1OY2A

Coupling of folding and binding in the ptb domain of the signaling protein shc
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
191
structure length
191
Chain Sequence
GQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHC transforming protein
publication title Coupling of Folding and Binding in the PTB Domain of the Signaling Protein Shc
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 16
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2003-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1oy2A00
2OTXA 1UEFA 2DHKA 2W2XD 1U5DA 1WGUA 4HAXB 2LULA 1DYNA 2D10A 1XD4A 5C6RA 3X23A 5LOPB 5J3TA 2I1KA 5L81A 2LOZA 2D9VA 3G9WA 1KZ7A 4K2OA 3WYFB 4KHAA 1QQGA 1OMWA 2HE7A 1NTVA 3LJUX 2D4QA 2KGXB 1TQZA 4HAUB 1NI2A 3O96A 4KHOA 3TO1A 1FHXA 1I2HA 2RGNB 4HAYB 2MKRA 2KUPA 1EAZA 2G35A 3TVVA 4XWXA 1ZM0A 3AU4A 1H4RA 3FEHA 2NZ8B 5HE3A 2R09A 1MKEA 5HE1A 2AL6A 5EFXA 2CODA 3PEGA 4C0AA 1Q67A 1ZC4B 2J0JA 1DBHA 2I5CA 2EC1A 3QIJA 1ZC3B 2GCLA 1W1HA 2MFQA 3P7ZA 3FM8C 2RLOA 3QWMA 3OANA 2H7DA 2J59M 1WG7A 2DFKA 1TJ6A 5DHFB 5DHAB 4F7GA 1X86A 4F7HA 3PZDA 1V88A 2KCJA 2XQNM 2ZPYA 1Y5OA 3ULCA 4A6HA 2CY4A 1XKEA 3A98B 4HHVA 3F0WA 5J3QA 5J3YA 1J19A 5C16A 5D3XA 1W1DA 3M1IB 2L2IA 1FOEA 1Z87A 2P0FA 1U27A 2P0DA 2YS5A 2YF0A 3D8FA 4HB2B 5C5BB 1GG3A 1RJ2A 3SNHA 2VSZA 2DX5A 1WI1A 1K5DB 4HAZB 4KHBB 2UZRA 1FHOA 2I5FA 4Y94A 3KRWA 2EMSA 3VOQA 2Z0QA 3PSCA 1W1GA 2COCA 4GXBA 3BJIA 1UPRA 2LOXA 1N3HA 2CRFA 1P6SA 2J0KA 1V5UA 4HB0B 4DBBA 4IAPA 2RVBB 2ADZA 2Z0OA 2I1JA 1BTKA 1PLSA 2J0MA 2W2XC 1LW3A 1B55A 3U7DA 4PNKA 2DTCA 2GCJA 3D8EA 2P8VA 2E2XA 4HAWB 2PZ1A 3ODWA 2M38A 3BINA 4A6FB 1KI1B 4L6EA 1DDWA 1KZGA 1RRPB 2DKQA 4DX90 3ODOA 1FGZA 3TFMA 2AEHA 5KCVA 2VKIA 1MK7B 5DI9B 1IRSA 3PVLA 2DLWA 3PVWA 1M7EA 2P0HA 1M7RA 3ZVRA 4MK0A 3ULBA 2Y8FA 1TXDA 2RUKB 1PFJA 4A6FA 4A5KA 1U5FA 1V5PA 4D0NB 2DHIA 1FAOA 1AQCA 2COFA 4H8SA 2DYQA 4HB3B 2D9ZA 4CYEA 2M14A 1WJ1A 1X11A 2K2JA 3CIKA 2MWNB 2IFSA 5D3VA 4HB4B 2DX1A 1MPHA 3KY9A 2YT1A 4GPTB 3DXDA 1SGHA 1OQNA 4TKNA 3QBVB 1QC6A 1MK9B 2IYBA 3PG7A 2MDXA 2D2QA 2OQBA 5DIFB 5D3WA 2GS0A 3SV1A 1WVHA 1X1FA 2W2WA 3SO6A 5JLJB 1DDVA 4WVFB 2LKOA 1MIZB 2EMTA 4KVGB 3A8PA 4HATB 3DXCA 1MAIA 1X05A 2UZSA 1V5MA 2D9WA 1FGYA 5C79A 4NY0A 2K2UA 1OY2A 2R0DA 3F5RA 1PMSA 2X18A 4GMVA 4WSFA 4MT7A 4EKUA 4MY6A 3V5WA 4F7UP 5C5BA 1BTNA 3A8QA 1NTYA 2BCJA 4ZRKA 4WJ7A 2GJYA 3MPXA 1EF1A 1I7AA 1GC6A 3RCPA 1UPQA 3KRXA 3KZ1A 2HTHB 5FI0A 3ZDTA 4PQ0A 3SUZA 2N0YA 5CLLB 1GC7A 2LYDA 1X1GA 2NMBA 2Q13A 4IOYX 2RNRB 1ISNA 4P7IA 1H10A 2DHJA 2DN6A 2N23A 1XCGA 2EJ8A 3PP2A 2QKMA 5HE0A 5FI1A 5JHGA 5JHHA 4K2PA 2QKLA 1UNPA 5D3YA 5DH9B 4EMOA 1U5EA 1P3RA 1EVHA 4HDOA 4CHJA 3TW1A 2YS1A 5JP4A 2ROVA 4KAXB 4ZRIA 1DDMA 2RSGA 2JP2A 1BWNA 4HDQA 1MIXA 5KQ4A 4TYZA 1P5TA 3AU5A 4CHMA 2YRYA 3ML4A 4B6HA 1SHCA 4HAVB 1DROA 3U8ZA 4GZUA 2YVCA 1V89A 3SYXA 4A6KA 5HE2A 2ROZB 1FHWA 4DXAB 4GMXB 1WGQA 3NSUA 3CXBB 1NU2A 2D9YA 