1OY2A

Coupling of folding and binding in the ptb domain of the signaling protein shc
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
191
structure length
191
Chain Sequence
GQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords SHC transforming protein
publication title Coupling of Folding and Binding in the PTB Domain of the Signaling Protein Shc
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2003-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1oy2A00
1OMWA 1WGQA 2OTXA 1TXDA 3QWMA 5HE0A 3BJIA 1I2HA 1BTKA 2RLOA 5HE1A 3PSCA 5J3YA 2H7DA 1Z87A 4HB3B 1MAIA 2DA0A 2N0YA 2Q13A 3ODWA 3HW2B 2G35A 1MK9B 5D27A 2DYQA 5LOPB 2MFQA 2EMSA 5DHFB 3G9WA 2DLWA 3D8DA 4K17A 1EF1A 1P3RA 5JP4A 1XD4A 4HAVB 2LKOA 3SO6A 5HE2A 2K2UA 3QIJA 4EJNA 3A8QA 2UVMA 3TFMA 2I1JA 2P0FA 1EGXA 2LG1A 3V5WA 1WVHA 4HAUB 4NSWA 2LOXA 1U5GA 2HE7A 1MIZB 4A5KA 2DN6A 1X86A 4MY6A 4K81A 1UNQA 2E2XA 4EMOA 1GC6A 1BAKA 3KY9A 2D9YA 3PVUA 3AU5A 1U27A 1KI1B 2EMTA 2ZPYA 3AJ4A 4F7GA 2MKRA 2VSZA 3MPXA 5L81A 4K2OA 3U8ZA 2BCJA 2QKLA 1B55A 3BINA 4KAXB 1FHXA 5KQ4A 3UZTA 1MK7B 2D10A 2IYBA 2EC1A 4DX90 1FGYA 2L1CA 4A6KA 1SHCA 4IFSA 1EVHA 2QKMA 3F0WA 4KHAA 3GYOA 3ULBA 2ELBA 3MDBC 5DHAB 1J19A 1IRSA 5J3QA 3SYXA 3HQCA 3TO1A 2DX5A 4WJ7A 4F7UP 1V5PA 2M14A 3T06A 5D3WA 5DH9B 4CHJA 1ZVRA 4NY0A 4A6HA 1FHOA 3U7DA 2UZRA 4KVGB 4YL8A 5CLQB 2P0HA 1KZ7A 4K2PA 3VOQA 1NI2A 1UNPA 1TQZA 3AU4A 3O96A 1WJMA 2D2QA 1QC6A 3F5RA 3KRXA 4HAWB 1QQGA 1H4RA 2RUKB 1V5UA 2Y7BA 4CYEA 2DKQA 2P0DA 2Z0QA 3N7CA 5C16A 3TVVA 2L2IA 1ZC4B 1PFJA 4B6HA 1AQCA 3PZDA 4ZRIA 3VIAA 2W2WA 2MDXA 3ODXA 1OQNA 3LJUX 3A8PA 2H7EA 2CY5A 4HDOA 1MPHA 3P7ZA 5D3XA 4BBKA 2FJLA 1KZGA 3SV1A 1X11A 3RCPA 4WSFA 4XWXA 5FI1A 3ML4A 1I7AA 2V76A 1W1GA 1FGZA 1U2BA 2RSGA 1K5GB 1PMSA 1FAOA 2COAA 1DDMA 1NTYA 1SGHA 4HHVA 1DDVA 3P6AA 2X18A 3FSSA 4A6FB 4IOYX 1W1DA 1U5FA 2DX1A 3FEHA 1WG7A 4Z2MB 2AEHA 5GOWB 2GS0A 1EAZA 5C6RA 1XX0A 2W2XD 4GXBA 4HAYB 3PVLA 1GG3A 2J0JA 2OQBA 5KQ1A 5JHGA 4A6FA 1BTNA 2YS5A 1V61A 2KGXB 2VKIA 4F7HA 4Z2NA 3KZ1A 4Y94A 4GPTB 2CY4A 2J59M 5DIFB 1XODA 1XCGA 4HDQA 2AL6A 3KRWA 2DHKA 2COFA 2I5CA 1WJ1A 3TW1A 1PLSA 2I5FA 1XR0B 5DI9B 2KCJA 1U5DA 2I1KA 4HAZB 3ODOA 4HB2B 1DDWA 2J0KA 2LYDA 4L6EA 5JHHA 2LOZA 1DROA 2GJYA 5C5BB 2DHIA 4EKUA 1WI1A 1X05A 2D9ZA 4ZRJA 1MKEA 2DTCA 5D3VA 1UNRA 1ZM0A 4MK0A 2CRFA 4IAPA 4KHBB 2D4QA 5C5BA 1V5MA 3CIKA 2D11A 3ULCA 1ZC3B 2YS1A 2KUPA 3X23A 3WYFB 2Z0OA 2JP2A 4TKNA 2XQNM 2COCA 1MIXA 4HAXB 2DKPA 1M7EA 5D3YA 1V89A 1E5WA 2YF0A 1Y5OA 4GMVA 2YVCA 3KSYA 4PNKA 1TJ6A 1GC7A 2YRYA 2RVBB 2CODA 4H8SA 1RJ2A 3D8EA 2RNRB 1M7RA 2J0MA 5CLLB 2P8VA 2R0DA 3NSUA 4TYZA 1U5EA 2NZ8B 2DYNA 5HE3A 1X1FA 2YS3A 5KCVA 1K5DB 2Z0PA 3WA0A 2R09A 3OANA 1H10A 3CXBB 5EFXA 4GN1A 1V88A 2K00A 3ZVRA 1UEFA 1XKEA 4GMXB 1P5TA 1NU2A 5J3TA 4C0AA 1LW3A 3PVWA 4MT7A 3M1IB 3DXCA 2YT1A 3IVFA 2D9XA 2N23A 4CHMA 1FB8A 4PQ0A 3D8FA 2NMBA 4D0NB 3DXDA 2RGNB 1RRPB 2D9VA 