1OY2A

Coupling of folding and binding in the ptb domain of the signaling protein shc
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
191
structure length
191
Chain Sequence
GQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHC transforming protein
publication title Coupling of Folding and Binding in the PTB Domain of the Signaling Protein Shc
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 16
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2003-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1oy2A00
2CAYA 3U8ZA 5KCVA 4WJ7A 5EFXA 3V5WA 1OY2A 2Y8FA 1FHOA 3RCPA 3M1IB 3A8QA 3LJUX 1P3RA 5LONB 2CODA 1I7AA 1X1FA 1PLSA 5FI1A 1V5UA 4ZRJA 1K5GB 1KZ7A 1EAZA 1GC6A 1PMSA 4IOYX 3X23A 2P0HA 1XODA 3PZDA 4F7GA 3ULCA 1U5FA 5D3VA 5L81A 3A8PA 2H7DA 2UZRA 1QQGA 1GC7A 1ISNA 4WVFB 4F7HA 1OQNA 1Y19B 3TO1A 1V89A 1KZGA 2DA0A 2VKIA 4HAVB 1J19A 1MK7B 2RSGA 2KGXB 4GMVA 1U2BA 1DDVA 3G9WA 2YRYA 4HAZB 2DN6A 3GYOA 2DTCA 4HB0B 3D8EA 4C0AA 1MPHA 1XR0B 3TVVA 2KCJA 4P7IA 2J59M 2XQNM 4F7UP 1EVHA 2L1CA 2Y7BA 2D4QA 1WVHA 2I1KA 1W1GA 2KUPA 2RVBB 1KI1B 2NZ8B 4TYZA 4K81A 4HAUB 2N23A 2K2JA 3PG7A 1ZVRA 3AJ4A 4KVGB 2Z0QA 2H7EA 2MDXA 4HB2B 4DX8A 2I5CA 2FJLA 4Z2NA 2EJ8A 5C5BB 2GJYA 1WI1A 3QIJA 1M7RA 5KQ4A 5CLLB 5HE2A 3DXCA 1E5WA 2LOXA 2COCA 2GCJA 2DLWA 4KAXB 2ZPYA 5DHFB 2E2XA 1MIXA 2HTHB 2BCJA 2LKOA 3PEGA 3NSUA 1SHCA 1UPQA 2RGNB 3CXBB 4ZRIA 5HE1A 3PSCA 2JP2A 3TCAA 1FGZA 1U27A 5JHHA 1J0WA 3ODXA 3MDBC 3TW1A 2D2QA 3IVFA 4EKUA 4A6FA 2Z0OA 1EF1A 5D3XA 1SGHA 1EGXA 1LB1A 1DDWA 2VRWB 5C79A 4TKNA 3KZ1A 3UZTA 1XD4A 4NY0A 5DI9B 4BBKA 3DXEA 2X18A 1TJ6A 1ZC4B 2MFQA 3SUZA 2MKRA 1I2HA 2YVCA 4K17A 3ODOA 2EC1A 1TQZA 1UEFA 1WJ1A 1X05A 3A98B 2W2XC 3TFMA 2HE7A 1GG3A 2CY4A 4EJNA 2DKQA 2LULA 1W1HA 4CHMA 2IFSA 2YSZA 2DYQA 3BINA 3DXDA 2N0YA 1XCGA 4CYEA 1U5DA 1K5DB 2OTXA 3PVWA 4CHJA 2QKMA 4HDOA 2W2XD 3SNHA 4XWXA 1AWEA 2DHKA 1U5EA 1FOEA 2LYDA 1V5PA 4KHBB 4A5KA 4HAWB 1RJ2A 5D3YA 2J0JA 4GPTB 1WG7A 1BTKA 1P6SA 2DX5A 2YF0A 2W2WA 4MT7A 4Y94A 2CRFA 1MKEA 4K2OA 4DXAB 1MAIA 3SO6A 2YS3A 4ZRKA 2QKLA 4YL8A 4YONA 2EMTA 1FAOA 3OANA 5CLQB 2ROZB 4GXBA 4D0NB 2MWNB 4MK0A 1W1DA 1X86A 2K2UA 3ULBA 1DROA 2AEHA 2YS1A 3AU5A 1BTNA 1Z87A 2J0MA 3T06A 5JP4A 1Q67A 4DBBA 1TXDA 3PVLA 3QBVB 1UNQA 4EMOA 2UZSA 4KHOA 2G35A 2CY5A 5DIFB 3BJIA 2R09A 2DFKA 1NI2A 2COAA 3F0WA 3SV1A 2P8VA 2RLOA 4NSWA 1P5TA 2YS5A 2DX1A 4A6FB 5JHGA 5HE0A 5DHAB 1ZC3B 4MY6A 3KRXA 2D9XA 2Y8GA 4K2PA 1M7EA 2AL6A 4GMXB 5J3QA 1V5MA 2ADZA 2DHIA 1H10A 2D11A 2ELBA 1ZM0A 2LOZA 1PFJA 4HDQA 3P7ZA 5J3TA 2D9ZA 2D10A 3VIAA 4HHVA 1NTVA 3HK0A 4GZUA 1X1GA 3WYFB 3O96A 4HB4B 1V88A 2RNRB 5FI0A 2EMSA 2M38A 1B55A 5C16A 5DH9B 3ZDTA 4GN1A 2DKPA 5LOPB 2M14A 1U5GA 2YT1A 1FHXA 1U29A 1H4RA 5GOWB 4KHAA 3GYPA 2I1JA 2VSZA 4PQ0A 3AU4A 4HATB 3VOQA 3WA0A 1QC6A 3D8FA 5JLJB 3SYXA 1LW3A 1UPRA 2GS0A 1UNPA 3CIKA 3FM8C 4IAPA 5HE3A 1AQCA 4IFSA 3FSSA 2DYNA 2DHJA 1FGYA 1WJMA 2ELAA 