1V61A 3UZTA 5GOWB 1XODA 3HK0A 4YL8A 2Y7BA 2COAA 2UVMA 3P6AA 2ELBA 1U2BA 3DXEA 4K81A 1EGXA 2V76A 4IFSA 3T06A 4BBKA 1BAKA 3WA0A 2YS3A 1ZSQA 5LONB 5KQ1A 3D8DA 1FB8A 3KSYA 4DX8A 1Y19B 3AJ4A 2K00A 3GYOA 1U5GA 3ODXA 3TCAA 3FSSA 4K17A 2L1CA 1XX0A 2YT0A 5CLQB 1WJMA 1E5WA 2H7EA 3PVUA 2D9XA 2YSZA 2CY5A 2Z0PA 1XR0B 2CAYA 5D27A 3GYPA 4Z2MB 2DKPA 2FJLA 1AWEA 3HQCA 3N7CA 4ZRJA 1ZVRA 1UNQA 2VRWB 3VIAA 2DA0A 1UNRA 1U29A 2Y8GA 1J0WA 3MDBC 2LG1A 2D11A 2DYNA 2ELAA 1LB1A 3HW2B 4YONA 4GN1A 1K5GB 4NSWA 4Z2NA 3IVFA 4EJNA
chains in the Genus database with same CATH superfamily
2OTXA 1UEFA 2DHKA 2W2XD 1U5DA 1WGUA 4HAXB 2LULA 1DYNA 2D10A 1XD4A 5C6RA 3X23A 5LOPB 3HIEA 5J3TA 2I1KA 5L81A 2LOZA 2D9VA 3G9WA 1KZ7A 4K2OA 3HSAA 3WYFB 4KHAA 1QQGA 1OMWA 2HE7A 1NTVA 3LJUX 2D4QA 2Z14A 2KGXB 1TQZA 4HAUB 1NI2A 2R2YA 3O96A 4KHOA 3TO1A 1FHXA 1I2HA 2RGNB 5I2MA 4HAYB 2MKRA 2KUPA 2Z4DA 1EAZA 2G35A 2ZKMX 4D6WA 3TVVA 4XWXA 1ZM0A 3AU4A 1H4RA 3FEHA 2NZ8B 5HE3A 2R09A 1MKEA 5HE1A 2AL6A 5EFXA 2CODA 3PEGA 4C0AA 1Q67A 1ZC4B 2J0JA 1DBHA 2I5CA 2EC1A 3QIJA 1ZC3B 2GCLA 1W1HA 2MFQA 3P7ZA 3FM8C 2RLOA 3QWMA 3OANA 4HSIA 2H7DA 2J59M 1WG7A 2DFKA 4OSNA 1TJ6A 5DHFB 5DHAB 4F7GA 4OT1A 1X86A 2KUQA 4F7HA 3PZDA 2YT2A 1V88A 2KCJA 2XQNM 2ZPYA 3NWDA 1Y5OA 3ULCA 4A6HA 2CY4A 1XKEA 3A98B 4HHVA 3F0WA 5J3QA 5J3YA 1J19A 5C16A 5D3XA 2KIEA 1W1DA 3M1IB 2L2IA 1FOEA 1Z87A 2P0FA 1U27A 2P0DA 2YS5A 2YF0A 3D8FA 4HB2B 5C5BB 1GG3A 1RJ2A 3SNHA 2VSZA 2DX5A 5LG4B 1WI1A 4QJ5B 1K5DB 4HAZB 4KHBB 4DIXA 2UZRA 1FHOA 2I5FA 4Y94A 3KRWA 2EMSA 3VOQA 2Z0QA 3PSCA 3FVCA 1W1GA 2COCA 4GXBA 3BJIA 1UPRA 2LOXA 1N3HA 2CRFA 1P6SA 2J0KA 1V5UA 4HB0B 4DBBA 4IAPA 2RVBB 2ADZA 1T77A 2Z0OA 2I1JA 1BTKA 1PLSA 2J0MA 2W2XC 1LW3A 1B55A 3U7DA 4PNKA 2DTCA 2GCJA 3D8EA 2P8VA 2E2XA 4HAWB 2PZ1A 3ODWA 2M38A 3BINA 4A6FB 1KI1B 4L6EA 1DDWA 1KZGA 1RRPB 2DKQA 4DX90 3ODOA 3A58A 1FGZA 3TFMA 2AEHA 5KCVA 2VKIA 1MK7B 5DI9B 1IRSA 3PVLA 2DLWA 3PVWA 5IRSA 1M7EA 2P0HA 1M7RA 3ZVRA 4MK0A 3ULBA 2Y8FA 1TXDA 2RUKB 1PFJA 2Z13A 2GUMA 4A5KA 4A6FA 1U5FA 2Z59A 1V5PA 4D0NB 2DHIA 1FAOA 1AQCA 2COFA 4H8SA 2DYQA 4HB3B 2D9ZA 4CYEA 2M14A 1WJ1A 1X11A 2K2JA 3CIKA 2MWNB 2IFSA 5D3VA 4HB4B 2DX1A 1MPHA 3KY9A 2YT1A 4GPTB 3DXDA 1SGHA 1OQNA 4TKNA 3QBVB 1QC6A 1MK9B 2IYBA 3PG7A 4L1RA 2MDXA 2D2QA 2OQBA 5DIFB 5D3WA 2GS0A 3SV1A 1WVHA 1X1FA 2W2WA 3SO6A 5JLJB 1DDVA 2K49A 2LKOA 4WVFB 1MIZB 2EMTA 4KVGB 3A8PA 4HATB 3DXCA 1MAIA 1X05A 2UZSA 3NWFA 1V5MA 2D9WA 1FGYA 5C79A 2NBVA 4NY0A 2K2UA 1OY2A 2R0DA 3F5RA 1PMSA 2X18A 4GMVA 4WSFA 4MT7A 4EKUA 4MY6A 3V5WA 4F7UP 5C5BA 1BTNA 3A8QA 1NTYA 2BCJA 4ZRKA 4WJ7A 2GJYA 3MPXA 2FJUB 1EF1A 1I7AA 5M4YB 1GC6A 3RCPA 1UPQA 4KHBA 3KRXA 3KZ1A 2HTHB 5FI0A 2RRFA 3ZDTA 4PQ0A 3SUZA 2N0YA 5CLLB 1GC7A 2LYDA 1X1GA 2NMBA 2Q13A 4IOYX 2RNRB 1ISNA 4P7IA 1H10A 2DHJA 2DN6A 2N23A 1XCGA 2EJ8A 3PP2A 2QKMA 5HE0A 5FI1A 5JHGA 5JHHA 4K2PA 2QKLA 1UNPA 5D3YA 5DH9B 4EMOA 1MI1A 1U5EA 1P3RA 1EVHA 4HDOA 4CHJA 3TW1A 