1N3HA 2ROZB 1AWEA 1UPQA 1P6SA 2Y8GA 1X1GA 3GYPA 2IFSA 2LULA 3FM8C 4DXAB 4DX8A 2PZ1A 3QBVB 4P7IA 1FHWA 3ZDTA 3HK0A 2VRWB 2YT0A 1WGUA 3A98B 1U29A 2W2XC 2HTHB 3SNHA 1ZSQA 3PEGA 2Y8FA 2DHJA 4ZRKA 5FI0A 1W1HA 4HATB 3SUZA 1DYNA 4HB0B 2K2JA 1NTVA 1BWNA 2D9WA 1UPRA 1J0WA 1Y19B 4GZUA 2DFKA 2GCJA 4KHOA 2M38A 4YONA 4WVFB 3TCAA 2CAYA 3PG7A 2MWNB 1ISNA 2ELAA 1OY2A 4DBBA 2EJ8A 1LB1A 2YSZA 1DBHA 4HB4B 5JLJB 3PP2A 2ROVA 1Q67A 5LONB 5C79A 2ADZA 3DXEA 2GCLA 1FOEA 2UZSA
chains in the Genus database with same CATH superfamily
2KIEA 1OMWA 1WGQA 2OTXA 1TXDA 3QWMA 5HE0A 3BJIA 1I2HA 1BTKA 2RLOA 5HE1A 3PSCA 4D6WA 5J3YA 2H7DA 1Z87A 4HB3B 1MAIA 2DA0A 2N0YA 2Q13A 2K49A 3ODWA 4KHBA 3HW2B 2G35A 1MK9B 5D27A 2DYQA 5LOPB 2MFQA 4QJ5B 2EMSA 5DHFB 3G9WA 2DLWA 3D8DA 4K17A 1EF1A 1P3RA 5JP4A 1XD4A 4HAVB 2LKOA 3SO6A 5M4YB 5HE2A 2K2UA 3QIJA 4EJNA 3A8QA 2UVMA 3HIEA 3TFMA 2I1JA 2P0FA 2KIGA 1EGXA 2LG1A 3V5WA 1WVHA 4HAUB 4NSWA 2Z14A 2LOXA 3B77A 1U5GA 2HE7A 1MIZB 4A5KA 2DN6A 1X86A 4OT1A 3OHMB 4MY6A 4K81A 1UNQA 4CSQA 2E2XA 2FJUB 4EMOA 1GC6A 1BAKA 3KY9A 2D9YA 3PVUA 3AU5A 1U27A 1KI1B 2EMTA 2ZPYA 3AJ4A 3A58A 4F7GA 2MKRA 2VSZA 3MPXA 5L81A 4K2OA 3U8ZA 2BCJA 2QKLA 1B55A 3BINA 4KAXB 1FHXA 5KQ4A 3UZTA 1MK7B 2D10A 4QJ4B 2IYBA 2EC1A 4DX90 1FGYA 2L1CA 3NWFA 4A6KA 1SHCA 4IFSA 1EVHA 2QKMA 3F0WA 4KHAA 3GYOA 3ULBA 2ELBA 3MDBC 5DHAB 5I2SA 3DCXA 1J19A 1IRSA 2RRFA 5J3QA 3SYXA 3HQCA 3TO1A 2DX5A 4WJ7A 4F7UP 1V5PA 2M14A 3T06A 5D3WA 5DH9B 4CHJA 1ZVRA 4NY0A 4HSIA 4A6HA 1FHOA 3U7DA 2UZRA 4KVGB 4YL8A 5CLQB 2P0HA 1KZ7A 2Z59A 4K2PA 3VOQA 1NI2A 4OSNA 1UNPA 1TQZA 3AU4A 3O96A 1WJMA 2D2QA 1QC6A 3F5RA 3KRXA 4HAWB 1QQGA 1H4RA 2RUKB 1V5UA 2Y7BA 4CYEA 2DKQA 2P0DA 2Z0QA 3N7CA 4GOUA 5C16A 3TVVA 2L2IA 1ZC4B 1PFJA 4B6HA 1AQCA 3PZDA 4ZRIA 3VIAA 3U12A 2W2WA 2MDXA 3ODXA 1OQNA 3LJUX 3A8PA 2H7EA 2NBVA 2CY5A 4HDOA 1MPHA 3P7ZA 3NW8A 5D3XA 4BBKA 2FJLA 1KZGA 3SV1A 1T77A 1X11A 3RCPA 4WSFA 4XWXA 2GUMA 5FI1A 3ML4A 1MI1A 1ZYIA 1I7AA 2V76A 1W1GA 1FGZA 1U2BA 2RSGA 1K5GB 1PMSA 1FAOA 2YT2A 2COAA 1DDMA 1NTYA 1SGHA 4HHVA 1DDVA 3P6AA 2X18A 3FSSA 4A6FB 4IOYX 1W1DA 1U5FA 2DX1A 3FEHA 1WG7A 4Z2MB 2AEHA 5GOWB 2GS0A 1EAZA 5C6RA 1XX0A 2W2XD 4GXBA 4HAYB 3PVLA 1GG3A 2J0JA 2OQBA 5KQ1A 5JHGA 4A6FA 1BTNA 2YS5A 5IRSA 1V61A 2KGXB 2VKIA 4F7HA 4Z2NA 3KZ1A 4Y94A 4GPTB 4GNKB 2CY4A 2J59M 5DIFB 1XODA 1XCGA 4HDQA 2AL6A 3KRWA 2DHKA 2COFA 2I5CA 2KR0A 1WJ1A 3TW1A 3NWAA 1PLSA 2I5FA 1XR0B 5DI9B 2KCJA 1U5DA 2I1KA 4HAZB 2KUQA 3ODOA 4HB2B 1DDWA 2J0KA 2LYDA 4L6EA 5JHHA 2LOZA 1DROA 2GJYA 5C5BB 2DHIA 4EKUA 1WI1A 1X05A 4QXAB 3HSAA 2D9ZA 4ZRJA 1MKEA 2DTCA 2R2YA 2Z4DA 5D3VA 1UNRA 1ZM0A 4MK0A 2CRFA 4QJ3B 4IAPA 4KHBB 2D4QA 5C5BA 1V5MA 3CIKA 2D11A 3ULCA 1ZC3B 5I2MA 2YS1A 2KUPA 3X23A 3WYFB 2Z0OA 2JP2A 4TKNA 2XQNM 2COCA 1MIXA 4HAXB 2DKPA 1M7EA 5D3YA 1V89A 1E5WA 2YF0A 1Y5OA 4GMVA 2YVCA 2K8EA 3KSYA 5LG4B 4PNKA 1TJ6A 1GC7A 2YRYA 2RVBB 4L1RA 2CODA 4H8SA 1RJ2A 3D8EA 2RNRB 