1OY2A

Coupling of folding and binding in the ptb domain of the signaling protein shc
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
191
structure length
191
Chain Sequence
GQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Coupling of Folding and Binding in the PTB Domain of the Signaling Protein Shc
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords SHC transforming protein
total genus 16
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2003-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1oy2A00
2YS1A 2AL6A 2AEHA 3GYOA 2COFA 4DX90 3A8QA 4H8SA 3P7ZA 3SV1A 4YONA 3PVWA 1SGHA 2YVCA 2EMSA 1DYNA 2L2IA 1V5UA 2ADZA 4A6KA 3LJUX 1K5GB 2DKPA 4PQ0A 2K00A 2Y8GA 2V76A 1X11A 4EMOA 2Q13A 1WVHA 1DDMA 1WJMA 2DYNA 2ELBA 5FI0A 3VOQA 1MIZB 3PSCA 1V5PA 2J0JA 1FHWA 4MY6A 3ULCA 4HAYB 2DKQA 2DX1A 2D9WA 3KY9A 2COAA 2Z0PA 2X18A 3KRWA 5J3QA 4K81A 3AU5A 4GPTB 4K2OA 2OTXA 1J19A 1MKEA 4P7IA 4WSFA 2FJLA 5C6RA 1FHOA 2DHJA 1GG3A 4XWXA 2EMTA 2W2XC 2VSZA 4GXBA 1U5DA 1MPHA 4MK0A 2NZ8B 3FEHA 1GC6A 2UVMA 2LOXA 4BBKA 2R0DA 3QWMA 3KSYA 2XQNM 1P5TA 2DN6A 2DX5A 2VKIA 1I2HA 2J59M 1XD4A 1FOEA 3MDBC 5J3TA 4EJNA 1U5GA 1QC6A 3BJIA 4PNKA 1EVHA 2K2JA 4HAZB 1P3RA 5DH9B 3ZDTA 4A6FB 2GCJA 4NY0A 2N0YA 1U5FA 5KQ1A 4HB3B 1TJ6A 2JP2A 3QIJA 5JP4A 1UNPA 2Z0QA 3AJ4A 5CLLB 5EFXA 5C16A 2D2QA 4HAVB 3QBVB 3P6AA 2CY4A 1NTVA 3OANA 4IAPA 2K2UA 1BTNA 2YSZA 1PLSA 2D4QA 4ZRIA 3F5RA 4A6FA 2M38A 1QQGA 1XCGA 5DHAB 3D8FA 4EKUA 1DDWA 4Y94A 5C5BB 5D3WA 1FAOA 4B6HA 4IOYX 3KRXA 5D3VA 1MAIA 3PVLA 1NU2A 5HE3A 3D8EA 2KUPA 2YS3A 1ISNA 5C79A 3MPXA 2D9YA 5HE2A 2DHIA 5J3YA 2GS0A 3ODXA 2BCJA 4HAXB 3TW1A 1XR0B 2OQBA 3F0WA 4A5KA 1N3HA 2ELAA 2MDXA 1U2BA 4K2PA 1V88A 2D9VA 2YT1A 1EAZA 3HQCA 1GC7A 1NI2A 2IFSA 2CAYA 5L81A 3SUZA 2ZPYA 1E5WA 4WVFB 3HW2B 5JLJB 1FGZA 2D11A 1P6SA 1XODA 1OMWA 3RCPA 1V5MA 1LB1A 3U8ZA 3SNHA 1DBHA 4DX8A 1ZSQA 2KGXB 3GYPA 1Y5OA 5GOWB 1MK9B 1LW3A 3TVVA 5DIFB 4TKNA 1FHXA 1OQNA 5JHGA 1MIXA 2LULA 4GMVA 3FSSA 3PP2A 4A6HA 2I5CA 3ML4A 4IFSA 2KCJA 2LYDA 1PFJA 2P0FA 4MT7A 3TFMA 4CHMA 3FM8C 1NTYA 2RUKB 3AU4A 1X86A 1WJ1A 2LOZA 5HE0A 3A98B 4Z2MB 1FGYA 4KHBB 1B55A 4HAWB 1WGUA 3D8DA 2E2XA 1AQCA 2EJ8A 4KHOA 5C5BA 2MKRA 1RJ2A 1H10A 1DDVA 1EGXA 2QKLA 1W1HA 1H4RA 4HDQA 1KZ7A 2Z0OA 1Z87A 2L1CA 4GZUA 4HB0B 2D9XA 3HK0A 1WGQA 3DXCA 1ZC4B 2P0DA 4HB2B 3PZDA 1XKEA 1KI1B 3UZTA 1TXDA 3WA0A 2HTHB 4ZRJA 3BINA 2DFKA 2DLWA 2NMBA 1X1GA 1WI1A 1V89A 1Y19B 3M1IB 1UPQA 2LG1A 2H7DA 2P0HA 1M7RA 2MWNB 4HHVA 1ZC3B 3TCAA 3PEGA 2DA0A 4ZRKA 1XX0A 5KCVA 3VIAA 5FI1A 2CODA 1UNRA 2Y8FA 3A8PA 2D10A 3PG7A 5JHHA 2DHKA 4F7UP 2ROZB 3NSUA 5D27A 4F7HA 3SYXA 2J0MA 2GCLA 5D3XA 4HDOA 3G9WA 2UZRA 2VRWB 2CRFA 4DBBA 2LKOA 2I1JA 1ZVRA 4KAXB 1M7EA 1UPRA 1K5DB 1IRSA 1U5EA 2RNRB 4K17A 2J0KA 1RRPB 1DROA 2YS5A 1WG7A 2ROVA 5CLQB 3U7DA 2PZ1A 3WYFB 4TYZA 4C0AA 5DI9B 1UNQA 2IYBA 4DXAB 1ZM0A 4HATB 1MK7B 3O96A 2I5FA 4L6EA 1PMSA 1J0WA 5HE1A 