2YS1A 5JP4A 2ROVA 4KAXB 4ZRIA 1DDMA 2RSGA 2JP2A 1BWNA 4HDQA 1MIXA 5KQ4A 4TYZA 1P5TA 3AU5A 4CHMA 2YRYA 3ML4A 4QJ4B 4B6HA 1SHCA 4HAVB 4QXAB 1DROA 3U8ZA 4GZUA 2YVCA 1V89A 3SYXA 4A6KA 5HE2A 2ROZB 1FHWA 4DXAB 4GMXB 1WGQA 3NSUA 3CXBB 1NU2A 4QJ3B 2D9YA 1V61A 3B77A 3OHMB 5GOWB 3UZTA 1XODA 3HK0A 4YL8A 2Y7BA 2COAA 2UVMA 3P6AA 2ELBA 1U2BA 3DXEA 4K81A 1EGXA 2V76A 4IFSA 3T06A 4BBKA 1BAKA 3WA0A 2YS3A 1ZSQA 5LONB 5KQ1A 3D8DA 1FB8A 3KSYA 4DX8A 1Y19B 2K8EA 3AJ4A 2K00A 3GYOA 1U5GA 3ODXA 3U12A 3TCAA 3FSSA 4CSQA 4K17A 2L1CA 1XX0A 2YT0A 5CLQB 3NW8A 1WJMA 1E5WA 2H7EA 3PVUA 3DCXA 2D9XA 2YSZA 2CY5A 2Z0PA 1XR0B 2CAYA 5D27A 1ZYIA 3GYPA 2DKPA 2FJLA 4Z2MB 1AWEA 3HQCA 3N7CA 4ZRJA 1ZVRA 1UNQA 2VRWB 3VIAA 2DA0A 1UNRA 1U29A 2Y8GA 1J0WA 2KIGA 2LG1A 3MDBC 4GNKB 2D11A 2DYNA 2ELAA 3NWAA 1LB1A 5I2SA 3HW2B 4YONA 4GN1A 2KR0A 1K5GB 4NSWA 4Z2NA 3IVFA 4EJNA 4GOUA
chains in the Genus database with same CATH topology
2OTXA 1UEFA 2DHKA 2W2XD 1U5DA 1WGUA 4HAXB 2LULA 1DYNA 2D10A 1XD4A 5C6RA 3X23A 5LOPB 5J3TA 2I1KA 5L81A 2LOZA 2D9VA 3G9WA 1KZ7A 4K2OA 3WYFB 4KHAA 1QQGA 1OMWA 2HE7A 1NTVA 3LJUX 2D4QA 2KGXB 1TQZA 4HAUB 1NI2A 3O96A 4KHOA 3TO1A 1FHXA 1I2HA 2RGNB 4HAYB 2MKRA 2KUPA 1EAZA 2G35A 3TVVA 4XWXA 1ZM0A 3AU4A 1H4RA 3FEHA 2NZ8B 5HE3A 2R09A 1MKEA 5HE1A 2AL6A 5EFXA 2CODA 3PEGA 4C0AA 1Q67A 1ZC4B 2J0JA 1DBHA 2I5CA 2EC1A 3QIJA 1ZC3B 2GCLA 1W1HA 2MFQA 3P7ZA 3FM8C 2RLOA 3QWMA 3OANA 2H7DA 2J59M 1WG7A 2DFKA 1TJ6A 5DHFB 5DHAB 4F7GA 1X86A 4F7HA 3PZDA 1V88A 2KCJA 2XQNM 2ZPYA 1Y5OA 3ULCA 4A6HA 2CY4A 1XKEA 3A98B 4HHVA 3F0WA 5J3QA 5J3YA 1J19A 5C16A 5D3XA 1W1DA 3M1IB 2L2IA 1FOEA 1Z87A 2P0FA 1U27A 2P0DA 2YS5A 2YF0A 3D8FA 4HB2B 5C5BB 1GG3A 1RJ2A 3SNHA 2VSZA 2DX5A 1WI1A 1K5DB 4HAZB 4KHBB 2UZRA 1FHOA 2I5FA 4Y94A 3KRWA 2EMSA 3VOQA 2Z0QA 3PSCA 1W1GA 2COCA 4GXBA 3BJIA 1UPRA 2LOXA 1N3HA 2CRFA 1P6SA 2J0KA 1V5UA 4HB0B 4DBBA 4IAPA 2RVBB 2ADZA 2Z0OA 2I1JA 1BTKA 1PLSA 2J0MA 2W2XC 1LW3A 1B55A 3U7DA 4PNKA 2DTCA 2GCJA 3D8EA 2P8VA 2E2XA 4HAWB 2PZ1A 3ODWA 2M38A 3BINA 4A6FB 1KI1B 4L6EA 1DDWA 1KZGA 1RRPB 2DKQA 4DX90 3ODOA 1FGZA 3TFMA 2AEHA 5KCVA 2VKIA 1MK7B 5DI9B 1IRSA 3PVLA 2DLWA 3PVWA 1M7EA 2P0HA 1M7RA 3ZVRA 4MK0A 3ULBA 2Y8FA 1TXDA 2RUKB 1PFJA 4A6FA 4A5KA 1U5FA 1V5PA 4D0NB 2DHIA 1FAOA 1AQCA 2COFA 4H8SA 2DYQA 4HB3B 2D9ZA 4CYEA 2M14A 1WJ1A 1X11A 2K2JA 3CIKA 2MWNB 2IFSA 5D3VA 4HB4B 2DX1A 1MPHA 3KY9A 2YT1A 4GPTB 3DXDA 1SGHA 1OQNA 4TKNA 3QBVB 1QC6A 1MK9B 2IYBA 3PG7A 2MDXA 2D2QA 2OQBA 5DIFB 5D3WA 2GS0A 3SV1A 1WVHA 1X1FA 2W2WA 3SO6A 5JLJB 1DDVA 4WVFB 2LKOA 1MIZB 2EMTA 4KVGB 3A8PA 4HATB 3DXCA 1MAIA 1X05A 2UZSA 1V5MA 2D9WA 1FGYA 5C79A 4NY0A 2K2UA 1OY2A 2R0DA 3F5RA 1PMSA 2X18A 4GMVA 4WSFA 4MT7A 4EKUA 4MY6A 3V5WA 4F7UP 5C5BA 1BTNA 3A8QA 1NTYA 2BCJA 4ZRKA 4WJ7A 2GJYA 3MPXA 1EF1A 1I7AA 1GC6A 3RCPA 1UPQA 3KRXA 3KZ1A 2HTHB 5FI0A 3ZDTA 4PQ0A 3SUZA 2N0YA 5CLLB 1GC7A 2LYDA 1X1GA 2NMBA 2Q13A 4IOYX 2RNRB 1ISNA 4P7IA 1H10A 2DHJA 2DN6A 