3A8QA

Low-resolution crystal structure of the tiam2 phccex domain
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
239
structure length
231
Chain Sequence
VVRKAGWLFFKPLVTLQKERKLELVARRKWKQYWVTLKGCTLLFYETYSAPRCALFAEDSIVQSVPEHPKKEHVFCLSNSCGDVYLFQATSQTDLENWVTAIHSACASLFAKKHGKEDTVRLLKSQTRSLLQKIDMDSKMKKMAELQLSVVSDPKNRKAIENQIRQWEQNLEKFHMDLFRMRCYLASLQGGELPNPKSLLAATSRPSKLALGRLGVLSVSSFHALVCSRDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords T-lymphoma invasion and metastasis-inducing protein 2
publication title The PHCCEx domain of Tiam1/2 is a novel protein- and membrane-binding module
pubmed doi rcsb
source organism Mus musculus
total genus 70
structure length 231
sequence length 239
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF18385 Tiam_CC_Ex T-lymphoma invasion and metastasis CC-Ex domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3a8qA01
3BJIA 4K2OA 4HAWB 1FHWA 2OQBA 3ZDTA 3KZ1A 3PEGA 4GMXB 5C79A 3AJ4A 2COFA 3O96A 2N23A 2Z0QA 3A8PA 2JP2A 1V88A 4HB2B 2VRWB 3F5RA 2G35A 4KHAA 4KAXB 1IRSA 1Y19B 2Z0OA 2KCJA 3PVWA 4DXAB 1QQGA 3NSUA 3G9WA 2P0FA 3VOQA 1FGZA 1WGQA 2DN6A 4P7IA 1KI1B 3TVVA 5LONB 5DH9B 3N7CA 2YRYA 5C5BB 1GC6A 2LULA 2LOXA 5D3VA 2EC1A 4ZRJA 1MAIA 3MDBC 1RRPB 1LW3A 2YS3A 1DDMA 2DHKA 1ZVRA 4A6HA 1UPQA 1ZM0A 4HB3B 2DYNA 3UZTA 2EMSA 3KRXA 3A8QA 2UVMA 2DA0A 1WI1A 5JP4A 2MFQA 2YVCA 1I7AA 1MKEA 2YS5A 1WJ1A 2DHJA 3ODWA 4YONA 2QKMA 4DX8A 1W1HA 2VKIA 2YT1A 4BBKA 2D9WA 4DBBA 2H7DA 2HE7A 4NSWA 1Q67A 1M7RA 1W1GA 2K2JA 2CY4A 1PMSA 3GYPA 2XQNM 3PG7A 2COCA 3FSSA 4HAYB 5KQ1A 2GJYA 4A5KA 4K81A 5J3TA 2YT0A 2Z0PA 2DFKA 3WYFB 3V5WA 1Y5OA 1XR0B 2IFSA 4TYZA 4A6KA 2X18A 1AWEA 5LOPB 1M7EA 1X1FA 1ZSQA 2M38A 1PFJA 5HE2A 3SV1A 1P6SA 3SO6A 1BAKA 3M1IB 1ISNA 1DDVA 3D8FA 4HAVB 3T06A 1OY2A 4WSFA 1X1GA 1UNQA 1SGHA 3TW1A 4EKUA 1BTKA 4CHMA 3KY9A 2HTHB 1XKEA 3ODOA 1FOEA 3QBVB 3X23A 2YF0A 5CLLB 1V5UA 3P6AA 1FGYA 2H7EA 1U5GA 5EFXA 1U5EA 4A6FB 3FEHA 1TXDA 1TQZA 4HAUB 3CXBB 1FHXA 1V61A 2D10A 2Y8GA 3PP2A 4WJ7A 3KSYA 4TKNA 1WJMA 1KZ7A 1UEFA 5GOWB 2Q13A 3FM8C 1ZC3B 3RCPA 4NY0A 2COAA 5DI9B 1EF1A 1J19A 2FJLA 3KRWA 2J0KA 2N0YA 1U5FA 2NMBA 2R09A 2UZRA 1WVHA 2GS0A 4EMOA 1E5WA 5HE3A 1BWNA 3D8DA 5KQ4A 2RLOA 3QIJA 2MDXA 1MK9B 3DXCA 5J3QA 1UNPA 4KVGB 1OMWA 3U8ZA 3DXEA 3P7ZA 2J59M 1V5MA 2R0DA 2Y8FA 4WVFB 2P8VA 1K5DB 3OANA 1QC6A 5J3YA 1H4RA 3A98B 4XWXA 3TCAA 1OQNA 4HHVA 4YL8A 5FI0A 3ULBA 5HE0A 2CRFA 2AL6A 3QWMA 4HAZB 3D8EA 1MIZB 2PZ1A 5JLJB 4PNKA 1P5TA 3ZVRA 2Y7BA 1GG3A 5FI1A 3TFMA 1FB8A 1KZGA 2I1KA 5DHAB 5JHGA 1V5PA 3AU5A 4HB0B 2CODA 5CLQB 3VIAA 4Z2NA 4PQ0A 2CAYA 4C0AA 2GCJA 2DX5A 1AQCA 2RVBB 3WA0A 2CY5A 2IYBA 1N3HA 1NI2A 3HW2B 4F7HA 3SUZA 1UNRA 5C6RA 2D11A 4IOYX 5JHHA 3U7DA 2I5FA 3SNHA 2K2UA 1BTNA 2E2XA 2LOZA 2VSZA 5KCVA 5C16A 4GMVA 4Z2MB 1W1DA 2AEHA 4DX90 4GXBA 4CYEA 1PLSA 1XODA 4K2PA 2D9YA 2DKPA 3PVLA 4CHJA 1XD4A 1NTYA 2RGNB 4HAXB 2YS1A 1SHCA 1MPHA 3LJUX 2QKLA 4GPTB 1WGUA 2D2QA 1X86A 4H8SA 3BINA 