4HAUB 2DTCA 5KQ4A 5DHFB 4D0NB 4GN1A 1W1DA 2QKMA 4CHJA 3KZ1A 2RLOA 1V61A 3IVFA 2CY5A 3ODOA 3T06A 2N23A 1UEFA 4GMXB 1I7AA 2RSGA 2HE7A 1BTKA 5LOPB 2W2WA 3CXBB 5D3YA 2UZSA 2MFQA 1Q67A 1KZGA 1BWNA 4Z2NA 3ODWA 2EC1A 2DYQA 2RGNB 2W2XD 3N7CA 1BAKA 3X23A 4YL8A 2YF0A 3SO6A 3CIKA 1TQZA 4KHAA 2GJYA 1X1FA 2YRYA 4F7GA 2M14A 1EF1A 2RVBB 2Y7BA 3ZVRA 2P8VA 1SHCA 2COCA 2G35A 4KVGB 2H7EA 3ULBA 3TO1A 3V5WA 4NSWA 3DXEA 2I1KA 1X05A 1U29A 2R09A 3PVUA 5LONB 1AWEA 3DXDA 4WJ7A 2YT0A 1U27A 1OY2A 1FB8A 1W1GA 4CYEA 2D9ZA 4HB4B
chains in the Genus database with same CATH superfamily
2YS1A 2AL6A 2AEHA 3GYOA 2COFA 4DX90 2K8EA 3A8QA 4H8SA 3P7ZA 3SV1A 4YONA 3PVWA 4GOUA 1SGHA 2YVCA 2EMSA 1DYNA 2L2IA 3DCXA 4CSQA 1V5UA 2ADZA 4A6KA 3LJUX 1K5GB 2DKPA 4PQ0A 1MI1A 2K00A 2KR0A 2Y8GA 2V76A 1X11A 4OT1A 4EMOA 3NWDA 2Q13A 1WVHA 1DDMA 1WJMA 2DYNA 2ELBA 5FI0A 3VOQA 1MIZB 3NWAA 2Z13A 1V5PA 3PSCA 2J0JA 1FHWA 4MY6A 3ULCA 4HAYB 2DKQA 2DX1A 2D9WA 3KY9A 2COAA 2YT2A 2Z0PA 2X18A 3KRWA 5J3QA 4K81A 3AU5A 4GPTB 4K2OA 2OTXA 1J19A 1MKEA 4P7IA 4WSFA 2FJLA 5C6RA 1FHOA 2DHJA 1GG3A 4XWXA 2EMTA 2W2XC 2VSZA 4GXBA 1U5DA 1MPHA 4MK0A 2NZ8B 3FEHA 1GC6A 2UVMA 2LOXA 4BBKA 2R0DA 3QWMA 3KSYA 2XQNM 1P5TA 2DN6A 2DX5A 2VKIA 1I2HA 2J59M 1XD4A 2Z59A 1FOEA 3MDBC 5J3TA 4EJNA 1U5GA 1QC6A 3BJIA 4PNKA 1EVHA 2K2JA 4HAZB 1P3RA 3NWFA 5DH9B 3ZDTA 4A6FB 2GCJA 4NY0A 2N0YA 1U5FA 5KQ1A 4HB3B 1TJ6A 2JP2A 3QIJA 5JP4A 1UNPA 2Z0QA 3AJ4A 5CLLB 5EFXA 5C16A 4QJ5B 2D2QA 4HAVB 3QBVB 3A58A 2CY4A 3P6AA 1NTVA 3OANA 4IAPA 2K2UA 1BTNA 2YSZA 1PLSA 2D4QA 4ZRIA 3F5RA 4A6FA 2M38A 1QQGA 1XCGA 5DHAB 3D8FA 4EKUA 4QXAB 1DDWA 4Y94A 5C5BB 5D3WA 1FAOA 4B6HA 4IOYX 3KRXA 5D3VA 1MAIA 3PVLA 1NU2A 5HE3A 3D8EA 2KUPA 2YS3A 1ISNA 2GUMA 5C79A 3MPXA 2D9YA 5HE2A 2DHIA 5J3YA 2GS0A 3ODXA 2BCJA 4HAXB 3TW1A 1XR0B 2OQBA 3F0WA 4A5KA 1N3HA 2ELAA 2MDXA 1U2BA 4K2PA 1V88A 2D9VA 2YT1A 1EAZA 3HQCA 1GC7A 1NI2A 2IFSA 2CAYA 5L81A 3SUZA 2ZPYA 1E5WA 4WVFB 3HW2B 2KIGA 5JLJB 1FGZA 2D11A 1P6SA 1XODA 1OMWA 3RCPA 1V5MA 1LB1A 3U8ZA 3SNHA 1DBHA 4DX8A 1ZSQA 2KGXB 3GYPA 1Y5OA 5GOWB 1MK9B 1LW3A 3TVVA 5DIFB 3NW8A 4GNKB 4TKNA 1FHXA 1OQNA 5JHGA 5LG4B 1MIXA 2LULA 4GMVA 3FSSA 3PP2A 3FVCA 4A6HA 2I5CA 3ML4A 4IFSA 2KCJA 2LYDA 1PFJA 2P0FA 4MT7A 3TFMA 4CHMA 3FM8C 1T77A 1NTYA 2Z4DA 2RUKB 3AU4A 1X86A 2R2YA 1WJ1A 2LOZA 5HE0A 3A98B 4Z2MB 2Z14A 1FGYA 4KHBB 1B55A 4HAWB 5I2MA 1WGUA 3D8DA 2E2XA 1AQCA 2EJ8A 4KHOA 5C5BA 2MKRA 1RJ2A 1H10A 1DDVA 1EGXA 2QKLA 2NBVA 1W1HA 1H4RA 4HDQA 1KZ7A 2Z0OA 1Z87A 2L1CA 4GZUA 4HB0B 2D9XA 3HK0A 1WGQA 3DXCA 1ZC4B 2P0DA 4HB2B 3PZDA 1XKEA 1KI1B 3UZTA 1TXDA 3WA0A 2HTHB 4ZRJA 3BINA 2DFKA 2DLWA 2NMBA 1X1GA 1WI1A 1V89A 1Y19B 3M1IB 1UPQA 2LG1A 2H7DA 2P0HA 1M7RA 2MWNB 4HHVA 1ZC3B 3TCAA 3PEGA 2DA0A 4ZRKA 1XX0A 5KCVA 3VIAA 5FI1A 2CODA 1UNRA 3B77A 2Y8FA 3A8PA 2D10A 3PG7A 5JHHA 2DHKA 4L1RA 4F7UP 1ZYIA 2ROZB 3NSUA 5D27A 4F7HA 3SYXA 2J0MA 2GCLA 5D3XA 4HDOA 3G9WA 2UZRA 2VRWB 2CRFA 4DBBA 2LKOA 