3A8QA

Low-resolution crystal structure of the tiam2 phccex domain
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
239
structure length
231
Chain Sequence
b'VVRKAGWLFFKPLVTLQKERKLELVARRKWKQYWVTLKGCTLLFYETYSAPRCALFAEDSIVQSVPEHPKKEHVFCLSNSCGDVYLFQATSQTDLENWVTAIHSACASLFAKKHGKEDTVRLLKSQTRSLLQKIDMDSKMKKMAELQLSVVSDPKNRKAIENQIRQWEQNLEKFHMDLFRMRCYLASLQGGELPNPKSLLAATSRPSKLALGRLGVLSVSSFHALVCSRDD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords T-lymphoma invasion and metastasis-inducing protein 2
molecule tags Signaling protein
source organism Mus musculus
publication title The PHCCEx domain of Tiam1/2 is a novel protein- and membrane-binding module
pubmed doi rcsb
total genus 70
structure length 231
sequence length 239
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF18385 Tiam_CC_Ex T-lymphoma invasion and metastasis CC-Ex domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3a8qA01
1W1GA 1NTYA 1V5PA 5D27A 2GCLA 1U29A 4EKUA 1MAIA 1DROA 1V5MA 4C0AA 2CODA 4K81A 2DLWA 2L2IA 2Y8GA 1EGXA 5C5BA 2H7EA 2RSGA 1KZ7A 1RRPB 2RLOA 3ZVRA 5D3XA 4KHAA 1ZSQA 2YT0A 2W2XC 2I5CA 2Y7BA 4HAWB 1X05A 3QWMA 3P7ZA 4CYEA 4EJNA 5DH9B 3AU4A 1WGQA 4MT7A 3TW1A 1MPHA 5JHGA 3M1IB 1PMSA 1UNPA 3DXDA 3A8PA 1I2HA 1XODA 3FEHA 4GXBA 1FOEA 2D9YA 3PVLA 4PNKA 4GZUA 2D9VA 1FHWA 3SV1A 2LYDA 4DBBA 2D9ZA 2YRYA 2YS3A 5HE1A 2XQNM 2Y8FA 1ZC3B 3GYOA 4IAPA 5DHAB 4ZRKA 4DXAB 1WGUA 2YSZA 3A98B 4GMXB 5HE2A 3O96A 2N0YA 2K00A 2L1CA 5HE0A 4MK0A 1QQGA 2DHIA 1ZC4B 3HW2B 2ROZB 1ISNA 2D9XA 2H7DA 1ZM0A 2R0DA 4HDQA 1I7AA 2MKRA 1P6SA 2DYNA 5C16A 1WJ1A 3WA0A 1EAZA 2RNRB 4K2OA 4TYZA 1V61A 3QIJA 3AJ4A 2Z0QA 2X18A 2QKLA 1U5GA 2M14A 5D3WA 2I1JA 1KZGA 2COAA 2DYQA 3FM8C 1X11A 3VOQA 4IFSA 2LOZA 1FGYA 1AQCA 2YS1A 4F7HA 3IVFA 3KSYA 4HB4B 3D8DA 5FI1A 3KRXA 4B6HA 3G9WA 2N23A 1SGHA 3N7CA 3P6AA 3ULCA 1U2BA 5CLQB 2J0JA 4NSWA 3GYPA 2QKMA 1X1GA 5C79A 1K5DB 2ELBA 1DBHA 5KCVA 2D11A 2LOXA 1H10A 2K2UA 3V5WA 2V76A 3KZ1A 4Y94A 1XR0B 1OMWA 2VRWB 5D3YA 1V89A 4GPTB 2UVMA 2GJYA 1GC7A 3CXBB 3HK0A 2NZ8B 2Q13A 4HB3B 1W1HA 1M7EA 2MDXA 4ZRIA 2P0FA 2I5FA 1U5EA 2DA0A 5DHFB 1AWEA 2P8VA 3WYFB 3T06A 1Z87A 2CY4A 5J3QA 3AU5A 1XD4A 4P7IA 4CHJA 4HAZB 1SHCA 1UNQA 3BJIA 3ZDTA 3MDBC 2COCA 1FHOA 5JHHA 2P0DA 2J0KA 2DX1A 1XKEA 2M38A 1DYNA 2LKOA 1LB1A 4GN1A 1U5DA 2MWNB 3ULBA 5LOPB 3SNHA 2IFSA 4WJ7A 5DIFB 1Y19B 5EFXA 1X86A 4Z2NA 5KQ1A 1N3HA 2DFKA 2J59M 1BTKA 2IYBA 3HQCA 2KUPA 3DXEA 4TKNA 5JLJB 1J0WA 1DDMA 5GOWB 3DXCA 4MY6A 2HE7A 4A6FA 1MIXA 2EC1A 1WVHA 3U7DA 2I1KA 5LONB 5C6RA 1U5FA 4XWXA 2R09A 2BCJA 2D9WA 1LW3A 4F7GA 2LG1A 3ODOA 1WG7A 3TCAA 1MKEA 2W2XD 2ADZA 3MPXA 5CLLB 1W1DA 4KVGB 1GG3A 1OY2A 3PG7A 3SYXA 4WVFB 1WJMA 2ZPYA 3A8QA 2KCJA 1FB8A 1K5GB 4H8SA 1XX0A 5FI0A 3FSSA 1UNRA 3CIKA 3KRWA 5D3VA 2DHJA 3NSUA 4HHVA 3LJUX 1U27A 1EVHA 2NMBA 2EMTA 1DDWA 2FJLA 2MFQA 1IRSA 2ROVA 1H4RA 2EMSA 1BTNA 4HAVB 2RGNB 2AEHA 3KY9A 1XCGA 1Q67A 3TFMA 5J3TA 3X23A 4HAUB 3VIAA 2YS5A 1BAKA 2JP2A 2D10A 