2N23A 1XCGA 2EJ8A 3PP2A 2QKMA 5HE0A 5FI1A 5JHGA 5JHHA 4K2PA 2QKLA 1UNPA 5D3YA 5DH9B 4EMOA 1U5EA 1P3RA 1EVHA 4HDOA 4CHJA 3TW1A 2YS1A 5JP4A 2ROVA 4KAXB 4ZRIA 1DDMA 2RSGA 2JP2A 1BWNA 4HDQA 1MIXA 5KQ4A 4TYZA 1P5TA 3AU5A 4CHMA 2YRYA 3ML4A 4B6HA 1SHCA 4HAVB 1DROA 3U8ZA 4GZUA 2YVCA 1V89A 3SYXA 4A6KA 5HE2A 2ROZB 1FHWA 4DXAB 4GMXB 1WGQA 3NSUA 3CXBB 1NU2A 2D9YA 1V61A 3UZTA 5GOWB 1XODA 3HK0A 4YL8A 2Y7BA 2COAA 2UVMA 3P6AA 2ELBA 1U2BA 3DXEA 4K81A 1EGXA 2V76A 4IFSA 3T06A 4BBKA 1BAKA 3WA0A 2YS3A 1ZSQA 5LONB 5KQ1A 3D8DA 1FB8A 3KSYA 4DX8A 1Y19B 3AJ4A 2K00A 3GYOA 1U5GA 3ODXA 3TCAA 3FSSA 4K17A 2L1CA 1XX0A 2YT0A 5CLQB 1WJMA 1E5WA 2H7EA 3PVUA 2D9XA 2YSZA 2CY5A 2Z0PA 1XR0B 2CAYA 5D27A 3GYPA 4Z2MB 2DKPA 2FJLA 1AWEA 3HQCA 3N7CA 4ZRJA 1ZVRA 1UNQA 2VRWB 3VIAA 2DA0A 1UNRA 1U29A 2Y8GA 1J0WA 3MDBC 2LG1A 2D11A 2DYNA 2ELAA 1LB1A 3HW2B 4YONA 4GN1A 1K5GB 4NSWA 4Z2NA 3IVFA 4EJNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTX A;  1UEF A;  2DHK A;  2W2X D;  1U5D A;  1WGU A;  4HAX B;  2LUL A;  1DYN A;  2D10 A;  1XD4 A;  5C6R A;  3X23 A;  5LOP B;  5J3T A;  2I1K A;  5L81 A;  2LOZ A;  2D9V A;  3G9W A;  1KZ7 A;  4K2O A;  3WYF B;  4KHA A;  1QQG A;  1OMW A;  2HE7 A;  1NTV A;  3LJU X;  2D4Q A;  2KGX B;  1TQZ A;  4HAU B;  1NI2 A;  3O96 A;  4KHO A;  3TO1 A;  1FHX A;  1I2H A;  2RGN B;  4HAY B;  2MKR A;  2KUP A;  1EAZ A;  2G35 A;  3TVV A;  4XWX A;  1ZM0 A;  3AU4 A;  1H4R A;  3FEH A;  2NZ8 B;  5HE3 A;  2R09 A;  1MKE A;  5HE1 A;  2AL6 A;  5EFX A;  2COD A;  3PEG A;  4C0A A;  1Q67 A;  1ZC4 B;  2J0J A;  1DBH A;  2I5C A;  2EC1 A;  3QIJ A;  1ZC3 B;  2GCL A;  1W1H A;  2MFQ A;  3P7Z A;  3FM8 C;  2RLO A;  3QWM A;  3OAN A;  2H7D A;  2J59 M;  1WG7 A;  2DFK A;  1TJ6 A;  5DHF B;  5DHA B;  4F7G A;  1X86 A;  4F7H A;  3PZD A;  1V88 A;  2KCJ A;  2XQN M;  2ZPY A;  1Y5O A;  3ULC A;  4A6H A;  2CY4 A;  1XKE A;  3A98 B;  4HHV A;  3F0W A;  5J3Q A;  5J3Y A;  1J19 A;  5C16 A;  5D3X A;  1W1D A;  3M1I B;  2L2I A;  1FOE A;  1Z87 A;  2P0F A;  1U27 A;  2P0D A;  2YS5 A;  2YF0 A;  3D8F A;  4HB2 B;  5C5B B;  1GG3 A;  1RJ2 A;  3SNH A;  2VSZ A;  2DX5 A;  1WI1 A;  1K5D B;  4HAZ B;  4KHB B;  2UZR A;  1FHO A;  2I5F A;  4Y94 A;  3KRW A;  2EMS A;  3VOQ A;  2Z0Q A;  3PSC A;  1W1G A;  2COC A;  4GXB A;  3BJI A;  1UPR A;  2LOX A;  1N3H A;  2CRF A;  1P6S A;  2J0K A;  1V5U A;  4HB0 B;  4DBB A;  4IAP A;  2RVB B;  2ADZ A;  2Z0O A;  2I1J A;  1BTK A;  1PLS A;  2J0M A;  2W2X C;  1LW3 A;  1B55 A;  3U7D A;  4PNK A;  2DTC A;  2GCJ A;  3D8E A;  2P8V A;  2E2X A;  4HAW B;  2PZ1 A;  3ODW A;  2M38 A;  3BIN A;  4A6F B;  1KI1 B;  4L6E A;  1DDW A;  1KZG A;  1RRP B;  2DKQ A;  4DX9 0;  3ODO A;  1FGZ A;  3TFM A;  2AEH A;  5KCV A;  2VKI A;  1MK7 B;  5DI9 B;  1IRS A;  3PVL A;  2DLW A;  3PVW A;  1M7E A;  2P0H A;  1M7R A;  3ZVR A;  4MK0 A;  3ULB A;  2Y8F A;  1TXD A;  2RUK B;  1PFJ A;  4A6F A;  4A5K A;  1U5F A;  1V5P A;  4D0N B;  2DHI A;  1FAO