3A8QA

Low-resolution crystal structure of the tiam2 phccex domain
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
239
structure length
231
Chain Sequence
VVRKAGWLFFKPLVTLQKERKLELVARRKWKQYWVTLKGCTLLFYETYSAPRCALFAEDSIVQSVPEHPKKEHVFCLSNSCGDVYLFQATSQTDLENWVTAIHSACASLFAKKHGKEDTVRLLKSQTRSLLQKIDMDSKMKKMAELQLSVVSDPKNRKAIENQIRQWEQNLEKFHMDLFRMRCYLASLQGGELPNPKSLLAATSRPSKLALGRLGVLSVSSFHALVCSRDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The PHCCEx domain of Tiam1/2 is a novel protein- and membrane-binding module
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords T-lymphoma invasion and metastasis-inducing protein 2
total genus 70
structure length 231
sequence length 239
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF18385 Tiam_CC_Ex T-lymphoma invasion and metastasis CC-Ex domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3a8qA01
4GN1A 2ZPYA 2RNRB 3QIJA 5JP4A 3FSSA 5DHFB 2Z0PA 2FJLA 1P6SA 2LULA 3WA0A 1AWEA 3CXBB 2YS1A 2COFA 2OQBA 5C79A 1NTYA 2K2UA 2DKQA 1P3RA 1RJ2A 2UZSA 4A6HA 5JHHA 1V88A 2CY4A 1Q67A 2G35A 3KRWA 2EC1A 1ZVRA 3DXEA 4GPTB 2NZ8B 1U2BA 2L1CA 1X1GA 1ZSQA 1ISNA 1N3HA 3TO1A 5C5BA 1U5DA 1QC6A 5HE0A 4IFSA 1FHOA 1U5FA 3MPXA 2D9WA 2D10A 2E2XA 1V5MA 2N23A 2IYBA 1DDWA 2P0FA 3VIAA 1EF1A 2GCJA 3IVFA 4MT7A 2MKRA 5KCVA 1H10A 1TXDA 3PVWA 2DX5A 4IOYX 3F0WA 1TJ6A 1ZC4B 5LONB 2HE7A 2I1KA 3A8PA 3ML4A 3ODXA 1DDMA 3KZ1A 2CY5A 2YT1A 4TYZA 5EFXA 2COAA 5DH9B 2UZRA 1MAIA 3D8FA 3F5RA 4K81A 3TVVA 2LOXA 1KI1B 2YS3A 1PFJA 2YVCA 4NSWA 1UNRA 4K2PA 2H7DA 4F7GA 3BINA 4KHOA 4EJNA 2DYQA 5KQ1A 3U8ZA 1XCGA 4EKUA 2D9ZA 1UNPA 4ZRJA 3HW2B 1V89A 1B55A 1MK9B 1MIXA 1WGQA 2MFQA 1EGXA 1ZM0A 2I1JA 1UPQA 2R0DA 3HK0A 2DHKA 3SV1A 3WYFB 1FGYA 5C6RA 4HDQA 3G9WA 1DBHA 2ELAA 2M38A 1BAKA 5D3VA 4EMOA 3KSYA 4CYEA 2CAYA 4HAZB 2VKIA 1V5UA 1LB1A 5D3XA 3BJIA 1ZC3B 1XKEA 1MPHA 1M7EA 1I2HA 4BBKA 1U29A 5J3QA 3D8DA 3OANA 5KQ4A 4B6HA 2HTHB 4HAUB 2Y7BA 2VRWB 4XWXA 1OMWA 5FI0A 4HB0B 2OTXA 2XQNM 3ODWA 3FM8C 4MK0A 4K2OA 1DDVA 2KCJA 2V76A 3NSUA 4ZRIA 1UNQA 1V61A 2DTCA 3SNHA 2X18A 5JLJB 2N0YA 1AQCA 2RGNB 4HDOA 1MKEA 1BTNA 3AU4A 2IFSA 2RLOA 2DYNA 3A8QA 4DX90 1W1HA 2AL6A 1X86A 2J0JA 2VSZA 3ULCA 3ZDTA 3PZDA 2ROZB 1SHCA 2QKLA 2Y8GA 1EVHA 2Y8FA 2ROVA 1UPRA 2KUPA 3RCPA 3P6AA 2EJ8A 1M7RA 2Q13A 4DBBA 1E5WA 3TFMA 1NI2A 1KZGA 3O96A 2DHJA 4HHVA 1NTVA 1XR0B 4A6KA 1BTKA 1LW3A 3PG7A 1GC6A 4YONA 2W2XD 5D27A 3A98B 4A6FA 2K2JA 5FI1A 2D2QA 1U5GA 2KGXB 4PNKA 3SO6A 2YRYA 2Z0OA 4PQ0A 2CODA 4KAXB 4HB3B 3AU5A 2LG1A 2PZ1A 3KRXA 1TQZA 5LOPB 5JHGA 5CLQB 5J3TA 3AJ4A 5J3YA 1J0WA 1WJ1A 4KHAA 2L2IA 2EMSA 2LKOA 3CIKA 4HAYB 2AEHA 3SUZA 1FHXA 3QWMA 5DI9B 5HE1A 4F7UP 4CHJA 5C16A 1QQGA 2UVMA 1SGHA 5D3YA 2ADZA 2GCLA 1WI1A 1PMSA 2BCJA 4GMXB 4NY0A 2Z0QA 3DXDA 1Y19B 3U7DA 3LJUX 3VOQA 2QKMA 5GOWB 2K00A 4HAVB 1KZ7A 2P0DA 4GZUA 3ULBA 2NMBA 2JP2A 4DXAB 2J59M 2LYDA 1I7AA 3GYOA 3GYPA 4DX8A 4H8SA 2MDXA 4YL8A 2D9YA 5DIFB 2COCA 4HATB 4Z2MB 1GG3A 4A5KA 1MK7B 