3F5RA 4DX90 3BINA 3SUZA 3ML4A 2HTHB 3ODXA 2D4QA 3ODWA 5L81A 1B55A 4CHMA 3QBVB 4PQ0A 3OANA 4A6KA 2E2XA 2OQBA 1KI1B 1M7RA 1ZVRA 4IOYX 3PP2A 1PLSA 4HDOA 1FGZA 4NY0A 1V5UA 5J3YA 2DX5A 2Z0OA 3D8EA 1UPRA 2LULA 1TXDA 3UZTA 3PZDA 1OQNA 2J0MA 3RCPA 4D0NB 2D2QA 4HB2B 2DKQA 2DN6A 1E5WA 2ELAA 3PEGA 2G35A 2OTXA 4L6EA 4ZRJA 2YVCA 2COFA 4KHOA 4A5KA 3PSCA 2EJ8A 5JP4A 4YONA 2CY5A 2RVBB 1FHXA 2KGXB 4HATB 1GC6A 4BBKA 5DI9B 4HB0B 3TVVA 1NU2A 1DDVA 4EMOA 1MK7B 1P3RA 3PVWA 5HE3A 5KQ4A 4Z2MB 4YL8A 4DX8A 1P5TA 1BWNA 2YT1A 1J19A 1Y5OA 3TO1A 3D8FA 4GMVA 2P0HA 4HAYB 2Z0PA 1NTVA 3PVUA 1PFJA 1TQZA 2GS0A 1NI2A 1EF1A 1TJ6A 1UPQA 4A6FB 1FAOA 1MIZB 3SO6A 2DHKA 2UZSA 2YF0A 5C5BB 1V88A 4K17A 2CAYA 2W2WA 2DTCA 3F0WA 2DKPA 2PZ1A 4KAXB 2UZRA 1QC6A 1X1FA 2CRFA 4HAXB 4F7UP 2K2JA 4WSFA 1RJ2A 1WI1A 2VKIA 2RUKB 4KHBB 2GCJA 1MK9B 1UEFA 4A6HA 4K2PA 3U8ZA 2VSZA 2AL6A
chains in the Genus database with same CATH superfamily
1W1GA 1NTYA 1V5PA 5D27A 2GCLA 1U29A 4EKUA 1MAIA 1DROA 1V5MA 4C0AA 2CODA 4K81A 2DLWA 2L2IA 2Y8GA 1EGXA 5C5BA 2H7EA 2RSGA 1KZ7A 1RRPB 2RLOA 3ZVRA 5D3XA 4KHAA 1ZSQA 2YT0A 2W2XC 2I5CA 2Y7BA 4HAWB 1X05A 3QWMA 4OSNA 3P7ZA 4CYEA 4EJNA 5DH9B 3AU4A 1WGQA 4MT7A 3TW1A 1MPHA 5JHGA 3A58A 3M1IB 1PMSA 1UNPA 3DXDA 3A8PA 1I2HA 1XODA 3FEHA 4GXBA 1FOEA 2D9YA 3PVLA 4PNKA 4GZUA 2D9VA 1FHWA 3SV1A 2LYDA 4DBBA 2D9ZA 2YRYA 2YS3A 5HE1A 2GUMA 2XQNM 2Y8FA 1ZC3B 3GYOA 4IAPA 5DHAB 4ZRKA 4DXAB 1WGUA 2YSZA 4QJ5B 3A98B 4GMXB 5HE2A 3O96A 2N0YA 2K00A 2L1CA 5HE0A 4MK0A 1QQGA 2DHIA 1ZC4B 3HW2B 2ROZB 1ISNA 2D9XA 5IRSA 2H7DA 1ZM0A 2R0DA 4HDQA 1I7AA 2MKRA 1P6SA 2DYNA 5C16A 1WJ1A 3WA0A 1EAZA 2KUQA 2RNRB 4K2OA 4TYZA 1V61A 3QIJA 3AJ4A 2Z0QA 2X18A 2QKLA 1U5GA 2M14A 5D3WA 2I1JA 1KZGA 2COAA 2DYQA 3FM8C 1X11A 3VOQA 4IFSA 2LOZA 1FGYA 1AQCA 2YS1A 4F7HA 3IVFA 3KSYA 4HB4B 3D8DA 5FI1A 3KRXA 4B6HA 2K49A 3G9WA 2N23A 1SGHA 3N7CA 3P6AA 3ULCA 4DIXA 1U2BA 5CLQB 2J0JA 4NSWA 3GYPA 2QKMA 1X1GA 5C79A 1K5DB 2ELBA 1DBHA 2Z14A 2D11A 5KCVA 2LOXA 1H10A 2K2UA 3V5WA 2V76A 3NW8A 3KZ1A 4Y94A 1XR0B 1OMWA 1ZYIA 2VRWB 5D3YA 2KIGA 1V89A 4GPTB 2UVMA 2GJYA 1GC7A 3CXBB 4KHBA 3HK0A 2NZ8B 2Q13A 4HB3B 1W1HA 5M4YB 1M7EA 2MDXA 4HSIA 4ZRIA 2P0FA 2I5FA 1U5EA 2DA0A 5DHFB 1AWEA 2P8VA 2Z4DA 3WYFB 3T06A 1Z87A 2CY4A 5J3QA 3AU5A 1XD4A 4P7IA 4CHJA 4HAZB 1SHCA 1UNQA 2FJUB 3BJIA 3ZDTA 3MDBC 2COCA 1FHOA 4GNKB 5JHHA 2P0DA 2J0KA 2DX1A 1XKEA 2M38A 1DYNA 2LKOA 1LB1A 4GN1A 1U5DA 2MWNB 3ULBA 5LOPB 5LG4B 3SNHA 2IFSA 4WJ7A 5DIFB 1Y19B 5EFXA 1X86A 4Z2NA 5KQ1A 1N3HA 2DFKA 2J59M 1BTKA 2IYBA 3HQCA 2KUPA 3DXEA 3OHMB 4TKNA 5JLJB 1J0WA 1DDMA 5GOWB 3DXCA 4MY6A 2HE7A 5I2SA 4A6FA 1MIXA 2EC1A 1WVHA 3U7DA 2I1KA 5LONB 5C6RA 1U5FA 2ZKMX 4XWXA 2R09A 2BCJA 2D9WA 3NWAA 1LW3A 4F7GA 2LG1A 3ODOA 1WG7A 3TCAA 1MI1A 1MKEA 2W2XD 2ADZA 3MPXA 5CLLB 1W1DA 4QXAB 2Z59A 4KVGB 3NWDA 1GG3A 1OY2A 2YT2A 3PG7A 3SYXA 4WVFB 1WJMA 2ZPYA 3A8QA 3FVCA 2KCJA 1FB8A 1K5GB 4H8SA 1XX0A 5FI0A 3FSSA 1UNRA 3CIKA 3KRWA 5D3VA 2DHJA 2K8EA 3NSUA 4HHVA 3LJUX 2R2YA 