1M7RA 2J0MA 5CLLB 2P8VA 2R0DA 3NSUA 4TYZA 1U5EA 2NZ8B 2DYNA 3NWDA 5HE3A 1X1FA 2YS3A 5KCVA 1K5DB 2Z0PA 3WA0A 2R09A 3OANA 1H10A 3CXBB 5EFXA 4GN1A 1V88A 2K00A 3ZVRA 1UEFA 1XKEA 4GMXB 1P5TA 1NU2A 5J3TA 4C0AA 1LW3A 3PVWA 4MT7A 3M1IB 3DXCA 2YT1A 3IVFA 2D9XA 2N23A 4CHMA 1FB8A 4PQ0A 2Z13A 3D8FA 4DIXA 2NMBA 4D0NB 3DXDA 2RGNB 1RRPB 2D9VA 1N3HA 2ROZB 1AWEA 1UPQA 1P6SA 2Y8GA 1X1GA 3GYPA 2IFSA 2LULA 2ZKMX 3FM8C 4DXAB 4DX8A 2PZ1A 3QBVB 4P7IA 1FHWA 3ZDTA 3HK0A 2VRWB 2YT0A 1WGUA 3A98B 1U29A 2W2XC 2HTHB 3SNHA 1ZSQA 3PEGA 2Y8FA 2DHJA 4ZRKA 5FI0A 1W1HA 4HATB 3SUZA 1DYNA 4HB0B 2K2JA 1NTVA 1BWNA 2D9WA 1UPRA 1J0WA 1Y19B 4GZUA 2DFKA 2GCJA 4KHOA 2M38A 4YONA 4WVFB 3TCAA 2CAYA 3PG7A 2MWNB 1ISNA 2ELAA 1OY2A 4DBBA 2EJ8A 1LB1A 2YSZA 1DBHA 4HB4B 5JLJB 3PP2A 2ROVA 1Q67A 5LONB 5C79A 2ADZA 3DXEA 3FVCA 2GCLA 1FOEA 2UZSA
chains in the Genus database with same CATH topology
1OMWA 1WGQA 2OTXA 1TXDA 3QWMA 5HE0A 3BJIA 1I2HA 1BTKA 2RLOA 5HE1A 3PSCA 5J3YA 2H7DA 1Z87A 4HB3B 1MAIA 2DA0A 2N0YA 2Q13A 3ODWA 3HW2B 2G35A 1MK9B 5D27A 2DYQA 5LOPB 2MFQA 2EMSA 5DHFB 3G9WA 2DLWA 3D8DA 4K17A 1EF1A 1P3RA 5JP4A 1XD4A 4HAVB 2LKOA 3SO6A 5HE2A 2K2UA 3QIJA 4EJNA 3A8QA 2UVMA 3TFMA 2I1JA 2P0FA 1EGXA 2LG1A 3V5WA 1WVHA 4HAUB 4NSWA 2LOXA 1U5GA 2HE7A 1MIZB 4A5KA 2DN6A 1X86A 4MY6A 4K81A 1UNQA 2E2XA 4EMOA 1GC6A 1BAKA 3KY9A 2D9YA 3PVUA 3AU5A 1U27A 1KI1B 2EMTA 2ZPYA 3AJ4A 4F7GA 2MKRA 2VSZA 3MPXA 5L81A 4K2OA 3U8ZA 2BCJA 2QKLA 1B55A 3BINA 4KAXB 1FHXA 5KQ4A 3UZTA 1MK7B 2D10A 2IYBA 2EC1A 4DX90 1FGYA 2L1CA 4A6KA 1SHCA 4IFSA 1EVHA 2QKMA 3F0WA 4KHAA 3GYOA 3ULBA 2ELBA 3MDBC 5DHAB 1J19A 1IRSA 5J3QA 3SYXA 3HQCA 3TO1A 2DX5A 4WJ7A 4F7UP 1V5PA 2M14A 3T06A 5D3WA 5DH9B 4CHJA 1ZVRA 4NY0A 4A6HA 1FHOA 3U7DA 2UZRA 4KVGB 4YL8A 5CLQB 2P0HA 1KZ7A 4K2PA 3VOQA 1NI2A 1UNPA 1TQZA 3AU4A 3O96A 1WJMA 2D2QA 1QC6A 3F5RA 3KRXA 4HAWB 1QQGA 1H4RA 2RUKB 1V5UA 2Y7BA 4CYEA 2DKQA 2P0DA 2Z0QA 3N7CA 5C16A 3TVVA 2L2IA 1ZC4B 1PFJA 4B6HA 1AQCA 3PZDA 4ZRIA 3VIAA 2W2WA 2MDXA 3ODXA 1OQNA 3LJUX 3A8PA 2H7EA 2CY5A 4HDOA 1MPHA 3P7ZA 5D3XA 4BBKA 2FJLA 1KZGA 3SV1A 1X11A 3RCPA 4WSFA 4XWXA 5FI1A 3ML4A 1I7AA 2V76A 1W1GA 1FGZA 1U2BA 2RSGA 1K5GB 1PMSA 1FAOA 2COAA 1DDMA 1NTYA 1SGHA 4HHVA 1DDVA 3P6AA 2X18A 3FSSA 4A6FB 4IOYX 1W1DA 1U5FA 2DX1A 3FEHA 1WG7A 4Z2MB 2AEHA 5GOWB 2GS0A 1EAZA 5C6RA 1XX0A 2W2XD 4GXBA 4HAYB 3PVLA 1GG3A 2J0JA 2OQBA 5KQ1A 5JHGA 4A6FA 1BTNA 2YS5A 1V61A 2KGXB 2VKIA 4F7HA 4Z2NA 3KZ1A 4Y94A 4GPTB 2CY4A 2J59M 5DIFB 1XODA 1XCGA 4HDQA 2AL6A 3KRWA 2DHKA 2COFA 2I5CA 1WJ1A 3TW1A 1PLSA 2I5FA 1XR0B 5DI9B 2KCJA 1U5DA 2I1KA 4HAZB 3ODOA 4HB2B 1DDWA 2J0KA 2LYDA 4L6EA 5JHHA 2LOZA 1DROA 2GJYA 5C5BB 2DHIA 4EKUA 1WI1A 1X05A 2D9ZA 4ZRJA 1MKEA 2DTCA 5D3VA 1UNRA 1ZM0A 4MK0A 2CRFA 4IAPA 4KHBB 2D4QA 5C5BA 1V5MA 3CIKA 2D11A 3ULCA 1ZC3B 2YS1A 2KUPA 3X23A 3WYFB 2Z0OA 2JP2A 4TKNA 2XQNM 2COCA 1MIXA 4HAXB 2DKPA 1M7EA 5D3YA 1V89A 1E5WA 2YF0A 1Y5OA 4GMVA 2YVCA 3KSYA 