A;  1AQC A;  2COF A;  4H8S A;  2DYQ A;  4HB3 B;  2D9Z A;  4CYE A;  2M14 A;  1WJ1 A;  1X11 A;  2K2J A;  3CIK A;  2MWN B;  2IFS A;  5D3V A;  4HB4 B;  2DX1 A;  1MPH A;  3KY9 A;  2YT1 A;  4GPT B;  3DXD A;  1SGH A;  1OQN A;  4TKN A;  3QBV B;  1QC6 A;  1MK9 B;  2IYB A;  3PG7 A;  2MDX A;  2D2Q A;  2OQB A;  5DIF B;  5D3W A;  2GS0 A;  3SV1 A;  1WVH A;  1X1F A;  2W2W A;  3SO6 A;  5JLJ B;  1DDV A;  4WVF B;  2LKO A;  1MIZ B;  2EMT A;  4KVG B;  3A8P A;  4HAT B;  3DXC A;  1MAI A;  1X05 A;  2UZS A;  1V5M A;  2D9W A;  1FGY A;  5C79 A;  4NY0 A;  2K2U A;  1OY2 A;  2R0D A;  3F5R A;  1PMS A;  2X18 A;  4GMV A;  4WSF A;  4MT7 A;  4EKU A;  4MY6 A;  3V5W A;  4F7U P;  5C5B A;  1BTN A;  3A8Q A;  1NTY A;  2BCJ A;  4ZRK A;  4WJ7 A;  2GJY A;  3MPX A;  1EF1 A;  1I7A A;  1GC6 A;  3RCP A;  1UPQ A;  3KRX A;  3KZ1 A;  2HTH B;  5FI0 A;  3ZDT A;  4PQ0 A;  3SUZ A;  2N0Y A;  5CLL B;  1GC7 A;  2LYD A;  1X1G A;  2NMB A;  2Q13 A;  4IOY X;  2RNR B;  1ISN A;  4P7I A;  1H10 A;  2DHJ A;  2DN6 A;  2N23 A;  1XCG A;  2EJ8 A;  3PP2 A;  2QKM A;  5HE0 A;  5FI1 A;  5JHG A;  5JHH A;  4K2P A;  2QKL A;  1UNP A;  5D3Y A;  5DH9 B;  4EMO A;  1U5E A;  1P3R A;  1EVH A;  4HDO A;  4CHJ A;  3TW1 A;  2YS1 A;  5JP4 A;  2ROV A;  4KAX B;  4ZRI A;  1DDM A;  2RSG A;  2JP2 A;  1BWN A;  4HDQ A;  1MIX A;  5KQ4 A;  4TYZ A;  1P5T A;  3AU5 A;  4CHM A;  2YRY A;  3ML4 A;  4B6H A;  1SHC A;  4HAV B;  1DRO A;  3U8Z A;  4GZU A;  2YVC A;  1V89 A;  3SYX A;  4A6K A;  5HE2 A;  2ROZ B;  1FHW A;  4DXA B;  4GMX B;  1WGQ A;  3NSU A;  3CXB B;  1NU2 A;  2D9Y A;  1V61 A;  3UZT A;  5GOW B;  1XOD A;  3HK0 A;  4YL8 A;  2Y7B A;  2COA A;  2UVM A;  3P6A A;  2ELB A;  1U2B A;  3DXE A;  4K81 A;  1EGX A;  2V76 A;  4IFS A;  3T06 A;  4BBK A;  1BAK A;  3WA0 A;  2YS3 A;  1ZSQ A;  5LON B;  5KQ1 A;  3D8D A;  1FB8 A;  3KSY A;  4DX8 A;  1Y19 B;  3AJ4 A;  2K00 A;  3GYO A;  1U5G A;  3ODX A;  3TCA A;  3FSS A;  4K17 A;  2L1C A;  1XX0 A;  2YT0 A;  5CLQ B;  1WJM A;  1E5W A;  2H7E A;  3PVU A;  2D9X A;  2YSZ A;  2CY5 A;  2Z0P A;  1XR0 B;  2CAY A;  5D27 A;  3GYP A;  4Z2M B;  2DKP A;  2FJL A;  1AWE A;  3HQC A;  3N7C A;  4ZRJ A;  1ZVR A;  1UNQ A;  2VRW B;  3VIA A;  2DA0 A;  1UNR A;  1U29 A;  2Y8G A;  1J0W A;  3MDB C;  2LG1 A;  2D11 A;  2DYN A;  2ELA A;  1LB1 A;  3HW2 B;  4YON A;  4GN1 A;  1K5G B;  4NSW A;  4Z2N A;  3IVF A;  4EJN A; 
#chains in the Genus database with same CATH topology
 2OTX A;  1UEF A;  2DHK A;  2W2X D;  1U5D A;  1WGU A;  4HAX B;  2LUL A;  1DYN A;  2D10 A;  1XD4 A;  5C6R A;  3X23 A;  5LOP B;  3HIE A;  5J3T A;  2I1K A;  5L81 A;  2LOZ A;  2D9V A;  3G9W A;  1KZ7 A;  4K2O A;  3HSA A;  3WYF B;  4KHA A;  1QQG A;  1OMW A;  2HE7 A;  1NTV A;  3LJU X;  2D4Q A;  2Z14 A;  2KGX B;  1TQZ A;  4HAU B;  1NI2 A;  2R2Y A;  3O96 A;  4KHO A;  3TO1 A;  1FHX A;  1I2H A;  2RGN B;  5I2M A;  4HAY B;  2MKR A;  2KUP A;  2Z4D A;  1EAZ A;  2G35 A;  2ZKM X;  4D6W A;  