3A8QA

Low-resolution crystal structure of the tiam2 phccex domain
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
239
structure length
231
Chain Sequence
VVRKAGWLFFKPLVTLQKERKLELVARRKWKQYWVTLKGCTLLFYETYSAPRCALFAEDSIVQSVPEHPKKEHVFCLSNSCGDVYLFQATSQTDLENWVTAIHSACASLFAKKHGKEDTVRLLKSQTRSLLQKIDMDSKMKKMAELQLSVVSDPKNRKAIENQIRQWEQNLEKFHMDLFRMRCYLASLQGGELPNPKSLLAATSRPSKLALGRLGVLSVSSFHALVCSRDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords T-lymphoma invasion and metastasis-inducing protein 2
publication title The PHCCEx domain of Tiam1/2 is a novel protein- and membrane-binding module
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 70
structure length 231
sequence length 239
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF18385 Tiam_CC_Ex T-lymphoma invasion and metastasis CC-Ex domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3a8qA01
2CY4A 4YONA 2MKRA 1XD4A 2PZ1A 3HK0A 3F5RA 2CY5A 5KQ1A 1WGQA 4KHOA 1U27A 5HE3A 3ML4A 2D11A 3PZDA 3CIKA 4D0NB 1U5FA 1ZSQA 1GC7A 4CHMA 4GMXB 2H7EA 4HAXB 1J0WA 2EMTA 4IAPA 1B55A 3T06A 5HE2A 4TYZA 2DHKA 3CXBB 2ADZA 2DTCA 2RLOA 2GJYA 1XKEA 2CODA 2YSZA 4WVFB 2D9XA 4K17A 2IYBA 2VKIA 2H7DA 1M7EA 1UNPA 5FI0A 4GZUA 2DHIA 1UNQA 1P6SA 4KAXB 2MDXA 3P6AA 3U8ZA 3SUZA 2W2WA 1FHOA 2ROZB 1E5WA 2YVCA 1FAOA 3SNHA 4IOYX 3PVLA 1BAKA 2D9WA 3SYXA 3A98B 2K00A 2EJ8A 2OTXA 5D3WA 1PLSA 2DYQA 1V89A 2LKOA 2RSGA 2M38A 4GN1A 3TW1A 3ODOA 3TVVA 2YRYA 1KI1B 1P5TA 2I1KA 3ZVRA 1J19A 1UPRA 1I7AA 2DX5A 2Z0OA 4Y94A 2DYNA 3AJ4A 5FI1A 4NSWA 1QQGA 5HE1A 4H8SA 4EJNA 4TKNA 2D10A 2R0DA 5C6RA 2I5FA 1DDWA 1XX0A 1RRPB 2Q13A 4KHAA 4B6HA 3UZTA 1UPQA 1SHCA 5DH9B 1NU2A 2UZSA 1BWNA 2D4QA 3FM8C 2UVMA 4P7IA 1V88A 1ZC4B 3WA0A 1WGUA 3FSSA 3F0WA 3HQCA 3ZDTA 3V5WA 1U5EA 1NTYA 4HAWB 1MKEA 2QKLA 1XCGA 1UNRA 2QKMA 4HB4B 2RNRB 1MIZB 3VIAA 3KZ1A 2J0MA 1V5MA 3ODWA 1MK7B 2CRFA 4L6EA 1BTNA 1U5DA 3RCPA 1DBHA 1V61A 3LJUX 4ZRKA 1GC6A 2Y7BA 1QC6A 4MT7A 4HDOA 2ELBA 4K2PA 3TCAA 4HDQA 4DBBA 3U7DA 1DDVA 3KRXA 4KVGB 2VRWB 2P8VA 2KCJA 3ULBA 3P7ZA 3QBVB 1N3HA 2EMSA 2YS3A 5DIFB 2ROVA 3WYFB 2AEHA 3IVFA 3PG7A 1TXDA 2RVBB 3PEGA 4HAZB 5LOPB 1Y5OA 4EKUA 5D3VA 1MK9B 3DXEA 1DYNA 1FB8A 2OQBA 3ULCA 1H4RA 3SO6A 2DA0A 3AU5A 1FHXA 4MK0A 4C0AA 4HB0B 1H10A 2M14A 1W1HA 1M7RA 2YS1A 3TFMA 3MPXA 1MAIA 2DFKA 2D9YA 5D3XA 3NSUA 5JHGA 4EMOA 2LYDA 4GPTB 2AL6A 5JP4A 2J59M 2KGXB 4HB3B 2COCA 5J3YA 2LULA 3GYPA 1K5DB 1Q67A 1EAZA 4WJ7A 5L81A 2DX1A 1X11A 3GYOA 5LONB 1X1GA 2NMBA 2X18A 3PVUA 4NY0A 1ZC3B 4CYEA 2ZPYA 1P3RA 5J3TA 2JP2A 4Z2NA 1PFJA 1WG7A 2FJLA 3BINA 3FEHA 2GCJA 4KHBB 3BJIA 1XODA 1WJ1A 3HW2B 3N7CA 2Y8GA 1U2BA 1W1DA 1IRSA 1Z87A 4IFSA 5KQ4A 2LOZA 2G35A 3DXDA 1K5GB 1LW3A 2YT0A 2P0FA 1KZ7A 4HHVA 3O96A 2DKQA 1DROA 3QIJA 2Z0QA 3OANA 4HATB 3KSYA 4CHJA 1V5UA 1FGYA 1X05A 1X1FA 2D9VA 1NTVA 1OQNA 4HAVB 2R09A 1X86A 2J0KA 4F7HA 3PSCA 2Z0PA 2YS5A 2DKPA 5HE0A 3TO1A 1ZM0A 1TQZA 2CAYA 2KUPA 4A5KA 4DX8A 5GOWB 1WVHA 2J0JA 5C16A 2V76A 4GXBA 