1U27A 1EVHA 2NMBA 2EMTA 1DDWA 2FJLA 2MFQA 1IRSA 2ROVA 1H4RA 2EMSA 1BTNA 4HAVB 2RGNB 2AEHA 3KY9A 1XCGA 4QJ3B 1Q67A 3TFMA 2KR0A 5J3TA 3X23A 4HAUB 3VIAA 2YS5A 1BAKA 2JP2A 2D10A 2RRFA 3F5RA 4DX90 3BINA 3SUZA 3ML4A 2HTHB 3ODXA 2D4QA 3HIEA 3ODWA 5L81A 1B55A 4CHMA 3QBVB 4PQ0A 3OANA 3NWFA 4A6KA 2E2XA 2OQBA 1KI1B 1M7RA 1ZVRA 4IOYX 4CSQA 3PP2A 1PLSA 4HDOA 1FGZA 4NY0A 1V5UA 5J3YA 2DX5A 3U12A 2Z0OA 3D8EA 1UPRA 2LULA 1TXDA 3UZTA 5I2MA 3PZDA 1OQNA 2J0MA 4D6WA 3RCPA 4D0NB 2D2QA 4HB2B 2DKQA 2DN6A 1E5WA 4QJ4B 2ELAA 3PEGA 2G35A 2OTXA 4L6EA 4ZRJA 2YVCA 2COFA 4KHOA 4A5KA 3PSCA 2EJ8A 5JP4A 4YONA 2CY5A 2RVBB 1FHXA 2KIEA 2KGXB 4HATB 1GC6A 4BBKA 5DI9B 4HB0B 3TVVA 1NU2A 1DDVA 4EMOA 4L1RA 1MK7B 1P3RA 3PVWA 5HE3A 5KQ4A 4Z2MB 4YL8A 2NBVA 4DX8A 2Z13A 1P5TA 1BWNA 2YT1A 3DCXA 3B77A 1J19A 1Y5OA 3TO1A 3D8FA 4GMVA 3HSAA 2P0HA 4HAYB 2Z0PA 1NTVA 3PVUA 1PFJA 1T77A 1TQZA 2GS0A 1NI2A 1EF1A 1TJ6A 1UPQA 4A6FB 1FAOA 1MIZB 3SO6A 2DHKA 2UZSA 2YF0A 5C5BB 1V88A 4GOUA 4K17A 2CAYA 2W2WA 2DTCA 3F0WA 2DKPA 2PZ1A 4KAXB 2UZRA 1QC6A 1X1FA 2CRFA 4HAXB 4F7UP 2K2JA 4WSFA 1RJ2A 1WI1A 2VKIA 2RUKB 4OT1A 4KHBB 2GCJA 1MK9B 1UEFA 4A6HA 4K2PA 3U8ZA 2VSZA 2AL6A
chains in the Genus database with same CATH topology
1W1GA 1NTYA 1V5PA 5D27A 2GCLA 1U29A 4EKUA 1MAIA 1DROA 1V5MA 4C0AA 2CODA 4K81A 2DLWA 2L2IA 2Y8GA 1EGXA 5C5BA 2H7EA 2RSGA 1KZ7A 1RRPB 2RLOA 3ZVRA 5D3XA 4KHAA 1ZSQA 2YT0A 2W2XC 2I5CA 2Y7BA 4HAWB 1X05A 3QWMA 3P7ZA 4CYEA 4EJNA 5DH9B 3AU4A 1WGQA 4MT7A 3TW1A 1MPHA 5JHGA 3M1IB 1PMSA 1UNPA 3DXDA 3A8PA 1I2HA 1XODA 3FEHA 4GXBA 1FOEA 2D9YA 3PVLA 4PNKA 4GZUA 2D9VA 1FHWA 3SV1A 2LYDA 4DBBA 2D9ZA 2YRYA 2YS3A 5HE1A 2XQNM 2Y8FA 1ZC3B 3GYOA 4IAPA 5DHAB 4ZRKA 4DXAB 1WGUA 2YSZA 3A98B 4GMXB 5HE2A 3O96A 2N0YA 2K00A 2L1CA 5HE0A 4MK0A 1QQGA 2DHIA 1ZC4B 3HW2B 2ROZB 1ISNA 2D9XA 2H7DA 1ZM0A 2R0DA 4HDQA 1I7AA 2MKRA 1P6SA 2DYNA 5C16A 1WJ1A 3WA0A 1EAZA 2RNRB 4K2OA 4TYZA 1V61A 3QIJA 3AJ4A 2Z0QA 2X18A 2QKLA 1U5GA 2M14A 5D3WA 2I1JA 1KZGA 2COAA 2DYQA 3FM8C 1X11A 3VOQA 4IFSA 2LOZA 1FGYA 1AQCA 2YS1A 4F7HA 3IVFA 3KSYA 4HB4B 3D8DA 5FI1A 3KRXA 4B6HA 3G9WA 2N23A 1SGHA 3N7CA 3P6AA 3ULCA 1U2BA 5CLQB 2J0JA 4NSWA 3GYPA 2QKMA 1X1GA 5C79A 1K5DB 2ELBA 1DBHA 5KCVA 2D11A 2LOXA 1H10A 2K2UA 3V5WA 2V76A 3KZ1A 4Y94A 1XR0B 1OMWA 2VRWB 5D3YA 1V89A 4GPTB 2UVMA 2GJYA 1GC7A 3CXBB 3HK0A 2NZ8B 2Q13A 4HB3B 1W1HA 1M7EA 2MDXA 4ZRIA 2P0FA 2I5FA 1U5EA 2DA0A 5DHFB 1AWEA 2P8VA 3WYFB 3T06A 1Z87A 2CY4A 5J3QA 3AU5A 1XD4A 4P7IA 4CHJA 4HAZB 1SHCA 1UNQA 3BJIA 3ZDTA 3MDBC 2COCA 1FHOA 5JHHA 2P0DA 2J0KA 2DX1A 1XKEA 2M38A 1DYNA 2LKOA 1LB1A 4GN1A 1U5DA 2MWNB 3ULBA 5LOPB 3SNHA 2IFSA 4WJ7A 5DIFB 1Y19B 5EFXA 1X86A 4Z2NA 5KQ1A 1N3HA 2DFKA 2J59M 1BTKA 2IYBA 3HQCA 2KUPA 3DXEA 4TKNA 5JLJB 1J0WA 1DDMA 5GOWB 3DXCA 4MY6A 2HE7A 4A6FA 1MIXA 2EC1A 1WVHA 3U7DA 2I1KA 5LONB 5C6RA 1U5FA 4XWXA 2R09A 2BCJA 2D9WA 1LW3A 4F7GA 2LG1A 3ODOA 1WG7A 3TCAA 1MKEA 2W2XD 2ADZA 3MPXA 5CLLB 1W1DA 4KVGB 1GG3A 1OY2A 3PG7A 3SYXA 4WVFB 1WJMA 2ZPYA 