3TVV A;  4XWX A;  1ZM0 A;  3AU4 A;  1H4R A;  3FEH A;  2NZ8 B;  5HE3 A;  2R09 A;  1MKE A;  5HE1 A;  2AL6 A;  5EFX A;  2COD A;  3PEG A;  4C0A A;  1Q67 A;  1ZC4 B;  2J0J A;  1DBH A;  2I5C A;  2EC1 A;  3QIJ A;  1ZC3 B;  2GCL A;  1W1H A;  2MFQ A;  3P7Z A;  3FM8 C;  2RLO A;  3QWM A;  3OAN A;  4HSI A;  2H7D A;  2J59 M;  1WG7 A;  2DFK A;  4OSN A;  1TJ6 A;  5DHF B;  5DHA B;  4F7G A;  4OT1 A;  1X86 A;  2KUQ A;  4F7H A;  3PZD A;  2YT2 A;  1V88 A;  2KCJ A;  2XQN M;  2ZPY A;  3NWD A;  1Y5O A;  3ULC A;  4A6H A;  2CY4 A;  1XKE A;  3A98 B;  4HHV A;  3F0W A;  5J3Q A;  5J3Y A;  1J19 A;  5C16 A;  5D3X A;  2KIE A;  1W1D A;  3M1I B;  2L2I A;  1FOE A;  1Z87 A;  2P0F A;  1U27 A;  2P0D A;  2YS5 A;  2YF0 A;  3D8F A;  4HB2 B;  5C5B B;  1GG3 A;  1RJ2 A;  3SNH A;  2VSZ A;  2DX5 A;  5LG4 B;  1WI1 A;  4QJ5 B;  1K5D B;  4HAZ B;  4KHB B;  4DIX A;  2UZR A;  1FHO A;  2I5F A;  4Y94 A;  3KRW A;  2EMS A;  3VOQ A;  2Z0Q A;  3PSC A;  3FVC A;  1W1G A;  2COC A;  4GXB A;  3BJI A;  1UPR A;  2LOX A;  1N3H A;  2CRF A;  1P6S A;  2J0K A;  1V5U A;  4HB0 B;  4DBB A;  4IAP A;  2RVB B;  2ADZ A;  1T77 A;  2Z0O A;  2I1J A;  1BTK A;  1PLS A;  2J0M A;  2W2X C;  1LW3 A;  1B55 A;  3U7D A;  4PNK A;  2DTC A;  2GCJ A;  3D8E A;  2P8V A;  2E2X A;  4HAW B;  2PZ1 A;  3ODW A;  2M38 A;  3BIN A;  4A6F B;  1KI1 B;  4L6E A;  1DDW A;  1KZG A;  1RRP B;  2DKQ A;  4DX9 0;  3ODO A;  3A58 A;  1FGZ A;  3TFM A;  2AEH A;  5KCV A;  2VKI A;  1MK7 B;  5DI9 B;  1IRS A;  3PVL A;  2DLW A;  3PVW A;  5IRS A;  1M7E A;  2P0H A;  1M7R A;  3ZVR A;  4MK0 A;  3ULB A;  2Y8F A;  1TXD A;  2RUK B;  1PFJ A;  2Z13 A;  2GUM A;  4A5K A;  4A6F A;  1U5F A;  2Z59 A;  1V5P A;  4D0N B;  2DHI A;  1FAO A;  1AQC A;  2COF A;  4H8S A;  2DYQ A;  4HB3 B;  2D9Z A;  4CYE A;  2M14 A;  1WJ1 A;  1X11 A;  2K2J A;  3CIK A;  2MWN B;  2IFS A;  5D3V A;  4HB4 B;  2DX1 A;  1MPH A;  3KY9 A;  2YT1 A;  4GPT B;  3DXD A;  1SGH A;  1OQN A;  4TKN A;  3QBV B;  1QC6 A;  1MK9 B;  2IYB A;  3PG7 A;  4L1R A;  2MDX A;  2D2Q A;  2OQB A;  5DIF B;  5D3W A;  2GS0 A;  3SV1 A;  1WVH A;  1X1F A;  2W2W A;  3SO6 A;  5JLJ B;  1DDV A;  2K49 A;  2LKO A;  4WVF B;  1MIZ B;  2EMT A;  4KVG B;  3A8P A;  4HAT B;  3DXC A;  1MAI A;  1X05 A;  2UZS A;  3NWF A;  1V5M A;  2D9W A;  1FGY A;  5C79 A;  2NBV A;  4NY0 A;  2K2U A;  1OY2 A;  2R0D A;  3F5R A;  1PMS A;  2X18 A;  4GMV A;  4WSF A;  4MT7 A;  4EKU A;  4MY6 A;  3V5W A;  4F7U P;  5C5B A;  1BTN A;  3A8Q A;  1NTY A;  2BCJ A;  4ZRK A;  4WJ7 A;  2GJY A;  3MPX A;  2FJU B;  1EF1 A;  1I7A A;  5M4Y B;  1GC6 A;  3RCP A;  1UPQ A;  4KHB A;  3KRX A;  3KZ1 A;  2HTH B;  5FI0 A;  2RRF A;  3ZDT A;  4PQ0 A;  3SUZ A;  2N0Y A;  5CLL B;  1GC7 A;  2LYD A;  1X1G A;  2NMB A;  2Q13 A;  4IOY X;  2RNR B;  1ISN A;  4P7I A;  1H10 A;  2DHJ A;  2DN6 A;  2N23 A;  1XCG A;  2EJ8 A;  3PP2 A;  2QKM A;  5HE0 A;  5FI1 A;  5JHG A;  5JHH A;  4K2P A;  2QKL A;  1UNP A;  5D3Y A;  