5C5BB 3DXCA 4K17A 2ELBA 1OY2A 1Z87A 1U27A 1U5EA 2DFKA 2YT0A 5HE2A 1BWNA 3T06A 1OQNA 4WJ7A 3V5WA 4Z2NA 3M1IB 1P5TA 1X1FA 1PLSA 1WGUA 5DHAB 4IAPA 2DLWA 1Y5OA 1XODA 2DX1A 2YF0A 3SYXA 4HAWB 2H7EA 3PP2A 1FAOA 2D9XA 2MWNB 1W1GA 1FGZA 2GJYA 1K5DB 1W1DA 3UZTA 1XX0A 4P7IA 4TKNA 2GS0A 1WG7A 3TCAA 3KY9A 4CHMA 2D9VA 3ZVRA 1WVHA 4HAXB 4MY6A 4GXBA 3N7CA 2RUKB 1J19A 1FOEA 4WSFA 3HQCA 3TW1A 1X11A 3MDBC 3FEHA 4Y94A 2W2XC 3X23A 2RSGA 4ZRKA 5HE3A 2J0KA 2J0MA 2I5CA 3PSCA 3QBVB 1DROA 2P0HA 2DN6A 5D3WA 3PVLA 4A6FB 1GC7A 1MIZB 3P7ZA 1DYNA 4GMVA 1X05A 3ODOA 1H4RA 1V5PA 5L81A 1K5GB 1NU2A 4D0NB 2CRFA 5CLLB 2YSZA 2I5FA 3D8EA 1RRPB 4C0AA 4F7HA 2R09A 4KVGB 2DHIA 1XD4A 2P8VA 2DA0A 4L6EA 2EMTA 2LOZA 1WJMA 3PVUA 1FHWA 4WVFB 2M14A 4HB4B 2YS5A 1FB8A 4KHBB 2DKPA 2D4QA 2RVBB 4HB2B 1IRSA 2D11A 3PEGA 1EAZA 2W2WA 1UEFA
chains in the Genus database with same CATH superfamily
4GN1A 2ZPYA 2RNRB 3QIJA 5JP4A 3FSSA 5DHFB 2Z0PA 3OHMB 2FJLA 1P6SA 2LULA 3WA0A 1AWEA 3CXBB 2YS1A 2COFA 2OQBA 1ZYIA 5C79A 1NTYA 2K2UA 2DKQA 1P3RA 1RJ2A 2UZSA 4A6HA 5JHHA 1V88A 2CY4A 1Q67A 2G35A 3KRWA 2EC1A 1ZVRA 3DXEA 4GPTB 2NZ8B 1U2BA 2L1CA 1X1GA 1ZSQA 1ISNA 1N3HA 3TO1A 5C5BA 1U5DA 1QC6A 5HE0A 4IFSA 1FHOA 1U5FA 3MPXA 2D9WA 2D10A 2E2XA 1V5MA 2N23A 2IYBA 1DDWA 2P0FA 3VIAA 4D6WA 1EF1A 2GCJA 3IVFA 4QJ5B 4MT7A 2MKRA 5KCVA 1H10A 1TXDA 3DCXA 3PVWA 2DX5A 4IOYX 4GOUA 3F0WA 2Z13A 1TJ6A 1ZC4B 5LONB 2HE7A 5M4YB 2I1KA 3A8PA 3ML4A 3ODXA 1DDMA 3KZ1A 2RRFA 2CY5A 2YT1A 4QJ3B 4TYZA 5EFXA 2COAA 5DH9B 2UZRA 4GNKB 1MAIA 3D8FA 3F5RA 4K81A 3TVVA 4QXAB 2LOXA 1KI1B 2YS3A 1PFJA 2YVCA 4NSWA 1UNRA 3NWDA 4K2PA 2H7DA 4F7GA 3BINA 4KHOA 4EJNA 2DYQA 5KQ1A 3U8ZA 1XCGA 5I2MA 2D9ZA 4EKUA 1UNPA 4ZRJA 3HW2B 1V89A 1B55A 3B77A 4HSIA 1MK9B 2ZKMX 1MIXA 1WGQA 2MFQA 1EGXA 1ZM0A 2YT2A 2I1JA 1UPQA 2R0DA 3HK0A 4QJ4B 2DHKA 4CSQA 3SV1A 3WYFB 1FGYA 5C6RA 3G9WA 4HDQA 1DBHA 2ELAA 2M38A 1BAKA 5D3VA 4EMOA 3KSYA 4CYEA 2CAYA 4HAZB 2VKIA 4OSNA 1V5UA 2FJUB 1LB1A 5D3XA 3BJIA 1ZC3B 1XKEA 1MPHA 1M7EA 4DIXA 1I2HA 4BBKA 1U29A 5J3QA 3D8DA 3OANA 5KQ4A 4B6HA 2HTHB 4HAUB 2Y7BA 2VRWB 4XWXA 1OMWA 5FI0A 4HB0B 5I2SA 2OTXA 1T77A 2XQNM 3ODWA 3FM8C 4MK0A 4K2OA 5IRSA 1DDVA 2KCJA 2KUQA 2KR0A 2V76A 3NSUA 4ZRIA 1UNQA 1V61A 2DTCA 3SNHA 2X18A 5JLJB 2N0YA 2Z4DA 1AQCA 2RGNB 1MKEA 4HDOA 1BTNA 3AU4A 2IFSA 2RLOA 2DYNA 3A8QA 4DX90 1W1HA 2AL6A 1X86A 2J0JA 2VSZA 3ULCA 3ZDTA 3PZDA 2ROZB 1SHCA 2QKLA 2Y8GA 1EVHA 2GUMA 2Y8FA 2ROVA 1UPRA 2KUPA 3RCPA 3P6AA 2EJ8A 1M7RA 2Q13A 4DBBA 1E5WA 3TFMA 1NI2A 1KZGA 3O96A 2DHJA 4HHVA 1NTVA 1XR0B 4A6KA 1BTKA 1LW3A 3PG7A 1GC6A 3NW8A 4YONA 3NWAA 2W2XD 5D27A 2KIEA 3A98B 4A6FA 2K2JA 5FI1A 2D2QA 1U5GA 2KGXB 4PNKA 3SO6A 2YRYA 2K8EA 2Z0OA 4PQ0A 2CODA 4KAXB 4HB3B 3U12A 3AU5A 2LG1A 2PZ1A 3KRXA 1TQZA 5LOPB 5JHGA 5CLQB 3HSAA 5J3TA 3AJ4A 5J3YA 1J0WA 1WJ1A 4KHAA 2L2IA 2EMSA 2LKOA 3CIKA 4HAYB 2AEHA 3SUZA 1FHXA 3QWMA 5DI9B 5HE1A 4F7UP 4CHJA 5C16A 1QQGA 2UVMA 1SGHA 5D3YA 2ADZA 2GCLA 2NBVA 1WI1A 3HIEA 1PMSA 2BCJA 