4HB3B 4L6EA 5D3WA 2YT0A 1XX0A 3FEHA 2P0DA 3KRWA 3ZVRA 5D27A 1WGQA 2IYBA 2Q13A 2LG1A 1NU2A 2UVMA 2K00A 2D9WA 5C6RA 1Y5OA 2J0KA 1X11A 2R0DA 3HW2B 3QWMA 4DX90 1RRPB 1BWNA 1FHWA 3HQCA 3F5RA 4Z2MB 1FB8A 2PZ1A 2L2IA 1BAKA 1DBHA 1DDMA 4PNKA 3MPXA 1MIZB 1N3HA 2D9VA 2P0FA 4HAXB 2ROVA 4HAYB 3U7DA 2I5FA 1WGUA 4A6HA 3P6AA 1V61A 3ML4A 2RUKB 2OQBA 4B6HA 3KSYA 1NTYA 1IRSA 2V76A 5C5BA 3N7CA 3KY9A 3D8DA 4WSFA 5KQ1A 5J3YA 3PVUA 1ZSQA 2D9YA 4A6KA 1XKEA 1MK9B 3PP2A 2COFA 1OMWA 2Z0PA 2GCLA 3ODWA 1DYNA 2NMBA 4H8SA 1UNRA
chains in the Genus database with same CATH superfamily
2CAYA 3U8ZA 2KIEA 5KCVA 4WJ7A 5EFXA 3V5WA 1OY2A 2Y8FA 1FHOA 3RCPA 3M1IB 4OSNA 3A8QA 3LJUX 1P3RA 5LONB 2CODA 1I7AA 1X1FA 1PLSA 5FI1A 3HIEA 1V5UA 4GNKB 4ZRJA 1K5GB 1KZ7A 1EAZA 1GC6A 1PMSA 4IOYX 3X23A 2P0HA 1XODA 3PZDA 4F7GA 2KIGA 3ULCA 1U5FA 5D3VA 4OT1A 5L81A 3A8PA 2H7DA 2UZRA 1QQGA 1GC7A 1ISNA 4WVFB 4GOUA 4F7HA 1OQNA 1Y19B 3TO1A 1V89A 1KZGA 2DA0A 2VKIA 4HAVB 1T77A 1J19A 1MK7B 2K8EA 3U12A 2RSGA 2KGXB 4GMVA 5I2MA 1U2BA 1DDVA 3G9WA 2YRYA 4HAZB 3GYOA 2DN6A 2DTCA 4HB0B 3D8EA 4C0AA 1MPHA 1XR0B 3TVVA 2KCJA 4P7IA 2J59M 2XQNM 4F7UP 1EVHA 2NBVA 2L1CA 2Y7BA 2D4QA 1WVHA 2I1KA 4KHBA 1W1GA 5I2SA 1ZYIA 2KUPA 3FVCA 2RVBB 1KI1B 2NZ8B 4TYZA 4K81A 4HAUB 2N23A 2K2JA 2Z13A 3PG7A 1ZVRA 3AJ4A 4KVGB 2Z0QA 2H7EA 2MDXA 4HB2B 4DX8A 2I5CA 2FJLA 4Z2NA 2EJ8A 5C5BB 2GJYA 1WI1A 3QIJA 1M7RA 5KQ4A 5CLLB 5HE2A 3DXCA 1E5WA 2LOXA 2COCA 2GCJA 2DLWA 4KAXB 2ZPYA 5DHFB 2E2XA 2GUMA 1MIXA 2HTHB 2BCJA 2LKOA 3PEGA 3NSUA 1SHCA 1UPQA 2K49A 2RGNB 5LG4B 3CXBB 4ZRIA 4L1RA 2RRFA 3PSCA 5HE1A 2JP2A 3NWDA 3TCAA 4CSQA 1FGZA 1U27A 5JHHA 1J0WA 3ODXA 3MDBC 3TW1A 2D2QA 3IVFA 4EKUA 4A6FA 2Z0OA 1EF1A 5D3XA 4D6WA 1SGHA 5M4YB 1EGXA 1LB1A 1DDWA 2VRWB 5C79A 4TKNA 3KZ1A 3UZTA 1XD4A 2ZKMX 4NY0A 5DI9B 4BBKA 3DXEA 2X18A 1TJ6A 1ZC4B 2MFQA 3SUZA 2MKRA 1I2HA 2YVCA 4K17A 3ODOA 2EC1A 1TQZA 1UEFA 1WJ1A 1X05A 3A98B 2W2XC 3TFMA 2HE7A 1GG3A 2CY4A 4EJNA 2DKQA 2LULA 1W1HA 4CHMA 4QJ5B 2IFSA 2YSZA 2DYQA 3BINA 3DXDA 2N0YA 2YT2A 1XCGA 4CYEA 1U5DA 1K5DB 2OTXA 3PVWA 4CHJA 2QKMA 4HDOA 2W2XD 3SNHA 4XWXA 1AWEA 2DHKA 1U5EA 1FOEA 2LYDA 1V5PA 4KHBB 4A5KA 4HAWB 1RJ2A 5D3YA 2J0JA 4GPTB 1WG7A 1BTKA 1P6SA 2DX5A 2YF0A 2W2WA 4MT7A 2Z59A 4Y94A 2CRFA 1MKEA 2KR0A 4K2OA 4DXAB 1MAIA 3SO6A 2YS3A 4ZRKA 2QKLA 4YL8A 4YONA 2EMTA 3NWAA 1FAOA 3OANA 5CLQB 2ROZB 4GXBA 4D0NB 2MWNB 4MK0A 2FJUB 1W1DA 1X86A 2K2UA 3ULBA 1DROA 2AEHA 2YS1A 3AU5A 1BTNA 3A58A 1Z87A 2J0MA 3T06A 5JP4A 2Z4DA 1Q67A 4DBBA 1TXDA 3PVLA 3QBVB 1UNQA 4EMOA 1MI1A 2UZSA 4KHOA 2G35A 2CY5A 5DIFB 3BJIA 2R09A 2DFKA 1NI2A 2COAA 3F0WA 3SV1A 3NW8A 2P8VA 2RLOA 4NSWA 1P5TA 2YS5A 2DX1A 4A6FB 5JHGA 5HE0A 5DHAB 1ZC3B 4MY6A 3DCXA 3KRXA 2D9XA 2Y8GA 4K2PA 1M7EA 2AL6A 4GMXB 5J3QA 3HSAA 3B77A 1V5MA 2ADZA 2DHIA 1H10A 2D11A 2ELBA 1ZM0A 2LOZA 1PFJA 4HDQA 3P7ZA 5J3TA 2D9ZA 2D10A 3VIAA 4HHVA 1NTVA 3HK0A 4GZUA 1X1GA 2R2YA 3WYFB 3O96A 4HB4B 1V88A 2RNRB 5FI0A 