1XR0B 3DXCA 5JLJB 3D8EA 4A6HA 2MWNB 2W2XD 2HTHB 1V5PA 2YT1A 1GG3A 4DX90 2VSZA 2NZ8B 2P0HA 3ODXA 1FOEA 1MPHA 4ZRJA 1DDMA 2P0DA 1MIXA 3KRWA 2N23A 2L1CA 1UEFA 2N0YA 2L2IA 3VOQA 4ZRIA 3AU4A 3D8FA 3SV1A 1ISNA 2I1JA 4DXAB 3D8DA 5EFXA 3PP2A 1RJ2A 5C5BA 1AQCA 2E2XA 4PNKA 4YL8A 1BTKA 2COFA 1EF1A 5D27A 1OMWA 1I2HA 2YF0A 2GS0A 2LOXA 4HB2B 1EVHA 2GCLA 2BCJA 1U5GA 3G9WA 5CLQB 4PQ0A 4BBKA 1TJ6A 2ELAA 5C79A 1PMSA 1LB1A 1SGHA 2D2QA 4HAUB 5CLLB 1FGZA 1Y19B 5KCVA 4HAYB 2EC1A 5DI9B 3QWMA 4Z2MB 5C5BB 1WJMA 2W2XC 5DHAB 2COAA 2I5CA 1KZGA 1OY2A 2LG1A 2DLWA 4A6FA 3MDBC 5J3QA 4F7UP 3A8QA 1WI1A 4MY6A 4XWXA 3KY9A 1W1GA 1ZVRA 4K2OA 2XQNM 4K81A 5DHFB 2HE7A 4WSFA 2IFSA 4GMVA 3A8PA 2K2JA 1EGXA 1FHWA 2MFQA 2K2UA 5D3YA 4F7GA 3PVWA 1U29A 2D9ZA 2DN6A 1NI2A 2DHJA 2RGNB 2RUKB 4A6KA 3M1IB 2Y8FA 4A6FB 5JHHA 2UZRA 1AWEA 3X23A
chains in the Genus database with same CATH superfamily
2CY4A 4YONA 2MKRA 1XD4A 2KIGA 2PZ1A 3HK0A 3F5RA 2CY5A 5KQ1A 1WGQA 4KHOA 1U27A 5HE3A 4QJ4B 4QXAB 3ML4A 2D11A 3PZDA 3CIKA 4D0NB 1U5FA 1ZSQA 1GC7A 4CHMA 4GMXB 2H7EA 4HAXB 1J0WA 2EMTA 4IAPA 1B55A 3T06A 5HE2A 2RRFA 4TYZA 2DHKA 3CXBB 2ADZA 2DTCA 2RLOA 4D6WA 2GJYA 1XKEA 2FJUB 2CODA 3NWAA 2YSZA 4WVFB 2D9XA 4K17A 2IYBA 2VKIA 2H7DA 1M7EA 1UNPA 5FI0A 2KR0A 4GZUA 2DHIA 1UNQA 1P6SA 4KAXB 2MDXA 3P6AA 3U8ZA 3SUZA 2Z59A 2W2WA 3U12A 1FHOA 2ROZB 1E5WA 2YVCA 4HSIA 3DCXA 1FAOA 3SNHA 4IOYX 3PVLA 1BAKA 2D9WA 3SYXA 3A98B 2K00A 2EJ8A 2OTXA 2Z4DA 4L1RA 5D3WA 1PLSA 2DYQA 1V89A 2LKOA 2RSGA 2M38A 4GN1A 2YT2A 3TW1A 3ODOA 3TVVA 2YRYA 1KI1B 1P5TA 2I1KA 2ZKMX 3ZVRA 1J19A 1UPRA 1I7AA 2DX5A 2Z0OA 4Y94A 2DYNA 3AJ4A 5FI1A 4CSQA 4NSWA 1QQGA 3NW8A 5HE1A 4H8SA 4EJNA 4TKNA 2D10A 2R0DA 5C6RA 5I2SA 4OSNA 2I5FA 3HSAA 1DDWA 1XX0A 1RRPB 2Q13A 4KHAA 4B6HA 3UZTA 1UPQA 1SHCA 2GUMA 5DH9B 1NU2A 2UZSA 1BWNA 2D4QA 3FM8C 2UVMA 4P7IA 1V88A 1ZC4B 3WA0A 1WGUA 2R2YA 3FSSA 3F0WA 3HQCA 3ZDTA 3V5WA 4QJ3B 4QJ5B 1U5EA 1NTYA 4HAWB 1MKEA 2QKLA 1XCGA 1UNRA 2QKMA 4HB4B 2RNRB 1MIZB 3NWFA 3KZ1A 3VIAA 2J0MA 1V5MA 3ODWA 1MK7B 2CRFA 4L6EA 3OHMB 1BTNA 1U5DA 3RCPA 1DBHA 1V61A 3LJUX 4ZRKA 1GC6A 2Y7BA 1QC6A 4MT7A 4HDOA 2ELBA 4K2PA 3TCAA 4HDQA 4DBBA 3U7DA 1DDVA 3KRXA 5M4YB 4KVGB 2VRWB 2P8VA 2KCJA 3ULBA 3P7ZA 2KIEA 3QBVB 1N3HA 2EMSA 2YS3A 2Z14A 5DIFB 2KUQA 2ROVA 3WYFB 2AEHA 3IVFA 3PG7A 1TXDA 2RVBB 5LG4B 3PEGA 4HAZB 5LOPB 1Y5OA 4EKUA 5D3VA 1MK9B 3DXEA 1DYNA 1FB8A 2OQBA 3ULCA 1H4RA 3SO6A 2DA0A 3AU5A 1FHXA 4MK0A 4C0AA 4HB0B 1H10A 2M14A 1W1HA 1M7RA 2YS1A 4KHBA 3FVCA 3TFMA 3MPXA 1MAIA 2DFKA 2D9YA 5D3XA 3NSUA 5JHGA 4EMOA 2LYDA 4GPTB 2AL6A 5JP4A 2J59M 2KGXB 4HB3B 2COCA 5J3YA 2LULA 3GYPA 1K5DB 1Q67A 1EAZA 4WJ7A 1T77A 5L81A 2DX1A 1X11A 1ZYIA 3GYOA 5LONB 1X1GA 2NMBA 2X18A 3PVUA 4NY0A 1ZC3B 4CYEA 2ZPYA 1P3RA 1MI1A 5J3TA 2JP2A 4Z2NA 1PFJA 1WG7A 2FJLA 3BINA 3FEHA 2GCJA 4KHBB 3BJIA 1XODA 1WJ1A 3HW2B 3N7CA 2Y8GA 1U2BA 1W1DA 1IRSA 1Z87A 4IFSA 5KQ4A 2LOZA 4OT1A 2G35A 2K8EA 3DXDA 1K5GB 1LW3A 2YT0A 2P0FA 1KZ7A 4HHVA 3O96A 2DKQA 