1OY2A

Coupling of folding and binding in the ptb domain of the signaling protein shc
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
191
structure length
191
Chain Sequence
GQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Coupling of Folding and Binding in the PTB Domain of the Signaling Protein Shc
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords SHC transforming protein
total genus 16
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2003-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1oy2A00
2DLWA 2ROZB 3DXEA 1OQNA 1V5UA 2DHKA 2LOZA 1K5DB 4HB3B 1E5WA 4PNKA 2D11A 4HAUB 5D3WA 1FB8A 4MT7A 2D10A 2ELAA 5LOPB 2RUKB 1WI1A 3KSYA 1UNQA 4K2PA 2LG1A 2W2XC 1UEFA 3ODOA 1FAOA 1ZSQA 2YVCA 4IFSA 5L81A 1N3HA 1WG7A 2EC1A 1V88A 1KZ7A 4HB4B 4KHAA 1GG3A 1U27A 2ROVA 1DDVA 1XCGA 1MPHA 4MY6A 1EVHA 2YRYA 2GJYA 3NSUA 3D8EA 2W2XD 3G9WA 1SHCA 1Z87A 5CLQB 1X05A 3TFMA 2EMTA 3KRWA 1DYNA 1BTNA 1UNRA 2K2JA 4EMOA 1WVHA 3ULBA 1RJ2A 3A98B 3BINA 3BJIA 5FI1A 1NU2A 1PMSA 3D8FA 1I7AA 3TVVA 5EFXA 3KZ1A 3RCPA 5J3QA 4IOYX 5C5BB 2CY5A 4H8SA 2KCJA 5JHHA 4HAWB 3PVLA 4EJNA 2COFA 1AWEA 3TW1A 4HDOA 2MKRA 4F7HA 2ADZA 2P8VA 3X23A 1EAZA 4K17A 3QWMA 3D8DA 3TCAA 3ZDTA 4F7UP 4WJ7A 2LYDA 1X1GA 1ZVRA 1B55A 2G35A 3ULCA 1GC6A 3WA0A 1XODA 1BWNA 2YSZA 1P6SA 2D9VA 3GYOA 2LOXA 3SYXA 2KUPA 3P7ZA 4HB0B 1FHOA 1ZM0A 4MK0A 2M38A 1V5PA 1QQGA 2R09A 2LKOA 4WVFB 1SGHA 1V5MA 1V61A 2NMBA 3U8ZA 2L1CA 3PP2A 2UZRA 3F0WA 3QIJA 2DTCA 2GCJA 4GMVA 2RLOA 3HK0A 1TJ6A 1MAIA 4A6FA 5C6RA 4KAXB 2CY4A 3AU4A 4EKUA 2RNRB 2VSZA 2DFKA 2IFSA 2NZ8B 4CHMA 1QC6A 3QBVB 4TYZA 2X18A 2Z0PA 1FHXA 2YT0A 4Z2MB 5DI9B 4GXBA 1XKEA 3SUZA 5JLJB 3FM8C 2XQNM 4GN1A 2LULA 3PZDA 4IAPA 2DX5A 4D0NB 2N0YA 2K00A 1PLSA 2YF0A 4GPTB 2UZSA 2M14A 2COAA 2D9WA 4Y94A 4A6FB 4L6EA 3PVUA 2QKMA 1U2BA 1AQCA 1XX0A 3A8PA 