1MK7B 4L6EA 2LKOA 1RJ2A 1I2HA 2I1JA 3ML4A 4HDOA 2D9VA 1NTVA 2W2XD 2D9ZA 1X05A 2KUPA 3CIKA 2DYQA 2EJ8A 3IVFA 1U27A 3ODXA 1X11A 5C5BA 2LG1A 2P0HA 1DROA 1J0WA 1EVHA 4MT7A 4F7UP 2ELBA 4HATB 5DHFB 3AU4A 3TO1A 4EJNA 5DIFB 2ROVA 1H10A 1B55A 3PVUA 5L81A 2ROZB 2RNRB 2M14A 1U29A 4KHBB 5D3YA 1FHOA 3GYOA 2I5CA 2V76A 1ZC4B 5D27A 2W2XC 2DKQA 3ULCA 4D0NB 2MKRA 5HE1A 4F7GA 4GN1A 2D4QA 1Z87A 2ADZA 1DDWA 4Y94A 1LB1A 2ZPYA 4K17A 4HB4B 2MWNB 2P0DA 2BCJA 2W2WA 4B6HA 2ELAA 1TJ6A 2KGXB 1DBHA 1EGXA 1NU2A 2RUKB 2L1CA 1V89A 1U5DA 1U2BA 3PSCA 3DXDA 4IFSA 1FAOA 4MK0A 1P3RA 1K5GB 1DYNA 3PZDA 4HDQA 2OTXA 2DLWA 2LYDA 3HK0A 3F0WA 4ZRIA 2J0MA 4MY6A 1MIXA 1EAZA 4KHOA 5D3WA 2RSGA 5D3XA 2EMTA 2NZ8B 1GC7A 3SYXA 2DX1A 2D9XA 1XCGA 2UZSA 4ZRKA 2YSZA 3HQCA 3MPXA 1UPRA 4A6FA 2L2IA 2DHIA 4GZUA 2J0JA 1XX0A 4IAPA 2K00A 2DTCA 2GCLA 1WG7A
chains in the Genus database with same CATH superfamily
4HSIA 3BJIA 4K2OA 4HAWB 1FHWA 2OQBA 3ZDTA 3KZ1A 3PEGA 4GMXB 5C79A 3AJ4A 2COFA 3O96A 2N23A 2Z0QA 2NBVA 3A8PA 2JP2A 1V88A 2ZKMX 4HB2B 2VRWB 3F5RA 2G35A 4KHAA 4KAXB 2Z59A 1IRSA 1Y19B 2Z0OA 2KCJA 3PVWA 4DXAB 1QQGA 3NSUA 3G9WA 2P0FA 3VOQA 1FGZA 1WGQA 2DN6A 4P7IA 1KI1B 3TVVA 5LONB 5DH9B 3N7CA 2YRYA 5C5BB 1GC6A 2LULA 1ZYIA 2LOXA 2EC1A 5D3VA 4ZRJA 1MAIA 3MDBC 1RRPB 3NWFA 1LW3A 2YS3A 1DDMA 3NWDA 2DHKA 1ZVRA 4A6HA 1UPQA 1ZM0A 4HB3B 3DCXA 2DYNA 3UZTA 2EMSA 3KRXA 3A8QA 2UVMA 2DA0A 1WI1A 5JP4A 2MFQA 2YVCA 1I7AA 1MKEA 2YS5A 1WJ1A 2DHJA 3ODWA 4YONA 2QKMA 4DX8A 1W1HA 2VKIA 2YT1A 4BBKA 2D9WA 4DBBA 2H7DA 3A58A 2HE7A 4NSWA 1Q67A 1M7RA 1W1GA 2K2JA 1T77A 2CY4A 1PMSA 3GYPA 2XQNM 3PG7A 2COCA 3FSSA 4HAYB 5KQ1A 2GJYA 4A5KA 4K81A 5J3TA 2YT0A 2Z0PA 2DFKA 3WYFB 2RRFA 3V5WA 1Y5OA 1XR0B 2IFSA 4TYZA 4A6KA 2X18A 2FJUB 1AWEA 2Z13A 5LOPB 1M7EA 1X1FA 1ZSQA 2M38A 2KR0A 1PFJA 5HE2A 3SV1A 4QJ3B 1P6SA 3SO6A 1BAKA 3M1IB 3OHMB 1MI1A 1ISNA 1DDVA 3D8FA 4HAVB 3T06A 1OY2A 4WSFA 1X1GA 1UNQA 1SGHA 3TW1A 4EKUA 1BTKA 4CHMA 3KY9A 2HTHB 1XKEA 3ODOA 1FOEA 3QBVB 3X23A 2YF0A 5CLLB 1V5UA 3P6AA 1FGYA 2H7EA 1U5GA 5EFXA 1U5EA 4A6FB 3FEHA 1TXDA 1TQZA 4HAUB 3CXBB 4L1RA 1FHXA 1V61A 2D10A 2Y8GA 3PP2A 4WJ7A 2K8EA 3KSYA 4TKNA 1WJMA 1KZ7A 1UEFA 5GOWB 2Q13A 3FM8C 3B77A 1ZC3B 2Z4DA 3RCPA 4NY0A 2KUQA 2COAA 5DI9B 1EF1A 1J19A 2FJLA 3KRWA 5M4YB 4GOUA 2J0KA 2N0YA 1U5FA 2NMBA 2R09A 2UZRA 1WVHA 2GS0A 4EMOA 1E5WA 5HE3A 1BWNA 3D8DA 5KQ4A 2RLOA 3QIJA 2MDXA 4KHBA 4OSNA 1MK9B 3DXCA 4OT1A 1UNPA 5J3QA 4KVGB 1OMWA 3U8ZA 3DXEA 3P7ZA 2J59M 1V5MA 2R0DA 2Y8FA 4WVFB 2P8VA 1K5DB 3OANA 1QC6A 5J3YA 1H4RA 3A98B 4XWXA 3TCAA 1OQNA 4HHVA 4YL8A 5FI0A 3ULBA 5HE0A 2CRFA 2AL6A 3QWMA 4HAZB 3D8EA 1MIZB 2PZ1A 5JLJB 4PNKA 2Z14A 1P5TA 3ZVRA 4QJ5B 2Y7BA 1GG3A 5FI1A 3TFMA 1FB8A 1KZGA 2I1KA 5DHAB 5JHGA 1V5PA 3AU5A 4HB0B 2CODA 5CLQB 3VIAA 4Z2NA 4D6WA 4PQ0A 2CAYA 4C0AA 2GCJA 2DX5A 1AQCA 2RVBB 3WA0A 2CY5A 2IYBA 1N3HA 1NI2A 3HW2B 4F7HA 3SUZA 1UNRA 5I2MA 5C6RA 2D11A 4IOYX 5JHHA 3U7DA 2I5FA 3SNHA 2K2UA 1BTNA 2E2XA 2LOZA 2KIEA 4CSQA 2VSZA 5KCVA 