1DROA 3QIJA 2Z0QA 3OANA 4HATB 3KSYA 4CHJA 1V5UA 1FGYA 1X05A 1X1FA 2D9VA 1NTVA 1OQNA 4HAVB 2R09A 1X86A 2J0KA 4F7HA 3PSCA 4DIXA 2Z0PA 2YS5A 2DKPA 5HE0A 3TO1A 1ZM0A 1TQZA 2CAYA 2KUPA 4A5KA 4DX8A 5GOWB 2Z13A 1WVHA 2J0JA 5C16A 2V76A 4GXBA 1XR0B 3DXCA 5JLJB 3D8EA 4A6HA 2MWNB 2W2XD 2HTHB 1V5PA 2YT1A 1GG3A 4DX90 2VSZA 2NZ8B 2P0HA 3ODXA 1FOEA 1MPHA 4ZRJA 1DDMA 2P0DA 1MIXA 3KRWA 2N23A 2L1CA 1UEFA 2N0YA 2L2IA 3VOQA 4ZRIA 3AU4A 4GNKB 3D8FA 3SV1A 1ISNA 2I1JA 4DXAB 3D8DA 5EFXA 3PP2A 1RJ2A 5C5BA 1AQCA 2E2XA 4PNKA 4YL8A 1BTKA 2COFA 1EF1A 5D27A 5IRSA 1OMWA 1I2HA 2YF0A 2GS0A 2LOXA 4HB2B 1EVHA 2GCLA 2BCJA 1U5GA 3G9WA 4GOUA 3HIEA 5CLQB 4PQ0A 4BBKA 1TJ6A 2ELAA 5C79A 1PMSA 1LB1A 2NBVA 1SGHA 2D2QA 3NWDA 4HAUB 5CLLB 1FGZA 1Y19B 5KCVA 4HAYB 2EC1A 5DI9B 3B77A 3QWMA 4Z2MB 5C5BB 1WJMA 2W2XC 5DHAB 2COAA 2I5CA 1KZGA 3A58A 1OY2A 2LG1A 2DLWA 4A6FA 3MDBC 5J3QA 4F7UP 3A8QA 1WI1A 4MY6A 4XWXA 3KY9A 1W1GA 1ZVRA 4K2OA 2XQNM 4K81A 5DHFB 2HE7A 4WSFA 2IFSA 4GMVA 2K49A 3A8PA 2K2JA 1EGXA 1FHWA 2MFQA 2K2UA 5D3YA 4F7GA 3PVWA 1U29A 2D9ZA 2DN6A 1NI2A 2DHJA 5I2MA 2RGNB 2RUKB 4A6KA 3M1IB 2Y8FA 4A6FB 5JHHA 2UZRA 1AWEA 3X23A
chains in the Genus database with same CATH topology
2CY4A 4YONA 2MKRA 1XD4A 2PZ1A 3HK0A 3F5RA 2CY5A 5KQ1A 1WGQA 4KHOA 1U27A 5HE3A 3ML4A 2D11A 3PZDA 3CIKA 4D0NB 1U5FA 1ZSQA 1GC7A 4CHMA 4GMXB 2H7EA 4HAXB 1J0WA 2EMTA 4IAPA 1B55A 3T06A 5HE2A 4TYZA 2DHKA 3CXBB 2ADZA 2DTCA 2RLOA 2GJYA 1XKEA 2CODA 2YSZA 4WVFB 2D9XA 4K17A 2IYBA 2VKIA 2H7DA 1M7EA 1UNPA 5FI0A 4GZUA 2DHIA 1UNQA 1P6SA 4KAXB 2MDXA 3P6AA 3U8ZA 3SUZA 2W2WA 1FHOA 2ROZB 1E5WA 2YVCA 1FAOA 3SNHA 4IOYX 3PVLA 1BAKA 2D9WA 3SYXA 3A98B 2K00A 2EJ8A 2OTXA 5D3WA 1PLSA 2DYQA 1V89A 2LKOA 2RSGA 2M38A 4GN1A 3TW1A 3ODOA 3TVVA 2YRYA 1KI1B 1P5TA 2I1KA 3ZVRA 1J19A 1UPRA 1I7AA 2DX5A 2Z0OA 4Y94A 2DYNA 3AJ4A 5FI1A 4NSWA 1QQGA 5HE1A 4H8SA 4EJNA 4TKNA 2D10A 2R0DA 5C6RA 2I5FA 1DDWA 1XX0A 1RRPB 2Q13A 4KHAA 4B6HA 3UZTA 1UPQA 1SHCA 5DH9B 1NU2A 2UZSA 1BWNA 2D4QA 3FM8C 2UVMA 4P7IA 1V88A 1ZC4B 3WA0A 1WGUA 3FSSA 3F0WA 3HQCA 3ZDTA 3V5WA 1U5EA 1NTYA 4HAWB 1MKEA 2QKLA 1XCGA 1UNRA 2QKMA 4HB4B 2RNRB 1MIZB 3VIAA 3KZ1A 2J0MA 1V5MA 3ODWA 1MK7B 2CRFA 4L6EA 1BTNA 1U5DA 3RCPA 1DBHA 1V61A 3LJUX 4ZRKA 1GC6A 2Y7BA 1QC6A 4MT7A 4HDOA 2ELBA 4K2PA 3TCAA 4HDQA 4DBBA 3U7DA 1DDVA 3KRXA 4KVGB 2VRWB 2P8VA 2KCJA 3ULBA 3P7ZA 3QBVB 1N3HA 2EMSA 2YS3A 5DIFB 2ROVA 3WYFB 2AEHA 3IVFA 3PG7A 1TXDA 2RVBB 3PEGA 4HAZB 5LOPB 1Y5OA 4EKUA 5D3VA 1MK9B 3DXEA 1DYNA 1FB8A 2OQBA 3ULCA 1H4RA 3SO6A 2DA0A 3AU5A 1FHXA 4MK0A 4C0AA 4HB0B 1H10A 2M14A 1W1HA 1M7RA 2YS1A 3TFMA 3MPXA 1MAIA 2DFKA 2D9YA 5D3XA 3NSUA 5JHGA 4EMOA 2LYDA 4GPTB 2AL6A 5JP4A 2J59M 2KGXB 4HB3B 2COCA 5J3YA 2LULA 3GYPA 1K5DB 1Q67A 1EAZA 4WJ7A 5L81A 2DX1A 1X11A 3GYOA 5LONB 1X1GA 2NMBA 2X18A 3PVUA 4NY0A 1ZC3B 4CYEA 2ZPYA 1P3RA 5J3TA 2JP2A 4Z2NA 1PFJA 1WG7A 2FJLA 3BINA 3FEHA 2GCJA 4KHBB 3BJIA 1XODA 1WJ1A 3HW2B 3N7CA 2Y8GA 1U2BA 1W1DA 1IRSA 1Z87A 4IFSA 5KQ4A 2LOZA 2G35A 3DXDA 