4GMXB 4NY0A 2Z0QA 2K49A 4OT1A 3DXDA 1Y19B 3U7DA 3LJUX 3VOQA 2QKMA 5GOWB 2K00A 4HAVB 1KZ7A 2P0DA 4GZUA 3ULBA 2NMBA 2JP2A 4DXAB 2J59M 2LYDA 1I7AA 3GYOA 3GYPA 4DX8A 4H8SA 2MDXA 4L1RA 4YL8A 4KHBA 2D9YA 5DIFB 2COCA 4HATB 4Z2MB 1GG3A 4A5KA 1MK7B 5C5BB 3DXCA 4K17A 2ELBA 1OY2A 1Z87A 1U27A 1U5EA 2DFKA 2YT0A 5HE2A 1BWNA 3T06A 1OQNA 4WJ7A 3V5WA 4Z2NA 3M1IB 1P5TA 1X1FA 5LG4B 1PLSA 1WGUA 5DHAB 4IAPA 2DLWA 1Y5OA 2Z14A 1XODA 2DX1A 2YF0A 3SYXA 4HAWB 2H7EA 3PP2A 1FAOA 2D9XA 2MWNB 1W1GA 1FGZA 3NWFA 2GJYA 1K5DB 1W1DA 3UZTA 1XX0A 4P7IA 4TKNA 2GS0A 1WG7A 3TCAA 3KY9A 4CHMA 2D9VA 3ZVRA 1WVHA 4HAXB 4MY6A 4GXBA 3N7CA 2RUKB 1J19A 1FOEA 4WSFA 3HQCA 3TW1A 1X11A 3MDBC 3FEHA 4Y94A 2W2XC 3X23A 2RSGA 4ZRKA 5HE3A 2J0KA 2J0MA 2I5CA 3PSCA 3QBVB 3FVCA 1DROA 2P0HA 2KIGA 2DN6A 5D3WA 3PVLA 4A6FB 1GC7A 1MIZB 3P7ZA 1DYNA 4GMVA 1X05A 3ODOA 1H4RA 1V5PA 5L81A 1K5GB 1NU2A 4D0NB 2CRFA 5CLLB 2YSZA 2I5FA 3D8EA 3A58A 1RRPB 4C0AA 4F7HA 2R09A 4KVGB 2DHIA 1XD4A 2P8VA 2DA0A 4L6EA 2EMTA 2LOZA 1WJMA 3PVUA 2R2YA 1FHWA 4WVFB 2M14A 1MI1A 4HB4B 2YS5A 1FB8A 4KHBB 2DKPA 2D4QA 2RVBB 4HB2B 1IRSA 2D11A 2Z59A 3PEGA 1EAZA 2W2WA 1UEFA
chains in the Genus database with same CATH topology
4GN1A 2ZPYA 2RNRB 3QIJA 5JP4A 3FSSA 5DHFB 2Z0PA 2FJLA 1P6SA 2LULA 3WA0A 1AWEA 3CXBB 2YS1A 2COFA 2OQBA 5C79A 1NTYA 2K2UA 2DKQA 1P3RA 1RJ2A 2UZSA 4A6HA 5JHHA 1V88A 2CY4A 1Q67A 2G35A 3KRWA 2EC1A 1ZVRA 3DXEA 4GPTB 2NZ8B 1U2BA 2L1CA 1X1GA 1ZSQA 1ISNA 1N3HA 3TO1A 5C5BA 1U5DA 1QC6A 5HE0A 4IFSA 1FHOA 1U5FA 3MPXA 2D9WA 2D10A 2E2XA 1V5MA 2N23A 2IYBA 1DDWA 2P0FA 3VIAA 1EF1A 2GCJA 3IVFA 4MT7A 2MKRA 5KCVA 1H10A 1TXDA 3PVWA 2DX5A 4IOYX 3F0WA 1TJ6A 1ZC4B 5LONB 2HE7A 2I1KA 3A8PA 3ML4A 3ODXA 1DDMA 3KZ1A 2CY5A 2YT1A 4TYZA 5EFXA 2COAA 5DH9B 2UZRA 1MAIA 3D8FA 3F5RA 4K81A 3TVVA 2LOXA 1KI1B 2YS3A 1PFJA 2YVCA 4NSWA 1UNRA 4K2PA 2H7DA 4F7GA 3BINA 4KHOA 4EJNA 2DYQA 5KQ1A 3U8ZA 1XCGA 4EKUA 2D9ZA 1UNPA 4ZRJA 3HW2B 1V89A 1B55A 1MK9B 1MIXA 1WGQA 2MFQA 1EGXA 1ZM0A 2I1JA 1UPQA 2R0DA 3HK0A 2DHKA 3SV1A 3WYFB 1FGYA 5C6RA 4HDQA 3G9WA 1DBHA 2ELAA 2M38A 1BAKA 5D3VA 4EMOA 3KSYA 4CYEA 2CAYA 4HAZB 2VKIA 1V5UA 1LB1A 5D3XA 3BJIA 1ZC3B 1XKEA 1MPHA 1M7EA 1I2HA 4BBKA 1U29A 5J3QA 3D8DA 3OANA 5KQ4A 4B6HA 2HTHB 4HAUB 2Y7BA 2VRWB 4XWXA 1OMWA 5FI0A 4HB0B 2OTXA 2XQNM 3ODWA 3FM8C 4MK0A 4K2OA 1DDVA 2KCJA 2V76A 3NSUA 4ZRIA 1UNQA 1V61A 2DTCA 3SNHA 2X18A 5JLJB 2N0YA 1AQCA 2RGNB 4HDOA 1MKEA 1BTNA 3AU4A 2IFSA 2RLOA 2DYNA 3A8QA 4DX90 1W1HA 2AL6A 1X86A 2J0JA 2VSZA 3ULCA 3ZDTA 3PZDA 2ROZB 1SHCA 2QKLA 2Y8GA 1EVHA 2Y8FA 2ROVA 1UPRA 2KUPA 3RCPA 3P6AA 2EJ8A 1M7RA 2Q13A 4DBBA 1E5WA 3TFMA 1NI2A 1KZGA 3O96A 2DHJA 4HHVA 1NTVA 1XR0B 4A6KA 1BTKA 1LW3A 3PG7A 1GC6A 4YONA 2W2XD 5D27A 3A98B 4A6FA 2K2JA 5FI1A 2D2QA 1U5GA 2KGXB 4PNKA 3SO6A 2YRYA 2Z0OA 4PQ0A 2CODA 4KAXB 4HB3B 3AU5A 2LG1A 2PZ1A 3KRXA 1TQZA 5LOPB 5JHGA 5CLQB 5J3TA 3AJ4A 5J3YA 1J0WA 1WJ1A 4KHAA 2L2IA 2EMSA 2LKOA 3CIKA 4HAYB 2AEHA 3SUZA 1FHXA 3QWMA 5DI9B 5HE1A 4F7UP 4CHJA 