3A8QA 2KCJA 1FB8A 1K5GB 4H8SA 1XX0A 5FI0A 3FSSA 1UNRA 3CIKA 3KRWA 5D3VA 2DHJA 3NSUA 4HHVA 3LJUX 1U27A 1EVHA 2NMBA 2EMTA 1DDWA 2FJLA 2MFQA 1IRSA 2ROVA 1H4RA 2EMSA 1BTNA 4HAVB 2RGNB 2AEHA 3KY9A 1XCGA 1Q67A 3TFMA 5J3TA 3X23A 4HAUB 3VIAA 2YS5A 1BAKA 2JP2A 2D10A 3F5RA 4DX90 3BINA 3SUZA 3ML4A 2HTHB 3ODXA 2D4QA 3ODWA 5L81A 1B55A 4CHMA 3QBVB 4PQ0A 3OANA 4A6KA 2E2XA 2OQBA 1KI1B 1M7RA 1ZVRA 4IOYX 3PP2A 1PLSA 4HDOA 1FGZA 4NY0A 1V5UA 5J3YA 2DX5A 2Z0OA 3D8EA 1UPRA 2LULA 1TXDA 3UZTA 3PZDA 1OQNA 2J0MA 3RCPA 4D0NB 2D2QA 4HB2B 2DKQA 2DN6A 1E5WA 2ELAA 3PEGA 2G35A 2OTXA 4L6EA 4ZRJA 2YVCA 2COFA 4KHOA 4A5KA 3PSCA 2EJ8A 5JP4A 4YONA 2CY5A 2RVBB 1FHXA 2KGXB 4HATB 1GC6A 4BBKA 5DI9B 4HB0B 3TVVA 1NU2A 1DDVA 4EMOA 1MK7B 1P3RA 3PVWA 5HE3A 5KQ4A 4Z2MB 4YL8A 4DX8A 1P5TA 1BWNA 2YT1A 1J19A 1Y5OA 3TO1A 3D8FA 4GMVA 2P0HA 4HAYB 2Z0PA 1NTVA 3PVUA 1PFJA 1TQZA 2GS0A 1NI2A 1EF1A 1TJ6A 1UPQA 4A6FB 1FAOA 1MIZB 3SO6A 2DHKA 2UZSA 2YF0A 5C5BB 1V88A 4K17A 2CAYA 2W2WA 2DTCA 3F0WA 2DKPA 2PZ1A 4KAXB 2UZRA 1QC6A 1X1FA 2CRFA 4HAXB 4F7UP 2K2JA 4WSFA 1RJ2A 1WI1A 2VKIA 2RUKB 4KHBB 2GCJA 1MK9B 1UEFA 4A6HA 4K2PA 3U8ZA 2VSZA 2AL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W1G A;  1NTY A;  1V5P A;  5D27 A;  2GCL A;  1U29 A;  4EKU A;  1MAI A;  1DRO A;  1V5M A;  4C0A A;  2COD A;  4K81 A;  2DLW A;  2L2I A;  2Y8G A;  1EGX A;  5C5B A;  2H7E A;  2RSG A;  1KZ7 A;  1RRP B;  2RLO A;  3ZVR A;  5D3X A;  4KHA A;  1ZSQ A;  2YT0 A;  2W2X C;  2I5C A;  2Y7B A;  4HAW B;  1X05 A;  3QWM A;  3P7Z A;  4CYE A;  4EJN A;  5DH9 B;  3AU4 A;  1WGQ A;  4MT7 A;  3TW1 A;  1MPH A;  5JHG A;  3M1I B;  1PMS A;  1UNP A;  3DXD A;  3A8P A;  1I2H A;  1XOD A;  3FEH A;  4GXB A;  1FOE A;  2D9Y A;  3PVL A;  4PNK A;  4GZU A;  2D9V A;  1FHW A;  3SV1 A;  2LYD A;  4DBB A;  2D9Z A;  2YRY A;  2YS3 A;  5HE1 A;  2XQN M;  2Y8F A;  1ZC3 B;  3GYO A;  4IAP A;  5DHA B;  4ZRK A;  4DXA B;  1WGU A;  2YSZ A;  3A98 B;  4GMX B;  5HE2 A;  3O96 A;  2N0Y A;  2K00 A;  2L1C A;  5HE0 A;  4MK0 A;  1QQG A;  2DHI A;  1ZC4 B;  3HW2 B;  2ROZ B;  1ISN A;  2D9X A;  2H7D A;  1ZM0 A;  2R0D A;  4HDQ A;  1I7A A;  2MKR A;  1P6S A;  2DYN A;  5C16 A;  1WJ1 A;  3WA0 A;  1EAZ A;  2RNR B;  4K2O A;  4TYZ A;  1V61 A;  3QIJ A;  3AJ4 A;  2Z0Q A;  2X18 A;  2QKL A;  1U5G A;  2M14 A;  5D3W A;  2I1J A;  1KZG A;  2COA A;  2DYQ A;  3FM8 C;  1X11 A;  3VOQ A;  4IFS A;  2LOZ A;  1FGY A;  1AQC A;  2YS1 A;  4F7H A;  3IVF A;  3KSY A;  4HB4 B;  3D8D A;  5FI1 A;  3KRX A;  4B6H A;  3G9W A;  2N23 A;  1SGH A;  3N7C A;  3P6A A;  3ULC A;  1U2B A;  5CLQ B;  2J0J A;  4NSW A;  3GYP A;  2QKM A;  1X1G A;  5C79 A;  1K5D B;  2ELB A;  1DBH A;  5KCV A;  2D11 A;  2LOX A;  1H10 A;  2K2U A;  3V5W A;  2V76 A;  3KZ1 A;  4Y94 A;  1XR0 B;  1OMW A;  2VRW B;  5D3Y A;  1V89 A;  4GPT B;  2UVM A;  2GJY A;  1GC7 A;  3CXB B;  3HK0 A;  2NZ8 B;  2Q13 A;  4HB3 B;  1W1H A;  1M7E A;  2MDX A;  4ZRI A;  2P0F A;  2I5F A;  1U5E A;  2DA0 A;  5DHF B;  1AWE A;  2P8V