1K5GB 1LW3A 2YT0A 2P0FA 1KZ7A 4HHVA 3O96A 2DKQA 1DROA 3QIJA 2Z0QA 3OANA 4HATB 3KSYA 4CHJA 1V5UA 1FGYA 1X05A 1X1FA 2D9VA 1NTVA 1OQNA 4HAVB 2R09A 1X86A 2J0KA 4F7HA 3PSCA 2Z0PA 2YS5A 2DKPA 5HE0A 3TO1A 1ZM0A 1TQZA 2CAYA 2KUPA 4A5KA 4DX8A 5GOWB 1WVHA 2J0JA 5C16A 2V76A 4GXBA 1XR0B 3DXCA 5JLJB 3D8EA 4A6HA 2MWNB 2W2XD 2HTHB 1V5PA 2YT1A 1GG3A 4DX90 2VSZA 2NZ8B 2P0HA 3ODXA 1FOEA 1MPHA 4ZRJA 1DDMA 2P0DA 1MIXA 3KRWA 2N23A 2L1CA 1UEFA 2N0YA 2L2IA 3VOQA 4ZRIA 3AU4A 3D8FA 3SV1A 1ISNA 2I1JA 4DXAB 3D8DA 5EFXA 3PP2A 1RJ2A 5C5BA 1AQCA 2E2XA 4PNKA 4YL8A 1BTKA 2COFA 1EF1A 5D27A 1OMWA 1I2HA 2YF0A 2GS0A 2LOXA 4HB2B 1EVHA 2GCLA 2BCJA 1U5GA 3G9WA 5CLQB 4PQ0A 4BBKA 1TJ6A 2ELAA 5C79A 1PMSA 1LB1A 1SGHA 2D2QA 4HAUB 5CLLB 1FGZA 1Y19B 5KCVA 4HAYB 2EC1A 5DI9B 3QWMA 4Z2MB 5C5BB 1WJMA 2W2XC 5DHAB 2COAA 2I5CA 1KZGA 1OY2A 2LG1A 2DLWA 4A6FA 3MDBC 5J3QA 4F7UP 3A8QA 1WI1A 4MY6A 4XWXA 3KY9A 1W1GA 1ZVRA 4K2OA 2XQNM 4K81A 5DHFB 2HE7A 4WSFA 2IFSA 4GMVA 3A8PA 2K2JA 1EGXA 1FHWA 2MFQA 2K2UA 5D3YA 4F7GA 3PVWA 1U29A 2D9ZA 2DN6A 1NI2A 2DHJA 2RGNB 2RUKB 4A6KA 3M1IB 2Y8FA 4A6FB 5JHHA 2UZRA 1AWEA 3X23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CY4 A;  4YON A;  2MKR A;  1XD4 A;  2PZ1 A;  3HK0 A;  3F5R A;  2CY5 A;  5KQ1 A;  1WGQ A;  4KHO A;  1U27 A;  5HE3 A;  3ML4 A;  2D11 A;  3PZD A;  3CIK A;  4D0N B;  1U5F A;  1ZSQ A;  1GC7 A;  4CHM A;  4GMX B;  2H7E A;  4HAX B;  1J0W A;  2EMT A;  4IAP A;  1B55 A;  3T06 A;  5HE2 A;  4TYZ A;  2DHK A;  3CXB B;  2ADZ A;  2DTC A;  2RLO A;  2GJY A;  1XKE A;  2COD A;  2YSZ A;  4WVF B;  2D9X A;  4K17 A;  2IYB A;  2VKI A;  2H7D A;  1M7E A;  1UNP A;  5FI0 A;  4GZU A;  2DHI A;  1UNQ A;  1P6S A;  4KAX B;  2MDX A;  3P6A A;  3U8Z A;  3SUZ A;  2W2W A;  1FHO A;  2ROZ B;  1E5W A;  2YVC A;  1FAO A;  3SNH A;  4IOY X;  3PVL A;  1BAK A;  2D9W A;  3SYX A;  3A98 B;  2K00 A;  2EJ8 A;  2OTX A;  5D3W A;  1PLS A;  2DYQ A;  1V89 A;  2LKO A;  2RSG A;  2M38 A;  4GN1 A;  3TW1 A;  3ODO A;  3TVV A;  2YRY A;  1KI1 B;  1P5T A;  2I1K A;  3ZVR A;  1J19 A;  1UPR A;  1I7A A;  2DX5 A;  2Z0O A;  4Y94 A;  2DYN A;  3AJ4 A;  5FI1 A;  4NSW A;  1QQG A;  5HE1 A;  4H8S A;  4EJN A;  4TKN A;  2D10 A;  2R0D A;  5C6R A;  2I5F A;  1DDW A;  1XX0 A;  1RRP B;  2Q13 A;  4KHA A;  4B6H A;  3UZT A;  1UPQ A;  1SHC A;  5DH9 B;  1NU2 A;  2UZS A;  1BWN A;  2D4Q A;  3FM8 C;  2UVM A;  4P7I A;  1V88 A;  1ZC4 B;  3WA0 A;  1WGU A;  3FSS A;  3F0W A;  3HQC A;  3ZDT A;  3V5W A;  1U5E A;  1NTY A;  4HAW B;  1MKE A;  2QKL A;  1XCG A;  1UNR A;  2QKM A;  4HB4 B;  2RNR B;  1MIZ B;  3VIA A;  3KZ1 A;  2J0M A;  1V5M A;  3ODW A;  1MK7 B;  2CRF A;  4L6E A;  1BTN A;  1U5D A;  3RCP A;  1DBH A;  1V61 A;  3LJU X;  4ZRK A;  1GC6 A;  2Y7B A;  1QC6 A;  4MT7 A;  4HDO A;  2ELB A;  4K2P A;  3TCA A;  4HDQ A;  4DBB A;  3U7D A;  1DDV A;  3KRX A;  4KVG B;  2VRW B;  2P8V A;  2KCJ A;  3ULB A;  3P7Z A;  3QBV B;  1N3H A;  2EMS A;  2YS3 A;  5DIF B;  2ROV A;  3WYF B;  2AEH A;  3IVF