4PNKA 1TJ6A 1GC7A 2YRYA 2RVBB 2CODA 4H8SA 1RJ2A 3D8EA 2RNRB 1M7RA 2J0MA 5CLLB 2P8VA 2R0DA 3NSUA 4TYZA 1U5EA 2NZ8B 2DYNA 5HE3A 1X1FA 2YS3A 5KCVA 1K5DB 2Z0PA 3WA0A 2R09A 3OANA 1H10A 3CXBB 5EFXA 4GN1A 1V88A 2K00A 3ZVRA 1UEFA 1XKEA 4GMXB 1P5TA 1NU2A 5J3TA 4C0AA 1LW3A 3PVWA 4MT7A 3M1IB 3DXCA 2YT1A 3IVFA 2D9XA 2N23A 4CHMA 1FB8A 4PQ0A 3D8FA 2NMBA 4D0NB 3DXDA 2RGNB 1RRPB 2D9VA 1N3HA 2ROZB 1AWEA 1UPQA 1P6SA 2Y8GA 1X1GA 3GYPA 2IFSA 2LULA 3FM8C 4DXAB 4DX8A 2PZ1A 3QBVB 4P7IA 1FHWA 3ZDTA 3HK0A 2VRWB 2YT0A 1WGUA 3A98B 1U29A 2W2XC 2HTHB 3SNHA 1ZSQA 3PEGA 2Y8FA 2DHJA 4ZRKA 5FI0A 1W1HA 4HATB 3SUZA 1DYNA 4HB0B 2K2JA 1NTVA 1BWNA 2D9WA 1UPRA 1J0WA 1Y19B 4GZUA 2DFKA 2GCJA 4KHOA 2M38A 4YONA 4WVFB 3TCAA 2CAYA 3PG7A 2MWNB 1ISNA 2ELAA 1OY2A 4DBBA 2EJ8A 1LB1A 2YSZA 1DBHA 4HB4B 5JLJB 3PP2A 2ROVA 1Q67A 5LONB 5C79A 2ADZA 3DXEA 2GCLA 1FOEA 2UZSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OMW A;  1WGQ A;  2OTX A;  1TXD A;  3QWM A;  5HE0 A;  3BJI A;  1I2H A;  1BTK A;  2RLO A;  5HE1 A;  3PSC A;  5J3Y A;  2H7D A;  1Z87 A;  4HB3 B;  1MAI A;  2DA0 A;  2N0Y A;  2Q13 A;  3ODW A;  3HW2 B;  2G35 A;  1MK9 B;  5D27 A;  2DYQ A;  5LOP B;  2MFQ A;  2EMS A;  5DHF B;  3G9W A;  2DLW A;  3D8D A;  4K17 A;  1EF1 A;  1P3R A;  5JP4 A;  1XD4 A;  4HAV B;  2LKO A;  3SO6 A;  5HE2 A;  2K2U A;  3QIJ A;  4EJN A;  3A8Q A;  2UVM A;  3TFM A;  2I1J A;  2P0F A;  1EGX A;  2LG1 A;  3V5W A;  1WVH A;  4HAU B;  4NSW A;  2LOX A;  1U5G A;  2HE7 A;  1MIZ B;  4A5K A;  2DN6 A;  1X86 A;  4MY6 A;  4K81 A;  1UNQ A;  2E2X A;  4EMO A;  1GC6 A;  1BAK A;  3KY9 A;  2D9Y A;  3PVU A;  3AU5 A;  1U27 A;  1KI1 B;  2EMT A;  2ZPY A;  3AJ4 A;  4F7G A;  2MKR A;  2VSZ A;  3MPX A;  5L81 A;  4K2O A;  3U8Z A;  2BCJ A;  2QKL A;  1B55 A;  3BIN A;  4KAX B;  1FHX A;  5KQ4 A;  3UZT A;  1MK7 B;  2D10 A;  2IYB A;  2EC1 A;  4DX9 0;  1FGY A;  2L1C A;  4A6K A;  1SHC A;  4IFS A;  1EVH A;  2QKM A;  3F0W A;  4KHA A;  3GYO A;  3ULB A;  2ELB A;  3MDB C;  5DHA B;  1J19 A;  1IRS A;  5J3Q A;  3SYX A;  3HQC A;  3TO1 A;  2DX5 A;  4WJ7 A;  4F7U P;  1V5P A;  2M14 A;  3T06 A;  5D3W A;  5DH9 B;  4CHJ A;  1ZVR A;  4NY0 A;  4A6H A;  1FHO A;  3U7D A;  2UZR A;  4KVG B;  4YL8 A;  5CLQ B;  2P0H A;  1KZ7 A;  4K2P A;  3VOQ A;  1NI2 A;  1UNP A;  1TQZ A;  3AU4 A;  3O96 A;  1WJM A;  2D2Q A;  1QC6 A;  3F5R A;  3KRX A;  4HAW B;  1QQG A;  1H4R A;  2RUK B;  1V5U A;  2Y7B A;  4CYE A;  2DKQ A;  2P0D A;  2Z0Q A;  3N7C A;  5C16 A;  3TVV A;  2L2I A;  1ZC4 B;  1PFJ A;  4B6H A;  1AQC A;  3PZD A;  4ZRI A;  3VIA A;  2W2W A;  2MDX A;  3ODX A;  1OQN A;  3LJU X;  3A8P A;  2H7E A;  2CY5 A;  4HDO A;  1MPH A;  3P7Z A;  5D3X A;  4BBK A;  2FJL A;  1KZG A;  3SV1 A;  1X11 A;  3RCP A;  4WSF A;  4XWX A;  5FI1 A;  3ML4 A;  1I7A A;  2V76 A;  1W1G A;  1FGZ A;  1U2B A;  2RSG A;  1K5G B;  1PMS A;  1FAO A;  2COA A;  1DDM A;  1NTY A;  1SGH A;  4HHV A;  1DDV A;  3P6A A;  2X18 A;  3FSS