A;  3WYF B;  3T06 A;  1Z87 A;  2CY4 A;  5J3Q A;  3AU5 A;  1XD4 A;  4P7I A;  4CHJ A;  4HAZ B;  1SHC A;  1UNQ A;  3BJI A;  3ZDT A;  3MDB C;  2COC A;  1FHO A;  5JHH A;  2P0D A;  2J0K A;  2DX1 A;  1XKE A;  2M38 A;  1DYN A;  2LKO A;  1LB1 A;  4GN1 A;  1U5D A;  2MWN B;  3ULB A;  5LOP B;  3SNH A;  2IFS A;  4WJ7 A;  5DIF B;  1Y19 B;  5EFX A;  1X86 A;  4Z2N A;  5KQ1 A;  1N3H A;  2DFK A;  2J59 M;  1BTK A;  2IYB A;  3HQC A;  2KUP A;  3DXE A;  4TKN A;  5JLJ B;  1J0W A;  1DDM A;  5GOW B;  3DXC A;  4MY6 A;  2HE7 A;  4A6F A;  1MIX A;  2EC1 A;  1WVH A;  3U7D A;  2I1K A;  5LON B;  5C6R A;  1U5F A;  4XWX A;  2R09 A;  2BCJ A;  2D9W A;  1LW3 A;  4F7G A;  2LG1 A;  3ODO A;  1WG7 A;  3TCA A;  1MKE A;  2W2X D;  2ADZ A;  3MPX A;  5CLL B;  1W1D A;  4KVG B;  1GG3 A;  1OY2 A;  3PG7 A;  3SYX A;  4WVF B;  1WJM A;  2ZPY A;  3A8Q A;  2KCJ A;  1FB8 A;  1K5G B;  4H8S A;  1XX0 A;  5FI0 A;  3FSS A;  1UNR A;  3CIK A;  3KRW A;  5D3V A;  2DHJ A;  3NSU A;  4HHV A;  3LJU X;  1U27 A;  1EVH A;  2NMB A;  2EMT A;  1DDW A;  2FJL A;  2MFQ A;  1IRS A;  2ROV A;  1H4R A;  2EMS A;  1BTN A;  4HAV B;  2RGN B;  2AEH A;  3KY9 A;  1XCG A;  1Q67 A;  3TFM A;  5J3T A;  3X23 A;  4HAU B;  3VIA A;  2YS5 A;  1BAK A;  2JP2 A;  2D10 A;  3F5R A;  4DX9 0;  3BIN A;  3SUZ A;  3ML4 A;  2HTH B;  3ODX A;  2D4Q A;  3ODW A;  5L81 A;  1B55 A;  4CHM A;  3QBV B;  4PQ0 A;  3OAN A;  4A6K A;  2E2X A;  2OQB A;  1KI1 B;  1M7R A;  1ZVR A;  4IOY X;  3PP2 A;  1PLS A;  4HDO A;  1FGZ A;  4NY0 A;  1V5U A;  5J3Y A;  2DX5 A;  2Z0O A;  3D8E A;  1UPR A;  2LUL A;  1TXD A;  3UZT A;  3PZD A;  1OQN A;  2J0M A;  3RCP A;  4D0N B;  2D2Q A;  4HB2 B;  2DKQ A;  2DN6 A;  1E5W A;  2ELA A;  3PEG A;  2G35 A;  2OTX A;  4L6E A;  4ZRJ A;  2YVC A;  2COF A;  4KHO A;  4A5K A;  3PSC A;  2EJ8 A;  5JP4 A;  4YON A;  2CY5 A;  2RVB B;  1FHX A;  2KGX B;  4HAT B;  1GC6 A;  4BBK A;  5DI9 B;  4HB0 B;  3TVV A;  1NU2 A;  1DDV A;  4EMO A;  1MK7 B;  1P3R A;  3PVW A;  5HE3 A;  5KQ4 A;  4Z2M B;  4YL8 A;  4DX8 A;  1P5T A;  1BWN A;  2YT1 A;  1J19 A;  1Y5O A;  3TO1 A;  3D8F A;  4GMV A;  2P0H A;  4HAY B;  2Z0P A;  1NTV A;  3PVU A;  1PFJ A;  1TQZ A;  2GS0 A;  1NI2 A;  1EF1 A;  1TJ6 A;  1UPQ A;  4A6F B;  1FAO A;  1MIZ B;  3SO6 A;  2DHK A;  2UZS A;  2YF0 A;  5C5B B;  1V88 A;  4K17 A;  2CAY A;  2W2W A;  2DTC A;  3F0W A;  2DKP A;  2PZ1 A;  4KAX B;  2UZR A;  1QC6 A;  1X1F A;  2CRF A;  4HAX B;  4F7U P;  2K2J A;  4WSF A;  1RJ2 A;  1WI1 A;  2VKI A;  2RUK B;  4KHB B;  2GCJ A;  1MK9 B;  1UEF A;  4A6H A;  4K2P A;  3U8Z A;  2VSZ A;  2AL6 A; 
#chains in the Genus database with same CATH topology