A;  3PG7 A;  1TXD A;  2RVB B;  3PEG A;  4HAZ B;  5LOP B;  1Y5O A;  4EKU A;  5D3V A;  1MK9 B;  3DXE A;  1DYN A;  1FB8 A;  2OQB A;  3ULC A;  1H4R A;  3SO6 A;  2DA0 A;  3AU5 A;  1FHX A;  4MK0 A;  4C0A A;  4HB0 B;  1H10 A;  2M14 A;  1W1H A;  1M7R A;  2YS1 A;  3TFM A;  3MPX A;  1MAI A;  2DFK A;  2D9Y A;  5D3X A;  3NSU A;  5JHG A;  4EMO A;  2LYD A;  4GPT B;  2AL6 A;  5JP4 A;  2J59 M;  2KGX B;  4HB3 B;  2COC A;  5J3Y A;  2LUL A;  3GYP A;  1K5D B;  1Q67 A;  1EAZ A;  4WJ7 A;  5L81 A;  2DX1 A;  1X11 A;  3GYO A;  5LON B;  1X1G A;  2NMB A;  2X18 A;  3PVU A;  4NY0 A;  1ZC3 B;  4CYE A;  2ZPY A;  1P3R A;  5J3T A;  2JP2 A;  4Z2N A;  1PFJ A;  1WG7 A;  2FJL A;  3BIN A;  3FEH A;  2GCJ A;  4KHB B;  3BJI A;  1XOD A;  1WJ1 A;  3HW2 B;  3N7C A;  2Y8G A;  1U2B A;  1W1D A;  1IRS A;  1Z87 A;  4IFS A;  5KQ4 A;  2LOZ A;  2G35 A;  3DXD A;  1K5G B;  1LW3 A;  2YT0 A;  2P0F A;  1KZ7 A;  4HHV A;  3O96 A;  2DKQ A;  1DRO A;  3QIJ A;  2Z0Q A;  3OAN A;  4HAT B;  3KSY A;  4CHJ A;  1V5U A;  1FGY A;  1X05 A;  1X1F A;  2D9V A;  1NTV A;  1OQN A;  4HAV B;  2R09 A;  1X86 A;  2J0K A;  4F7H A;  3PSC A;  2Z0P A;  2YS5 A;  2DKP A;  5HE0 A;  3TO1 A;  1ZM0 A;  1TQZ A;  2CAY A;  2KUP A;  4A5K A;  4DX8 A;  5GOW B;  1WVH A;  2J0J A;  5C16 A;  2V76 A;  4GXB A;  1XR0 B;  3DXC A;  5JLJ B;  3D8E A;  4A6H A;  2MWN B;  2W2X D;  2HTH B;  1V5P A;  2YT1 A;  1GG3 A;  4DX9 0;  2VSZ A;  2NZ8 B;  2P0H A;  3ODX A;  1FOE A;  1MPH A;  4ZRJ A;  1DDM A;  2P0D A;  1MIX A;  3KRW A;  2N23 A;  2L1C A;  1UEF A;  2N0Y A;  2L2I A;  3VOQ A;  4ZRI A;  3AU4 A;  3D8F A;  3SV1 A;  1ISN A;  2I1J A;  4DXA B;  3D8D A;  5EFX A;  3PP2 A;  1RJ2 A;  5C5B A;  1AQC A;  2E2X A;  4PNK A;  4YL8 A;  1BTK A;  2COF A;  1EF1 A;  5D27 A;  1OMW A;  1I2H A;  2YF0 A;  2GS0 A;  2LOX A;  4HB2 B;  1EVH A;  2GCL A;  2BCJ A;  1U5G A;  3G9W A;  5CLQ B;  4PQ0 A;  4BBK A;  1TJ6 A;  2ELA A;  5C79 A;  1PMS A;  1LB1 A;  1SGH A;  2D2Q A;  4HAU B;  5CLL B;  1FGZ A;  1Y19 B;  5KCV A;  4HAY B;  2EC1 A;  5DI9 B;  3QWM A;  4Z2M B;  5C5B B;  1WJM A;  2W2X C;  5DHA B;  2COA A;  2I5C A;  1KZG A;  1OY2 A;  2LG1 A;  2DLW A;  4A6F A;  3MDB C;  5J3Q A;  4F7U P;  3A8Q A;  1WI1 A;  4MY6 A;  4XWX A;  3KY9 A;  1W1G A;  1ZVR A;  4K2O A;  2XQN M;  4K81 A;  5DHF B;  2HE7 A;  4WSF A;  2IFS A;  4GMV A;  3A8P A;  2K2J A;  1EGX A;  1FHW A;  2MFQ A;  2K2U A;  5D3Y A;  4F7G A;  3PVW A;  1U29 A;  2D9Z A;  2DN6 A;  1NI2 A;  2DHJ A;  2RGN B;  2RUK B;  4A6K A;  3M1I B;  2Y8F A;  4A6F B;  5JHH A;  2UZR A;  1AWE A;  3X23 A; 
#chains in the Genus database with same CATH topology