2I1JA 3U12A 1ZVRA 4QJ3B 4KAXB 1M7EA 1UPRA 1K5DB 1IRSA 1U5EA 2RNRB 4K17A 2FJUB 2J0KA 1RRPB 1DROA 4D6WA 2YS5A 1WG7A 2ROVA 5CLQB 3U7DA 2PZ1A 3WYFB 4TYZA 4C0AA 5DI9B 1UNQA 2IYBA 4DXAB 1ZM0A 4HATB 1MK7B 3O96A 2I5FA 4L6EA 1PMSA 2KUQA 1J0WA 4HSIA 5HE1A 4HAUB 2DTCA 5KQ4A 5DHFB 4D0NB 4GN1A 1W1DA 4KHBA 2QKMA 4CHJA 3KZ1A 2RLOA 5IRSA 1V61A 3IVFA 2CY5A 3ODOA 3T06A 2N23A 1UEFA 4GMXB 1I7AA 2RSGA 2HE7A 2KIEA 1BTKA 5I2SA 5LOPB 2W2WA 3OHMB 3CXBB 5D3YA 2UZSA 2MFQA 1Q67A 1KZGA 1BWNA 4Z2NA 3HIEA 3ODWA 2EC1A 2DYQA 2RGNB 5M4YB 2W2XD 3N7CA 1BAKA 3X23A 4YL8A 2YF0A 3SO6A 4DIXA 3CIKA 1TQZA 4KHAA 2GJYA 1X1FA 2YRYA 4F7GA 2M14A 2RRFA 3HSAA 1EF1A 2RVBB 2Y7BA 3ZVRA 2P8VA 1SHCA 2ZKMX 2COCA 2G35A 4KVGB 2H7EA 4OSNA 4QJ4B 2K49A 3ULBA 3TO1A 3V5WA 4NSWA 3DXEA 2I1KA 1X05A 1U29A 2R09A 3PVUA 5LONB 1AWEA 3DXDA 4WJ7A 2YT0A 1U27A 1OY2A 1FB8A 1W1GA 4CYEA 2D9ZA 4HB4B
chains in the Genus database with same CATH topology
2YS1A 2AL6A 2AEHA 3GYOA 2COFA 4DX90 3A8QA 4H8SA 3P7ZA 3SV1A 4YONA 3PVWA 1SGHA 2YVCA 2EMSA 1DYNA 2L2IA 1V5UA 2ADZA 4A6KA 3LJUX 1K5GB 2DKPA 4PQ0A 2K00A 2Y8GA 2V76A 1X11A 4EMOA 2Q13A 1WVHA 1DDMA 1WJMA 2DYNA 2ELBA 5FI0A 3VOQA 1MIZB 3PSCA 1V5PA 2J0JA 1FHWA 4MY6A 3ULCA 4HAYB 2DKQA 2DX1A 2D9WA 3KY9A 2COAA 2Z0PA 2X18A 3KRWA 5J3QA 4K81A 3AU5A 4GPTB 4K2OA 2OTXA 1J19A 1MKEA 4P7IA 4WSFA 2FJLA 5C6RA 1FHOA 2DHJA 1GG3A 4XWXA 2EMTA 2W2XC 2VSZA 4GXBA 1U5DA 1MPHA 4MK0A 2NZ8B 3FEHA 1GC6A 2UVMA 2LOXA 4BBKA 2R0DA 3QWMA 3KSYA 2XQNM 1P5TA 2DN6A 2DX5A 2VKIA 1I2HA 2J59M 1XD4A 1FOEA 3MDBC 5J3TA 4EJNA 1U5GA 1QC6A 3BJIA 4PNKA 1EVHA 2K2JA 4HAZB 1P3RA 5DH9B 3ZDTA 4A6FB 2GCJA 4NY0A 2N0YA 1U5FA 5KQ1A 4HB3B 1TJ6A 2JP2A 3QIJA 5JP4A 1UNPA 2Z0QA 3AJ4A 5CLLB 5EFXA 5C16A 2D2QA 4HAVB 3QBVB 3P6AA 2CY4A 1NTVA 3OANA 4IAPA 2K2UA 1BTNA 2YSZA 1PLSA 2D4QA 4ZRIA 3F5RA 4A6FA 2M38A 1QQGA 1XCGA 5DHAB 3D8FA 4EKUA 1DDWA 4Y94A 5C5BB 5D3WA 1FAOA 4B6HA 4IOYX 3KRXA 5D3VA 1MAIA 3PVLA 1NU2A 5HE3A 3D8EA 2KUPA 2YS3A 1ISNA 5C79A 3MPXA 2D9YA 5HE2A 2DHIA 5J3YA 2GS0A 3ODXA 2BCJA 4HAXB 3TW1A 1XR0B 2OQBA 3F0WA 4A5KA 1N3HA 2ELAA 2MDXA 1U2BA 4K2PA 1V88A 2D9VA 2YT1A 1EAZA 3HQCA 1GC7A 1NI2A 2IFSA 2CAYA 5L81A 3SUZA 2ZPYA 1E5WA 4WVFB 3HW2B 5JLJB 1FGZA 2D11A 1P6SA 1XODA 1OMWA 3RCPA 1V5MA 1LB1A 3U8ZA 3SNHA 1DBHA 4DX8A 1ZSQA 2KGXB 3GYPA 1Y5OA 5GOWB 1MK9B 1LW3A 3TVVA 5DIFB 4TKNA 1FHXA 1OQNA 5JHGA 1MIXA 2LULA 4GMVA 3FSSA 3PP2A 4A6HA 2I5CA 3ML4A 4IFSA 2KCJA 2LYDA 1PFJA 2P0FA 4MT7A 3TFMA 4CHMA 3FM8C 1NTYA 2RUKB 3AU4A 1X86A 1WJ1A 2LOZA 5HE0A 3A98B 4Z2MB 1FGYA 4KHBB 1B55A 4HAWB 1WGUA 3D8DA 2E2XA 1AQCA 2EJ8A 4KHOA 5C5BA 2MKRA 1RJ2A 1H10A 1DDVA 1EGXA 2QKLA 1W1HA 1H4RA 4HDQA 1KZ7A 2Z0OA 1Z87A 2L1CA 4GZUA 4HB0B 2D9XA 3HK0A 1WGQA 3DXCA 1ZC4B 2P0DA 4HB2B 3PZDA 1XKEA 1KI1B 3UZTA 1TXDA 3WA0A 2HTHB 4ZRJA 3BINA 2DFKA 2DLWA 2NMBA 1X1GA 1WI1A 1V89A 1Y19B 3M1IB 1UPQA 2LG1A 2H7DA 2P0HA 1M7RA 2MWNB 4HHVA 1ZC3B 3TCAA 3PEGA 2DA0A 4ZRKA 1XX0A 5KCVA 3VIAA 5FI1A 