5C16A 1QQGA 2UVMA 1SGHA 5D3YA 2ADZA 2GCLA 1WI1A 1PMSA 2BCJA 4GMXB 4NY0A 2Z0QA 3DXDA 1Y19B 3U7DA 3LJUX 3VOQA 2QKMA 5GOWB 2K00A 4HAVB 1KZ7A 2P0DA 4GZUA 3ULBA 2NMBA 2JP2A 4DXAB 2J59M 2LYDA 1I7AA 3GYOA 3GYPA 4DX8A 4H8SA 2MDXA 4YL8A 2D9YA 5DIFB 2COCA 4HATB 4Z2MB 1GG3A 4A5KA 1MK7B 5C5BB 3DXCA 4K17A 2ELBA 1OY2A 1Z87A 1U27A 1U5EA 2DFKA 2YT0A 5HE2A 1BWNA 3T06A 1OQNA 4WJ7A 3V5WA 4Z2NA 3M1IB 1P5TA 1X1FA 1PLSA 1WGUA 5DHAB 4IAPA 2DLWA 1Y5OA 1XODA 2DX1A 2YF0A 3SYXA 4HAWB 2H7EA 3PP2A 1FAOA 2D9XA 2MWNB 1W1GA 1FGZA 2GJYA 1K5DB 1W1DA 3UZTA 1XX0A 4P7IA 4TKNA 2GS0A 1WG7A 3TCAA 3KY9A 4CHMA 2D9VA 3ZVRA 1WVHA 4HAXB 4MY6A 4GXBA 3N7CA 2RUKB 1J19A 1FOEA 4WSFA 3HQCA 3TW1A 1X11A 3MDBC 3FEHA 4Y94A 2W2XC 3X23A 2RSGA 4ZRKA 5HE3A 2J0KA 2J0MA 2I5CA 3PSCA 3QBVB 1DROA 2P0HA 2DN6A 5D3WA 3PVLA 4A6FB 1GC7A 1MIZB 3P7ZA 1DYNA 4GMVA 1X05A 3ODOA 1H4RA 1V5PA 5L81A 1K5GB 1NU2A 4D0NB 2CRFA 5CLLB 2YSZA 2I5FA 3D8EA 1RRPB 4C0AA 4F7HA 2R09A 4KVGB 2DHIA 1XD4A 2P8VA 2DA0A 4L6EA 2EMTA 2LOZA 1WJMA 3PVUA 1FHWA 4WVFB 2M14A 4HB4B 2YS5A 1FB8A 4KHBB 2DKPA 2D4QA 2RVBB 4HB2B 1IRSA 2D11A 3PEGA 1EAZA 2W2WA 1UEFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GN1 A;  2ZPY A;  2RNR B;  3QIJ A;  5JP4 A;  3FSS A;  5DHF B;  2Z0P A;  2FJL A;  1P6S A;  2LUL A;  3WA0 A;  1AWE A;  3CXB B;  2YS1 A;  2COF A;  2OQB A;  5C79 A;  1NTY A;  2K2U A;  2DKQ A;  1P3R A;  1RJ2 A;  2UZS A;  4A6H A;  5JHH A;  1V88 A;  2CY4 A;  1Q67 A;  2G35 A;  3KRW A;  2EC1 A;  1ZVR A;  3DXE A;  4GPT B;  2NZ8 B;  1U2B A;  2L1C A;  1X1G A;  1ZSQ A;  1ISN A;  1N3H A;  3TO1 A;  5C5B A;  1U5D A;  1QC6 A;  5HE0 A;  4IFS A;  1FHO A;  1U5F A;  3MPX A;  2D9W A;  2D10 A;  2E2X A;  1V5M A;  2N23 A;  2IYB A;  1DDW A;  2P0F A;  3VIA A;  1EF1 A;  2GCJ A;  3IVF A;  4MT7 A;  2MKR A;  5KCV A;  1H10 A;  1TXD A;  3PVW A;  2DX5 A;  4IOY X;  3F0W A;  1TJ6 A;  1ZC4 B;  5LON B;  2HE7 A;  2I1K A;  3A8P A;  3ML4 A;  3ODX A;  1DDM A;  3KZ1 A;  2CY5 A;  2YT1 A;  4TYZ A;  5EFX A;  2COA A;  5DH9 B;  2UZR A;  1MAI A;  3D8F A;  3F5R A;  4K81 A;  3TVV A;  2LOX A;  1KI1 B;  2YS3 A;  1PFJ A;  2YVC A;  4NSW A;  1UNR A;  4K2P A;  2H7D A;  4F7G A;  3BIN A;  4KHO A;  4EJN A;  2DYQ A;  5KQ1 A;  3U8Z A;  1XCG A;  4EKU A;  2D9Z A;  1UNP A;  4ZRJ A;  3HW2 B;  1V89 A;  1B55 A;  1MK9 B;  1MIX A;  1WGQ A;  2MFQ A;  1EGX A;  1ZM0 A;  2I1J A;  1UPQ A;  2R0D A;  3HK0 A;  2DHK A;  3SV1 A;  3WYF B;  1FGY A;  5C6R A;  4HDQ A;  3G9W A;  1DBH A;  2ELA A;  2M38 A;  1BAK A;  5D3V A;  4EMO A;  3KSY A;  4CYE A;  2CAY A;  4HAZ B;  2VKI A;  1V5U A;  1LB1 A;  5D3X A;  3BJI A;  1ZC3 B;  1XKE A;  1MPH A;  1M7E A;  1I2H A;  4BBK A;  1U29 A;  5J3Q A;  3D8D A;  3OAN A;  5KQ4 A;  4B6H A;  2HTH B;  4HAU B;  2Y7B A;  2VRW B;  4XWX A;  1OMW A;  5FI0 A;  4HB0 B;  2OTX A;  2XQN M;  3ODW A;  3FM8 C;  4MK0 A;  4K2O A;  1DDV A;  2KCJ A;  2V76 A;  3NSU A;  4ZRI A;  1UNQ A;  1V61 A;  2DTC A;  3SNH A;  2X18 A;  5JLJ B;  2N0Y A;  1AQC A;  2RGN B;  