2EMSA 2M38A 1B55A 5C16A 5DH9B 3ZDTA 4GN1A 2DKPA 5LOPB 2M14A 1U5GA 2YT1A 1FHXA 1U29A 1H4RA 5GOWB 4KHAA 3GYPA 2I1JA 5IRSA 2VSZA 4PQ0A 3AU4A 4HATB 3VOQA 3WA0A 1QC6A 3D8FA 5JLJB 3SYXA 1LW3A 1UPRA 2GS0A 1UNPA 3CIKA 3FM8C 4IAPA 5HE3A 1AQCA 4IFSA 3FSSA 2DYNA 2DHJA 1FGYA 4QJ4B 1WJMA 2ELAA 4DIXA 4HB3B 4L6EA 5D3WA 2YT0A 1XX0A 3FEHA 2P0DA 3KRWA 3ZVRA 5D27A 1WGQA 2IYBA 2Q13A 2LG1A 1NU2A 2UVMA 2K00A 2D9WA 5C6RA 2KUQA 1Y5OA 2J0KA 1X11A 2R0DA 3HW2B 2Z14A 3QWMA 4DX90 1RRPB 3OHMB 1BWNA 1FHWA 3HQCA 3F5RA 4Z2MB 1FB8A 2PZ1A 2L2IA 1BAKA 1DBHA 1DDMA 4PNKA 3MPXA 1MIZB 1N3HA 2D9VA 2P0FA 4HAXB 2ROVA 4HAYB 4QJ3B 3U7DA 2I5FA 1WGUA 4A6HA 3P6AA 1V61A 3ML4A 2RUKB 2OQBA 4B6HA 3KSYA 1NTYA 4HSIA 3NWFA 1IRSA 2V76A 5C5BA 3N7CA 3KY9A 3D8DA 4WSFA 5KQ1A 5J3YA 3PVUA 1ZSQA 2D9YA 4A6KA 1XKEA 1MK9B 3PP2A 2COFA 1OMWA 4QXAB 2Z0PA 2GCLA 3ODWA 1DYNA 2NMBA 4H8SA 1UNRA
chains in the Genus database with same CATH topology
2CAYA 3U8ZA 5KCVA 4WJ7A 5EFXA 3V5WA 1OY2A 2Y8FA 1FHOA 3RCPA 3M1IB 3A8QA 3LJUX 1P3RA 5LONB 2CODA 1I7AA 1X1FA 1PLSA 5FI1A 1V5UA 4ZRJA 1K5GB 1KZ7A 1EAZA 1GC6A 1PMSA 4IOYX 3X23A 2P0HA 1XODA 3PZDA 4F7GA 3ULCA 1U5FA 5D3VA 5L81A 3A8PA 2H7DA 2UZRA 1QQGA 1GC7A 1ISNA 4WVFB 4F7HA 1OQNA 1Y19B 3TO1A 1V89A 1KZGA 2DA0A 2VKIA 4HAVB 1J19A 1MK7B 2RSGA 2KGXB 4GMVA 1U2BA 1DDVA 3G9WA 2YRYA 4HAZB 2DN6A 3GYOA 2DTCA 4HB0B 3D8EA 4C0AA 1MPHA 1XR0B 3TVVA 2KCJA 4P7IA 2J59M 2XQNM 4F7UP 1EVHA 2L1CA 2Y7BA 2D4QA 1WVHA 2I1KA 1W1GA 2KUPA 2RVBB 1KI1B 2NZ8B 4TYZA 4K81A 4HAUB 2N23A 2K2JA 3PG7A 1ZVRA 3AJ4A 4KVGB 2Z0QA 2H7EA 2MDXA 4HB2B 4DX8A 2I5CA 2FJLA 4Z2NA 2EJ8A 5C5BB 2GJYA 1WI1A 3QIJA 1M7RA 5KQ4A 5CLLB 5HE2A 3DXCA 1E5WA 2LOXA 2COCA 2GCJA 2DLWA 4KAXB 2ZPYA 5DHFB 2E2XA 1MIXA 2HTHB 2BCJA 2LKOA 3PEGA 3NSUA 1SHCA 1UPQA 2RGNB 3CXBB 4ZRIA 5HE1A 3PSCA 2JP2A 3TCAA 1FGZA 1U27A 5JHHA 1J0WA 3ODXA 3MDBC 3TW1A 2D2QA 3IVFA 4EKUA 4A6FA 2Z0OA 1EF1A 5D3XA 1SGHA 1EGXA 1LB1A 1DDWA 2VRWB 5C79A 4TKNA 3KZ1A 3UZTA 1XD4A 4NY0A 5DI9B 4BBKA 3DXEA 2X18A 1TJ6A 1ZC4B 2MFQA 3SUZA 2MKRA 1I2HA 2YVCA 4K17A 3ODOA 2EC1A 1TQZA 1UEFA 1WJ1A 1X05A 3A98B 2W2XC 3TFMA 2HE7A 1GG3A 2CY4A 4EJNA 2DKQA 2LULA 1W1HA 4CHMA 2IFSA 2YSZA 2DYQA 3BINA 3DXDA 2N0YA 1XCGA 4CYEA 1U5DA 1K5DB 2OTXA 3PVWA 4CHJA 2QKMA 4HDOA 2W2XD 3SNHA 4XWXA 1AWEA 2DHKA 1U5EA 1FOEA 2LYDA 1V5PA 4KHBB 4A5KA 4HAWB 1RJ2A 5D3YA 2J0JA 4GPTB 1WG7A 1BTKA 1P6SA 2DX5A 2YF0A 2W2WA 4MT7A 4Y94A 2CRFA 1MKEA 4K2OA 4DXAB 1MAIA 3SO6A 2YS3A 4ZRKA 2QKLA 4YL8A 4YONA 2EMTA 1FAOA 3OANA 5CLQB 2ROZB 4GXBA 4D0NB 2MWNB 4MK0A 1W1DA 1X86A 2K2UA 3ULBA 1DROA 2AEHA 2YS1A 3AU5A 1BTNA 1Z87A 2J0MA 3T06A 5JP4A 1Q67A 4DBBA 1TXDA 3PVLA 3QBVB 1UNQA 4EMOA 2UZSA 4KHOA 2G35A 2CY5A 5DIFB 3BJIA 2R09A 2DFKA 1NI2A 2COAA 3F0WA 3SV1A 2P8VA 2RLOA 4NSWA 1P5TA 2YS5A 2DX1A 4A6FB 5JHGA 5HE0A 5DHAB 1ZC3B 4MY6A 3KRXA 2D9XA 2Y8GA 4K2PA 1M7EA 2AL6A 4GMXB 5J3QA 1V5MA 2ADZA 2DHIA 1H10A 2D11A 2ELBA 1ZM0A 2LOZA 1PFJA 4HDQA 3P7ZA 5J3TA 