A;  4A6F B;  4IOY X;  1W1D A;  1U5F A;  2DX1 A;  3FEH A;  1WG7 A;  4Z2M B;  2AEH A;  5GOW B;  2GS0 A;  1EAZ A;  5C6R A;  1XX0 A;  2W2X D;  4GXB A;  4HAY B;  3PVL A;  1GG3 A;  2J0J A;  2OQB A;  5KQ1 A;  5JHG A;  4A6F A;  1BTN A;  2YS5 A;  1V61 A;  2KGX B;  2VKI A;  4F7H A;  4Z2N A;  3KZ1 A;  4Y94 A;  4GPT B;  2CY4 A;  2J59 M;  5DIF B;  1XOD A;  1XCG A;  4HDQ A;  2AL6 A;  3KRW A;  2DHK A;  2COF A;  2I5C A;  1WJ1 A;  3TW1 A;  1PLS A;  2I5F A;  1XR0 B;  5DI9 B;  2KCJ A;  1U5D A;  2I1K A;  4HAZ B;  3ODO A;  4HB2 B;  1DDW A;  2J0K A;  2LYD A;  4L6E A;  5JHH A;  2LOZ A;  1DRO A;  2GJY A;  5C5B B;  2DHI A;  4EKU A;  1WI1 A;  1X05 A;  2D9Z A;  4ZRJ A;  1MKE A;  2DTC A;  5D3V A;  1UNR A;  1ZM0 A;  4MK0 A;  2CRF A;  4IAP A;  4KHB B;  2D4Q A;  5C5B A;  1V5M A;  3CIK A;  2D11 A;  3ULC A;  1ZC3 B;  2YS1 A;  2KUP A;  3X23 A;  3WYF B;  2Z0O A;  2JP2 A;  4TKN A;  2XQN M;  2COC A;  1MIX A;  4HAX B;  2DKP A;  1M7E A;  5D3Y A;  1V89 A;  1E5W A;  2YF0 A;  1Y5O A;  4GMV A;  2YVC A;  3KSY A;  4PNK A;  1TJ6 A;  1GC7 A;  2YRY A;  2RVB B;  2COD A;  4H8S A;  1RJ2 A;  3D8E A;  2RNR B;  1M7R A;  2J0M A;  5CLL B;  2P8V A;  2R0D A;  3NSU A;  4TYZ A;  1U5E A;  2NZ8 B;  2DYN A;  5HE3 A;  1X1F A;  2YS3 A;  5KCV A;  1K5D B;  2Z0P A;  3WA0 A;  2R09 A;  3OAN A;  1H10 A;  3CXB B;  5EFX A;  4GN1 A;  1V88 A;  2K00 A;  3ZVR A;  1UEF A;  1XKE A;  4GMX B;  1P5T A;  1NU2 A;  5J3T A;  4C0A A;  1LW3 A;  3PVW A;  4MT7 A;  3M1I B;  3DXC A;  2YT1 A;  3IVF A;  2D9X A;  2N23 A;  4CHM A;  1FB8 A;  4PQ0 A;  3D8F A;  2NMB A;  4D0N B;  3DXD A;  2RGN B;  1RRP B;  2D9V A;  1N3H A;  2ROZ B;  1AWE A;  1UPQ A;  1P6S A;  2Y8G A;  1X1G A;  3GYP A;  2IFS A;  2LUL A;  3FM8 C;  4DXA B;  4DX8 A;  2PZ1 A;  3QBV B;  4P7I A;  1FHW A;  3ZDT A;  3HK0 A;  2VRW B;  2YT0 A;  1WGU A;  3A98 B;  1U29 A;  2W2X C;  2HTH B;  3SNH A;  1ZSQ A;  3PEG A;  2Y8F A;  2DHJ A;  4ZRK A;  5FI0 A;  1W1H A;  4HAT B;  3SUZ A;  1DYN A;  4HB0 B;  2K2J A;  1NTV A;  1BWN A;  2D9W A;  1UPR A;  1J0W A;  1Y19 B;  4GZU A;  2DFK A;  2GCJ A;  4KHO A;  2M38 A;  4YON A;  4WVF B;  3TCA A;  2CAY A;  3PG7 A;  2MWN B;  1ISN A;  2ELA A;  1OY2 A;  4DBB A;  2EJ8 A;  1LB1 A;  2YSZ A;  1DBH A;  4HB4 B;  5JLJ B;  3PP2 A;  2ROV A;  1Q67 A;  5LON B;  5C79 A;  2ADZ A;  3DXE A;  2GCL A;  1FOE A;  2UZS A; 
#chains in the Genus database with same CATH topology
 2KIE A;  1OMW A;  1WGQ A;  2OTX A;  1TXD A;  3QWM A;  5HE0 A;  3BJI A;  1I2H A;  1BTK A;  2RLO A;  5HE1 A;  3PSC A;  4D6W A;  5J3Y A;  2H7D A;  1Z87 A;  4HB3 B;  1MAI A;  2DA0 A;  2N0Y A;  2Q13 A;  2K49 A;  3ODW A;  4KHB A;  3HW2 B;  2G35 A;  1MK9 B;  5D27 A;  2DYQ A;  5LOP B;  2MFQ A;  4QJ5 B;  2EMS A;  5DHF B;  3G9W A;  2DLW A;  3D8D A;  4K17 A;  1EF1 A;  1P3R A;  5JP4 A;  1XD4 A;  4HAV B;  2LKO A;  3SO6 A;  5M4Y B;  5HE2 A;  2K2U A;  3QIJ A;  4EJN A;  3A8Q A;  2UVM A;  3HIE A;  3TFM A;  