2CODA 1UNRA 2Y8FA 3A8PA 2D10A 3PG7A 5JHHA 2DHKA 4F7UP 2ROZB 3NSUA 5D27A 4F7HA 3SYXA 2J0MA 2GCLA 5D3XA 4HDOA 3G9WA 2UZRA 2VRWB 2CRFA 4DBBA 2LKOA 2I1JA 1ZVRA 4KAXB 1M7EA 1UPRA 1K5DB 1IRSA 1U5EA 2RNRB 4K17A 2J0KA 1RRPB 1DROA 2YS5A 1WG7A 2ROVA 5CLQB 3U7DA 2PZ1A 3WYFB 4TYZA 4C0AA 5DI9B 1UNQA 2IYBA 4DXAB 1ZM0A 4HATB 1MK7B 3O96A 2I5FA 4L6EA 1PMSA 1J0WA 5HE1A 4HAUB 2DTCA 5KQ4A 5DHFB 4D0NB 4GN1A 1W1DA 2QKMA 4CHJA 3KZ1A 2RLOA 1V61A 3IVFA 2CY5A 3ODOA 3T06A 2N23A 1UEFA 4GMXB 1I7AA 2RSGA 2HE7A 1BTKA 5LOPB 2W2WA 3CXBB 5D3YA 2UZSA 2MFQA 1Q67A 1KZGA 1BWNA 4Z2NA 3ODWA 2EC1A 2DYQA 2RGNB 2W2XD 3N7CA 1BAKA 3X23A 4YL8A 2YF0A 3SO6A 3CIKA 1TQZA 4KHAA 2GJYA 1X1FA 2YRYA 4F7GA 2M14A 1EF1A 2RVBB 2Y7BA 3ZVRA 2P8VA 1SHCA 2COCA 2G35A 4KVGB 2H7EA 3ULBA 3TO1A 3V5WA 4NSWA 3DXEA 2I1KA 1X05A 1U29A 2R09A 3PVUA 5LONB 1AWEA 3DXDA 4WJ7A 2YT0A 1U27A 1OY2A 1FB8A 1W1GA 4CYEA 2D9ZA 4HB4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YS1 A;  2AL6 A;  2AEH A;  3GYO A;  2COF A;  4DX9 0;  3A8Q A;  4H8S A;  3P7Z A;  3SV1 A;  4YON A;  3PVW A;  1SGH A;  2YVC A;  2EMS A;  1DYN A;  2L2I A;  1V5U A;  2ADZ A;  4A6K A;  3LJU X;  1K5G B;  2DKP A;  4PQ0 A;  2K00 A;  2Y8G A;  2V76 A;  1X11 A;  4EMO A;  2Q13 A;  1WVH A;  1DDM A;  1WJM A;  2DYN A;  2ELB A;  5FI0 A;  3VOQ A;  1MIZ B;  3PSC A;  1V5P A;  2J0J A;  1FHW A;  4MY6 A;  3ULC A;  4HAY B;  2DKQ A;  2DX1 A;  2D9W A;  3KY9 A;  2COA A;  2Z0P A;  2X18 A;  3KRW A;  5J3Q A;  4K81 A;  3AU5 A;  4GPT B;  4K2O A;  2OTX A;  1J19 A;  1MKE A;  4P7I A;  4WSF A;  2FJL A;  5C6R A;  1FHO A;  2DHJ A;  1GG3 A;  4XWX A;  2EMT A;  2W2X C;  2VSZ A;  4GXB A;  1U5D A;  1MPH A;  4MK0 A;  2NZ8 B;  3FEH A;  1GC6 A;  2UVM A;  2LOX A;  4BBK A;  2R0D A;  3QWM A;  3KSY A;  2XQN M;  1P5T A;  2DN6 A;  2DX5 A;  2VKI A;  1I2H A;  2J59 M;  1XD4 A;  1FOE A;  3MDB C;  5J3T A;  4EJN A;  1U5G A;  1QC6 A;  3BJI A;  4PNK A;  1EVH A;  2K2J A;  4HAZ B;  1P3R A;  5DH9 B;  3ZDT A;  4A6F B;  2GCJ A;  4NY0 A;  2N0Y A;  1U5F A;  5KQ1 A;  4HB3 B;  1TJ6 A;  2JP2 A;  3QIJ A;  5JP4 A;  1UNP A;  2Z0Q A;  3AJ4 A;  5CLL B;  5EFX A;  5C16 A;  2D2Q A;  4HAV B;  3QBV B;  3P6A A;  2CY4 A;  1NTV A;  3OAN A;  4IAP A;  2K2U A;  1BTN A;  2YSZ A;  1PLS A;  2D4Q A;  4ZRI A;  3F5R A;  4A6F A;  2M38 A;  1QQG A;  1XCG A;  5DHA B;  3D8F A;  4EKU A;  1DDW A;  4Y94 A;  5C5B B;  5D3W A;  1FAO A;  4B6H A;  4IOY X;  3KRX A;  5D3V A;  1MAI A;  3PVL A;  1NU2 A;  5HE3 A;  3D8E A;  2KUP A;  2YS3 A;  1ISN A;  5C79 A;  3MPX A;  2D9Y A;  5HE2 A;  2DHI A;  5J3Y A;  2GS0 A;  3ODX A;  2BCJ A;  4HAX B;  3TW1 A;  1XR0 B;  2OQB A;  3F0W A;  4A5K A;  1N3H A;  2ELA A;  2MDX A;  1U2B A;  4K2P A;  1V88 A;  2D9V A;  2YT1 A;  1EAZ A;  3HQC A;  1GC7 A;  1NI2 A;  2IFS A;  2CAY A;  5L81 A;  3SUZ A;  2ZPY A;  1E5W A;  4WVF B;  3HW2 B;  5JLJ B;  1FGZ A;  2D11 A;  1P6S A;  1XOD A;  1OMW A;  3RCP A;  1V5M A;  1LB1 A;  3U8Z A;  3SNH