2D9ZA 2D10A 3VIAA 4HHVA 1NTVA 3HK0A 4GZUA 1X1GA 3WYFB 3O96A 4HB4B 1V88A 2RNRB 5FI0A 2EMSA 2M38A 1B55A 5C16A 5DH9B 3ZDTA 4GN1A 2DKPA 5LOPB 2M14A 1U5GA 2YT1A 1FHXA 1U29A 1H4RA 5GOWB 4KHAA 3GYPA 2I1JA 2VSZA 4PQ0A 3AU4A 4HATB 3VOQA 3WA0A 1QC6A 3D8FA 5JLJB 3SYXA 1LW3A 1UPRA 2GS0A 1UNPA 3CIKA 3FM8C 4IAPA 5HE3A 1AQCA 4IFSA 3FSSA 2DYNA 2DHJA 1FGYA 1WJMA 2ELAA 4HB3B 4L6EA 5D3WA 2YT0A 1XX0A 3FEHA 2P0DA 3KRWA 3ZVRA 5D27A 1WGQA 2IYBA 2Q13A 2LG1A 1NU2A 2UVMA 2K00A 2D9WA 5C6RA 1Y5OA 2J0KA 1X11A 2R0DA 3HW2B 3QWMA 4DX90 1RRPB 1BWNA 1FHWA 3HQCA 3F5RA 4Z2MB 1FB8A 2PZ1A 2L2IA 1BAKA 1DBHA 1DDMA 4PNKA 3MPXA 1MIZB 1N3HA 2D9VA 2P0FA 4HAXB 2ROVA 4HAYB 3U7DA 2I5FA 1WGUA 4A6HA 3P6AA 1V61A 3ML4A 2RUKB 2OQBA 4B6HA 3KSYA 1NTYA 1IRSA 2V76A 5C5BA 3N7CA 3KY9A 3D8DA 4WSFA 5KQ1A 5J3YA 3PVUA 1ZSQA 2D9YA 4A6KA 1XKEA 1MK9B 3PP2A 2COFA 1OMWA 2Z0PA 2GCLA 3ODWA 1DYNA 2NMBA 4H8SA 1UNRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CAY A;  3U8Z A;  5KCV A;  4WJ7 A;  5EFX A;  3V5W A;  1OY2 A;  2Y8F A;  1FHO A;  3RCP A;  3M1I B;  3A8Q A;  3LJU X;  1P3R A;  5LON B;  2COD A;  1I7A A;  1X1F A;  1PLS A;  5FI1 A;  1V5U A;  4ZRJ A;  1K5G B;  1KZ7 A;  1EAZ A;  1GC6 A;  1PMS A;  4IOY X;  3X23 A;  2P0H A;  1XOD A;  3PZD A;  4F7G A;  3ULC A;  1U5F A;  5D3V A;  5L81 A;  3A8P A;  2H7D A;  2UZR A;  1QQG A;  1GC7 A;  1ISN A;  4WVF B;  4F7H A;  1OQN A;  1Y19 B;  3TO1 A;  1V89 A;  1KZG A;  2DA0 A;  2VKI A;  4HAV B;  1J19 A;  1MK7 B;  2RSG A;  2KGX B;  4GMV A;  1U2B A;  1DDV A;  3G9W A;  2YRY A;  4HAZ B;  2DN6 A;  3GYO A;  2DTC A;  4HB0 B;  3D8E A;  4C0A A;  1MPH A;  1XR0 B;  3TVV A;  2KCJ A;  4P7I A;  2J59 M;  2XQN M;  4F7U P;  1EVH A;  2L1C A;  2Y7B A;  2D4Q A;  1WVH A;  2I1K A;  1W1G A;  2KUP A;  2RVB B;  1KI1 B;  2NZ8 B;  4TYZ A;  4K81 A;  4HAU B;  2N23 A;  2K2J A;  3PG7 A;  1ZVR A;  3AJ4 A;  4KVG B;  2Z0Q A;  2H7E A;  2MDX A;  4HB2 B;  4DX8 A;  2I5C A;  2FJL A;  4Z2N A;  2EJ8 A;  5C5B B;  2GJY A;  1WI1 A;  3QIJ A;  1M7R A;  5KQ4 A;  5CLL B;  5HE2 A;  3DXC A;  1E5W A;  2LOX A;  2COC A;  2GCJ A;  2DLW A;  4KAX B;  2ZPY A;  5DHF B;  2E2X A;  1MIX A;  2HTH B;  2BCJ A;  2LKO A;  3PEG A;  3NSU A;  1SHC A;  1UPQ A;  2RGN B;  3CXB B;  4ZRI A;  5HE1 A;  3PSC A;  2JP2 A;  3TCA A;  1FGZ A;  1U27 A;  5JHH A;  1J0W A;  3ODX A;  3MDB C;  3TW1 A;  2D2Q A;  3IVF A;  4EKU A;  4A6F A;  2Z0O A;  1EF1 A;  5D3X A;  1SGH A;  1EGX A;  1LB1 A;  1DDW A;  2VRW B;  5C79 A;  4TKN A;  3KZ1 A;  3UZT A;  1XD4 A;  4NY0 A;  5DI9 B;  4BBK A;  3DXE A;  2X18 A;  1TJ6 A;  1ZC4 B;  2MFQ A;  3SUZ A;  2MKR A;  1I2H A;  2YVC A;  4K17 A;  3ODO A;  2EC1 A;  1TQZ A;  1UEF A;  1WJ1 A;  1X05 A;  3A98 B;  2W2X C;  3TFM A;  2HE7 A;  1GG3 A;  2CY4 A;  4EJN A;  2DKQ A;  2LUL A;  1W1H A;  4CHM A;  2IFS A;  2YSZ A;  2DYQ A;  3BIN A;  3DXD A;  2N0Y A;  1XCG A;  4CYE A;  1U5D A;  1K5D B;  2OTX A;  3PVW A;  4CHJ A;  2QKM A;  4HDO A;  2W2X