4HDO A;  1MKE A;  1BTN A;  3AU4 A;  2IFS A;  2RLO A;  2DYN A;  3A8Q A;  4DX9 0;  1W1H A;  2AL6 A;  1X86 A;  2J0J A;  2VSZ A;  3ULC A;  3ZDT A;  3PZD A;  2ROZ B;  1SHC A;  2QKL A;  2Y8G A;  1EVH A;  2Y8F A;  2ROV A;  1UPR A;  2KUP A;  3RCP A;  3P6A A;  2EJ8 A;  1M7R A;  2Q13 A;  4DBB A;  1E5W A;  3TFM A;  1NI2 A;  1KZG A;  3O96 A;  2DHJ A;  4HHV A;  1NTV A;  1XR0 B;  4A6K A;  1BTK A;  1LW3 A;  3PG7 A;  1GC6 A;  4YON A;  2W2X D;  5D27 A;  3A98 B;  4A6F A;  2K2J A;  5FI1 A;  2D2Q A;  1U5G A;  2KGX B;  4PNK A;  3SO6 A;  2YRY A;  2Z0O A;  4PQ0 A;  2COD A;  4KAX B;  4HB3 B;  3AU5 A;  2LG1 A;  2PZ1 A;  3KRX A;  1TQZ A;  5LOP B;  5JHG A;  5CLQ B;  5J3T A;  3AJ4 A;  5J3Y A;  1J0W A;  1WJ1 A;  4KHA A;  2L2I A;  2EMS A;  2LKO A;  3CIK A;  4HAY B;  2AEH A;  3SUZ A;  1FHX A;  3QWM A;  5DI9 B;  5HE1 A;  4F7U P;  4CHJ A;  5C16 A;  1QQG A;  2UVM A;  1SGH A;  5D3Y A;  2ADZ A;  2GCL A;  1WI1 A;  1PMS A;  2BCJ A;  4GMX B;  4NY0 A;  2Z0Q A;  3DXD A;  1Y19 B;  3U7D A;  3LJU X;  3VOQ A;  2QKM A;  5GOW B;  2K00 A;  4HAV B;  1KZ7 A;  2P0D A;  4GZU A;  3ULB A;  2NMB A;  2JP2 A;  4DXA B;  2J59 M;  2LYD A;  1I7A A;  3GYO A;  3GYP A;  4DX8 A;  4H8S A;  2MDX A;  4YL8 A;  2D9Y A;  5DIF B;  2COC A;  4HAT B;  4Z2M B;  1GG3 A;  4A5K A;  1MK7 B;  5C5B B;  3DXC A;  4K17 A;  2ELB A;  1OY2 A;  1Z87 A;  1U27 A;  1U5E A;  2DFK A;  2YT0 A;  5HE2 A;  1BWN A;  3T06 A;  1OQN A;  4WJ7 A;  3V5W A;  4Z2N A;  3M1I B;  1P5T A;  1X1F A;  1PLS A;  1WGU A;  5DHA B;  4IAP A;  2DLW A;  1Y5O A;  1XOD A;  2DX1 A;  2YF0 A;  3SYX A;  4HAW B;  2H7E A;  3PP2 A;  1FAO A;  2D9X A;  2MWN B;  1W1G A;  1FGZ A;  2GJY A;  1K5D B;  1W1D A;  3UZT A;  1XX0 A;  4P7I A;  4TKN A;  2GS0 A;  1WG7 A;  3TCA A;  3KY9 A;  4CHM A;  2D9V A;  3ZVR A;  1WVH A;  4HAX B;  4MY6 A;  4GXB A;  3N7C A;  2RUK B;  1J19 A;  1FOE A;  4WSF A;  3HQC A;  3TW1 A;  1X11 A;  3MDB C;  3FEH A;  4Y94 A;  2W2X C;  3X23 A;  2RSG A;  4ZRK A;  5HE3 A;  2J0K A;  2J0M A;  2I5C A;  3PSC A;  3QBV B;  1DRO A;  2P0H A;  2DN6 A;  5D3W A;  3PVL A;  4A6F B;  1GC7 A;  1MIZ B;  3P7Z A;  1DYN A;  4GMV A;  1X05 A;  3ODO A;  1H4R A;  1V5P A;  5L81 A;  1K5G B;  1NU2 A;  4D0N B;  2CRF A;  5CLL B;  2YSZ A;  2I5F A;  3D8E A;  1RRP B;  4C0A A;  4F7H A;  2R09 A;  4KVG B;  2DHI A;  1XD4 A;  2P8V A;  2DA0 A;  4L6E A;  2EMT A;  2LOZ A;  1WJM A;  3PVU A;  1FHW A;  4WVF B;  2M14 A;  4HB4 B;  2YS5 A;  1FB8 A;  4KHB B;  2DKP A;  2D4Q A;  2RVB B;  4HB2 B;  1IRS A;  2D11 A;  3PEG A;  1EAZ A;  2W2W A;  1UEF A; 
#chains in the Genus database with same CATH topology