 2CY4 A;  4YON A;  2MKR A;  1XD4 A;  2KIG A;  2PZ1 A;  3HK0 A;  3F5R A;  2CY5 A;  5KQ1 A;  1WGQ A;  4KHO A;  1U27 A;  5HE3 A;  4QJ4 B;  4QXA B;  3ML4 A;  2D11 A;  3PZD A;  3CIK A;  4D0N B;  1U5F A;  1ZSQ A;  1GC7 A;  4CHM A;  4GMX B;  2H7E A;  4HAX B;  1J0W A;  2EMT A;  4IAP A;  1B55 A;  3T06 A;  5HE2 A;  2RRF A;  4TYZ A;  2DHK A;  3CXB B;  2ADZ A;  2DTC A;  2RLO A;  4D6W A;  2GJY A;  1XKE A;  2FJU B;  2COD A;  3NWA A;  2YSZ A;  4WVF B;  2D9X A;  4K17 A;  2IYB A;  2VKI A;  2H7D A;  1M7E A;  1UNP A;  5FI0 A;  2KR0 A;  4GZU A;  2DHI A;  1UNQ A;  1P6S A;  4KAX B;  2MDX A;  3P6A A;  3U8Z A;  3SUZ A;  2Z59 A;  2W2W A;  3U12 A;  1FHO A;  2ROZ B;  1E5W A;  2YVC A;  4HSI A;  3DCX A;  1FAO A;  3SNH A;  4IOY X;  3PVL A;  1BAK A;  2D9W A;  3SYX A;  3A98 B;  2K00 A;  2EJ8 A;  2OTX A;  2Z4D A;  4L1R A;  5D3W A;  1PLS A;  2DYQ A;  1V89 A;  2LKO A;  2RSG A;  2M38 A;  4GN1 A;  2YT2 A;  3TW1 A;  3ODO A;  3TVV A;  2YRY A;  1KI1 B;  1P5T A;  2I1K A;  2ZKM X;  3ZVR A;  1J19 A;  1UPR A;  1I7A A;  2DX5 A;  2Z0O A;  4Y94 A;  2DYN A;  3AJ4 A;  5FI1 A;  4CSQ A;  4NSW A;  1QQG A;  3NW8 A;  5HE1 A;  4H8S A;  4EJN A;  4TKN A;  2D10 A;  2R0D A;  5C6R A;  5I2S A;  4OSN A;  2I5F A;  3HSA A;  1DDW A;  1XX0 A;  1RRP B;  2Q13 A;  4KHA A;  4B6H A;  3UZT A;  1UPQ A;  1SHC A;  2GUM A;  5DH9 B;  1NU2 A;  2UZS A;  1BWN A;  2D4Q A;  3FM8 C;  2UVM A;  4P7I A;  1V88 A;  1ZC4 B;  3WA0 A;  1WGU A;  2R2Y A;  3FSS A;  3F0W A;  3HQC A;  3ZDT A;  3V5W A;  4QJ3 B;  4QJ5 B;  1U5E A;  1NTY A;  4HAW B;  1MKE A;  2QKL A;  1XCG A;  1UNR A;  2QKM A;  4HB4 B;  2RNR B;  1MIZ B;  3NWF A;  3KZ1 A;  3VIA A;  2J0M A;  1V5M A;  3ODW A;  1MK7 B;  2CRF A;  4L6E A;  3OHM B;  1BTN A;  1U5D A;  3RCP A;  1DBH A;  1V61 A;  3LJU X;  4ZRK A;  1GC6 A;  2Y7B A;  1QC6 A;  4MT7 A;  4HDO A;  2ELB A;  4K2P A;  3TCA A;  4HDQ A;  4DBB A;  3U7D A;  1DDV A;  3KRX A;  5M4Y B;  4KVG B;  2VRW B;  2P8V A;  2KCJ A;  3ULB A;  3P7Z A;  2KIE A;  3QBV B;  1N3H A;  2EMS A;  2YS3 A;  2Z14 A;  5DIF B;  2KUQ A;  2ROV A;  3WYF B;  2AEH A;  3IVF A;  3PG7 A;  1TXD A;  2RVB B;  5LG4 B;  3PEG A;  4HAZ B;  5LOP B;  1Y5O A;  4EKU A;  5D3V A;  1MK9 B;  3DXE A;  1DYN A;  1FB8 A;  2OQB A;  3ULC A;  1H4R A;  3SO6 A;  2DA0 A;  3AU5 A;  1FHX A;  4MK0 A;  4C0A A;  4HB0 B;  1H10 A;  2M14 A;  1W1H A;  1M7R A;  2YS1 A;  4KHB A;  3FVC A;  3TFM A;  3MPX A;  1MAI A;  2DFK A;  2D9Y A;  5D3X A;  3NSU A;  5JHG A;  4EMO A;  2LYD A;  4GPT B;  2AL6 A;  5JP4 A;  2J59 M;  2KGX B;  4HB3 B;  2COC A;  5J3Y A;  2LUL A;  3GYP A;  1K5D B;  1Q67 A;  1EAZ A;  4WJ7 A;  1T77 A;  5L81 A;  2DX1 A;  1X11 A;  1ZYI A;  3GYO A;  5LON B;  1X1G A;  2NMB A;  2X18 A;  3PVU A;  4NY0 A;  1ZC3 B;  4CYE A;  2ZPY A;  1P3R A;  1MI1 A;  5J3T A;  2JP2 A;  4Z2N A;  1PFJ A;  1WG7 A;  2FJL A;  3BIN A;  3FEH A;  2GCJ A;  4KHB B;  3BJI A;  1XOD A;  1WJ1 A;  3HW2 B;  3N7C A;  2Y8G A;  1U2B A;  1W1D A;  1IRS A;  1Z87 A;  4IFS A;  5KQ4 A;  2LOZ A;  4OT1 A;  2G35 A;  2K8E A;  3DXD A;  1K5G B;  1LW3 A;  2YT0 A;  2P0F A;  1KZ7 A;  4HHV A;  3O96 A;  2DKQ A;  1DRO A;  3QIJ A;  2Z0Q A;  3OAN A;  4HAT B;  3KSY A;  4CHJ A;  1V5U A;  1FGY A;  1X05 A;  1X1F A;  2D9V A;  1NTV A;  1OQN A;  4HAV B;  2R09 A;  1X86 A;  2J0K A;  4F7H A;  3PSC A;  4DIX A;  2Z0P A;  2YS5 A;  2DKP A;  5HE0 