO A;  5GOW B;  1DDW A;  3SUZ A;  3O96 A;  5D27 A;  4A5K A;  2D9W A;  2MWN B;  2J59 M;  1TXD A;  4NSW A;  2DKP A;  2YT1 A;  4KAX B;  1DDM A;  1EGX A;  2ZPY A;  2KUP A;  2YF0 A;  1P3R A;  1BTK A;  1QC6 A;  4D0N B;  2MKR A;  1Z87 A;  3U7D A;  2M14 A;  4KVG B;  2COF A;  2ROZ B;  1W1H A;  5D3V A;  1XR0 B;  4A6K A;  2JP2 A;  3D8D A;  5DHA B;  1ZC3 B;  4HB2 B;  5C6R A;  1W1G A;  3RCP A;  4HB0 B;  1V5U A;  2I1K A;  5KQ4 A;  5CLQ B;  2I1J A;  5DIF B;  1MK9 B;  2W2W A;  1WVH A;  2N0Y A;  2YS3 A;  3F0W A;  2D11 A;  3DXE A;  4ZRK A;  1UNR A;  2Y8F A;  3FEH A;  2N23 A;  4MT7 A;  2RNR B;  3MDB C;  3SO6 A;  4GMV A;  1BWN A;  1K5G B;  3BIN A;  2CAY A;  2VRW B;  1X05 A;  1ZM0 A;  2OTX A;  1OMW A;  5HE0 A;  1TJ6 A;  3A8P A;  2K00 A;  2J0K A;  4DX9 0;  3TCA A;  1B55 A;  1XOD A;  4GMX B;  1UNQ A;  3PEG A;  1WG7 A;  3G9W A;  3DXD A;  3HK0 A;  1PMS A;  4IOY X;  1X86 A;  2OQB A;  1M7E A;  2VKI A;  3HQC A;  1FB8 A;  3N7C A;  2COA A;  2GCL A;  2V76 A;  2D9Y A;  4HAU B;  2D10 A;  3D8E A;  3OAN A;  2IFS A;  1WGQ A;  1AWE A;  2Y7B A;  3DXC A;  4A6F B;  3F5R A;  5JHH A;  4A6H A;  2EMS A;  3UZT A;  2Z0O A;  2YVC A;  1U2B A;  2YSZ A;  4F7H A;  2P8V A;  1LB1 A;  4TYZ A;  4YON A;  1MIX A;  5J3Y A;  1FHW A;  1DBH A;  2P0H A;  2YS5 A;  1E5W A;  1P5T A;  4TKN A;  1WJ1 A;  1EF1 A;  4EJN A;  4Z2M B;  4B6H A;  4DXA B;  1I2H A;  2DYN A;  2XQN M;  1PLS A;  2L1C A;  2AL6 A;  4ZRI A;  4A6F A;  5DHF B;  2Q13 A;  1WJM A;  2UZS A;  4EMO A;  2GS0 A;  3PG7 A;  2CY5 A;  2D4Q A;  2KCJ A;  1FGY A;  1FOE A;  2NMB A;  1V5P A;  2R09 A;  5CLL B;  3GYP A;  2GJY A;  2DFK A;  3P7Z A;  3PVU A;  2DHJ A;  1KZ7 A;  3KRX A;  1X11 A;  5DI9 B;  1X1G A;  1QQG A;  2LKO A;  2CY4 A;  4BBK A;  4C0A A;  2FJL A;  2K2U A;  2MFQ A;  3AJ4 A;  3TW1 A;  2LG1 A;  3WYF B;  4HDO A;  5D3Y A;  1FAO A;  1ZVR A;  5FI0 A;  1K5D B;  5HE1 A;  1XKE A;  2RSG A;  3BJI A;  4IAP A;  2CRF A;  1PFJ A;  1MIZ B;  3KY9 A;  4XWX A;  1ZSQ A;  2UZR A;  3NSU A;  2ROV A;  1WGU A;  5KCV A;  2YS1 A;  3GYO A;  1NI2 A;  1ISN A;  3U8Z A;  2D2Q A;  1M7R A;  2YT0 A;  3SYX A;  1RJ2 A;  1U29 A;  2PZ1 A;  4DX8 A;  4CHM A;  1XX0 A;  2LYD A;  4MY6 A;  3PVW A;  1GC6 A;  1Y19 B;  2Z0P A;  1LW3 A;  3ZVR A;  4YL8 A;  3FSS A;  3P6A A;  2H7D A;  1MPH A;  2P0D A;  5JP4 A;  2G35 A;  5L81 A;  1U5D A;  4KHB B;  2I5F A;  2QKL A;  4WJ7 A;  3ODW A;  2DN6 A;  2DYQ A;  3SNH A;  1FGZ A;  1MKE A;  3V5W A;  3TFM A;  4NY0 A;  2GCJ A;  2COD A;  4K2P A;  2DHI A;  5D3X A;  2QKM A;  2J0J A;  1DDV A;  3CIK A;  2DX1 A;  3KRW A;  1TQZ A;  1EVH A;  1J0W A;  2YRY A;  2EMT A;  1UEF A;  2E2X A;  4IFS A;  1UPQ A;  2DKQ A;  1UPR A;  1XCG A;  2IYB A;  3LJU X;  4KHA A;  2LUL A;  1RRP B;  4K81 A;  2HTH B;  3X23 A;  4HAT B;  5C79 A;  5JHG A;  5J3T A;  3SV1 A;  4HAY B;  2Z0Q A;  3QWM A;  4CYE A;  3KZ1 A;  2D9X A;  1DYN A;  5LON B;  4L6E A;  5J3Q A;  4Z2N A;  2MDX A;  1NU2 A;  4Y94 A;  3QBV B;  4PQ0 A;  2X18 A;  1DRO A;  3A8Q A;  1V5M A;  4CHJ A;  2NZ8 B;  1GC7 A;  2L2I A;  4MK0 A;  1KI1 B;  2D9V A;  2DHK A;  2LOX A;  4DBB A;  1FHX A;  2W2X D;  1I7A A;  4HAX B;  3ML4 A;  1OY2 A;  3KSY A;  3ULC A;  5KQ1 A;  1KZG A;  2AEH A;  1SGH A;  1IRS A;  4HB4 B;  1X1F A;  2HE7 A;  5FI1 A;  1EAZ A;  2J0M A;  1ZC4 B;  4KHO A;  1U5F A;  1U27 A;  5C5B B;  2RLO A;  1P6S A;  4HAW B;  2KGX B;  3ZDT A;  2COC A;  3PVL A;  4PNK A;  2DX5 A;  2Y8G A;  3AU4 A;  1V61 A;  5LOP B;  2D9Z A;  3VOQ A;  4P7I A;  1V88 A;  4GN1 A;  2W2X C;  5C16 A;  3CXB B;  5D3W A;  2DA0 A;  4GZU A;  5DH9 B;  5C5B A;  4F7G A;  1NTV A;  2BCJ A;  1MK7 B;  1V89 A;  1Q67 A;  1H4R A;  3PP2 A;  4WVF B;  4EKU A;  4HAV B;  3FM8 C;  5JLJ B;  3TVV A;  1GG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...