 1W1G A;  1NTY A;  1V5P A;  5D27 A;  2GCL A;  1U29 A;  4EKU A;  1MAI A;  1DRO A;  1V5M A;  4C0A A;  2COD A;  4K81 A;  2DLW A;  2L2I A;  2Y8G A;  1EGX A;  5C5B A;  2H7E A;  2RSG A;  1KZ7 A;  1RRP B;  2RLO A;  3ZVR A;  5D3X A;  4KHA A;  1ZSQ A;  2YT0 A;  2W2X C;  2I5C A;  2Y7B A;  4HAW B;  1X05 A;  3QWM A;  4OSN A;  3P7Z A;  4CYE A;  4EJN A;  5DH9 B;  3AU4 A;  1WGQ A;  4MT7 A;  3TW1 A;  1MPH A;  5JHG A;  3A58 A;  3M1I B;  1PMS A;  1UNP A;  3DXD A;  3A8P A;  1I2H A;  1XOD A;  3FEH A;  4GXB A;  1FOE A;  2D9Y A;  3PVL A;  4PNK A;  4GZU A;  2D9V A;  1FHW A;  3SV1 A;  2LYD A;  4DBB A;  2D9Z A;  2YRY A;  2YS3 A;  5HE1 A;  2GUM A;  2XQN M;  2Y8F A;  1ZC3 B;  3GYO A;  4IAP A;  5DHA B;  4ZRK A;  4DXA B;  1WGU A;  2YSZ A;  4QJ5 B;  3A98 B;  4GMX B;  5HE2 A;  3O96 A;  2N0Y A;  2K00 A;  2L1C A;  5HE0 A;  4MK0 A;  1QQG A;  2DHI A;  1ZC4 B;  3HW2 B;  2ROZ B;  1ISN A;  2D9X A;  5IRS A;  2H7D A;  1ZM0 A;  2R0D A;  4HDQ A;  1I7A A;  2MKR A;  1P6S A;  2DYN A;  5C16 A;  1WJ1 A;  3WA0 A;  1EAZ A;  2KUQ A;  2RNR B;  4K2O A;  4TYZ A;  1V61 A;  3QIJ A;  3AJ4 A;  2Z0Q A;  2X18 A;  2QKL A;  1U5G A;  2M14 A;  5D3W A;  2I1J A;  1KZG A;  2COA A;  2DYQ A;  3FM8 C;  1X11 A;  3VOQ A;  4IFS A;  2LOZ A;  1FGY A;  1AQC A;  2YS1 A;  4F7H A;  3IVF A;  3KSY A;  4HB4 B;  3D8D A;  5FI1 A;  3KRX A;  4B6H A;  2K49 A;  3G9W A;  2N23 A;  1SGH A;  3N7C A;  3P6A A;  3ULC A;  4DIX A;  1U2B A;  5CLQ B;  2J0J A;  4NSW A;  3GYP A;  2QKM A;  1X1G A;  5C79 A;  1K5D B;  2ELB A;  1DBH A;  2Z14 A;  2D11 A;  5KCV A;  2LOX A;  1H10 A;  2K2U A;  3V5W A;  2V76 A;  3NW8 A;  3KZ1 A;  4Y94 A;  1XR0 B;  1OMW A;  1ZYI A;  2VRW B;  5D3Y A;  2KIG A;  1V89 A;  4GPT B;  2UVM A;  2GJY A;  1GC7 A;  3CXB B;  4KHB A;  3HK0 A;  2NZ8 B;  2Q13 A;  4HB3 B;  1W1H A;  5M4Y B;  1M7E A;  2MDX A;  4HSI A;  4ZRI A;  2P0F A;  2I5F A;  1U5E A;  2DA0 A;  5DHF B;  1AWE A;  2P8V A;  2Z4D A;  3WYF B;  3T06 A;  1Z87 A;  2CY4 A;  5J3Q A;  3AU5 A;  1XD4 A;  4P7I A;  4CHJ A;  4HAZ B;  1SHC A;  1UNQ A;  2FJU B;  3BJI A;  3ZDT A;  3MDB C;  2COC A;  1FHO A;  4GNK B;  5JHH A;  2P0D A;  2J0K A;  2DX1 A;  1XKE A;  2M38 A;  1DYN A;  2LKO A;  1LB1 A;  4GN1 A;  1U5D A;  2MWN B;  3ULB A;  5LOP B;  5LG4 B;  3SNH A;  2IFS A;  4WJ7 A;  5DIF B;  1Y19 B;  5EFX A;  1X86 A;  4Z2N A;  5KQ1 A;  1N3H A;  2DFK A;  2J59 M;  1BTK A;  2IYB A;  3HQC A;  2KUP A;  3DXE A;  3OHM B;  4TKN A;  5JLJ B;  1J0W A;  1DDM A;  5GOW B;  3DXC A;  4MY6 A;  2HE7 A;  5I2S A;  4A6F A;  1MIX A;  2EC1 A;  1WVH A;  3U7D A;  2I1K A;  5LON B;  5C6R A;  1U5F A;  2ZKM X;  4XWX A;  2R09 A;  2BCJ A;  2D9W A;  3NWA A;  1LW3 A;  4F7G A;  2LG1 A;  3ODO A;  1WG7 A;  3TCA A;  1MI1 A;  1MKE A;  2W2X D;  2ADZ A;  3MPX A;  5CLL B;  1W1D A;  4QXA B;  2Z59 A;  4KVG B;  3NWD A;  1GG3 A;  1OY2 A;  2YT2 A;  3PG7 A;  3SYX A;  4WVF B;  1WJM A;  2ZPY A;  3A8Q A;  3FVC A;  2KCJ A;  1FB8 A;  1K5G B;  4H8S A;  1XX0 A;  5FI0 A;  3FSS A;  1UNR A;  3CIK A;  3KRW A;  5D3V A;  2DHJ A;  2K8E A;  3NSU A;  4HHV A;  3LJU X;  2R2Y A;  1U27 A;  1EVH A;  2NMB A;  2EMT A;  1DDW A;  2FJL A;  2MFQ A;  1IRS A;  2ROV A;  1H4R A;  2EMS A;  1BTN A;  4HAV B;  2RGN B;  2AEH A;  3KY9 A;  1XCG A;  4QJ3 B;  1Q67 A;  3TFM A;  2KR0 A;  5J3T A;  3X23 A;  4HAU B;  3VIA A;  2YS5 A;  1BAK A;  2JP2 