A;  3TO1 A;  1ZM0 A;  1TQZ A;  2CAY A;  2KUP A;  4A5K A;  4DX8 A;  5GOW B;  2Z13 A;  1WVH A;  2J0J A;  5C16 A;  2V76 A;  4GXB A;  1XR0 B;  3DXC A;  5JLJ B;  3D8E A;  4A6H A;  2MWN B;  2W2X D;  2HTH B;  1V5P A;  2YT1 A;  1GG3 A;  4DX9 0;  2VSZ A;  2NZ8 B;  2P0H A;  3ODX A;  1FOE A;  1MPH A;  4ZRJ A;  1DDM A;  2P0D A;  1MIX A;  3KRW A;  2N23 A;  2L1C A;  1UEF A;  2N0Y A;  2L2I A;  3VOQ A;  4ZRI A;  3AU4 A;  4GNK B;  3D8F A;  3SV1 A;  1ISN A;  2I1J A;  4DXA B;  3D8D A;  5EFX A;  3PP2 A;  1RJ2 A;  5C5B A;  1AQC A;  2E2X A;  4PNK A;  4YL8 A;  1BTK A;  2COF A;  1EF1 A;  5D27 A;  5IRS A;  1OMW A;  1I2H A;  2YF0 A;  2GS0 A;  2LOX A;  4HB2 B;  1EVH A;  2GCL A;  2BCJ A;  1U5G A;  3G9W A;  4GOU A;  3HIE A;  5CLQ B;  4PQ0 A;  4BBK A;  1TJ6 A;  2ELA A;  5C79 A;  1PMS A;  1LB1 A;  2NBV A;  1SGH A;  2D2Q A;  3NWD A;  4HAU B;  5CLL B;  1FGZ A;  1Y19 B;  5KCV A;  4HAY B;  2EC1 A;  5DI9 B;  3B77 A;  3QWM A;  4Z2M B;  5C5B B;  1WJM A;  2W2X C;  5DHA B;  2COA A;  2I5C A;  1KZG A;  3A58 A;  1OY2 A;  2LG1 A;  2DLW A;  4A6F A;  3MDB C;  5J3Q A;  4F7U P;  3A8Q A;  1WI1 A;  4MY6 A;  4XWX A;  3KY9 A;  1W1G A;  1ZVR A;  4K2O A;  2XQN M;  4K81 A;  5DHF B;  2HE7 A;  4WSF A;  2IFS A;  4GMV A;  2K49 A;  3A8P A;  2K2J A;  1EGX A;  1FHW A;  2MFQ A;  2K2U A;  5D3Y A;  4F7G A;  3PVW A;  1U29 A;  2D9Z A;  2DN6 A;  1NI2 A;  2DHJ A;  5I2M A;  2RGN B;  2RUK B;  4A6K A;  3M1I B;  2Y8F A;  4A6F B;  5JHH A;  2UZR A;  1AWE A;  3X23 A; 
#chains in the Genus database with same CATH homology
 2CY4 A;  4YON A;  2MKR A;  1XD4 A;  2PZ1 A;  3HK0 A;  3F5R A;  2CY5 A;  5KQ1 A;  1WGQ A;  4KHO A;  1U27 A;  5HE3 A;  3ML4 A;  2D11 A;  3PZD A;  3CIK A;  4D0N B;  1U5F A;  1ZSQ A;  1GC7 A;  4CHM A;  4GMX B;  2H7E A;  4HAX B;  1J0W A;  2EMT A;  4IAP A;  1B55 A;  3T06 A;  5HE2 A;  4TYZ A;  2DHK A;  3CXB B;  2ADZ A;  2DTC A;  2RLO A;  2GJY A;  1XKE A;  2COD A;  2YSZ A;  4WVF B;  2D9X A;  4K17 A;  2IYB A;  2VKI A;  2H7D A;  1M7E A;  1UNP A;  5FI0 A;  4GZU A;  2DHI A;  1UNQ A;  1P6S A;  4KAX B;  2MDX A;  3P6A A;  3U8Z A;  3SUZ A;  2W2W A;  1FHO A;  2ROZ B;  1E5W A;  2YVC A;  1FAO A;  3SNH A;  4IOY X;  3PVL A;  1BAK A;  2D9W A;  3SYX A;  3A98 B;  2K00 A;  2EJ8 A;  2OTX A;  5D3W A;  1PLS A;  2DYQ A;  1V89 A;  2LKO A;  2RSG A;  2M38 A;  4GN1 A;  3TW1 A;  3ODO A;  3TVV A;  2YRY A;  1KI1 B;  1P5T A;  2I1K A;  3ZVR A;  1J19 A;  1UPR A;  1I7A A;  2DX5 A;  2Z0O A;  4Y94 A;  2DYN A;  3AJ4 A;  5FI1 A;  4NSW A;  1QQG A;  5HE1 A;  4H8S A;  4EJN A;  4TKN A;  2D10 A;  2R0D A;  5C6R A;  2I5F A;  1DDW A;  1XX0 A;  1RRP B;  2Q13 A;  4KHA A;  4B6H A;  3UZT A;  1UPQ A;  1SHC A;  5DH9 B;  1NU2 A;  2UZS A;  1BWN A;  2D4Q A;  3FM8 C;  2UVM A;  4P7I A;  1V88 A;  1ZC4 B;  3WA0 A;  1WGU A;  3FSS A;  3F0W A;  3HQC A;  3ZDT A;  3V5W A;  1U5E A;  1NTY A;  4HAW B;  1MKE A;  2QKL A;  1XCG A;  1UNR A;  2QKM A;  4HB4 B;  2RNR B;  1MIZ B;  3VIA A;  3KZ1 A;  2J0M A;  1V5M