A;  1DBH A;  4DX8 A;  1ZSQ A;  2KGX B;  3GYP A;  1Y5O A;  5GOW B;  1MK9 B;  1LW3 A;  3TVV A;  5DIF B;  4TKN A;  1FHX A;  1OQN A;  5JHG A;  1MIX A;  2LUL A;  4GMV A;  3FSS A;  3PP2 A;  4A6H A;  2I5C A;  3ML4 A;  4IFS A;  2KCJ A;  2LYD A;  1PFJ A;  2P0F A;  4MT7 A;  3TFM A;  4CHM A;  3FM8 C;  1NTY A;  2RUK B;  3AU4 A;  1X86 A;  1WJ1 A;  2LOZ A;  5HE0 A;  3A98 B;  4Z2M B;  1FGY A;  4KHB B;  1B55 A;  4HAW B;  1WGU A;  3D8D A;  2E2X A;  1AQC A;  2EJ8 A;  4KHO A;  5C5B A;  2MKR A;  1RJ2 A;  1H10 A;  1DDV A;  1EGX A;  2QKL A;  1W1H A;  1H4R A;  4HDQ A;  1KZ7 A;  2Z0O A;  1Z87 A;  2L1C A;  4GZU A;  4HB0 B;  2D9X A;  3HK0 A;  1WGQ A;  3DXC A;  1ZC4 B;  2P0D A;  4HB2 B;  3PZD A;  1XKE A;  1KI1 B;  3UZT A;  1TXD A;  3WA0 A;  2HTH B;  4ZRJ A;  3BIN A;  2DFK A;  2DLW A;  2NMB A;  1X1G A;  1WI1 A;  1V89 A;  1Y19 B;  3M1I B;  1UPQ A;  2LG1 A;  2H7D A;  2P0H A;  1M7R A;  2MWN B;  4HHV A;  1ZC3 B;  3TCA A;  3PEG A;  2DA0 A;  4ZRK A;  1XX0 A;  5KCV A;  3VIA A;  5FI1 A;  2COD A;  1UNR A;  2Y8F A;  3A8P A;  2D10 A;  3PG7 A;  5JHH A;  2DHK A;  4F7U P;  2ROZ B;  3NSU A;  5D27 A;  4F7H A;  3SYX A;  2J0M A;  2GCL A;  5D3X A;  4HDO A;  3G9W A;  2UZR A;  2VRW B;  2CRF A;  4DBB A;  2LKO A;  2I1J A;  1ZVR A;  4KAX B;  1M7E A;  1UPR A;  1K5D B;  1IRS A;  1U5E A;  2RNR B;  4K17 A;  2J0K A;  1RRP B;  1DRO A;  2YS5 A;  1WG7 A;  2ROV A;  5CLQ B;  3U7D A;  2PZ1 A;  3WYF B;  4TYZ A;  4C0A A;  5DI9 B;  1UNQ A;  2IYB A;  4DXA B;  1ZM0 A;  4HAT B;  1MK7 B;  3O96 A;  2I5F A;  4L6E A;  1PMS A;  1J0W A;  5HE1 A;  4HAU B;  2DTC A;  5KQ4 A;  5DHF B;  4D0N B;  4GN1 A;  1W1D A;  2QKM A;  4CHJ A;  3KZ1 A;  2RLO A;  1V61 A;  3IVF A;  2CY5 A;  3ODO A;  3T06 A;  2N23 A;  1UEF A;  4GMX B;  1I7A A;  2RSG A;  2HE7 A;  1BTK A;  5LOP B;  2W2W A;  3CXB B;  5D3Y A;  2UZS A;  2MFQ A;  1Q67 A;  1KZG A;  1BWN A;  4Z2N A;  3ODW A;  2EC1 A;  2DYQ A;  2RGN B;  2W2X D;  3N7C A;  1BAK A;  3X23 A;  4YL8 A;  2YF0 A;  3SO6 A;  3CIK A;  1TQZ A;  4KHA A;  2GJY A;  1X1F A;  2YRY A;  4F7G A;  2M14 A;  1EF1 A;  2RVB B;  2Y7B A;  3ZVR A;  2P8V A;  1SHC A;  2COC A;  2G35 A;  4KVG B;  2H7E A;  3ULB A;  3TO1 A;  3V5W A;  4NSW A;  3DXE A;  2I1K A;  1X05 A;  1U29 A;  2R09 A;  3PVU A;  5LON B;  1AWE A;  3DXD A;  4WJ7 A;  2YT0 A;  1U27 A;  1OY2 A;  1FB8 A;  1W1G A;  4CYE A;  2D9Z A;  4HB4 B; 
#chains in the Genus database with same CATH topology
 2YS1 A;  2AL6 A;  2AEH A;  3GYO A;  2COF A;  4DX9 0;  2K8E A;  3A8Q A;  4H8S A;  3P7Z A;  3SV1 A;  4YON A;  3PVW A;  4GOU A;  1SGH A;  2YVC A;  2EMS A;  1DYN A;  2L2I A;  3DCX A;  4CSQ A;  1V5U A;  2ADZ A;  4A6K A;  3LJU X;  1K5G B;  2DKP A;  4PQ0 A;  1MI1 A;  2K00 A;  2KR0 A;  2Y8G A;  2V76 A;  1X11 A;  4OT1 A;  4EMO A;  3NWD A;  2Q13 A;  1WVH A;  1DDM A;  1WJM A;  2DYN A;  2ELB A;  5FI0 A;  3VOQ A;  1MIZ B;  3NWA A;  2Z13 A;  1V5P A;  3PSC A;  2J0J A;  1FHW A;  4MY6 A;  