 4GN1 A;  2ZPY A;  2RNR B;  3QIJ A;  5JP4 A;  3FSS A;  5DHF B;  2Z0P A;  3OHM B;  2FJL A;  1P6S A;  2LUL A;  3WA0 A;  1AWE A;  3CXB B;  2YS1 A;  2COF A;  2OQB A;  1ZYI A;  5C79 A;  1NTY A;  2K2U A;  2DKQ A;  1P3R A;  1RJ2 A;  2UZS A;  4A6H A;  5JHH A;  1V88 A;  2CY4 A;  1Q67 A;  2G35 A;  3KRW A;  2EC1 A;  1ZVR A;  3DXE A;  4GPT B;  2NZ8 B;  1U2B A;  2L1C A;  1X1G A;  1ZSQ A;  1ISN A;  1N3H A;  3TO1 A;  5C5B A;  1U5D A;  1QC6 A;  5HE0 A;  4IFS A;  1FHO A;  1U5F A;  3MPX A;  2D9W A;  2D10 A;  2E2X A;  1V5M A;  2N23 A;  2IYB A;  1DDW A;  2P0F A;  3VIA A;  4D6W A;  1EF1 A;  2GCJ A;  3IVF A;  4QJ5 B;  4MT7 A;  2MKR A;  5KCV A;  1H10 A;  1TXD A;  3DCX A;  3PVW A;  2DX5 A;  4IOY X;  4GOU A;  3F0W A;  2Z13 A;  1TJ6 A;  1ZC4 B;  5LON B;  2HE7 A;  5M4Y B;  2I1K A;  3A8P A;  3ML4 A;  3ODX A;  1DDM A;  3KZ1 A;  2RRF A;  2CY5 A;  2YT1 A;  4QJ3 B;  4TYZ A;  5EFX A;  2COA A;  5DH9 B;  2UZR A;  4GNK B;  1MAI A;  3D8F A;  3F5R A;  4K81 A;  3TVV A;  4QXA B;  2LOX A;  1KI1 B;  2YS3 A;  1PFJ A;  2YVC A;  4NSW A;  1UNR A;  3NWD A;  4K2P A;  2H7D A;  4F7G A;  3BIN A;  4KHO A;  4EJN A;  2DYQ A;  5KQ1 A;  3U8Z A;  1XCG A;  5I2M A;  2D9Z A;  4EKU A;  1UNP A;  4ZRJ A;  3HW2 B;  1V89 A;  1B55 A;  3B77 A;  4HSI A;  1MK9 B;  2ZKM X;  1MIX A;  1WGQ A;  2MFQ A;  1EGX A;  1ZM0 A;  2YT2 A;  2I1J A;  1UPQ A;  2R0D A;  3HK0 A;  4QJ4 B;  2DHK A;  4CSQ A;  3SV1 A;  3WYF B;  1FGY A;  5C6R A;  3G9W A;  4HDQ A;  1DBH A;  2ELA A;  2M38 A;  1BAK A;  5D3V A;  4EMO A;  3KSY A;  4CYE A;  2CAY A;  4HAZ B;  2VKI A;  4OSN A;  1V5U A;  2FJU B;  1LB1 A;  5D3X A;  3BJI A;  1ZC3 B;  1XKE A;  1MPH A;  1M7E A;  4DIX A;  1I2H A;  4BBK A;  1U29 A;  5J3Q A;  3D8D A;  3OAN A;  5KQ4 A;  4B6H A;  2HTH B;  4HAU B;  2Y7B A;  2VRW B;  4XWX A;  1OMW A;  5FI0 A;  4HB0 B;  5I2S A;  2OTX A;  1T77 A;  2XQN M;  3ODW A;  3FM8 C;  4MK0 A;  4K2O A;  5IRS A;  1DDV A;  2KCJ A;  2KUQ A;  2KR0 A;  2V76 A;  3NSU A;  4ZRI A;  1UNQ A;  1V61 A;  2DTC A;  3SNH A;  2X18 A;  5JLJ B;  2N0Y A;  2Z4D A;  1AQC A;  2RGN B;  1MKE A;  4HDO A;  1BTN A;  3AU4 A;  2IFS A;  2RLO A;  2DYN A;  3A8Q A;  4DX9 0;  1W1H A;  2AL6 A;  1X86 A;  2J0J A;  2VSZ A;  3ULC A;  3ZDT A;  3PZD A;  2ROZ B;  1SHC A;  2QKL A;  2Y8G A;  1EVH A;  2GUM A;  2Y8F A;  2ROV A;  1UPR A;  2KUP A;  3RCP A;  3P6A A;  2EJ8 A;  1M7R A;  2Q13 A;  4DBB A;  1E5W A;  3TFM A;  1NI2 A;  1KZG A;  3O96 A;  2DHJ A;  4HHV A;  1NTV A;  1XR0 B;  4A6K A;  1BTK A;  1LW3 A;  3PG7 A;  1GC6 A;  3NW8 A;  4YON A;  3NWA A;  2W2X D;  5D27 A;  2KIE A;  3A98 B;  4A6F A;  2K2J A;  5FI1 A;  2D2Q A;  1U5G A;  2KGX B;  4PNK A;  3SO6 A;  2YRY A;  2K8E A;  2Z0O A;  4PQ0 A;  2COD A;  4KAX B;  4HB3 B;  3U12 A;  3AU5 A;  2LG1 A;  2PZ1 A;  3KRX A;  1TQZ A;  5LOP B;  5JHG A;  5CLQ B;  3HSA A;  5J3T A;  3AJ4 A;  5J3Y A;  1J0W A;  1WJ1 A;  4KHA A;  2L2I A;  2EMS A;  2LKO A;  3CIK A;  4HAY B;  2AEH A;  3SUZ A;  1FHX A;  3QWM A;  5DI9 B;  5HE1 A;  4F7U P;  4CHJ A;  5C16 A;  1QQG A;  2UVM A;  1SGH A;  5D3Y A;  2ADZ A;  2GCL A;  2NBV A;  1WI1 A;  3HIE A;  1PMS A;  2BCJ A;  4GMX B;  4NY0 A;  2Z0Q A;  2K49 A;  4OT1 A;  3DXD A;  1Y19 B;  3U7D A;  3LJU X;  3VOQ A;  2QKM A;  5GOW B;  2K00 A;  4HAV B;  1KZ7 A;  2P0D A;  4GZU A;  3ULB A;  2NMB A;  2JP2 A;  4DXA B;  2J59 M;  2LYD A;  1I7A A;  