5C16A 4GMVA 4Z2MB 1W1DA 2AEHA 4DX90 4GXBA 4CYEA 1PLSA 1XODA 4K2PA 2D9YA 2DKPA 2R2YA 3PVLA 4CHJA 1XD4A 1NTYA 2RGNB 4HAXB 2YS1A 1SHCA 1MPHA 3LJUX 2QKLA 4GPTB 1WGUA 2D2QA 1X86A 4H8SA 3BINA 1MK7B 4L6EA 2LKOA 1RJ2A 1I2HA 2I1JA 3ML4A 4HDOA 2GUMA 2D9VA 1NTVA 2W2XD 2D9ZA 1X05A 2KUPA 3CIKA 4DIXA 2DYQA 2EJ8A 4GNKB 3IVFA 1U27A 3ODXA 1X11A 5C5BA 2LG1A 2P0HA 1DROA 1J0WA 1EVHA 4MT7A 4F7UP 3NWAA 2ELBA 4HATB 5DHFB 3AU4A 3TO1A 4EJNA 5DIFB 2ROVA 1H10A 1B55A 3PVUA 5L81A 2ROZB 2RNRB 2M14A 1U29A 4KHBB 5D3YA 1FHOA 3GYOA 2I5CA 5I2SA 2V76A 1ZC4B 5D27A 2W2XC 3HIEA 2DKQA 3ULCA 2YT2A 4D0NB 2MKRA 5HE1A 4F7GA 4GN1A 2D4QA 1Z87A 3HSAA 2ADZA 1DDWA 4Y94A 1LB1A 2ZPYA 4K17A 4HB4B 2MWNB 2P0DA 2BCJA 2W2WA 4B6HA 2ELAA 1TJ6A 2KGXB 1DBHA 1EGXA 1NU2A 2RUKB 5IRSA 2L1CA 5LG4B 1V89A 1U5DA 1U2BA 3PSCA 3DXDA 4IFSA 1FAOA 4MK0A 1P3RA 1K5GB 1DYNA 3PZDA 4HDQA 4QJ4B 2OTXA 2DLWA 2LYDA 3HK0A 3NW8A 3F0WA 4ZRIA 2J0MA 4MY6A 1MIXA 1EAZA 4KHOA 2K49A 5D3WA 2RSGA 5D3XA 2EMTA 2NZ8B 1GC7A 3SYXA 2DX1A 2D9XA 4QXAB 1XCGA 2UZSA 4ZRKA 2YSZA 3HQCA 2KIGA 3MPXA 1UPRA 4A6FA 2L2IA 3FVCA 2DHIA 4GZUA 2J0JA 1XX0A 4IAPA 2K00A 2DTCA 2GCLA 3U12A 1WG7A
chains in the Genus database with same CATH topology
3BJIA 4K2OA 4HAWB 1FHWA 2OQBA 3ZDTA 3KZ1A 3PEGA 4GMXB 5C79A 3AJ4A 2COFA 3O96A 2N23A 2Z0QA 3A8PA 2JP2A 1V88A 4HB2B 2VRWB 3F5RA 2G35A 4KHAA 4KAXB 1IRSA 1Y19B 2Z0OA 2KCJA 3PVWA 4DXAB 1QQGA 3NSUA 3G9WA 2P0FA 3VOQA 1FGZA 1WGQA 2DN6A 4P7IA 1KI1B 3TVVA 5LONB 5DH9B 3N7CA 2YRYA 5C5BB 1GC6A 2LULA 2LOXA 5D3VA 2EC1A 4ZRJA 1MAIA 3MDBC 1RRPB 1LW3A 2YS3A 1DDMA 2DHKA 1ZVRA 4A6HA 1UPQA 1ZM0A 4HB3B 2DYNA 3UZTA 2EMSA 3KRXA 3A8QA 2UVMA 2DA0A 1WI1A 5JP4A 2MFQA 2YVCA 1I7AA 1MKEA 2YS5A 1WJ1A 2DHJA 3ODWA 4YONA 2QKMA 4DX8A 1W1HA 2VKIA 2YT1A 4BBKA 2D9WA 4DBBA 2H7DA 2HE7A 4NSWA 1Q67A 1M7RA 1W1GA 2K2JA 2CY4A 1PMSA 3GYPA 2XQNM 3PG7A 2COCA 3FSSA 4HAYB 5KQ1A 2GJYA 4A5KA 4K81A 5J3TA 2YT0A 2Z0PA 2DFKA 3WYFB 3V5WA 1Y5OA 1XR0B 2IFSA 4TYZA 4A6KA 2X18A 1AWEA 5LOPB 1M7EA 1X1FA 1ZSQA 2M38A 1PFJA 5HE2A 3SV1A 1P6SA 3SO6A 1BAKA 3M1IB 1ISNA 1DDVA 3D8FA 4HAVB 3T06A 1OY2A 4WSFA 1X1GA 1UNQA 1SGHA 3TW1A 4EKUA 1BTKA 4CHMA 3KY9A 2HTHB 1XKEA 3ODOA 1FOEA 3QBVB 3X23A 2YF0A 5CLLB 1V5UA 3P6AA 1FGYA 2H7EA 1U5GA 5EFXA 1U5EA 4A6FB 3FEHA 1TXDA 1TQZA 4HAUB 3CXBB 1FHXA 1V61A 2D10A 2Y8GA 3PP2A 4WJ7A 3KSYA 4TKNA 1WJMA 1KZ7A 1UEFA 5GOWB 2Q13A 3FM8C 1ZC3B 3RCPA 4NY0A 2COAA 5DI9B 1EF1A 1J19A 2FJLA 3KRWA 2J0KA 2N0YA 1U5FA 2NMBA 2R09A 2UZRA 1WVHA 2GS0A 4EMOA 1E5WA 5HE3A 1BWNA 3D8DA 5KQ4A 2RLOA 3QIJA 2MDXA 1MK9B 3DXCA 5J3QA 1UNPA 4KVGB 1OMWA 3U8ZA 3DXEA 3P7ZA 2J59M 1V5MA 2R0DA 2Y8FA 4WVFB 2P8VA 1K5DB 3OANA 1QC6A 5J3YA 1H4RA 3A98B 4XWXA 3TCAA 1OQNA 4HHVA 4YL8A 5FI0A 3ULBA 5HE0A 2CRFA 2AL6A 3QWMA 4HAZB 3D8EA 1MIZB 2PZ1A 5JLJB 4PNKA 1P5TA 3ZVRA 2Y7BA 1GG3A 5FI1A 3TFMA 1FB8A 1KZGA 2I1KA 5DHAB 5JHGA 1V5PA 3AU5A 4HB0B 2CODA 5CLQB 3VIAA 4Z2NA 4PQ0A 2CAYA 4C0AA 2GCJA 2DX5A 1AQCA 2RVBB 3WA0A 2CY5A 2IYBA 1N3HA 1NI2A 3HW2B 4F7HA 