3ULC A;  4HAY B;  2DKQ A;  2DX1 A;  2D9W A;  3KY9 A;  2COA A;  2YT2 A;  2Z0P A;  2X18 A;  3KRW A;  5J3Q A;  4K81 A;  3AU5 A;  4GPT B;  4K2O A;  2OTX A;  1J19 A;  1MKE A;  4P7I A;  4WSF A;  2FJL A;  5C6R A;  1FHO A;  2DHJ A;  1GG3 A;  4XWX A;  2EMT A;  2W2X C;  2VSZ A;  4GXB A;  1U5D A;  1MPH A;  4MK0 A;  2NZ8 B;  3FEH A;  1GC6 A;  2UVM A;  2LOX A;  4BBK A;  2R0D A;  3QWM A;  3KSY A;  2XQN M;  1P5T A;  2DN6 A;  2DX5 A;  2VKI A;  1I2H A;  2J59 M;  1XD4 A;  2Z59 A;  1FOE A;  3MDB C;  5J3T A;  4EJN A;  1U5G A;  1QC6 A;  3BJI A;  4PNK A;  1EVH A;  2K2J A;  4HAZ B;  1P3R A;  3NWF A;  5DH9 B;  3ZDT A;  4A6F B;  2GCJ A;  4NY0 A;  2N0Y A;  1U5F A;  5KQ1 A;  4HB3 B;  1TJ6 A;  2JP2 A;  3QIJ A;  5JP4 A;  1UNP A;  2Z0Q A;  3AJ4 A;  5CLL B;  5EFX A;  5C16 A;  4QJ5 B;  2D2Q A;  4HAV B;  3QBV B;  3A58 A;  2CY4 A;  3P6A A;  1NTV A;  3OAN A;  4IAP A;  2K2U A;  1BTN A;  2YSZ A;  1PLS A;  2D4Q A;  4ZRI A;  3F5R A;  4A6F A;  2M38 A;  1QQG A;  1XCG A;  5DHA B;  3D8F A;  4EKU A;  4QXA B;  1DDW A;  4Y94 A;  5C5B B;  5D3W A;  1FAO A;  4B6H A;  4IOY X;  3KRX A;  5D3V A;  1MAI A;  3PVL A;  1NU2 A;  5HE3 A;  3D8E A;  2KUP A;  2YS3 A;  1ISN A;  2GUM A;  5C79 A;  3MPX A;  2D9Y A;  5HE2 A;  2DHI A;  5J3Y A;  2GS0 A;  3ODX A;  2BCJ A;  4HAX B;  3TW1 A;  1XR0 B;  2OQB A;  3F0W A;  4A5K A;  1N3H A;  2ELA A;  2MDX A;  1U2B A;  4K2P A;  1V88 A;  2D9V A;  2YT1 A;  1EAZ A;  3HQC A;  1GC7 A;  1NI2 A;  2IFS A;  2CAY A;  5L81 A;  3SUZ A;  2ZPY A;  1E5W A;  4WVF B;  3HW2 B;  2KIG A;  5JLJ B;  1FGZ A;  2D11 A;  1P6S A;  1XOD A;  1OMW A;  3RCP A;  1V5M A;  1LB1 A;  3U8Z A;  3SNH A;  1DBH A;  4DX8 A;  1ZSQ A;  2KGX B;  3GYP A;  1Y5O A;  5GOW B;  1MK9 B;  1LW3 A;  3TVV A;  5DIF B;  3NW8 A;  4GNK B;  4TKN A;  1FHX A;  1OQN A;  5JHG A;  5LG4 B;  1MIX A;  2LUL A;  4GMV A;  3FSS A;  3PP2 A;  3FVC A;  4A6H A;  2I5C A;  3ML4 A;  4IFS A;  2KCJ A;  2LYD A;  1PFJ A;  2P0F A;  4MT7 A;  3TFM A;  4CHM A;  3FM8 C;  1T77 A;  1NTY A;  2Z4D A;  2RUK B;  3AU4 A;  1X86 A;  2R2Y A;  1WJ1 A;  2LOZ A;  5HE0 A;  3A98 B;  4Z2M B;  2Z14 A;  1FGY A;  4KHB B;  1B55 A;  4HAW B;  5I2M A;  1WGU A;  3D8D A;  2E2X A;  1AQC A;  2EJ8 A;  4KHO A;  5C5B A;  2MKR A;  1RJ2 A;  1H10 A;  1DDV A;  1EGX A;  2QKL A;  2NBV A;  1W1H A;  1H4R A;  4HDQ A;  1KZ7 A;  2Z0O A;  1Z87 A;  2L1C A;  4GZU A;  4HB0 B;  2D9X A;  3HK0 A;  1WGQ A;  3DXC A;  1ZC4 B;  2P0D A;  4HB2 B;  3PZD A;  1XKE A;  1KI1 B;  3UZT A;  1TXD A;  3WA0 A;  2HTH B;  4ZRJ A;  3BIN A;  2DFK A;  2DLW A;  2NMB A;  1X1G A;  1WI1 A;  1V89 A;  1Y19 B;  3M1I B;  1UPQ A;  2LG1 A;  2H7D A;  2P0H A;  1M7R A;  2MWN B;  4HHV A;  1ZC3 B;  3TCA A;  3PEG A;  2DA0 A;  4ZRK A;  1XX0 A;  5KCV A;  3VIA A;  5FI1 A;  2COD A;  1UNR A;  3B77 A;  2Y8F A;  3A8P A;  2D10 A;  3PG7 A;  5JHH A;  2DHK A;  4L1R A;  4F7U P;  1ZYI A;  2ROZ B;  3NSU A;  5D27 A;  4F7H A;  3SYX A;  2J0M A;  