D;  3SNH A;  4XWX A;  1AWE A;  2DHK A;  1U5E A;  1FOE A;  2LYD A;  1V5P A;  4KHB B;  4A5K A;  4HAW B;  1RJ2 A;  5D3Y A;  2J0J A;  4GPT B;  1WG7 A;  1BTK A;  1P6S A;  2DX5 A;  2YF0 A;  2W2W A;  4MT7 A;  4Y94 A;  2CRF A;  1MKE A;  4K2O A;  4DXA B;  1MAI A;  3SO6 A;  2YS3 A;  4ZRK A;  2QKL A;  4YL8 A;  4YON A;  2EMT A;  1FAO A;  3OAN A;  5CLQ B;  2ROZ B;  4GXB A;  4D0N B;  2MWN B;  4MK0 A;  1W1D A;  1X86 A;  2K2U A;  3ULB A;  1DRO A;  2AEH A;  2YS1 A;  3AU5 A;  1BTN A;  1Z87 A;  2J0M A;  3T06 A;  5JP4 A;  1Q67 A;  4DBB A;  1TXD A;  3PVL A;  3QBV B;  1UNQ A;  4EMO A;  2UZS A;  4KHO A;  2G35 A;  2CY5 A;  5DIF B;  3BJI A;  2R09 A;  2DFK A;  1NI2 A;  2COA A;  3F0W A;  3SV1 A;  2P8V A;  2RLO A;  4NSW A;  1P5T A;  2YS5 A;  2DX1 A;  4A6F B;  5JHG A;  5HE0 A;  5DHA B;  1ZC3 B;  4MY6 A;  3KRX A;  2D9X A;  2Y8G A;  4K2P A;  1M7E A;  2AL6 A;  4GMX B;  5J3Q A;  1V5M A;  2ADZ A;  2DHI A;  1H10 A;  2D11 A;  2ELB A;  1ZM0 A;  2LOZ A;  1PFJ A;  4HDQ A;  3P7Z A;  5J3T A;  2D9Z A;  2D10 A;  3VIA A;  4HHV A;  1NTV A;  3HK0 A;  4GZU A;  1X1G A;  3WYF B;  3O96 A;  4HB4 B;  1V88 A;  2RNR B;  5FI0 A;  2EMS A;  2M38 A;  1B55 A;  5C16 A;  5DH9 B;  3ZDT A;  4GN1 A;  2DKP A;  5LOP B;  2M14 A;  1U5G A;  2YT1 A;  1FHX A;  1U29 A;  1H4R A;  5GOW B;  4KHA A;  3GYP A;  2I1J A;  2VSZ A;  4PQ0 A;  3AU4 A;  4HAT B;  3VOQ A;  3WA0 A;  1QC6 A;  3D8F A;  5JLJ B;  3SYX A;  1LW3 A;  1UPR A;  2GS0 A;  1UNP A;  3CIK A;  3FM8 C;  4IAP A;  5HE3 A;  1AQC A;  4IFS A;  3FSS A;  2DYN A;  2DHJ A;  1FGY A;  1WJM A;  2ELA A;  4HB3 B;  4L6E A;  5D3W A;  2YT0 A;  1XX0 A;  3FEH A;  2P0D A;  3KRW A;  3ZVR A;  5D27 A;  1WGQ A;  2IYB A;  2Q13 A;  2LG1 A;  1NU2 A;  2UVM A;  2K00 A;  2D9W A;  5C6R A;  1Y5O A;  2J0K A;  1X11 A;  2R0D A;  3HW2 B;  3QWM A;  4DX9 0;  1RRP B;  1BWN A;  1FHW A;  3HQC A;  3F5R A;  4Z2M B;  1FB8 A;  2PZ1 A;  2L2I A;  1BAK A;  1DBH A;  1DDM A;  4PNK A;  3MPX A;  1MIZ B;  1N3H A;  2D9V A;  2P0F A;  4HAX B;  2ROV A;  4HAY B;  3U7D A;  2I5F A;  1WGU A;  4A6H A;  3P6A A;  1V61 A;  3ML4 A;  2RUK B;  2OQB A;  4B6H A;  3KSY A;  1NTY A;  1IRS A;  2V76 A;  5C5B A;  3N7C A;  3KY9 A;  3D8D A;  4WSF A;  5KQ1 A;  5J3Y A;  3PVU A;  1ZSQ A;  2D9Y A;  4A6K A;  1XKE A;  1MK9 B;  3PP2 A;  2COF A;  1OMW A;  2Z0P A;  2GCL A;  3ODW A;  1DYN A;  2NMB A;  4H8S A;  1UNR A; 
#chains in the Genus database with same CATH topology
 2CAY A;  3U8Z A;  2KIE A;  5KCV A;  4WJ7 A;  5EFX A;  3V5W A;  1OY2 A;  2Y8F A;  1FHO A;  3RCP A;  3M1I B;  4OSN A;  3A8Q A;  3LJU X;  1P3R A;  5LON B;  2COD A;  1I7A A;  1X1F A;  1PLS A;  5FI1 A;  3HIE A;  1V5U A;  4GNK B;  4ZRJ A;  1K5G B;  1KZ7 A;  1EAZ A;  1GC6 A;  1PMS A;  4IOY X;  3X23 A;  2P0H A;  1XOD A;  3PZD A;  4F7G A;  2KIG A;  3ULC A;  1U5F A;  5D3V A;  4OT1 A;  5L81 A;  3A8P A;  2H7D A;  2UZR A;  1QQG A;  1GC7 A;  1ISN A;  4WVF B;  4GOU A;  4F7H A;  1OQN