2I1J A;  2P0F A;  2KIG A;  1EGX A;  2LG1 A;  3V5W A;  1WVH A;  4HAU B;  4NSW A;  2Z14 A;  2LOX A;  3B77 A;  1U5G A;  2HE7 A;  1MIZ B;  4A5K A;  2DN6 A;  1X86 A;  4OT1 A;  3OHM B;  4MY6 A;  4K81 A;  1UNQ A;  4CSQ A;  2E2X A;  2FJU B;  4EMO A;  1GC6 A;  1BAK A;  3KY9 A;  2D9Y A;  3PVU A;  3AU5 A;  1U27 A;  1KI1 B;  2EMT A;  2ZPY A;  3AJ4 A;  3A58 A;  4F7G A;  2MKR A;  2VSZ A;  3MPX A;  5L81 A;  4K2O A;  3U8Z A;  2BCJ A;  2QKL A;  1B55 A;  3BIN A;  4KAX B;  1FHX A;  5KQ4 A;  3UZT A;  1MK7 B;  2D10 A;  4QJ4 B;  2IYB A;  2EC1 A;  4DX9 0;  1FGY A;  2L1C A;  3NWF A;  4A6K A;  1SHC A;  4IFS A;  1EVH A;  2QKM A;  3F0W A;  4KHA A;  3GYO A;  3ULB A;  2ELB A;  3MDB C;  5DHA B;  5I2S A;  3DCX A;  1J19 A;  1IRS A;  2RRF A;  5J3Q A;  3SYX A;  3HQC A;  3TO1 A;  2DX5 A;  4WJ7 A;  4F7U P;  1V5P A;  2M14 A;  3T06 A;  5D3W A;  5DH9 B;  4CHJ A;  1ZVR A;  4NY0 A;  4HSI A;  4A6H A;  1FHO A;  3U7D A;  2UZR A;  4KVG B;  4YL8 A;  5CLQ B;  2P0H A;  1KZ7 A;  2Z59 A;  4K2P A;  3VOQ A;  1NI2 A;  4OSN A;  1UNP A;  1TQZ A;  3AU4 A;  3O96 A;  1WJM A;  2D2Q A;  1QC6 A;  3F5R A;  3KRX A;  4HAW B;  1QQG A;  1H4R A;  2RUK B;  1V5U A;  2Y7B A;  4CYE A;  2DKQ A;  2P0D A;  2Z0Q A;  3N7C A;  4GOU A;  5C16 A;  3TVV A;  2L2I A;  1ZC4 B;  1PFJ A;  4B6H A;  1AQC A;  3PZD A;  4ZRI A;  3VIA A;  3U12 A;  2W2W A;  2MDX A;  3ODX A;  1OQN A;  3LJU X;  3A8P A;  2H7E A;  2NBV A;  2CY5 A;  4HDO A;  1MPH A;  3P7Z A;  3NW8 A;  5D3X A;  4BBK A;  2FJL A;  1KZG A;  3SV1 A;  1T77 A;  1X11 A;  3RCP A;  4WSF A;  4XWX A;  2GUM A;  5FI1 A;  3ML4 A;  1MI1 A;  1ZYI A;  1I7A A;  2V76 A;  1W1G A;  1FGZ A;  1U2B A;  2RSG A;  1K5G B;  1PMS A;  1FAO A;  2YT2 A;  2COA A;  1DDM A;  1NTY A;  1SGH A;  4HHV A;  1DDV A;  3P6A A;  2X18 A;  3FSS A;  4A6F B;  4IOY X;  1W1D A;  1U5F A;  2DX1 A;  3FEH A;  1WG7 A;  4Z2M B;  2AEH A;  5GOW B;  2GS0 A;  1EAZ A;  5C6R A;  1XX0 A;  2W2X D;  4GXB A;  4HAY B;  3PVL A;  1GG3 A;  2J0J A;  2OQB A;  5KQ1 A;  5JHG A;  4A6F A;  1BTN A;  2YS5 A;  5IRS A;  1V61 A;  2KGX B;  2VKI A;  4F7H A;  4Z2N A;  3KZ1 A;  4Y94 A;  4GPT B;  4GNK B;  2CY4 A;  2J59 M;  5DIF B;  1XOD A;  1XCG A;  4HDQ A;  2AL6 A;  3KRW A;  2DHK A;  2COF A;  2I5C A;  2KR0 A;  1WJ1 A;  3TW1 A;  3NWA A;  1PLS A;  2I5F A;  1XR0 B;  5DI9 B;  2KCJ A;  1U5D A;  2I1K A;  4HAZ B;  2KUQ A;  3ODO A;  4HB2 B;  1DDW A;  2J0K A;  2LYD A;  4L6E A;  5JHH A;  2LOZ A;  1DRO A;  2GJY A;  5C5B B;  2DHI A;  4EKU A;  1WI1 A;  1X05 A;  4QXA B;  3HSA A;  2D9Z A;  4ZRJ A;  1MKE A;  2DTC A;  2R2Y A;  2Z4D A;  5D3V A;  1UNR A;  1ZM0 A;  4MK0 A;  2CRF A;  4QJ3 B;  4IAP A;  4KHB B;  2D4Q A;  5C5B A;  1V5M A;  3CIK A;  2D11 A;  3ULC A;  1ZC3 B;  5I2M A;  2YS1 A;  2KUP A;  3X23 A;  3WYF B;  2Z0O A;  2JP2 A;  4TKN A;  2XQN M;  2COC A;  1MIX A;  4HAX B;  2DKP A;  1M7E A;  5D3Y A;  1V89 A;  1E5W A;  2YF0 A;  1Y5O A;  4GMV A;  2YVC A;  2K8E