5JHGA 2I1JA 1TQZA 3HQCA 2VKIA 1LB1A 1MIZB 3KRXA 3MDBC 5DHAB 5D27A 1W1DA 3KY9A 4YL8A 2N23A 2EMSA 3PEGA 3SV1A 4KVGB 3ZVRA 2CAYA 1FGYA 1X1FA 4A6KA 2BCJA 4TKNA 2Y8GA 1NTVA 1X11A 2DKQA 1FHWA 4K2OA 2YS5A 3ML4A 2K2UA 2Z0QA 1RRPB 2Q13A 2GS0A 4A5KA 4DX8A 3LJUX 1NI2A 2QKLA 1XD4A 2DYQA 1V89A 2E2XA 2OTXA 2YS1A 2P0HA 1M7EA 3AJ4A 3HW2B 1DBHA 1GC7A 1K5GB 1PFJA 1BAKA 2IYBA 1UNPA 5FI0A 1U5EA 1WGQA 1DDMA 4KHBB 2CODA 5DHFB 4P7IA 1W1HA 5HE1A 2MWNB 3P6AA 2CRFA 3A8QA 3SO6A 2P0DA 1WJ1A 5DIFB 2J0JA 1MKEA 2AL6A 4KHOA 2D2QA 1LW3A 3CIKA 2OQBA 2GCLA 5HE3A 2PZ1A 4CHJA 3ODXA 2DA0A 1UPRA 1Q67A 2MFQA 2L2IA 3WYFB 1MIXA 2J0KA 1J19A 3PG7A 2YS3A 1H4RA 4PQ0A 4WSFA 1H10A 1W1GA 1P3RA 1WJMA 2ZPYA 2D9ZA 2P0FA 1MK9B 4HAVB 3CXBB 2HE7A 1KZGA 5KQ4A 2D4QA 1U29A 5LONB 3M1IB 4YONA 3ODWA 5KCVA 4BBKA 3PVWA 5HE2A 2VRWB 4DX90 2V76A 3O96A 1J0WA 3SNHA 2AEHA 1BTKA 4GMXB 5KQ1A 3F5RA 3V5WA 1FGZA 2W2WA 1X86A 3DXCA 1EF1A 5D3VA 2I5CA 2R0DA 2J59M 4HHVA 3GYPA 2RGNB 1Y5OA 1ISNA 3UZTA 1IRSA 5JP4A 2MDXA 4DBBA 4A6HA 2J0MA 5C79A 3MPXA 3N7CA 1ZC3B 1MK7B 3AU5A 2FJLA 4HDQA 5DH9B 4ZRJA 2Y7BA 2JP2A 4CYEA 2RVBB 3VIAA 2DYNA 1Y19B 2COCA 2DKPA 4XWXA 4NY0A 2Y8FA 2Z0OA 4ZRIA 2EJ8A 1OMWA 3DXDA 5CLLB 1EGXA 1U5DA 1I2HA 5D3XA 5C5BA 4Z2NA 1M7RA 4B6HA 1P5TA 2D9YA 4HAXB 4GZUA 4F7GA 4HB2B 5HE0A 4HAYB 2DX1A 1U5GA 2HTHB 2I1KA 2RSGA 2ELBA 4NSWA 5J3TA 2YT1A 2H7DA 4C0AA 3FEHA 4ZRKA 5D3YA 4DXAB 1DROA 1XR0B 3U7DA 4HAZB 4K81A 1TXDA 1OY2A 2H7EA 3OANA 1ZC4B 2DHJA 3PSCA 3VOQA 1KI1B 3TO1A 1UPQA 2UVMA 2D9XA 2DHIA 1FOEA 3IVFA 2DN6A 3T06A 5C16A 4HATB 1NTYA 1WGUA 2I5FA 2KGXB 1DDWA 1U5FA 5GOWB 5J3YA 3FSSA
chains in the Genus database with same CATH superfamily