3SUZA 1UNRA 5C6RA 2D11A 4IOYX 5JHHA 3U7DA 2I5FA 3SNHA 2K2UA 1BTNA 2E2XA 2LOZA 2VSZA 5KCVA 5C16A 4GMVA 4Z2MB 1W1DA 2AEHA 4DX90 4GXBA 4CYEA 1PLSA 1XODA 4K2PA 2D9YA 2DKPA 3PVLA 4CHJA 1XD4A 1NTYA 2RGNB 4HAXB 2YS1A 1SHCA 1MPHA 3LJUX 2QKLA 4GPTB 1WGUA 2D2QA 1X86A 4H8SA 3BINA 1MK7B 4L6EA 2LKOA 1RJ2A 1I2HA 2I1JA 3ML4A 4HDOA 2D9VA 1NTVA 2W2XD 2D9ZA 1X05A 2KUPA 3CIKA 2DYQA 2EJ8A 3IVFA 1U27A 3ODXA 1X11A 5C5BA 2LG1A 2P0HA 1DROA 1J0WA 1EVHA 4MT7A 4F7UP 2ELBA 4HATB 5DHFB 3AU4A 3TO1A 4EJNA 5DIFB 2ROVA 1H10A 1B55A 3PVUA 5L81A 2ROZB 2RNRB 2M14A 1U29A 4KHBB 5D3YA 1FHOA 3GYOA 2I5CA 2V76A 1ZC4B 5D27A 2W2XC 2DKQA 3ULCA 4D0NB 2MKRA 5HE1A 4F7GA 4GN1A 2D4QA 1Z87A 2ADZA 1DDWA 4Y94A 1LB1A 2ZPYA 4K17A 4HB4B 2MWNB 2P0DA 2BCJA 2W2WA 4B6HA 2ELAA 1TJ6A 2KGXB 1DBHA 1EGXA 1NU2A 2RUKB 2L1CA 1V89A 1U5DA 1U2BA 3PSCA 3DXDA 4IFSA 1FAOA 4MK0A 1P3RA 1K5GB 1DYNA 3PZDA 4HDQA 2OTXA 2DLWA 2LYDA 3HK0A 3F0WA 4ZRIA 2J0MA 4MY6A 1MIXA 1EAZA 4KHOA 5D3WA 2RSGA 5D3XA 2EMTA 2NZ8B 1GC7A 3SYXA 2DX1A 2D9XA 1XCGA 2UZSA 4ZRKA 2YSZA 3HQCA 3MPXA 1UPRA 4A6FA 2L2IA 2DHIA 4GZUA 2J0JA 1XX0A 4IAPA 2K00A 2DTCA 2GCLA 1WG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BJI A;  4K2O A;  4HAW B;  1FHW A;  2OQB A;  3ZDT A;  3KZ1 A;  3PEG A;  4GMX B;  5C79 A;  3AJ4 A;  2COF A;  3O96 A;  2N23 A;  2Z0Q A;  3A8P A;  2JP2 A;  1V88 A;  4HB2 B;  2VRW B;  3F5R A;  2G35 A;  4KHA A;  4KAX B;  1IRS A;  1Y19 B;  2Z0O A;  2KCJ A;  3PVW A;  4DXA B;  1QQG A;  3NSU A;  3G9W A;  2P0F A;  3VOQ A;  1FGZ A;  1WGQ A;  2DN6 A;  4P7I A;  1KI1 B;  3TVV A;  5LON B;  5DH9 B;  3N7C A;  2YRY A;  5C5B B;  1GC6 A;  2LUL A;  2LOX A;  5D3V A;  2EC1 A;  4ZRJ A;  1MAI A;  3MDB C;  1RRP B;  1LW3 A;  2YS3 A;  1DDM A;  2DHK A;  1ZVR A;  4A6H A;  1UPQ A;  1ZM0 A;  4HB3 B;  2DYN A;  3UZT A;  2EMS A;  3KRX A;  3A8Q A;  2UVM A;  2DA0 A;  1WI1 A;  5JP4 A;  2MFQ A;  2YVC A;  1I7A A;  1MKE A;  2YS5 A;  1WJ1 A;  2DHJ A;  3ODW A;  4YON A;  2QKM A;  4DX8 A;  1W1H A;  2VKI A;  2YT1 A;  4BBK A;  2D9W A;  4DBB A;  2H7D A;  2HE7 A;  4NSW A;  1Q67 A;  1M7R A;  1W1G A;  2K2J A;  2CY4 A;  1PMS A;  3GYP A;  2XQN M;  3PG7 A;  2COC A;  3FSS A;  4HAY B;  5KQ1 A;  2GJY A;  4A5K A;  4K81 A;  5J3T A;  2YT0 A;  2Z0P A;  2DFK A;  3WYF B;  3V5W A;  1Y5O A;  1XR0 B;  2IFS A;  4TYZ A;  4A6K A;  2X18 A;  1AWE A;  5LOP B;  1M7E A;  1X1F A;  1ZSQ A;  2M38 A;  1PFJ A;  5HE2 A;  3SV1 A;  1P6S A;  3SO6 A;  1BAK A;  3M1I B;  1ISN A;  1DDV A;  3D8F A;  4HAV B;  3T06 A;  1OY2 A;  4WSF A;  1X1G A;  1UNQ A;  1SGH A;  3TW1 A;  4EKU A;  1BTK A;  4CHM A;  3KY9 A;  2HTH B;  1XKE A;  3ODO A;  1FOE A;  3QBV B;  3X23 A;  2YF0 A;  5CLL B;  1V5U A;  3P6A A;  1FGY A;  2H7E A;  1U5G A;  5EFX A;  1U5E A;  4A6F B;  3FEH A;  1TXD A;  1TQZ A;  4HAU B;  3CXB B;  1FHX A;  1V61 A;  2D10 A;  2Y8G A;  3PP2 A;  4WJ7 A;  3KSY A;  4TKN A;  1WJM A;  1KZ7 A;  1UEF A;  5GOW B;  2Q13 A;  3FM8 C;  1ZC3 B;  3RCP A;  4NY0 A;  2COA A;  5DI9 B;  1EF1 