A;  1Y19 B;  3TO1 A;  1V89 A;  1KZG A;  2DA0 A;  2VKI A;  4HAV B;  1T77 A;  1J19 A;  1MK7 B;  2K8E A;  3U12 A;  2RSG A;  2KGX B;  4GMV A;  5I2M A;  1U2B A;  1DDV A;  3G9W A;  2YRY A;  4HAZ B;  3GYO A;  2DN6 A;  2DTC A;  4HB0 B;  3D8E A;  4C0A A;  1MPH A;  1XR0 B;  3TVV A;  2KCJ A;  4P7I A;  2J59 M;  2XQN M;  4F7U P;  1EVH A;  2NBV A;  2L1C A;  2Y7B A;  2D4Q A;  1WVH A;  2I1K A;  4KHB A;  1W1G A;  5I2S A;  1ZYI A;  2KUP A;  3FVC A;  2RVB B;  1KI1 B;  2NZ8 B;  4TYZ A;  4K81 A;  4HAU B;  2N23 A;  2K2J A;  2Z13 A;  3PG7 A;  1ZVR A;  3AJ4 A;  4KVG B;  2Z0Q A;  2H7E A;  2MDX A;  4HB2 B;  4DX8 A;  2I5C A;  2FJL A;  4Z2N A;  2EJ8 A;  5C5B B;  2GJY A;  1WI1 A;  3QIJ A;  1M7R A;  5KQ4 A;  5CLL B;  5HE2 A;  3DXC A;  1E5W A;  2LOX A;  2COC A;  2GCJ A;  2DLW A;  4KAX B;  2ZPY A;  5DHF B;  2E2X A;  2GUM A;  1MIX A;  2HTH B;  2BCJ A;  2LKO A;  3PEG A;  3NSU A;  1SHC A;  1UPQ A;  2K49 A;  2RGN B;  5LG4 B;  3CXB B;  4ZRI A;  4L1R A;  2RRF A;  3PSC A;  5HE1 A;  2JP2 A;  3NWD A;  3TCA A;  4CSQ A;  1FGZ A;  1U27 A;  5JHH A;  1J0W A;  3ODX A;  3MDB C;  3TW1 A;  2D2Q A;  3IVF A;  4EKU A;  4A6F A;  2Z0O A;  1EF1 A;  5D3X A;  4D6W A;  1SGH A;  5M4Y B;  1EGX A;  1LB1 A;  1DDW A;  2VRW B;  5C79 A;  4TKN A;  3KZ1 A;  3UZT A;  1XD4 A;  2ZKM X;  4NY0 A;  5DI9 B;  4BBK A;  3DXE A;  2X18 A;  1TJ6 A;  1ZC4 B;  2MFQ A;  3SUZ A;  2MKR A;  1I2H A;  2YVC A;  4K17 A;  3ODO A;  2EC1 A;  1TQZ A;  1UEF A;  1WJ1 A;  1X05 A;  3A98 B;  2W2X C;  3TFM A;  2HE7 A;  1GG3 A;  2CY4 A;  4EJN A;  2DKQ A;  2LUL A;  1W1H A;  4CHM A;  4QJ5 B;  2IFS A;  2YSZ A;  2DYQ A;  3BIN A;  3DXD A;  2N0Y A;  2YT2 A;  1XCG A;  4CYE A;  1U5D A;  1K5D B;  2OTX A;  3PVW A;  4CHJ A;  2QKM A;  4HDO A;  2W2X D;  3SNH A;  4XWX A;  1AWE A;  2DHK A;  1U5E A;  1FOE A;  2LYD A;  1V5P A;  4KHB B;  4A5K A;  4HAW B;  1RJ2 A;  5D3Y A;  2J0J A;  4GPT B;  1WG7 A;  1BTK A;  1P6S A;  2DX5 A;  2YF0 A;  2W2W A;  4MT7 A;  2Z59 A;  4Y94 A;  2CRF A;  1MKE A;  2KR0 A;  4K2O A;  4DXA B;  1MAI A;  3SO6 A;  2YS3 A;  4ZRK A;  2QKL A;  4YL8 A;  4YON A;  2EMT A;  3NWA A;  1FAO A;  3OAN A;  5CLQ B;  2ROZ B;  4GXB A;  4D0N B;  2MWN B;  4MK0 A;  2FJU B;  1W1D A;  1X86 A;  2K2U A;  3ULB A;  1DRO A;  2AEH A;  2YS1 A;  3AU5 A;  1BTN A;  3A58 A;  1Z87 A;  2J0M A;  3T06 A;  5JP4 A;  2Z4D A;  1Q67 A;  4DBB A;  1TXD A;  3PVL A;  3QBV B;  1UNQ A;  4EMO A;  1MI1 A;  2UZS A;  4KHO A;  2G35 A;  2CY5 A;  5DIF B;  3BJI A;  2R09 A;  2DFK A;  1NI2 A;  2COA A;  3F0W A;  3SV1 A;  3NW8 A;  2P8V A;  2RLO A;  4NSW A;  1P5T A;  2YS5 A;  2DX1 A;  4A6F B;  5JHG A;  5HE0 A;  5DHA B;  1ZC3 B;  4MY6 A;  3DCX A;  3KRX A;  2D9X A;  2Y8G A;  4K2P A;  1M7E A;  2AL6 A;  4GMX B;  5J3Q A;  3HSA A;  3B77 A;  1V5M A;  2ADZ A;  2DHI A;  1H10 A;  2D11 A;  2ELB A;  1ZM0 A;  2LOZ A;  1PFJ A;  4HDQ A;  3P7Z A;  5J3T A;  2D9Z A;  2D10 A;  3VIA A;  4HHV A;  1NTV A;  3HK0 A;  