2GCL A;  5D3X A;  4HDO A;  3G9W A;  2UZR A;  2VRW B;  2CRF A;  4DBB A;  2LKO A;  2I1J A;  3U12 A;  1ZVR A;  4QJ3 B;  4KAX B;  1M7E A;  1UPR A;  1K5D B;  1IRS A;  1U5E A;  2RNR B;  4K17 A;  2FJU B;  2J0K A;  1RRP B;  1DRO A;  4D6W A;  2YS5 A;  1WG7 A;  2ROV A;  5CLQ B;  3U7D A;  2PZ1 A;  3WYF B;  4TYZ A;  4C0A A;  5DI9 B;  1UNQ A;  2IYB A;  4DXA B;  1ZM0 A;  4HAT B;  1MK7 B;  3O96 A;  2I5F A;  4L6E A;  1PMS A;  2KUQ A;  1J0W A;  4HSI A;  5HE1 A;  4HAU B;  2DTC A;  5KQ4 A;  5DHF B;  4D0N B;  4GN1 A;  1W1D A;  4KHB A;  2QKM A;  4CHJ A;  3KZ1 A;  2RLO A;  5IRS A;  1V61 A;  3IVF A;  2CY5 A;  3ODO A;  3T06 A;  2N23 A;  1UEF A;  4GMX B;  1I7A A;  2RSG A;  2HE7 A;  2KIE A;  1BTK A;  5I2S A;  5LOP B;  2W2W A;  3OHM B;  3CXB B;  5D3Y A;  2UZS A;  2MFQ A;  1Q67 A;  1KZG A;  1BWN A;  4Z2N A;  3HIE A;  3ODW A;  2EC1 A;  2DYQ A;  2RGN B;  5M4Y B;  2W2X D;  3N7C A;  1BAK A;  3X23 A;  4YL8 A;  2YF0 A;  3SO6 A;  4DIX A;  3CIK A;  1TQZ A;  4KHA A;  2GJY A;  1X1F A;  2YRY A;  4F7G A;  2M14 A;  2RRF A;  3HSA A;  1EF1 A;  2RVB B;  2Y7B A;  3ZVR A;  2P8V A;  1SHC A;  2ZKM X;  2COC A;  2G35 A;  4KVG B;  2H7E A;  4OSN A;  4QJ4 B;  2K49 A;  3ULB A;  3TO1 A;  3V5W A;  4NSW A;  3DXE A;  2I1K A;  1X05 A;  1U29 A;  2R09 A;  3PVU A;  5LON B;  1AWE A;  3DXD A;  4WJ7 A;  2YT0 A;  1U27 A;  1OY2 A;  1FB8 A;  1W1G A;  4CYE A;  2D9Z A;  4HB4 B; 
#chains in the Genus database with same CATH homology
 2YS1 A;  2AL6 A;  2AEH A;  3GYO A;  2COF A;  4DX9 0;  3A8Q A;  4H8S A;  3P7Z A;  3SV1 A;  4YON A;  3PVW A;  1SGH A;  2YVC A;  2EMS A;  1DYN A;  2L2I A;  1V5U A;  2ADZ A;  4A6K A;  3LJU X;  1K5G B;  2DKP A;  4PQ0 A;  2K00 A;  2Y8G A;  2V76 A;  1X11 A;  4EMO A;  2Q13 A;  1WVH A;  1DDM A;  1WJM A;  2DYN A;  2ELB A;  5FI0 A;  3VOQ A;  1MIZ B;  3PSC A;  1V5P A;  2J0J A;  1FHW A;  4MY6 A;  3ULC A;  4HAY B;  2DKQ A;  2DX1 A;  2D9W A;  3KY9 A;  2COA A;  2Z0P A;  2X18 A;  3KRW A;  5J3Q A;  4K81 A;  3AU5 A;  4GPT B;  4K2O A;  2OTX A;  1J19 A;  1MKE A;  4P7I A;  4WSF A;  2FJL A;  5C6R A;  1FHO A;  2DHJ A;  1GG3 A;  4XWX A;  2EMT A;  2W2X C;  2VSZ A;  4GXB A;  1U5D A;  1MPH A;  4MK0 A;  2NZ8 B;  3FEH A;  1GC6 A;  2UVM A;  2LOX A;  4BBK A;  2R0D A;  3QWM A;  3KSY A;  2XQN M;  1P5T A;  2DN6 A;  2DX5 A;  2VKI A;  1I2H A;  2J59 M;  1XD4 A;  1FOE A;  3MDB C;  5J3T A;  4EJN A;  1U5G A;  1QC6 A;  3BJI A;  4PNK A;  1EVH A;  2K2J A;  4HAZ B;  1P3R A;  5DH9 B;  3ZDT A;  4A6F B;  2GCJ A;  4NY0 A;  2N0Y A;  1U5F A;  5KQ1 A;  4HB3 B;  1TJ6 A;  2JP2 A;  3QIJ A;  5JP4 A;  1UNP A;  2Z0Q A;  3AJ4 A;  5CLL B;  5EFX A;  5C16 A;  2D2Q A;  4HAV B;  3QBV B;  3P6A A;  2CY4 A;  1NTV A;  3OAN A;  4IAP A;  2K2U A;  1BTN A;  2YSZ A;  1PLS A;  2D4Q A;  4ZRI A;  3F5R A;  4A6F A;  2M38 A;  1QQG A;  1XCG A;  5DHA B;  3D8F A;  4EKU A;  1DDW A;  4Y94 A;  5C5B B;  5D3W A;  1FAO A;  4B6H A;  4IOY X;  3KRX A;  5D3V A;  1MAI