A;  1J19 A;  2FJL A;  3KRW A;  2J0K A;  2N0Y A;  1U5F A;  2NMB A;  2R09 A;  2UZR A;  1WVH A;  2GS0 A;  4EMO A;  1E5W A;  5HE3 A;  1BWN A;  3D8D A;  5KQ4 A;  2RLO A;  3QIJ A;  2MDX A;  1MK9 B;  3DXC A;  5J3Q A;  1UNP A;  4KVG B;  1OMW A;  3U8Z A;  3DXE A;  3P7Z A;  2J59 M;  1V5M A;  2R0D A;  2Y8F A;  4WVF B;  2P8V A;  1K5D B;  3OAN A;  1QC6 A;  5J3Y A;  1H4R A;  3A98 B;  4XWX A;  3TCA A;  1OQN A;  4HHV A;  4YL8 A;  5FI0 A;  3ULB A;  5HE0 A;  2CRF A;  2AL6 A;  3QWM A;  4HAZ B;  3D8E A;  1MIZ B;  2PZ1 A;  5JLJ B;  4PNK A;  1P5T A;  3ZVR A;  2Y7B A;  1GG3 A;  5FI1 A;  3TFM A;  1FB8 A;  1KZG A;  2I1K A;  5DHA B;  5JHG A;  1V5P A;  3AU5 A;  4HB0 B;  2COD A;  5CLQ B;  3VIA A;  4Z2N A;  4PQ0 A;  2CAY A;  4C0A A;  2GCJ A;  2DX5 A;  1AQC A;  2RVB B;  3WA0 A;  2CY5 A;  2IYB A;  1N3H A;  1NI2 A;  3HW2 B;  4F7H A;  3SUZ A;  1UNR A;  5C6R A;  2D11 A;  4IOY X;  5JHH A;  3U7D A;  2I5F A;  3SNH A;  2K2U A;  1BTN A;  2E2X A;  2LOZ A;  2VSZ A;  5KCV A;  5C16 A;  4GMV A;  4Z2M B;  1W1D A;  2AEH A;  4DX9 0;  4GXB A;  4CYE A;  1PLS A;  1XOD A;  4K2P A;  2D9Y A;  2DKP A;  3PVL A;  4CHJ A;  1XD4 A;  1NTY A;  2RGN B;  4HAX B;  2YS1 A;  1SHC A;  1MPH A;  3LJU X;  2QKL A;  4GPT B;  1WGU A;  2D2Q A;  1X86 A;  4H8S A;  3BIN A;  1MK7 B;  4L6E A;  2LKO A;  1RJ2 A;  1I2H A;  2I1J A;  3ML4 A;  4HDO A;  2D9V A;  1NTV A;  2W2X D;  2D9Z A;  1X05 A;  2KUP A;  3CIK A;  2DYQ A;  2EJ8 A;  3IVF A;  1U27 A;  3ODX A;  1X11 A;  5C5B A;  2LG1 A;  2P0H A;  1DRO A;  1J0W A;  1EVH A;  4MT7 A;  4F7U P;  2ELB A;  4HAT B;  5DHF B;  3AU4 A;  3TO1 A;  4EJN A;  5DIF B;  2ROV A;  1H10 A;  1B55 A;  3PVU A;  5L81 A;  2ROZ B;  2RNR B;  2M14 A;  1U29 A;  4KHB B;  5D3Y A;  1FHO A;  3GYO A;  2I5C A;  2V76 A;  1ZC4 B;  5D27 A;  2W2X C;  2DKQ A;  3ULC A;  4D0N B;  2MKR A;  5HE1 A;  4F7G A;  4GN1 A;  2D4Q A;  1Z87 A;  2ADZ A;  1DDW A;  4Y94 A;  1LB1 A;  2ZPY A;  4K17 A;  4HB4 B;  2MWN B;  2P0D A;  2BCJ A;  2W2W A;  4B6H A;  2ELA A;  1TJ6 A;  2KGX B;  1DBH A;  1EGX A;  1NU2 A;  2RUK B;  2L1C A;  1V89 A;  1U5D A;  1U2B A;  3PSC A;  3DXD A;  4IFS A;  1FAO A;  4MK0 A;  1P3R A;  1K5G B;  1DYN A;  3PZD A;  4HDQ A;  2OTX A;  2DLW A;  2LYD A;  3HK0 A;  3F0W A;  4ZRI A;  2J0M A;  4MY6 A;  1MIX A;  1EAZ A;  4KHO A;  5D3W A;  2RSG A;  5D3X A;  2EMT A;  2NZ8 B;  1GC7 A;  3SYX A;  2DX1 A;  2D9X A;  1XCG A;  2UZS A;  4ZRK A;  2YSZ A;  3HQC A;  3MPX A;  1UPR A;  4A6F A;  2L2I A;  2DHI A;  4GZU A;  2J0J A;  1XX0 A;  4IAP A;  2K00 A;  2DTC A;  2GCL A;  1WG7 A; 
#chains in the Genus database with same CATH topology