A;  3KSY A;  5LG4 B;  4PNK A;  1TJ6 A;  1GC7 A;  2YRY A;  2RVB B;  4L1R A;  2COD A;  4H8S A;  1RJ2 A;  3D8E A;  2RNR B;  1M7R A;  2J0M A;  5CLL B;  2P8V A;  2R0D A;  3NSU A;  4TYZ A;  1U5E A;  2NZ8 B;  2DYN A;  3NWD A;  5HE3 A;  1X1F A;  2YS3 A;  5KCV A;  1K5D B;  2Z0P A;  3WA0 A;  2R09 A;  3OAN A;  1H10 A;  3CXB B;  5EFX A;  4GN1 A;  1V88 A;  2K00 A;  3ZVR A;  1UEF A;  1XKE A;  4GMX B;  1P5T A;  1NU2 A;  5J3T A;  4C0A A;  1LW3 A;  3PVW A;  4MT7 A;  3M1I B;  3DXC A;  2YT1 A;  3IVF A;  2D9X A;  2N23 A;  4CHM A;  1FB8 A;  4PQ0 A;  2Z13 A;  3D8F A;  4DIX A;  2NMB A;  4D0N B;  3DXD A;  2RGN B;  1RRP B;  2D9V A;  1N3H A;  2ROZ B;  1AWE A;  1UPQ A;  1P6S A;  2Y8G A;  1X1G A;  3GYP A;  2IFS A;  2LUL A;  2ZKM X;  3FM8 C;  4DXA B;  4DX8 A;  2PZ1 A;  3QBV B;  4P7I A;  1FHW A;  3ZDT A;  3HK0 A;  2VRW B;  2YT0 A;  1WGU A;  3A98 B;  1U29 A;  2W2X C;  2HTH B;  3SNH A;  1ZSQ A;  3PEG A;  2Y8F A;  2DHJ A;  4ZRK A;  5FI0 A;  1W1H A;  4HAT B;  3SUZ A;  1DYN A;  4HB0 B;  2K2J A;  1NTV A;  1BWN A;  2D9W A;  1UPR A;  1J0W A;  1Y19 B;  4GZU A;  2DFK A;  2GCJ A;  4KHO A;  2M38 A;  4YON A;  4WVF B;  3TCA A;  2CAY A;  3PG7 A;  2MWN B;  1ISN A;  2ELA A;  1OY2 A;  4DBB A;  2EJ8 A;  1LB1 A;  2YSZ A;  1DBH A;  4HB4 B;  5JLJ B;  3PP2 A;  2ROV A;  1Q67 A;  5LON B;  5C79 A;  2ADZ A;  3DXE A;  3FVC A;  2GCL A;  1FOE A;  2UZS A; 
#chains in the Genus database with same CATH homology
 1OMW A;  1WGQ A;  2OTX A;  1TXD A;  3QWM A;  5HE0 A;  3BJI A;  1I2H A;  1BTK A;  2RLO A;  5HE1 A;  3PSC A;  5J3Y A;  2H7D A;  1Z87 A;  4HB3 B;  1MAI A;  2DA0 A;  2N0Y A;  2Q13 A;  3ODW A;  3HW2 B;  2G35 A;  1MK9 B;  5D27 A;  2DYQ A;  5LOP B;  2MFQ A;  2EMS A;  5DHF B;  3G9W A;  2DLW A;  3D8D A;  4K17 A;  1EF1 A;  1P3R A;  5JP4 A;  1XD4 A;  4HAV B;  2LKO A;  3SO6 A;  5HE2 A;  2K2U A;  3QIJ A;  4EJN A;  3A8Q A;  2UVM A;  3TFM A;  2I1J A;  2P0F A;  1EGX A;  2LG1 A;  3V5W A;  1WVH A;  4HAU B;  4NSW A;  2LOX A;  1U5G A;  2HE7 A;  1MIZ B;  4A5K A;  2DN6 A;  1X86 A;  4MY6 A;  4K81 A;  1UNQ A;  2E2X A;  4EMO A;  1GC6 A;  1BAK A;  3KY9 A;  2D9Y A;  3PVU A;  3AU5 A;  1U27 A;  1KI1 B;  2EMT A;  2ZPY A;  3AJ4 A;  4F7G A;  2MKR A;  2VSZ A;  3MPX A;  5L81 A;  4K2O A;  3U8Z A;  2BCJ A;  2QKL A;  1B55 A;  3BIN A;  4KAX B;  1FHX A;  5KQ4 A;  3UZT A;  1MK7 B;  2D10 A;  2IYB A;  2EC1 A;  4DX9 0;  1FGY A;  2L1C A;  4A6K A;  1SHC A;  4IFS A;  1EVH A;  2QKM A;  3F0W A;  4KHA A;  3GYO A;  3ULB A;  2ELB A;  3MDB C;  5DHA B;  1J19 A;  1IRS A;  5J3Q A;  3SYX A;  3HQC A;  3TO1 A;  2DX5 A;  4WJ7 A;  4F7U P;  1V5P A;  2M14 A;  3T06 A;  5D3W A;  5DH9 B;  4CHJ A;  1ZVR A;  4NY0 A;  4A6H A;  1FHO A;  3U7D A;  2UZR A;  4KVG B;  4YL8 A;  5CLQ B;  2P0H A;  1KZ7 A;  4K2P A;  3VOQ A;  1NI2 A;  1UNP A;  1TQZ A;  3AU4 A;  3O96 A;  1WJM A;  2D2Q A;  1QC6 A;  3F5R A;  3KRX A;  4HAW B;  1QQG A;  1H4R A;  2RUK B;  1V5U A;  