A;  3PVL A;  1NU2 A;  5HE3 A;  3D8E A;  2KUP A;  2YS3 A;  1ISN A;  5C79 A;  3MPX A;  2D9Y A;  5HE2 A;  2DHI A;  5J3Y A;  2GS0 A;  3ODX A;  2BCJ A;  4HAX B;  3TW1 A;  1XR0 B;  2OQB A;  3F0W A;  4A5K A;  1N3H A;  2ELA A;  2MDX A;  1U2B A;  4K2P A;  1V88 A;  2D9V A;  2YT1 A;  1EAZ A;  3HQC A;  1GC7 A;  1NI2 A;  2IFS A;  2CAY A;  5L81 A;  3SUZ A;  2ZPY A;  1E5W A;  4WVF B;  3HW2 B;  5JLJ B;  1FGZ A;  2D11 A;  1P6S A;  1XOD A;  1OMW A;  3RCP A;  1V5M A;  1LB1 A;  3U8Z A;  3SNH A;  1DBH A;  4DX8 A;  1ZSQ A;  2KGX B;  3GYP A;  1Y5O A;  5GOW B;  1MK9 B;  1LW3 A;  3TVV A;  5DIF B;  4TKN A;  1FHX A;  1OQN A;  5JHG A;  1MIX A;  2LUL A;  4GMV A;  3FSS A;  3PP2 A;  4A6H A;  2I5C A;  3ML4 A;  4IFS A;  2KCJ A;  2LYD A;  1PFJ A;  2P0F A;  4MT7 A;  3TFM A;  4CHM A;  3FM8 C;  1NTY A;  2RUK B;  3AU4 A;  1X86 A;  1WJ1 A;  2LOZ A;  5HE0 A;  3A98 B;  4Z2M B;  1FGY A;  4KHB B;  1B55 A;  4HAW B;  1WGU A;  3D8D A;  2E2X A;  1AQC A;  2EJ8 A;  4KHO A;  5C5B A;  2MKR A;  1RJ2 A;  1H10 A;  1DDV A;  1EGX A;  2QKL A;  1W1H A;  1H4R A;  4HDQ A;  1KZ7 A;  2Z0O A;  1Z87 A;  2L1C A;  4GZU A;  4HB0 B;  2D9X A;  3HK0 A;  1WGQ A;  3DXC A;  1ZC4 B;  2P0D A;  4HB2 B;  3PZD A;  1XKE A;  1KI1 B;  3UZT A;  1TXD A;  3WA0 A;  2HTH B;  4ZRJ A;  3BIN A;  2DFK A;  2DLW A;  2NMB A;  1X1G A;  1WI1 A;  1V89 A;  1Y19 B;  3M1I B;  1UPQ A;  2LG1 A;  2H7D A;  2P0H A;  1M7R A;  2MWN B;  4HHV A;  1ZC3 B;  3TCA A;  3PEG A;  2DA0 A;  4ZRK A;  1XX0 A;  5KCV A;  3VIA A;  5FI1 A;  2COD A;  1UNR A;  2Y8F A;  3A8P A;  2D10 A;  3PG7 A;  5JHH A;  2DHK A;  4F7U P;  2ROZ B;  3NSU A;  5D27 A;  4F7H A;  3SYX A;  2J0M A;  2GCL A;  5D3X A;  4HDO A;  3G9W A;  2UZR A;  2VRW B;  2CRF A;  4DBB A;  2LKO A;  2I1J A;  1ZVR A;  4KAX B;  1M7E A;  1UPR A;  1K5D B;  1IRS A;  1U5E A;  2RNR B;  4K17 A;  2J0K A;  1RRP B;  1DRO A;  2YS5 A;  1WG7 A;  2ROV A;  5CLQ B;  3U7D A;  2PZ1 A;  3WYF B;  4TYZ A;  4C0A A;  5DI9 B;  1UNQ A;  2IYB A;  4DXA B;  1ZM0 A;  4HAT B;  1MK7 B;  3O96 A;  2I5F A;  4L6E A;  1PMS A;  1J0W A;  5HE1 A;  4HAU B;  2DTC A;  5KQ4 A;  5DHF B;  4D0N B;  4GN1 A;  1W1D A;  2QKM A;  4CHJ A;  3KZ1 A;  2RLO A;  1V61 A;  3IVF A;  2CY5 A;  3ODO A;  3T06 A;  2N23 A;  1UEF A;  4GMX B;  1I7A A;  2RSG A;  2HE7 A;  1BTK A;  5LOP B;  2W2W A;  3CXB B;  5D3Y A;  2UZS A;  2MFQ A;  1Q67 A;  1KZG A;  1BWN A;  4Z2N A;  3ODW A;  2EC1 A;  2DYQ A;  2RGN B;  2W2X D;  3N7C A;  1BAK A;  3X23 A;  4YL8 A;  2YF0 A;  3SO6 A;  3CIK A;  1TQZ A;  4KHA A;  2GJY A;  1X1F A;  2YRY A;  4F7G A;  2M14 A;  1EF1 A;  2RVB B;  2Y7B A;  3ZVR A;  2P8V A;  1SHC A;  2COC A;  2G35 A;  4KVG B;  2H7E A;  3ULB A;  3TO1 A;  3V5W A;  4NSW A;  3DXE A;  2I1K A;  1X05 A;  1U29 A;  2R09 A;  3PVU A;  5LON B;  1AWE A;  3DXD A;  4WJ7 A;  2YT0 A;  1U27 A;  1OY2 A;  1FB8 A;  1W1G A;  4CYE A;  2D9Z A;  4HB4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...