A;  2D10 A;  2RRF A;  3F5R A;  4DX9 0;  3BIN A;  3SUZ A;  3ML4 A;  2HTH B;  3ODX A;  2D4Q A;  3HIE A;  3ODW A;  5L81 A;  1B55 A;  4CHM A;  3QBV B;  4PQ0 A;  3OAN A;  3NWF A;  4A6K A;  2E2X A;  2OQB A;  1KI1 B;  1M7R A;  1ZVR A;  4IOY X;  4CSQ A;  3PP2 A;  1PLS A;  4HDO A;  1FGZ A;  4NY0 A;  1V5U A;  5J3Y A;  2DX5 A;  3U12 A;  2Z0O A;  3D8E A;  1UPR A;  2LUL A;  1TXD A;  3UZT A;  5I2M A;  3PZD A;  1OQN A;  2J0M A;  4D6W A;  3RCP A;  4D0N B;  2D2Q A;  4HB2 B;  2DKQ A;  2DN6 A;  1E5W A;  4QJ4 B;  2ELA A;  3PEG A;  2G35 A;  2OTX A;  4L6E A;  4ZRJ A;  2YVC A;  2COF A;  4KHO A;  4A5K A;  3PSC A;  2EJ8 A;  5JP4 A;  4YON A;  2CY5 A;  2RVB B;  1FHX A;  2KIE A;  2KGX B;  4HAT B;  1GC6 A;  4BBK A;  5DI9 B;  4HB0 B;  3TVV A;  1NU2 A;  1DDV A;  4EMO A;  4L1R A;  1MK7 B;  1P3R A;  3PVW A;  5HE3 A;  5KQ4 A;  4Z2M B;  4YL8 A;  2NBV A;  4DX8 A;  2Z13 A;  1P5T A;  1BWN A;  2YT1 A;  3DCX A;  3B77 A;  1J19 A;  1Y5O A;  3TO1 A;  3D8F A;  4GMV A;  3HSA A;  2P0H A;  4HAY B;  2Z0P A;  1NTV A;  3PVU A;  1PFJ A;  1T77 A;  1TQZ A;  2GS0 A;  1NI2 A;  1EF1 A;  1TJ6 A;  1UPQ A;  4A6F B;  1FAO A;  1MIZ B;  3SO6 A;  2DHK A;  2UZS A;  2YF0 A;  5C5B B;  1V88 A;  4GOU A;  4K17 A;  2CAY A;  2W2W A;  2DTC A;  3F0W A;  2DKP A;  2PZ1 A;  4KAX B;  2UZR A;  1QC6 A;  1X1F A;  2CRF A;  4HAX B;  4F7U P;  2K2J A;  4WSF A;  1RJ2 A;  1WI1 A;  2VKI A;  2RUK B;  4OT1 A;  4KHB B;  2GCJ A;  1MK9 B;  1UEF A;  4A6H A;  4K2P A;  3U8Z A;  2VSZ A;  2AL6 A; 
#chains in the Genus database with same CATH homology
 1W1G A;  1NTY A;  1V5P A;  5D27 A;  2GCL A;  1U29 A;  4EKU A;  1MAI A;  1DRO A;  1V5M A;  4C0A A;  2COD A;  4K81 A;  2DLW A;  2L2I A;  2Y8G A;  1EGX A;  5C5B A;  2H7E A;  2RSG A;  1KZ7 A;  1RRP B;  2RLO A;  3ZVR A;  5D3X A;  4KHA A;  1ZSQ A;  2YT0 A;  2W2X C;  2I5C A;  2Y7B A;  4HAW B;  1X05 A;  3QWM A;  3P7Z A;  4CYE A;  4EJN A;  5DH9 B;  3AU4 A;  1WGQ A;  4MT7 A;  3TW1 A;  1MPH A;  5JHG A;  3M1I B;  1PMS A;  1UNP A;  3DXD A;  3A8P A;  1I2H A;  1XOD A;  3FEH A;  4GXB A;  1FOE A;  2D9Y A;  3PVL A;  4PNK A;  4GZU A;  2D9V A;  1FHW A;  3SV1 A;  2LYD A;  4DBB A;  2D9Z A;  2YRY A;  2YS3 A;  5HE1 A;  2XQN M;  2Y8F A;  1ZC3 B;  3GYO A;  4IAP A;  5DHA B;  4ZRK A;  4DXA B;  1WGU A;  2YSZ A;  3A98 B;  4GMX B;  5HE2 A;  3O96 A;  2N0Y A;  2K00 A;  2L1C A;  5HE0 A;  4MK0 A;  1QQG A;  2DHI A;  1ZC4 B;  3HW2 B;  2ROZ B;  1ISN A;  2D9X A;  2H7D A;  1ZM0 A;  2R0D A;  4HDQ A;  1I7A A;  2MKR A;  1P6S A;  2DYN A;  5C16 A;  1WJ1 A;  3WA0 A;  1EAZ A;  2RNR B;  4K2O A;  4TYZ A;  1V61 A;  3QIJ A;  3AJ4 A;  2Z0Q A;  2X18 A;  2QKL A;  1U5G A;  2M14 A;  5D3W A;  2I1J A;  1KZG A;  2COA A;  2DYQ A;  3FM8 C;  1X11 A;  3VOQ A;  4IFS A;  2LOZ A;  1FGY A;  1AQC A;  2YS1 A;  4F7H A;  3IVF A;  3KSY A;  4HB4 B;  3D8D A;  5FI1 A;  3KRX A;  4B6H A;  3G9W A;  2N23 A;  1SGH A;  3N7C A;  3P6A A;  3ULC A;  1U2B A;  5CLQ B;  2J0J A;  4NSW A;  3GYP A;  2QKM A;  1X1G A;  