 4HSI A;  3BJI A;  4K2O A;  4HAW B;  1FHW A;  2OQB A;  3ZDT A;  3KZ1 A;  3PEG A;  4GMX B;  5C79 A;  3AJ4 A;  2COF A;  3O96 A;  2N23 A;  2Z0Q A;  2NBV A;  3A8P A;  2JP2 A;  1V88 A;  2ZKM X;  4HB2 B;  2VRW B;  3F5R A;  2G35 A;  4KHA A;  4KAX B;  2Z59 A;  1IRS A;  1Y19 B;  2Z0O A;  2KCJ A;  3PVW A;  4DXA B;  1QQG A;  3NSU A;  3G9W A;  2P0F A;  3VOQ A;  1FGZ A;  1WGQ A;  2DN6 A;  4P7I A;  1KI1 B;  3TVV A;  5LON B;  5DH9 B;  3N7C A;  2YRY A;  5C5B B;  1GC6 A;  2LUL A;  1ZYI A;  2LOX A;  2EC1 A;  5D3V A;  4ZRJ A;  1MAI A;  3MDB C;  1RRP B;  3NWF A;  1LW3 A;  2YS3 A;  1DDM A;  3NWD A;  2DHK A;  1ZVR A;  4A6H A;  1UPQ A;  1ZM0 A;  4HB3 B;  3DCX A;  2DYN A;  3UZT A;  2EMS A;  3KRX A;  3A8Q A;  2UVM A;  2DA0 A;  1WI1 A;  5JP4 A;  2MFQ A;  2YVC A;  1I7A A;  1MKE A;  2YS5 A;  1WJ1 A;  2DHJ A;  3ODW A;  4YON A;  2QKM A;  4DX8 A;  1W1H A;  2VKI A;  2YT1 A;  4BBK A;  2D9W A;  4DBB A;  2H7D A;  3A58 A;  2HE7 A;  4NSW A;  1Q67 A;  1M7R A;  1W1G A;  2K2J A;  1T77 A;  2CY4 A;  1PMS A;  3GYP A;  2XQN M;  3PG7 A;  2COC A;  3FSS A;  4HAY B;  5KQ1 A;  2GJY A;  4A5K A;  4K81 A;  5J3T A;  2YT0 A;  2Z0P A;  2DFK A;  3WYF B;  2RRF A;  3V5W A;  1Y5O A;  1XR0 B;  2IFS A;  4TYZ A;  4A6K A;  2X18 A;  2FJU B;  1AWE A;  2Z13 A;  5LOP B;  1M7E A;  1X1F A;  1ZSQ A;  2M38 A;  2KR0 A;  1PFJ A;  5HE2 A;  3SV1 A;  4QJ3 B;  1P6S A;  3SO6 A;  1BAK A;  3M1I B;  3OHM B;  1MI1 A;  1ISN A;  1DDV A;  3D8F A;  4HAV B;  3T06 A;  1OY2 A;  4WSF A;  1X1G A;  1UNQ A;  1SGH A;  3TW1 A;  4EKU A;  1BTK A;  4CHM A;  3KY9 A;  2HTH B;  1XKE A;  3ODO A;  1FOE A;  3QBV B;  3X23 A;  2YF0 A;  5CLL B;  1V5U A;  3P6A A;  1FGY A;  2H7E A;  1U5G A;  5EFX A;  1U5E A;  4A6F B;  3FEH A;  1TXD A;  1TQZ A;  4HAU B;  3CXB B;  4L1R A;  1FHX A;  1V61 A;  2D10 A;  2Y8G A;  3PP2 A;  4WJ7 A;  2K8E A;  3KSY A;  4TKN A;  1WJM A;  1KZ7 A;  1UEF A;  5GOW B;  2Q13 A;  3FM8 C;  3B77 A;  1ZC3 B;  2Z4D A;  3RCP A;  4NY0 A;  2KUQ A;  2COA A;  5DI9 B;  1EF1 A;  1J19 A;  2FJL A;  3KRW A;  5M4Y B;  4GOU A;  2J0K A;  2N0Y A;  1U5F A;  2NMB A;  2R09 A;  2UZR A;  1WVH A;  2GS0 A;  4EMO A;  1E5W A;  5HE3 A;  1BWN A;  3D8D A;  5KQ4 A;  2RLO A;  3QIJ A;  2MDX A;  4KHB A;  4OSN A;  1MK9 B;  3DXC A;  4OT1 A;  1UNP A;  5J3Q A;  4KVG B;  1OMW A;  3U8Z A;  3DXE A;  3P7Z A;  2J59 M;  1V5M A;  2R0D A;  2Y8F A;  4WVF B;  2P8V A;  1K5D B;  3OAN A;  1QC6 A;  5J3Y A;  1H4R A;  3A98 B;  4XWX A;  3TCA A;  1OQN A;  4HHV A;  4YL8 A;  5FI0 A;  3ULB A;  5HE0 A;  2CRF A;  2AL6 A;  3QWM A;  4HAZ B;  3D8E A;  1MIZ B;  2PZ1 A;  5JLJ B;  4PNK A;  2Z14 A;  1P5T A;  3ZVR A;  4QJ5 B;  2Y7B A;  1GG3 A;  5FI1 A;  3TFM A;  1FB8 A;  1KZG A;  2I1K A;  5DHA B;  5JHG A;  1V5P A;  3AU5 A;  4HB0 B;  2COD A;  5CLQ B;  3VIA A;  4Z2N A;  4D6W A;  4PQ0 A;  2CAY A;  4C0A A;  2GCJ A;  2DX5 A;  1AQC A;  2RVB B;  3WA0 A;  2CY5 A;  2IYB A;  1N3H A;  1NI2 A;  3HW2 B;  4F7H A;  3SUZ A;  1UNR A;  5I2M A;  5C6R A;  2D11 A;  4IOY X;  5JHH A;  3U7D A;  2I5F A;  3SNH A;  2K2U A;  1BTN A;  2E2X A;  2LOZ A;  2KIE A;  4CSQ A;  2VSZ A;  5KCV A;  5C16 A;  4GMV A;  4Z2M B;  1W1D A;  2AEH A;  4DX9 0;  4GXB A;  4CYE A;  1PLS A;  1XOD A;  4K2P A;  2D9Y A;  2DKP A;  2R2Y A;  3PVL A;  4CHJ A;  1XD4 A;  1NTY A;  2RGN B;  4HAX B;  2YS1 A;  1SHC A;  1MPH A;  3LJU X;  2QKL