2Y7B A;  4CYE A;  2DKQ A;  2P0D A;  2Z0Q A;  3N7C A;  5C16 A;  3TVV A;  2L2I A;  1ZC4 B;  1PFJ A;  4B6H A;  1AQC A;  3PZD A;  4ZRI A;  3VIA A;  2W2W A;  2MDX A;  3ODX A;  1OQN A;  3LJU X;  3A8P A;  2H7E A;  2CY5 A;  4HDO A;  1MPH A;  3P7Z A;  5D3X A;  4BBK A;  2FJL A;  1KZG A;  3SV1 A;  1X11 A;  3RCP A;  4WSF A;  4XWX A;  5FI1 A;  3ML4 A;  1I7A A;  2V76 A;  1W1G A;  1FGZ A;  1U2B A;  2RSG A;  1K5G B;  1PMS A;  1FAO A;  2COA A;  1DDM A;  1NTY A;  1SGH A;  4HHV A;  1DDV A;  3P6A A;  2X18 A;  3FSS A;  4A6F B;  4IOY X;  1W1D A;  1U5F A;  2DX1 A;  3FEH A;  1WG7 A;  4Z2M B;  2AEH A;  5GOW B;  2GS0 A;  1EAZ A;  5C6R A;  1XX0 A;  2W2X D;  4GXB A;  4HAY B;  3PVL A;  1GG3 A;  2J0J A;  2OQB A;  5KQ1 A;  5JHG A;  4A6F A;  1BTN A;  2YS5 A;  1V61 A;  2KGX B;  2VKI A;  4F7H A;  4Z2N A;  3KZ1 A;  4Y94 A;  4GPT B;  2CY4 A;  2J59 M;  5DIF B;  1XOD A;  1XCG A;  4HDQ A;  2AL6 A;  3KRW A;  2DHK A;  2COF A;  2I5C A;  1WJ1 A;  3TW1 A;  1PLS A;  2I5F A;  1XR0 B;  5DI9 B;  2KCJ A;  1U5D A;  2I1K A;  4HAZ B;  3ODO A;  4HB2 B;  1DDW A;  2J0K A;  2LYD A;  4L6E A;  5JHH A;  2LOZ A;  1DRO A;  2GJY A;  5C5B B;  2DHI A;  4EKU A;  1WI1 A;  1X05 A;  2D9Z A;  4ZRJ A;  1MKE A;  2DTC A;  5D3V A;  1UNR A;  1ZM0 A;  4MK0 A;  2CRF A;  4IAP A;  4KHB B;  2D4Q A;  5C5B A;  1V5M A;  3CIK A;  2D11 A;  3ULC A;  1ZC3 B;  2YS1 A;  2KUP A;  3X23 A;  3WYF B;  2Z0O A;  2JP2 A;  4TKN A;  2XQN M;  2COC A;  1MIX A;  4HAX B;  2DKP A;  1M7E A;  5D3Y A;  1V89 A;  1E5W A;  2YF0 A;  1Y5O A;  4GMV A;  2YVC A;  3KSY A;  4PNK A;  1TJ6 A;  1GC7 A;  2YRY A;  2RVB B;  2COD A;  4H8S A;  1RJ2 A;  3D8E A;  2RNR B;  1M7R A;  2J0M A;  5CLL B;  2P8V A;  2R0D A;  3NSU A;  4TYZ A;  1U5E A;  2NZ8 B;  2DYN A;  5HE3 A;  1X1F A;  2YS3 A;  5KCV A;  1K5D B;  2Z0P A;  3WA0 A;  2R09 A;  3OAN A;  1H10 A;  3CXB B;  5EFX A;  4GN1 A;  1V88 A;  2K00 A;  3ZVR A;  1UEF A;  1XKE A;  4GMX B;  1P5T A;  1NU2 A;  5J3T A;  4C0A A;  1LW3 A;  3PVW A;  4MT7 A;  3M1I B;  3DXC A;  2YT1 A;  3IVF A;  2D9X A;  2N23 A;  4CHM A;  1FB8 A;  4PQ0 A;  3D8F A;  2NMB A;  4D0N B;  3DXD A;  2RGN B;  1RRP B;  2D9V A;  1N3H A;  2ROZ B;  1AWE A;  1UPQ A;  1P6S A;  2Y8G A;  1X1G A;  3GYP A;  2IFS A;  2LUL A;  3FM8 C;  4DXA B;  4DX8 A;  2PZ1 A;  3QBV B;  4P7I A;  1FHW A;  3ZDT A;  3HK0 A;  2VRW B;  2YT0 A;  1WGU A;  3A98 B;  1U29 A;  2W2X C;  2HTH B;  3SNH A;  1ZSQ A;  3PEG A;  2Y8F A;  2DHJ A;  4ZRK A;  5FI0 A;  1W1H A;  4HAT B;  3SUZ A;  1DYN A;  4HB0 B;  2K2J A;  1NTV A;  1BWN A;  2D9W A;  1UPR A;  1J0W A;  1Y19 B;  4GZU A;  2DFK A;  2GCJ A;  4KHO A;  2M38 A;  4YON A;  4WVF B;  3TCA A;  2CAY A;  3PG7 A;  2MWN B;  1ISN A;  2ELA A;  1OY2 A;  4DBB A;  2EJ8 A;  1LB1 A;  2YSZ A;  1DBH A;  4HB4 B;  5JLJ B;  3PP2 A;  2ROV A;  1Q67 A;  5LON B;  5C79 A;  2ADZ A;  3DXE A;  2GCL A;  1FOE A;  2UZS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...