5DH9 B;  4EMO A;  1MI1 A;  1U5E A;  1P3R A;  1EVH A;  4HDO A;  4CHJ A;  3TW1 A;  2YS1 A;  5JP4 A;  2ROV A;  4KAX B;  4ZRI A;  1DDM A;  2RSG A;  2JP2 A;  1BWN A;  4HDQ A;  1MIX A;  5KQ4 A;  4TYZ A;  1P5T A;  3AU5 A;  4CHM A;  2YRY A;  3ML4 A;  4QJ4 B;  4B6H A;  1SHC A;  4HAV B;  4QXA B;  1DRO A;  3U8Z A;  4GZU A;  2YVC A;  1V89 A;  3SYX A;  4A6K A;  5HE2 A;  2ROZ B;  1FHW A;  4DXA B;  4GMX B;  1WGQ A;  3NSU A;  3CXB B;  1NU2 A;  4QJ3 B;  2D9Y A;  1V61 A;  3B77 A;  3OHM B;  5GOW B;  3UZT A;  1XOD A;  3HK0 A;  4YL8 A;  2Y7B A;  2COA A;  2UVM A;  3P6A A;  2ELB A;  1U2B A;  3DXE A;  4K81 A;  1EGX A;  2V76 A;  4IFS A;  3T06 A;  4BBK A;  1BAK A;  3WA0 A;  2YS3 A;  1ZSQ A;  5LON B;  5KQ1 A;  3D8D A;  1FB8 A;  3KSY A;  4DX8 A;  1Y19 B;  2K8E A;  3AJ4 A;  2K00 A;  3GYO A;  1U5G A;  3ODX A;  3U12 A;  3TCA A;  3FSS A;  4CSQ A;  4K17 A;  2L1C A;  1XX0 A;  2YT0 A;  5CLQ B;  3NW8 A;  1WJM A;  1E5W A;  2H7E A;  3PVU A;  3DCX A;  2D9X A;  2YSZ A;  2CY5 A;  2Z0P A;  1XR0 B;  2CAY A;  5D27 A;  1ZYI A;  3GYP A;  2DKP A;  2FJL A;  4Z2M B;  1AWE A;  3HQC A;  3N7C A;  4ZRJ A;  1ZVR A;  1UNQ A;  2VRW B;  3VIA A;  2DA0 A;  1UNR A;  1U29 A;  2Y8G A;  1J0W A;  2KIG A;  2LG1 A;  3MDB C;  4GNK B;  2D11 A;  2DYN A;  2ELA A;  3NWA A;  1LB1 A;  5I2S A;  3HW2 B;  4YON A;  4GN1 A;  2KR0 A;  1K5G B;  4NSW A;  4Z2N A;  3IVF A;  4EJN A;  4GOU A; 
#chains in the Genus database with same CATH homology
 2OTX A;  1UEF A;  2DHK A;  2W2X D;  1U5D A;  1WGU A;  4HAX B;  2LUL A;  1DYN A;  2D10 A;  1XD4 A;  5C6R A;  3X23 A;  5LOP B;  5J3T A;  2I1K A;  5L81 A;  2LOZ A;  2D9V A;  3G9W A;  1KZ7 A;  4K2O A;  3WYF B;  4KHA A;  1QQG A;  1OMW A;  2HE7 A;  1NTV A;  3LJU X;  2D4Q A;  2KGX B;  1TQZ A;  4HAU B;  1NI2 A;  3O96 A;  4KHO A;  3TO1 A;  1FHX A;  1I2H A;  2RGN B;  4HAY B;  2MKR A;  2KUP A;  1EAZ A;  2G35 A;  3TVV A;  4XWX A;  1ZM0 A;  3AU4 A;  1H4R A;  3FEH A;  2NZ8 B;  5HE3 A;  2R09 A;  1MKE A;  5HE1 A;  2AL6 A;  5EFX A;  2COD A;  3PEG A;  4C0A A;  1Q67 A;  1ZC4 B;  2J0J A;  1DBH A;  2I5C A;  2EC1 A;  3QIJ A;  1ZC3 B;  2GCL A;  1W1H A;  2MFQ A;  3P7Z A;  3FM8 C;  2RLO A;  3QWM A;  3OAN A;  2H7D A;  2J59 M;  1WG7 A;  2DFK A;  1TJ6 A;  5DHF B;  5DHA B;  4F7G A;  1X86 A;  4F7H A;  3PZD A;  1V88 A;  2KCJ A;  2XQN M;  2ZPY A;  1Y5O A;  3ULC A;  4A6H A;  2CY4 A;  1XKE A;  3A98 B;  4HHV A;  3F0W A;  5J3Q A;  5J3Y A;  1J19 A;  5C16 A;  5D3X A;  1W1D A;  3M1I B;  2L2I A;  1FOE A;  1Z87 A;  2P0F A;  1U27 A;  2P0D A;  2YS5 A;  2YF0 A;  3D8F A;  4HB2 B;  5C5B B;  1GG3 A;  1RJ2 A;  3SNH A;  2VSZ A;  2DX5 A;  1WI1 A;  1K5D B;  4HAZ B;  4KHB B;  2UZR A;  1FHO A;  2I5F A;  4Y94 A;  3KRW A;  2EMS A;  3VOQ A;  2Z0Q A;  3PSC A;  1W1G A;  2COC A;  4GXB A;  3BJI A;  1UPR A;  2LOX A;  1N3H A;  2CRF A;  1P6S A;  2J0K A;  1V5U A;  4HB0 B;  4DBB A;  4IAP A;  2RVB B;  2ADZ A;  2Z0O A;  2I1J A;  1BTK A;  1PLS