4GZU A;  1X1G A;  2R2Y A;  3WYF B;  3O96 A;  4HB4 B;  1V88 A;  2RNR B;  5FI0 A;  2EMS A;  2M38 A;  1B55 A;  5C16 A;  5DH9 B;  3ZDT A;  4GN1 A;  2DKP A;  5LOP B;  2M14 A;  1U5G A;  2YT1 A;  1FHX A;  1U29 A;  1H4R A;  5GOW B;  4KHA A;  3GYP A;  2I1J A;  5IRS A;  2VSZ A;  4PQ0 A;  3AU4 A;  4HAT B;  3VOQ A;  3WA0 A;  1QC6 A;  3D8F A;  5JLJ B;  3SYX A;  1LW3 A;  1UPR A;  2GS0 A;  1UNP A;  3CIK A;  3FM8 C;  4IAP A;  5HE3 A;  1AQC A;  4IFS A;  3FSS A;  2DYN A;  2DHJ A;  1FGY A;  4QJ4 B;  1WJM A;  2ELA A;  4DIX A;  4HB3 B;  4L6E A;  5D3W A;  2YT0 A;  1XX0 A;  3FEH A;  2P0D A;  3KRW A;  3ZVR A;  5D27 A;  1WGQ A;  2IYB A;  2Q13 A;  2LG1 A;  1NU2 A;  2UVM A;  2K00 A;  2D9W A;  5C6R A;  2KUQ A;  1Y5O A;  2J0K A;  1X11 A;  2R0D A;  3HW2 B;  2Z14 A;  3QWM A;  4DX9 0;  1RRP B;  3OHM B;  1BWN A;  1FHW A;  3HQC A;  3F5R A;  4Z2M B;  1FB8 A;  2PZ1 A;  2L2I A;  1BAK A;  1DBH A;  1DDM A;  4PNK A;  3MPX A;  1MIZ B;  1N3H A;  2D9V A;  2P0F A;  4HAX B;  2ROV A;  4HAY B;  4QJ3 B;  3U7D A;  2I5F A;  1WGU A;  4A6H A;  3P6A A;  1V61 A;  3ML4 A;  2RUK B;  2OQB A;  4B6H A;  3KSY A;  1NTY A;  4HSI A;  3NWF A;  1IRS A;  2V76 A;  5C5B A;  3N7C A;  3KY9 A;  3D8D A;  4WSF A;  5KQ1 A;  5J3Y A;  3PVU A;  1ZSQ A;  2D9Y A;  4A6K A;  1XKE A;  1MK9 B;  3PP2 A;  2COF A;  1OMW A;  4QXA B;  2Z0P A;  2GCL A;  3ODW A;  1DYN A;  2NMB A;  4H8S A;  1UNR A; 
#chains in the Genus database with same CATH homology
 2CAY A;  3U8Z A;  5KCV A;  4WJ7 A;  5EFX A;  3V5W A;  1OY2 A;  2Y8F A;  1FHO A;  3RCP A;  3M1I B;  3A8Q A;  3LJU X;  1P3R A;  5LON B;  2COD A;  1I7A A;  1X1F A;  1PLS A;  5FI1 A;  1V5U A;  4ZRJ A;  1K5G B;  1KZ7 A;  1EAZ A;  1GC6 A;  1PMS A;  4IOY X;  3X23 A;  2P0H A;  1XOD A;  3PZD A;  4F7G A;  3ULC A;  1U5F A;  5D3V A;  5L81 A;  3A8P A;  2H7D A;  2UZR A;  1QQG A;  1GC7 A;  1ISN A;  4WVF B;  4F7H A;  1OQN A;  1Y19 B;  3TO1 A;  1V89 A;  1KZG A;  2DA0 A;  2VKI A;  4HAV B;  1J19 A;  1MK7 B;  2RSG A;  2KGX B;  4GMV A;  1U2B A;  1DDV A;  3G9W A;  2YRY A;  4HAZ B;  2DN6 A;  3GYO A;  2DTC A;  4HB0 B;  3D8E A;  4C0A A;  1MPH A;  1XR0 B;  3TVV A;  2KCJ A;  4P7I A;  2J59 M;  2XQN M;  4F7U P;  1EVH A;  2L1C A;  2Y7B A;  2D4Q A;  1WVH A;  2I1K A;  1W1G A;  2KUP A;  2RVB B;  1KI1 B;  2NZ8 B;  4TYZ A;  4K81 A;  4HAU B;  2N23 A;  2K2J A;  3PG7 A;  1ZVR A;  3AJ4 A;  4KVG B;  2Z0Q A;  2H7E A;  2MDX A;  4HB2 B;  4DX8 A;  2I5C A;  2FJL A;  4Z2N A;  2EJ8 A;  5C5B B;  2GJY A;  1WI1 A;  3QIJ A;  1M7R A;  5KQ4 A;  5CLL B;  5HE2 A;  3DXC A;  1E5W A;  2LOX A;  2COC A;  2GCJ A;  2DLW A;  4KAX B;  2ZPY A;  5DHF B;  2E2X A;  1MIX A;  2HTH B;  2BCJ A;  2LKO A;  3PEG A;  3NSU A;  1SHC A;  1UPQ A;  2RGN B;  3CXB B;  4ZRI A;  5HE1 A;  3PSC A;  2JP2 A;  3TCA A;  1FGZ A;  1U27 A;  5JHH A;  1J0W A;  3ODX A;  3MDB C;  3TW1 A;  2D2Q A;  3IVF A;  4EKU A;  4A6F A;  2Z0O A;  1EF1 A;  5D3X A;  1SGH A;  1EGX A;  1LB1 