A;  4GPT B;  1WGU A;  2D2Q A;  1X86 A;  4H8S A;  3BIN A;  1MK7 B;  4L6E A;  2LKO A;  1RJ2 A;  1I2H A;  2I1J A;  3ML4 A;  4HDO A;  2GUM A;  2D9V A;  1NTV A;  2W2X D;  2D9Z A;  1X05 A;  2KUP A;  3CIK A;  4DIX A;  2DYQ A;  2EJ8 A;  4GNK B;  3IVF A;  1U27 A;  3ODX A;  1X11 A;  5C5B A;  2LG1 A;  2P0H A;  1DRO A;  1J0W A;  1EVH A;  4MT7 A;  4F7U P;  3NWA A;  2ELB A;  4HAT B;  5DHF B;  3AU4 A;  3TO1 A;  4EJN A;  5DIF B;  2ROV A;  1H10 A;  1B55 A;  3PVU A;  5L81 A;  2ROZ B;  2RNR B;  2M14 A;  1U29 A;  4KHB B;  5D3Y A;  1FHO A;  3GYO A;  2I5C A;  5I2S A;  2V76 A;  1ZC4 B;  5D27 A;  2W2X C;  3HIE A;  2DKQ A;  3ULC A;  2YT2 A;  4D0N B;  2MKR A;  5HE1 A;  4F7G A;  4GN1 A;  2D4Q A;  1Z87 A;  3HSA A;  2ADZ A;  1DDW A;  4Y94 A;  1LB1 A;  2ZPY A;  4K17 A;  4HB4 B;  2MWN B;  2P0D A;  2BCJ A;  2W2W A;  4B6H A;  2ELA A;  1TJ6 A;  2KGX B;  1DBH A;  1EGX A;  1NU2 A;  2RUK B;  5IRS A;  2L1C A;  5LG4 B;  1V89 A;  1U5D A;  1U2B A;  3PSC A;  3DXD A;  4IFS A;  1FAO A;  4MK0 A;  1P3R A;  1K5G B;  1DYN A;  3PZD A;  4HDQ A;  4QJ4 B;  2OTX A;  2DLW A;  2LYD A;  3HK0 A;  3NW8 A;  3F0W A;  4ZRI A;  2J0M A;  4MY6 A;  1MIX A;  1EAZ A;  4KHO A;  2K49 A;  5D3W A;  2RSG A;  5D3X A;  2EMT A;  2NZ8 B;  1GC7 A;  3SYX A;  2DX1 A;  2D9X A;  4QXA B;  1XCG A;  2UZS A;  4ZRK A;  2YSZ A;  3HQC A;  2KIG A;  3MPX A;  1UPR A;  4A6F A;  2L2I A;  3FVC A;  2DHI A;  4GZU A;  2J0J A;  1XX0 A;  4IAP A;  2K00 A;  2DTC A;  2GCL A;  3U12 A;  1WG7 A; 
#chains in the Genus database with same CATH homology
 3BJI A;  4K2O A;  4HAW B;  1FHW A;  2OQB A;  3ZDT A;  3KZ1 A;  3PEG A;  4GMX B;  5C79 A;  3AJ4 A;  2COF A;  3O96 A;  2N23 A;  2Z0Q A;  3A8P A;  2JP2 A;  1V88 A;  4HB2 B;  2VRW B;  3F5R A;  2G35 A;  4KHA A;  4KAX B;  1IRS A;  1Y19 B;  2Z0O A;  2KCJ A;  3PVW A;  4DXA B;  1QQG A;  3NSU A;  3G9W A;  2P0F A;  3VOQ A;  1FGZ A;  1WGQ A;  2DN6 A;  4P7I A;  1KI1 B;  3TVV A;  5LON B;  5DH9 B;  3N7C A;  2YRY A;  5C5B B;  1GC6 A;  2LUL A;  2LOX A;  5D3V A;  2EC1 A;  4ZRJ A;  1MAI A;  3MDB C;  1RRP B;  1LW3 A;  2YS3 A;  1DDM A;  2DHK A;  1ZVR A;  4A6H A;  1UPQ A;  1ZM0 A;  4HB3 B;  2DYN A;  3UZT A;  2EMS A;  3KRX A;  3A8Q A;  2UVM A;  2DA0 A;  1WI1 A;  5JP4 A;  2MFQ A;  2YVC A;  1I7A A;  1MKE A;  2YS5 A;  1WJ1 A;  2DHJ A;  3ODW A;  4YON A;  2QKM A;  4DX8 A;  1W1H A;  2VKI A;  2YT1 A;  4BBK A;  2D9W A;  4DBB A;  2H7D A;  2HE7 A;  4NSW A;  1Q67 A;  1M7R A;  1W1G A;  2K2J A;  2CY4 A;  1PMS A;  3GYP A;  2XQN M;  3PG7 A;  2COC A;  3FSS A;  4HAY B;  5KQ1 A;  2GJY A;  4A5K A;  4K81 A;  5J3T A;  2YT0 A;  2Z0P A;  2DFK A;  3WYF B;  3V5W A;  1Y5O A;  1XR0 B;  2IFS A;  4TYZ A;  4A6K A;  2X18 A;  1AWE A;  5LOP B;  1M7E A;  1X1F A;  1ZSQ A;  2M38 A;  1PFJ A;  5HE2 A;  3SV1 A;  1P6S A;  3SO6 A;  1BAK A;  3M1I B;  1ISN A;  1DDV A;  3D8F A;  4HAV B;  3T06 A;  1OY2 A;  4WSF A;  1X1G A;  1UNQ A;  1SGH A;  3TW1 A;  4EKU A;  1BTK A;  4CHM A;  3KY9 A;  2HTH B;  1XKE