2KIEA 2DLWA 2ROZB 3DXEA 1OQNA 1V5UA 2DHKA 2LOZA 3B77A 1K5DB 4HB3B 1E5WA 4OSNA 4PNKA 2D11A 4HAUB 5D3WA 1FB8A 4MT7A 2D10A 2ELAA 5LOPB 2RUKB 1WI1A 3KSYA 1UNQA 4K2PA 2LG1A 2W2XC 5LG4B 1UEFA 3ODOA 1FAOA 1ZSQA 2YVCA 4IFSA 5L81A 1MI1A 1N3HA 1WG7A 2EC1A 4QJ4B 1V88A 1KZ7A 4HB4B 4KHAA 1GG3A 1U27A 2ROVA 1DDVA 4KHBA 1XCGA 1MPHA 2KR0A 4MY6A 1EVHA 2YRYA 2GJYA 3NSUA 3D8EA 2W2XD 3G9WA 1SHCA 1Z87A 5CLQB 4QXAB 1X05A 3TFMA 2EMTA 3KRWA 1DYNA 3NWAA 1BTNA 1UNRA 2K2JA 4EMOA 1WVHA 3ULBA 1RJ2A 3A98B 3BINA 3BJIA 5FI1A 1NU2A 1PMSA 3D8FA 1I7AA 3TVVA 5EFXA 3KZ1A 3RCPA 5J3QA 2R2YA 4IOYX 5C5BB 2CY5A 4H8SA 2KCJA 5JHHA 4DIXA 4HAWB 3PVLA 4EJNA 2COFA 1AWEA 3TW1A 4HDOA 2MKRA 4F7HA 2ADZA 2P8VA 3X23A 1EAZA 4K17A 3QWMA 3NWDA 3D8DA 3TCAA 3ZDTA 4F7UP 4WJ7A 2LYDA 1X1GA 1ZVRA 1B55A 2G35A 3ULCA 2Z4DA 1GC6A 3WA0A 1XODA 1BWNA 2YSZA 1P6SA 2D9VA 3GYOA 2LOXA 3SYXA 2KUPA 3P7ZA 2GUMA 2KUQA 4HB0B 1FHOA 1ZM0A 4MK0A 2M38A 1V5PA 1QQGA 2R09A 2LKOA 2NBVA 4WVFB 1SGHA 1V5MA 1V61A 2NMBA 3U8ZA 2L1CA 3PP2A 2UZRA 3F0WA 3QIJA 2DTCA 2GCJA 4GMVA 2RLOA 3HK0A 1TJ6A 1MAIA 4A6FA 5C6RA 2K49A 2YT2A 4KAXB 2CY4A 3AU4A 5M4YB 4EKUA 2RNRB 2VSZA 2DFKA 2IFSA 2NZ8B 4CHMA 1QC6A 3QBVB 4TYZA 2X18A 2Z0PA 1FHXA 2YT0A 4Z2MB 5DI9B 4GXBA 1XKEA 3SUZA 5JLJB 3FM8C 2XQNM 4GN1A 2LULA 3PZDA 4IAPA 2DX5A 4D0NB 2N0YA 2K00A 1PLSA 2YF0A 4GPTB 2UZSA 2M14A 2COAA 2D9WA 2RRFA 4Y94A 4A6FB 4L6EA 3PVUA 2QKMA 1U2BA 4OT1A 1AQCA 1XX0A 3A8PA 5JHGA 2I1JA 1TQZA 3HQCA 2VKIA 1LB1A 1MIZB 3KRXA 3MDBC 4L1RA 5DHAB 5D27A 1W1DA 3KY9A 4YL8A 2N23A 2EMSA 3PEGA 3SV1A 4KVGB 3ZVRA 2CAYA 1FGYA 3FVCA 1X1FA 4A6KA 2BCJA 4TKNA 2Y8GA 1NTVA 1X11A 2DKQA 1FHWA 4K2OA 1ZYIA 2YS5A 3ML4A 2K2UA 2Z0QA 1RRPB 2Q13A 2GS0A 3HIEA 4A5KA 4DX8A 3LJUX 5IRSA 1NI2A 2QKLA 1XD4A 2DYQA 1V89A 2E2XA 2OTXA 2YS1A 2P0HA 1M7EA 3AJ4A 3HW2B 1DBHA 1GC7A 1K5GB 2Z13A 1PFJA 1BAKA 3A58A 2IYBA 1UNPA 5FI0A 1U5EA 1WGQA 2FJUB 1DDMA 4KHBB 2CODA 5DHFB 4P7IA 1W1HA 5HE1A 2MWNB 3P6AA 2CRFA 3A8QA 3SO6A 3NWFA 2P0DA 1WJ1A 5DIFB 2J0JA 1MKEA 2AL6A 4KHOA 2D2QA 1LW3A 3U12A 3CIKA 