A;  2J0M A;  2W2X C;  1LW3 A;  1B55 A;  3U7D A;  4PNK A;  2DTC A;  2GCJ A;  3D8E A;  2P8V A;  2E2X A;  4HAW B;  2PZ1 A;  3ODW A;  2M38 A;  3BIN A;  4A6F B;  1KI1 B;  4L6E A;  1DDW A;  1KZG A;  1RRP B;  2DKQ A;  4DX9 0;  3ODO A;  1FGZ A;  3TFM A;  2AEH A;  5KCV A;  2VKI A;  1MK7 B;  5DI9 B;  1IRS A;  3PVL A;  2DLW A;  3PVW A;  1M7E A;  2P0H A;  1M7R A;  3ZVR A;  4MK0 A;  3ULB A;  2Y8F A;  1TXD A;  2RUK B;  1PFJ A;  4A6F A;  4A5K A;  1U5F A;  1V5P A;  4D0N B;  2DHI A;  1FAO A;  1AQC A;  2COF A;  4H8S A;  2DYQ A;  4HB3 B;  2D9Z A;  4CYE A;  2M14 A;  1WJ1 A;  1X11 A;  2K2J A;  3CIK A;  2MWN B;  2IFS A;  5D3V A;  4HB4 B;  2DX1 A;  1MPH A;  3KY9 A;  2YT1 A;  4GPT B;  3DXD A;  1SGH A;  1OQN A;  4TKN A;  3QBV B;  1QC6 A;  1MK9 B;  2IYB A;  3PG7 A;  2MDX A;  2D2Q A;  2OQB A;  5DIF B;  5D3W A;  2GS0 A;  3SV1 A;  1WVH A;  1X1F A;  2W2W A;  3SO6 A;  5JLJ B;  1DDV A;  4WVF B;  2LKO A;  1MIZ B;  2EMT A;  4KVG B;  3A8P A;  4HAT B;  3DXC A;  1MAI A;  1X05 A;  2UZS A;  1V5M A;  2D9W A;  1FGY A;  5C79 A;  4NY0 A;  2K2U A;  1OY2 A;  2R0D A;  3F5R A;  1PMS A;  2X18 A;  4GMV A;  4WSF A;  4MT7 A;  4EKU A;  4MY6 A;  3V5W A;  4F7U P;  5C5B A;  1BTN A;  3A8Q A;  1NTY A;  2BCJ A;  4ZRK A;  4WJ7 A;  2GJY A;  3MPX A;  1EF1 A;  1I7A A;  1GC6 A;  3RCP A;  1UPQ A;  3KRX A;  3KZ1 A;  2HTH B;  5FI0 A;  3ZDT A;  4PQ0 A;  3SUZ A;  2N0Y A;  5CLL B;  1GC7 A;  2LYD A;  1X1G A;  2NMB A;  2Q13 A;  4IOY X;  2RNR B;  1ISN A;  4P7I A;  1H10 A;  2DHJ A;  2DN6 A;  2N23 A;  1XCG A;  2EJ8 A;  3PP2 A;  2QKM A;  5HE0 A;  5FI1 A;  5JHG A;  5JHH A;  4K2P A;  2QKL A;  1UNP A;  5D3Y A;  5DH9 B;  4EMO A;  1U5E A;  1P3R A;  1EVH A;  4HDO A;  4CHJ A;  3TW1 A;  2YS1 A;  5JP4 A;  2ROV A;  4KAX B;  4ZRI A;  1DDM A;  2RSG A;  2JP2 A;  1BWN A;  4HDQ A;  1MIX A;  5KQ4 A;  4TYZ A;  1P5T A;  3AU5 A;  4CHM A;  2YRY A;  3ML4 A;  4B6H A;  1SHC A;  4HAV B;  1DRO A;  3U8Z A;  4GZU A;  2YVC A;  1V89 A;  3SYX A;  4A6K A;  5HE2 A;  2ROZ B;  1FHW A;  4DXA B;  4GMX B;  1WGQ A;  3NSU A;  3CXB B;  1NU2 A;  2D9Y A;  1V61 A;  3UZT A;  5GOW B;  1XOD A;  3HK0 A;  4YL8 A;  2Y7B A;  2COA A;  2UVM A;  3P6A A;  2ELB A;  1U2B A;  3DXE A;  4K81 A;  1EGX A;  2V76 A;  4IFS A;  3T06 A;  4BBK A;  1BAK A;  3WA0 A;  2YS3 A;  1ZSQ A;  5LON B;  5KQ1 A;  3D8D A;  1FB8 A;  3KSY A;  4DX8 A;  1Y19 B;  3AJ4 A;  2K00 A;  3GYO A;  1U5G A;  3ODX A;  3TCA A;  3FSS A;  4K17 A;  2L1C A;  1XX0 A;  2YT0 A;  5CLQ B;  1WJM A;  1E5W A;  2H7E A;  3PVU A;  2D9X A;  2YSZ A;  2CY5 A;  2Z0P A;  1XR0 B;  2CAY A;  5D27 A;  3GYP A;  4Z2M B;  2DKP A;  2FJL A;  1AWE A;  3HQC A;  3N7C A;  4ZRJ A;  1ZVR A;  1UNQ A;  2VRW B;  3VIA A;  2DA0 A;  1UNR A;  1U29 A;  2Y8G A;  1J0W A;  3MDB C;  2LG1 A;  2D11 A;  2DYN A;  2ELA A;  1LB1 A;  3HW2 B;  4YON A;  4GN1 A;  1K5G B;  4NSW A;  4Z2N A;  3IVF A;  4EJN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...