5C79 A;  1K5D B;  2ELB A;  1DBH A;  5KCV A;  2D11 A;  2LOX A;  1H10 A;  2K2U A;  3V5W A;  2V76 A;  3KZ1 A;  4Y94 A;  1XR0 B;  1OMW A;  2VRW B;  5D3Y A;  1V89 A;  4GPT B;  2UVM A;  2GJY A;  1GC7 A;  3CXB B;  3HK0 A;  2NZ8 B;  2Q13 A;  4HB3 B;  1W1H A;  1M7E A;  2MDX A;  4ZRI A;  2P0F A;  2I5F A;  1U5E A;  2DA0 A;  5DHF B;  1AWE A;  2P8V A;  3WYF B;  3T06 A;  1Z87 A;  2CY4 A;  5J3Q A;  3AU5 A;  1XD4 A;  4P7I A;  4CHJ A;  4HAZ B;  1SHC A;  1UNQ A;  3BJI A;  3ZDT A;  3MDB C;  2COC A;  1FHO A;  5JHH A;  2P0D A;  2J0K A;  2DX1 A;  1XKE A;  2M38 A;  1DYN A;  2LKO A;  1LB1 A;  4GN1 A;  1U5D A;  2MWN B;  3ULB A;  5LOP B;  3SNH A;  2IFS A;  4WJ7 A;  5DIF B;  1Y19 B;  5EFX A;  1X86 A;  4Z2N A;  5KQ1 A;  1N3H A;  2DFK A;  2J59 M;  1BTK A;  2IYB A;  3HQC A;  2KUP A;  3DXE A;  4TKN A;  5JLJ B;  1J0W A;  1DDM A;  5GOW B;  3DXC A;  4MY6 A;  2HE7 A;  4A6F A;  1MIX A;  2EC1 A;  1WVH A;  3U7D A;  2I1K A;  5LON B;  5C6R A;  1U5F A;  4XWX A;  2R09 A;  2BCJ A;  2D9W A;  1LW3 A;  4F7G A;  2LG1 A;  3ODO A;  1WG7 A;  3TCA A;  1MKE A;  2W2X D;  2ADZ A;  3MPX A;  5CLL B;  1W1D A;  4KVG B;  1GG3 A;  1OY2 A;  3PG7 A;  3SYX A;  4WVF B;  1WJM A;  2ZPY A;  3A8Q A;  2KCJ A;  1FB8 A;  1K5G B;  4H8S A;  1XX0 A;  5FI0 A;  3FSS A;  1UNR A;  3CIK A;  3KRW A;  5D3V A;  2DHJ A;  3NSU A;  4HHV A;  3LJU X;  1U27 A;  1EVH A;  2NMB A;  2EMT A;  1DDW A;  2FJL A;  2MFQ A;  1IRS A;  2ROV A;  1H4R A;  2EMS A;  1BTN A;  4HAV B;  2RGN B;  2AEH A;  3KY9 A;  1XCG A;  1Q67 A;  3TFM A;  5J3T A;  3X23 A;  4HAU B;  3VIA A;  2YS5 A;  1BAK A;  2JP2 A;  2D10 A;  3F5R A;  4DX9 0;  3BIN A;  3SUZ A;  3ML4 A;  2HTH B;  3ODX A;  2D4Q A;  3ODW A;  5L81 A;  1B55 A;  4CHM A;  3QBV B;  4PQ0 A;  3OAN A;  4A6K A;  2E2X A;  2OQB A;  1KI1 B;  1M7R A;  1ZVR A;  4IOY X;  3PP2 A;  1PLS A;  4HDO A;  1FGZ A;  4NY0 A;  1V5U A;  5J3Y A;  2DX5 A;  2Z0O A;  3D8E A;  1UPR A;  2LUL A;  1TXD A;  3UZT A;  3PZD A;  1OQN A;  2J0M A;  3RCP A;  4D0N B;  2D2Q A;  4HB2 B;  2DKQ A;  2DN6 A;  1E5W A;  2ELA A;  3PEG A;  2G35 A;  2OTX A;  4L6E A;  4ZRJ A;  2YVC A;  2COF A;  4KHO A;  4A5K A;  3PSC A;  2EJ8 A;  5JP4 A;  4YON A;  2CY5 A;  2RVB B;  1FHX A;  2KGX B;  4HAT B;  1GC6 A;  4BBK A;  5DI9 B;  4HB0 B;  3TVV A;  1NU2 A;  1DDV A;  4EMO A;  1MK7 B;  1P3R A;  3PVW A;  5HE3 A;  5KQ4 A;  4Z2M B;  4YL8 A;  4DX8 A;  1P5T A;  1BWN A;  2YT1 A;  1J19 A;  1Y5O A;  3TO1 A;  3D8F A;  4GMV A;  2P0H A;  4HAY B;  2Z0P A;  1NTV A;  3PVU A;  1PFJ A;  1TQZ A;  2GS0 A;  1NI2 A;  1EF1 A;  1TJ6 A;  1UPQ A;  4A6F B;  1FAO A;  1MIZ B;  3SO6 A;  2DHK A;  2UZS A;  2YF0 A;  5C5B B;  1V88 A;  4K17 A;  2CAY A;  2W2W A;  2DTC A;  3F0W A;  2DKP A;  2PZ1 A;  4KAX B;  2UZR A;  1QC6 A;  1X1F A;  2CRF A;  4HAX B;  4F7U P;  2K2J A;  4WSF A;  1RJ2 A;  1WI1 A;  2VKI A;  2RUK B;  4KHB B;  2GCJ A;  1MK9 B;  1UEF A;  4A6H A;  4K2P A;  3U8Z A;  2VSZ A;  2AL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...