2OQBA 2GCLA 5HE3A 2PZ1A 4CHJA 3ODXA 3NW8A 2DA0A 4GNKB 1UPRA 1Q67A 2MFQA 2L2IA 3WYFB 1MIXA 2J0KA 1J19A 3PG7A 3OHMB 2YS3A 1H4RA 4PQ0A 4WSFA 1H10A 1W1GA 1P3RA 1WJMA 2ZPYA 2D9ZA 2P0FA 4CSQA 1MK9B 4HAVB 3CXBB 2HE7A 1KZGA 5KQ4A 2D4QA 1U29A 5LONB 3M1IB 4YONA 3ODWA 5KCVA 4BBKA 3PVWA 4QJ3B 5HE2A 2VRWB 4DX90 2V76A 3O96A 1J0WA 4HSIA 2K8EA 3SNHA 2AEHA 1BTKA 4GMXB 5KQ1A 3F5RA 3V5WA 3DCXA 1FGZA 2W2WA 1X86A 3DXCA 1EF1A 5D3VA 2I5CA 2R0DA 2J59M 4HHVA 3GYPA 2RGNB 2KIGA 1Y5OA 1ISNA 3UZTA 3HSAA 5I2SA 1IRSA 5JP4A 2MDXA 4DBBA 4A6HA 2J0MA 5C79A 3MPXA 3N7CA 1ZC3B 1MK7B 3AU5A 2FJLA 4HDQA 5DH9B 4ZRJA 2Y7BA 2JP2A 4CYEA 2RVBB 3VIAA 1T77A 2DYNA 1Y19B 2COCA 5I2MA 2DKPA 4XWXA 4NY0A 2Y8FA 2Z0OA 4ZRIA 2EJ8A 1OMWA 2Z14A 3DXDA 5CLLB 1EGXA 1U5DA 1I2HA 5D3XA 5C5BA 4Z2NA 1M7RA 4B6HA 1P5TA 2D9YA 4HAXB 4GZUA 4F7GA 4HB2B 5HE0A 4HAYB 2DX1A 1U5GA 2HTHB 2I1KA 2RSGA 2ELBA 4NSWA 5J3TA 2YT1A 2H7DA 4C0AA 3FEHA 4ZRKA 4D6WA 5D3YA 4DXAB 1DROA 1XR0B 3U7DA 4HAZB 4K81A 1TXDA 1OY2A 2H7EA 3OANA 2ZKMX 1ZC4B 2DHJA 3PSCA 3VOQA 1KI1B 3TO1A 4QJ5B 1UPQA 2UVMA 2D9XA 2DHIA 1FOEA 3IVFA 2DN6A 3T06A 5C16A 4HATB 1NTYA 1WGUA 2I5FA 2KGXB 1DDWA 1U5FA 5GOWB 5J3YA 2Z59A 3FSSA 4GOUA
chains in the Genus database with same CATH topology
2DLWA 2ROZB 3DXEA 1OQNA 1V5UA 2DHKA 2LOZA 1K5DB 4HB3B 1E5WA 4PNKA 2D11A 4HAUB 5D3WA 1FB8A 4MT7A 2D10A 2ELAA 5LOPB 2RUKB 1WI1A 3KSYA 1UNQA 4K2PA 2LG1A 2W2XC 1UEFA 3ODOA 1FAOA 1ZSQA 2YVCA 4IFSA 5L81A 1N3HA 1WG7A 2EC1A 1V88A 1KZ7A 4HB4B 4KHAA 1GG3A 1U27A 2ROVA 1DDVA 1XCGA 1MPHA 4MY6A 1EVHA 2YRYA 2GJYA 3NSUA 3D8EA 2W2XD 3G9WA 1SHCA 1Z87A 5CLQB 1X05A 3TFMA 2EMTA 3KRWA 1DYNA 1BTNA 1UNRA 2K2JA 4EMOA 1WVHA 3ULBA 1RJ2A 3A98B 3BINA 3BJIA 5FI1A 1NU2A 1PMSA 3D8FA 1I7AA 3TVVA 5EFXA 3KZ1A 3RCPA 5J3QA 4IOYX 5C5BB 2CY5A 4H8SA 2KCJA 5JHHA 4HAWB 3PVLA 4EJNA 2COFA 1AWEA 3TW1A 4HDOA 2MKRA 