A;  1DDW A;  2VRW B;  5C79 A;  4TKN A;  3KZ1 A;  3UZT A;  1XD4 A;  4NY0 A;  5DI9 B;  4BBK A;  3DXE A;  2X18 A;  1TJ6 A;  1ZC4 B;  2MFQ A;  3SUZ A;  2MKR A;  1I2H A;  2YVC A;  4K17 A;  3ODO A;  2EC1 A;  1TQZ A;  1UEF A;  1WJ1 A;  1X05 A;  3A98 B;  2W2X C;  3TFM A;  2HE7 A;  1GG3 A;  2CY4 A;  4EJN A;  2DKQ A;  2LUL A;  1W1H A;  4CHM A;  2IFS A;  2YSZ A;  2DYQ A;  3BIN A;  3DXD A;  2N0Y A;  1XCG A;  4CYE A;  1U5D A;  1K5D B;  2OTX A;  3PVW A;  4CHJ A;  2QKM A;  4HDO A;  2W2X D;  3SNH A;  4XWX A;  1AWE A;  2DHK A;  1U5E A;  1FOE A;  2LYD A;  1V5P A;  4KHB B;  4A5K A;  4HAW B;  1RJ2 A;  5D3Y A;  2J0J A;  4GPT B;  1WG7 A;  1BTK A;  1P6S A;  2DX5 A;  2YF0 A;  2W2W A;  4MT7 A;  4Y94 A;  2CRF A;  1MKE A;  4K2O A;  4DXA B;  1MAI A;  3SO6 A;  2YS3 A;  4ZRK A;  2QKL A;  4YL8 A;  4YON A;  2EMT A;  1FAO A;  3OAN A;  5CLQ B;  2ROZ B;  4GXB A;  4D0N B;  2MWN B;  4MK0 A;  1W1D A;  1X86 A;  2K2U A;  3ULB A;  1DRO A;  2AEH A;  2YS1 A;  3AU5 A;  1BTN A;  1Z87 A;  2J0M A;  3T06 A;  5JP4 A;  1Q67 A;  4DBB A;  1TXD A;  3PVL A;  3QBV B;  1UNQ A;  4EMO A;  2UZS A;  4KHO A;  2G35 A;  2CY5 A;  5DIF B;  3BJI A;  2R09 A;  2DFK A;  1NI2 A;  2COA A;  3F0W A;  3SV1 A;  2P8V A;  2RLO A;  4NSW A;  1P5T A;  2YS5 A;  2DX1 A;  4A6F B;  5JHG A;  5HE0 A;  5DHA B;  1ZC3 B;  4MY6 A;  3KRX A;  2D9X A;  2Y8G A;  4K2P A;  1M7E A;  2AL6 A;  4GMX B;  5J3Q A;  1V5M A;  2ADZ A;  2DHI A;  1H10 A;  2D11 A;  2ELB A;  1ZM0 A;  2LOZ A;  1PFJ A;  4HDQ A;  3P7Z A;  5J3T A;  2D9Z A;  2D10 A;  3VIA A;  4HHV A;  1NTV A;  3HK0 A;  4GZU A;  1X1G A;  3WYF B;  3O96 A;  4HB4 B;  1V88 A;  2RNR B;  5FI0 A;  2EMS A;  2M38 A;  1B55 A;  5C16 A;  5DH9 B;  3ZDT A;  4GN1 A;  2DKP A;  5LOP B;  2M14 A;  1U5G A;  2YT1 A;  1FHX A;  1U29 A;  1H4R A;  5GOW B;  4KHA A;  3GYP A;  2I1J A;  2VSZ A;  4PQ0 A;  3AU4 A;  4HAT B;  3VOQ A;  3WA0 A;  1QC6 A;  3D8F A;  5JLJ B;  3SYX A;  1LW3 A;  1UPR A;  2GS0 A;  1UNP A;  3CIK A;  3FM8 C;  4IAP A;  5HE3 A;  1AQC A;  4IFS A;  3FSS A;  2DYN A;  2DHJ A;  1FGY A;  1WJM A;  2ELA A;  4HB3 B;  4L6E A;  5D3W A;  2YT0 A;  1XX0 A;  3FEH A;  2P0D A;  3KRW A;  3ZVR A;  5D27 A;  1WGQ A;  2IYB A;  2Q13 A;  2LG1 A;  1NU2 A;  2UVM A;  2K00 A;  2D9W A;  5C6R A;  1Y5O A;  2J0K A;  1X11 A;  2R0D A;  3HW2 B;  3QWM A;  4DX9 0;  1RRP B;  1BWN A;  1FHW A;  3HQC A;  3F5R A;  4Z2M B;  1FB8 A;  2PZ1 A;  2L2I A;  1BAK A;  1DBH A;  1DDM A;  4PNK A;  3MPX A;  1MIZ B;  1N3H A;  2D9V A;  2P0F A;  4HAX B;  2ROV A;  4HAY B;  3U7D A;  2I5F A;  1WGU A;  4A6H A;  3P6A A;  1V61 A;  3ML4 A;  2RUK B;  2OQB A;  4B6H A;  3KSY A;  1NTY A;  1IRS A;  2V76 A;  5C5B A;  3N7C A;  3KY9 A;  3D8D A;  4WSF A;  5KQ1 A;  5J3Y A;  3PVU A;  1ZSQ A;  2D9Y A;  4A6K A;  1XKE A;  1MK9 B;  3PP2 A;  2COF A;  1OMW A;  2Z0P A;  2GCL A;  3ODW A;  1DYN A;  2NMB A;  4H8S A;  1UNR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...