A;  3ODW A;  1MK7 B;  2CRF A;  4L6E A;  1BTN A;  1U5D A;  3RCP A;  1DBH A;  1V61 A;  3LJU X;  4ZRK A;  1GC6 A;  2Y7B A;  1QC6 A;  4MT7 A;  4HDO A;  2ELB A;  4K2P A;  3TCA A;  4HDQ A;  4DBB A;  3U7D A;  1DDV A;  3KRX A;  4KVG B;  2VRW B;  2P8V A;  2KCJ A;  3ULB A;  3P7Z A;  3QBV B;  1N3H A;  2EMS A;  2YS3 A;  5DIF B;  2ROV A;  3WYF B;  2AEH A;  3IVF A;  3PG7 A;  1TXD A;  2RVB B;  3PEG A;  4HAZ B;  5LOP B;  1Y5O A;  4EKU A;  5D3V A;  1MK9 B;  3DXE A;  1DYN A;  1FB8 A;  2OQB A;  3ULC A;  1H4R A;  3SO6 A;  2DA0 A;  3AU5 A;  1FHX A;  4MK0 A;  4C0A A;  4HB0 B;  1H10 A;  2M14 A;  1W1H A;  1M7R A;  2YS1 A;  3TFM A;  3MPX A;  1MAI A;  2DFK A;  2D9Y A;  5D3X A;  3NSU A;  5JHG A;  4EMO A;  2LYD A;  4GPT B;  2AL6 A;  5JP4 A;  2J59 M;  2KGX B;  4HB3 B;  2COC A;  5J3Y A;  2LUL A;  3GYP A;  1K5D B;  1Q67 A;  1EAZ A;  4WJ7 A;  5L81 A;  2DX1 A;  1X11 A;  3GYO A;  5LON B;  1X1G A;  2NMB A;  2X18 A;  3PVU A;  4NY0 A;  1ZC3 B;  4CYE A;  2ZPY A;  1P3R A;  5J3T A;  2JP2 A;  4Z2N A;  1PFJ A;  1WG7 A;  2FJL A;  3BIN A;  3FEH A;  2GCJ A;  4KHB B;  3BJI A;  1XOD A;  1WJ1 A;  3HW2 B;  3N7C A;  2Y8G A;  1U2B A;  1W1D A;  1IRS A;  1Z87 A;  4IFS A;  5KQ4 A;  2LOZ A;  2G35 A;  3DXD A;  1K5G B;  1LW3 A;  2YT0 A;  2P0F A;  1KZ7 A;  4HHV A;  3O96 A;  2DKQ A;  1DRO A;  3QIJ A;  2Z0Q A;  3OAN A;  4HAT B;  3KSY A;  4CHJ A;  1V5U A;  1FGY A;  1X05 A;  1X1F A;  2D9V A;  1NTV A;  1OQN A;  4HAV B;  2R09 A;  1X86 A;  2J0K A;  4F7H A;  3PSC A;  2Z0P A;  2YS5 A;  2DKP A;  5HE0 A;  3TO1 A;  1ZM0 A;  1TQZ A;  2CAY A;  2KUP A;  4A5K A;  4DX8 A;  5GOW B;  1WVH A;  2J0J A;  5C16 A;  2V76 A;  4GXB A;  1XR0 B;  3DXC A;  5JLJ B;  3D8E A;  4A6H A;  2MWN B;  2W2X D;  2HTH B;  1V5P A;  2YT1 A;  1GG3 A;  4DX9 0;  2VSZ A;  2NZ8 B;  2P0H A;  3ODX A;  1FOE A;  1MPH A;  4ZRJ A;  1DDM A;  2P0D A;  1MIX A;  3KRW A;  2N23 A;  2L1C A;  1UEF A;  2N0Y A;  2L2I A;  3VOQ A;  4ZRI A;  3AU4 A;  3D8F A;  3SV1 A;  1ISN A;  2I1J A;  4DXA B;  3D8D A;  5EFX A;  3PP2 A;  1RJ2 A;  5C5B A;  1AQC A;  2E2X A;  4PNK A;  4YL8 A;  1BTK A;  2COF A;  1EF1 A;  5D27 A;  1OMW A;  1I2H A;  2YF0 A;  2GS0 A;  2LOX A;  4HB2 B;  1EVH A;  2GCL A;  2BCJ A;  1U5G A;  3G9W A;  5CLQ B;  4PQ0 A;  4BBK A;  1TJ6 A;  2ELA A;  5C79 A;  1PMS A;  1LB1 A;  1SGH A;  2D2Q A;  4HAU B;  5CLL B;  1FGZ A;  1Y19 B;  5KCV A;  4HAY B;  2EC1 A;  5DI9 B;  3QWM A;  4Z2M B;  5C5B B;  1WJM A;  2W2X C;  5DHA B;  2COA A;  2I5C A;  1KZG A;  1OY2 A;  2LG1 A;  2DLW A;  4A6F A;  3MDB C;  5J3Q A;  4F7U P;  3A8Q A;  1WI1 A;  4MY6 A;  4XWX A;  3KY9 A;  1W1G A;  1ZVR A;  4K2O A;  2XQN M;  4K81 A;  5DHF B;  2HE7 A;  4WSF A;  2IFS A;  4GMV A;  3A8P A;  2K2J A;  1EGX A;  1FHW A;  2MFQ A;  2K2U A;  5D3Y A;  4F7G A;  3PVW A;  1U29 A;  2D9Z A;  2DN6 A;  1NI2 A;  2DHJ A;  2RGN B;  2RUK B;  4A6K A;  3M1I B;  2Y8F A;  4A6F B;  5JHH A;  2UZR A;  1AWE A;  3X23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...