4F7HA 2ADZA 2P8VA 3X23A 1EAZA 4K17A 3QWMA 3D8DA 3TCAA 3ZDTA 4F7UP 4WJ7A 2LYDA 1X1GA 1ZVRA 1B55A 2G35A 3ULCA 1GC6A 3WA0A 1XODA 1BWNA 2YSZA 1P6SA 2D9VA 3GYOA 2LOXA 3SYXA 2KUPA 3P7ZA 4HB0B 1FHOA 1ZM0A 4MK0A 2M38A 1V5PA 1QQGA 2R09A 2LKOA 4WVFB 1SGHA 1V5MA 1V61A 2NMBA 3U8ZA 2L1CA 3PP2A 2UZRA 3F0WA 3QIJA 2DTCA 2GCJA 4GMVA 2RLOA 3HK0A 1TJ6A 1MAIA 4A6FA 5C6RA 4KAXB 2CY4A 3AU4A 4EKUA 2RNRB 2VSZA 2DFKA 2IFSA 2NZ8B 4CHMA 1QC6A 3QBVB 4TYZA 2X18A 2Z0PA 1FHXA 2YT0A 4Z2MB 5DI9B 4GXBA 1XKEA 3SUZA 5JLJB 3FM8C 2XQNM 4GN1A 2LULA 3PZDA 4IAPA 2DX5A 4D0NB 2N0YA 2K00A 1PLSA 2YF0A 4GPTB 2UZSA 2M14A 2COAA 2D9WA 4Y94A 4A6FB 4L6EA 3PVUA 2QKMA 1U2BA 1AQCA 1XX0A 3A8PA 5JHGA 2I1JA 1TQZA 3HQCA 2VKIA 1LB1A 1MIZB 3KRXA 3MDBC 5DHAB 5D27A 1W1DA 3KY9A 4YL8A 2N23A 2EMSA 3PEGA 3SV1A 4KVGB 3ZVRA 2CAYA 1FGYA 1X1FA 4A6KA 2BCJA 4TKNA 2Y8GA 1NTVA 1X11A 2DKQA 1FHWA 4K2OA 2YS5A 3ML4A 2K2UA 2Z0QA 1RRPB 2Q13A 2GS0A 4A5KA 4DX8A 3LJUX 1NI2A 2QKLA 1XD4A 2DYQA 1V89A 2E2XA 2OTXA 2YS1A 2P0HA 1M7EA 3AJ4A 3HW2B 1DBHA 1GC7A 1K5GB 1PFJA 1BAKA 2IYBA 1UNPA 5FI0A 1U5EA 1WGQA 1DDMA 4KHBB 2CODA 5DHFB 4P7IA 1W1HA 5HE1A 2MWNB 3P6AA 2CRFA 3A8QA 3SO6A 2P0DA 1WJ1A 5DIFB 2J0JA 1MKEA 2AL6A 4KHOA 2D2QA 1LW3A 3CIKA 2OQBA 2GCLA 5HE3A 2PZ1A 4CHJA 3ODXA 2DA0A 1UPRA 1Q67A 2MFQA 2L2IA 3WYFB 1MIXA 2J0KA 1J19A 3PG7A 2YS3A 1H4RA 4PQ0A 4WSFA 1H10A 1W1GA 1P3RA 1WJMA 2ZPYA 2D9ZA 2P0FA 1MK9B 4HAVB 3CXBB 2HE7A 1KZGA 5KQ4A 2D4QA 1U29A 5LONB 3M1IB 4YONA 3ODWA 5KCVA 4BBKA 3PVWA 5HE2A 2VRWB 4DX90 2V76A 3O96A 1J0WA 3SNHA 2AEHA 1BTKA 4GMXB 5KQ1A 3F5RA 3V5WA 1FGZA 2W2WA 1X86A 3DXCA 1EF1A 5D3VA 2I5CA 2R0DA 2J59M 4HHVA 3GYPA 2RGNB 1Y5OA 1ISNA 3UZTA 1IRSA 5JP4A 2MDXA 4DBBA 4A6HA 2J0MA 5C79A 3MPXA 3N7CA 1ZC3B 1MK7B 3AU5A 2FJLA 4HDQA 5DH9B 4ZRJA 2Y7BA 2JP2A 4CYEA 2RVBB 3VIAA 2DYNA 1Y19B 2COCA 2DKPA 4XWXA 4NY0A 2Y8FA 