3GYO A;  3GYP A;  4DX8 A;  4H8S A;  2MDX A;  4L1R A;  4YL8 A;  4KHB A;  2D9Y A;  5DIF B;  2COC A;  4HAT B;  4Z2M B;  1GG3 A;  4A5K A;  1MK7 B;  5C5B B;  3DXC A;  4K17 A;  2ELB A;  1OY2 A;  1Z87 A;  1U27 A;  1U5E A;  2DFK A;  2YT0 A;  5HE2 A;  1BWN A;  3T06 A;  1OQN A;  4WJ7 A;  3V5W A;  4Z2N A;  3M1I B;  1P5T A;  1X1F A;  5LG4 B;  1PLS A;  1WGU A;  5DHA B;  4IAP A;  2DLW A;  1Y5O A;  2Z14 A;  1XOD A;  2DX1 A;  2YF0 A;  3SYX A;  4HAW B;  2H7E A;  3PP2 A;  1FAO A;  2D9X A;  2MWN B;  1W1G A;  1FGZ A;  3NWF A;  2GJY A;  1K5D B;  1W1D A;  3UZT A;  1XX0 A;  4P7I A;  4TKN A;  2GS0 A;  1WG7 A;  3TCA A;  3KY9 A;  4CHM A;  2D9V A;  3ZVR A;  1WVH A;  4HAX B;  4MY6 A;  4GXB A;  3N7C A;  2RUK B;  1J19 A;  1FOE A;  4WSF A;  3HQC A;  3TW1 A;  1X11 A;  3MDB C;  3FEH A;  4Y94 A;  2W2X C;  3X23 A;  2RSG A;  4ZRK A;  5HE3 A;  2J0K A;  2J0M A;  2I5C A;  3PSC A;  3QBV B;  3FVC A;  1DRO A;  2P0H A;  2KIG A;  2DN6 A;  5D3W A;  3PVL A;  4A6F B;  1GC7 A;  1MIZ B;  3P7Z A;  1DYN A;  4GMV A;  1X05 A;  3ODO A;  1H4R A;  1V5P A;  5L81 A;  1K5G B;  1NU2 A;  4D0N B;  2CRF A;  5CLL B;  2YSZ A;  2I5F A;  3D8E A;  3A58 A;  1RRP B;  4C0A A;  4F7H A;  2R09 A;  4KVG B;  2DHI A;  1XD4 A;  2P8V A;  2DA0 A;  4L6E A;  2EMT A;  2LOZ A;  1WJM A;  3PVU A;  2R2Y A;  1FHW A;  4WVF B;  2M14 A;  1MI1 A;  4HB4 B;  2YS5 A;  1FB8 A;  4KHB B;  2DKP A;  2D4Q A;  2RVB B;  4HB2 B;  1IRS A;  2D11 A;  2Z59 A;  3PEG A;  1EAZ A;  2W2W A;  1UEF A; 
#chains in the Genus database with same CATH homology
 4GN1 A;  2ZPY A;  2RNR B;  3QIJ A;  5JP4 A;  3FSS A;  5DHF B;  2Z0P A;  2FJL A;  1P6S A;  2LUL A;  3WA0 A;  1AWE A;  3CXB B;  2YS1 A;  2COF A;  2OQB A;  5C79 A;  1NTY A;  2K2U A;  2DKQ A;  1P3R A;  1RJ2 A;  2UZS A;  4A6H A;  5JHH A;  1V88 A;  2CY4 A;  1Q67 A;  2G35 A;  3KRW A;  2EC1 A;  1ZVR A;  3DXE A;  4GPT B;  2NZ8 B;  1U2B A;  2L1C A;  1X1G A;  1ZSQ A;  1ISN A;  1N3H A;  3TO1 A;  5C5B A;  1U5D A;  1QC6 A;  5HE0 A;  4IFS A;  1FHO A;  1U5F A;  3MPX A;  2D9W A;  2D10 A;  2E2X A;  1V5M A;  2N23 A;  2IYB A;  1DDW A;  2P0F A;  3VIA A;  1EF1 A;  2GCJ A;  3IVF A;  4MT7 A;  2MKR A;  5KCV A;  1H10 A;  1TXD A;  3PVW A;  2DX5 A;  4IOY X;  3F0W A;  1TJ6 A;  1ZC4 B;  5LON B;  2HE7 A;  2I1K A;  3A8P A;  3ML4 A;  3ODX A;  1DDM A;  3KZ1 A;  2CY5 A;  2YT1 A;  4TYZ A;  5EFX A;  2COA A;  5DH9 B;  2UZR A;  1MAI A;  3D8F A;  3F5R A;  4K81 A;  3TVV A;  2LOX A;  1KI1 B;  2YS3 A;  1PFJ A;  2YVC A;  4NSW A;  1UNR A;  4K2P A;  2H7D A;  4F7G A;  3BIN A;  4KHO A;  4EJN A;  2DYQ A;  5KQ1 A;  3U8Z A;  1XCG A;  4EKU A;  2D9Z A;  1UNP A;  4ZRJ A;  3HW2 B;  1V89 A;  1B55 A;  1MK9 B;  1MIX A;  1WGQ A;  2MFQ A;  1EGX A;  1ZM0 A;  2I1J A;  1UPQ A;  2R0D A;  3HK0 A;  2DHK A;  3SV1 A;  3WYF B;  1FGY A;  5C6R A;  4HDQ A;  3G9W A;  1DBH A;  2ELA A;  2M38 A;  1BAK A;  5D3V A;  4EMO A;  3KSY A;  4CYE A;  2CAY A;  4HAZ B;  2VKI A;  1V5U A;  1LB1 A;  5D3X A;  3BJI A;  1ZC3 