A;  3ODO A;  1FOE A;  3QBV B;  3X23 A;  2YF0 A;  5CLL B;  1V5U A;  3P6A A;  1FGY A;  2H7E A;  1U5G A;  5EFX A;  1U5E A;  4A6F B;  3FEH A;  1TXD A;  1TQZ A;  4HAU B;  3CXB B;  1FHX A;  1V61 A;  2D10 A;  2Y8G A;  3PP2 A;  4WJ7 A;  3KSY A;  4TKN A;  1WJM A;  1KZ7 A;  1UEF A;  5GOW B;  2Q13 A;  3FM8 C;  1ZC3 B;  3RCP A;  4NY0 A;  2COA A;  5DI9 B;  1EF1 A;  1J19 A;  2FJL A;  3KRW A;  2J0K A;  2N0Y A;  1U5F A;  2NMB A;  2R09 A;  2UZR A;  1WVH A;  2GS0 A;  4EMO A;  1E5W A;  5HE3 A;  1BWN A;  3D8D A;  5KQ4 A;  2RLO A;  3QIJ A;  2MDX A;  1MK9 B;  3DXC A;  5J3Q A;  1UNP A;  4KVG B;  1OMW A;  3U8Z A;  3DXE A;  3P7Z A;  2J59 M;  1V5M A;  2R0D A;  2Y8F A;  4WVF B;  2P8V A;  1K5D B;  3OAN A;  1QC6 A;  5J3Y A;  1H4R A;  3A98 B;  4XWX A;  3TCA A;  1OQN A;  4HHV A;  4YL8 A;  5FI0 A;  3ULB A;  5HE0 A;  2CRF A;  2AL6 A;  3QWM A;  4HAZ B;  3D8E A;  1MIZ B;  2PZ1 A;  5JLJ B;  4PNK A;  1P5T A;  3ZVR A;  2Y7B A;  1GG3 A;  5FI1 A;  3TFM A;  1FB8 A;  1KZG A;  2I1K A;  5DHA B;  5JHG A;  1V5P A;  3AU5 A;  4HB0 B;  2COD A;  5CLQ B;  3VIA A;  4Z2N A;  4PQ0 A;  2CAY A;  4C0A A;  2GCJ A;  2DX5 A;  1AQC A;  2RVB B;  3WA0 A;  2CY5 A;  2IYB A;  1N3H A;  1NI2 A;  3HW2 B;  4F7H A;  3SUZ A;  1UNR A;  5C6R A;  2D11 A;  4IOY X;  5JHH A;  3U7D A;  2I5F A;  3SNH A;  2K2U A;  1BTN A;  2E2X A;  2LOZ A;  2VSZ A;  5KCV A;  5C16 A;  4GMV A;  4Z2M B;  1W1D A;  2AEH A;  4DX9 0;  4GXB A;  4CYE A;  1PLS A;  1XOD A;  4K2P A;  2D9Y A;  2DKP A;  3PVL A;  4CHJ A;  1XD4 A;  1NTY A;  2RGN B;  4HAX B;  2YS1 A;  1SHC A;  1MPH A;  3LJU X;  2QKL A;  4GPT B;  1WGU A;  2D2Q A;  1X86 A;  4H8S A;  3BIN A;  1MK7 B;  4L6E A;  2LKO A;  1RJ2 A;  1I2H A;  2I1J A;  3ML4 A;  4HDO A;  2D9V A;  1NTV A;  2W2X D;  2D9Z A;  1X05 A;  2KUP A;  3CIK A;  2DYQ A;  2EJ8 A;  3IVF A;  1U27 A;  3ODX A;  1X11 A;  5C5B A;  2LG1 A;  2P0H A;  1DRO A;  1J0W A;  1EVH A;  4MT7 A;  4F7U P;  2ELB A;  4HAT B;  5DHF B;  3AU4 A;  3TO1 A;  4EJN A;  5DIF B;  2ROV A;  1H10 A;  1B55 A;  3PVU A;  5L81 A;  2ROZ B;  2RNR B;  2M14 A;  1U29 A;  4KHB B;  5D3Y A;  1FHO A;  3GYO A;  2I5C A;  2V76 A;  1ZC4 B;  5D27 A;  2W2X C;  2DKQ A;  3ULC A;  4D0N B;  2MKR A;  5HE1 A;  4F7G A;  4GN1 A;  2D4Q A;  1Z87 A;  2ADZ A;  1DDW A;  4Y94 A;  1LB1 A;  2ZPY A;  4K17 A;  4HB4 B;  2MWN B;  2P0D A;  2BCJ A;  2W2W A;  4B6H A;  2ELA A;  1TJ6 A;  2KGX B;  1DBH A;  1EGX A;  1NU2 A;  2RUK B;  2L1C A;  1V89 A;  1U5D A;  1U2B A;  3PSC A;  3DXD A;  4IFS A;  1FAO A;  4MK0 A;  1P3R A;  1K5G B;  1DYN A;  3PZD A;  4HDQ A;  2OTX A;  2DLW A;  2LYD A;  3HK0 A;  3F0W A;  4ZRI A;  2J0M A;  4MY6 A;  1MIX A;  1EAZ A;  4KHO A;  5D3W A;  2RSG A;  5D3X A;  2EMT A;  2NZ8 B;  1GC7 A;  3SYX A;  2DX1 A;  2D9X A;  1XCG A;  2UZS A;  4ZRK A;  2YSZ A;  3HQC A;  3MPX A;  1UPR A;  4A6F A;  2L2I A;  2DHI A;  4GZU A;  2J0J A;  1XX0 A;  4IAP A;  2K00 A;  2DTC A;  2GCL A;  1WG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...