B;  1XKE A;  1MPH A;  1M7E A;  1I2H A;  4BBK A;  1U29 A;  5J3Q A;  3D8D A;  3OAN A;  5KQ4 A;  4B6H A;  2HTH B;  4HAU B;  2Y7B A;  2VRW B;  4XWX A;  1OMW A;  5FI0 A;  4HB0 B;  2OTX A;  2XQN M;  3ODW A;  3FM8 C;  4MK0 A;  4K2O A;  1DDV A;  2KCJ A;  2V76 A;  3NSU A;  4ZRI A;  1UNQ A;  1V61 A;  2DTC A;  3SNH A;  2X18 A;  5JLJ B;  2N0Y A;  1AQC A;  2RGN B;  4HDO A;  1MKE A;  1BTN A;  3AU4 A;  2IFS A;  2RLO A;  2DYN A;  3A8Q A;  4DX9 0;  1W1H A;  2AL6 A;  1X86 A;  2J0J A;  2VSZ A;  3ULC A;  3ZDT A;  3PZD A;  2ROZ B;  1SHC A;  2QKL A;  2Y8G A;  1EVH A;  2Y8F A;  2ROV A;  1UPR A;  2KUP A;  3RCP A;  3P6A A;  2EJ8 A;  1M7R A;  2Q13 A;  4DBB A;  1E5W A;  3TFM A;  1NI2 A;  1KZG A;  3O96 A;  2DHJ A;  4HHV A;  1NTV A;  1XR0 B;  4A6K A;  1BTK A;  1LW3 A;  3PG7 A;  1GC6 A;  4YON A;  2W2X D;  5D27 A;  3A98 B;  4A6F A;  2K2J A;  5FI1 A;  2D2Q A;  1U5G A;  2KGX B;  4PNK A;  3SO6 A;  2YRY A;  2Z0O A;  4PQ0 A;  2COD A;  4KAX B;  4HB3 B;  3AU5 A;  2LG1 A;  2PZ1 A;  3KRX A;  1TQZ A;  5LOP B;  5JHG A;  5CLQ B;  5J3T A;  3AJ4 A;  5J3Y A;  1J0W A;  1WJ1 A;  4KHA A;  2L2I A;  2EMS A;  2LKO A;  3CIK A;  4HAY B;  2AEH A;  3SUZ A;  1FHX A;  3QWM A;  5DI9 B;  5HE1 A;  4F7U P;  4CHJ A;  5C16 A;  1QQG A;  2UVM A;  1SGH A;  5D3Y A;  2ADZ A;  2GCL A;  1WI1 A;  1PMS A;  2BCJ A;  4GMX B;  4NY0 A;  2Z0Q A;  3DXD A;  1Y19 B;  3U7D A;  3LJU X;  3VOQ A;  2QKM A;  5GOW B;  2K00 A;  4HAV B;  1KZ7 A;  2P0D A;  4GZU A;  3ULB A;  2NMB A;  2JP2 A;  4DXA B;  2J59 M;  2LYD A;  1I7A A;  3GYO A;  3GYP A;  4DX8 A;  4H8S A;  2MDX A;  4YL8 A;  2D9Y A;  5DIF B;  2COC A;  4HAT B;  4Z2M B;  1GG3 A;  4A5K A;  1MK7 B;  5C5B B;  3DXC A;  4K17 A;  2ELB A;  1OY2 A;  1Z87 A;  1U27 A;  1U5E A;  2DFK A;  2YT0 A;  5HE2 A;  1BWN A;  3T06 A;  1OQN A;  4WJ7 A;  3V5W A;  4Z2N A;  3M1I B;  1P5T A;  1X1F A;  1PLS A;  1WGU A;  5DHA B;  4IAP A;  2DLW A;  1Y5O A;  1XOD A;  2DX1 A;  2YF0 A;  3SYX A;  4HAW B;  2H7E A;  3PP2 A;  1FAO A;  2D9X A;  2MWN B;  1W1G A;  1FGZ A;  2GJY A;  1K5D B;  1W1D A;  3UZT A;  1XX0 A;  4P7I A;  4TKN A;  2GS0 A;  1WG7 A;  3TCA A;  3KY9 A;  4CHM A;  2D9V A;  3ZVR A;  1WVH A;  4HAX B;  4MY6 A;  4GXB A;  3N7C A;  2RUK B;  1J19 A;  1FOE A;  4WSF A;  3HQC A;  3TW1 A;  1X11 A;  3MDB C;  3FEH A;  4Y94 A;  2W2X C;  3X23 A;  2RSG A;  4ZRK A;  5HE3 A;  2J0K A;  2J0M A;  2I5C A;  3PSC A;  3QBV B;  1DRO A;  2P0H A;  2DN6 A;  5D3W A;  3PVL A;  4A6F B;  1GC7 A;  1MIZ B;  3P7Z A;  1DYN A;  4GMV A;  1X05 A;  3ODO A;  1H4R A;  1V5P A;  5L81 A;  1K5G B;  1NU2 A;  4D0N B;  2CRF A;  5CLL B;  2YSZ A;  2I5F A;  3D8E A;  1RRP B;  4C0A A;  4F7H A;  2R09 A;  4KVG B;  2DHI A;  1XD4 A;  2P8V A;  2DA0 A;  4L6E A;  2EMT A;  2LOZ A;  1WJM A;  3PVU A;  1FHW A;  4WVF B;  2M14 A;  4HB4 B;  2YS5 A;  1FB8 A;  4KHB B;  2DKP A;  2D4Q A;  2RVB B;  4HB2 B;  1IRS A;  2D11 A;  3PEG A;  1EAZ A;  2W2W A;  1UEF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...