2Z0OA 4ZRIA 2EJ8A 1OMWA 3DXDA 5CLLB 1EGXA 1U5DA 1I2HA 5D3XA 5C5BA 4Z2NA 1M7RA 4B6HA 1P5TA 2D9YA 4HAXB 4GZUA 4F7GA 4HB2B 5HE0A 4HAYB 2DX1A 1U5GA 2HTHB 2I1KA 2RSGA 2ELBA 4NSWA 5J3TA 2YT1A 2H7DA 4C0AA 3FEHA 4ZRKA 5D3YA 4DXAB 1DROA 1XR0B 3U7DA 4HAZB 4K81A 1TXDA 1OY2A 2H7EA 3OANA 1ZC4B 2DHJA 3PSCA 3VOQA 1KI1B 3TO1A 1UPQA 2UVMA 2D9XA 2DHIA 1FOEA 3IVFA 2DN6A 3T06A 5C16A 4HATB 1NTYA 1WGUA 2I5FA 2KGXB 1DDWA 1U5FA 5GOWB 5J3YA 3FSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DLW A;  2ROZ B;  3DXE A;  1OQN A;  1V5U A;  2DHK A;  2LOZ A;  1K5D B;  4HB3 B;  1E5W A;  4PNK A;  2D11 A;  4HAU B;  5D3W A;  1FB8 A;  4MT7 A;  2D10 A;  2ELA A;  5LOP B;  2RUK B;  1WI1 A;  3KSY A;  1UNQ A;  4K2P A;  2LG1 A;  2W2X C;  1UEF A;  3ODO A;  1FAO A;  1ZSQ A;  2YVC A;  4IFS A;  5L81 A;  1N3H A;  1WG7 A;  2EC1 A;  1V88 A;  1KZ7 A;  4HB4 B;  4KHA A;  1GG3 A;  1U27 A;  2ROV A;  1DDV A;  1XCG A;  1MPH A;  4MY6 A;  1EVH A;  2YRY A;  2GJY A;  3NSU A;  3D8E A;  2W2X D;  3G9W A;  1SHC A;  1Z87 A;  5CLQ B;  1X05 A;  3TFM A;  2EMT A;  3KRW A;  1DYN A;  1BTN A;  1UNR A;  2K2J A;  4EMO A;  1WVH A;  3ULB A;  1RJ2 A;  3A98 B;  3BIN A;  3BJI A;  5FI1 A;  1NU2 A;  1PMS A;  3D8F A;  1I7A A;  3TVV A;  5EFX A;  3KZ1 A;  3RCP A;  5J3Q A;  4IOY X;  5C5B B;  2CY5 A;  4H8S A;  2KCJ A;  5JHH A;  4HAW B;  3PVL A;  4EJN A;  2COF A;  1AWE A;  3TW1 A;  4HDO A;  2MKR A;  4F7H A;  2ADZ A;  2P8V A;  3X23 A;  1EAZ A;  4K17 A;  3QWM A;  3D8D A;  3TCA A;  3ZDT A;  4F7U P;  4WJ7 A;  2LYD A;  1X1G A;  1ZVR A;  1B55 A;  2G35 A;  3ULC A;  1GC6 A;  3WA0 A;  1XOD A;  1BWN A;  2YSZ A;  1P6S A;  2D9V A;  3GYO A;  2LOX A;  3SYX A;  2KUP A;  3P7Z A;  4HB0 B;  1FHO A;  1ZM0 A;  4MK0 A;  2M38 A;  1V5P A;  1QQG A;  2R09 A;  2LKO A;  4WVF B;  1SGH A;  1V5M A;  1V61 A;  2NMB A;  3U8Z A;  2L1C A;  3PP2 A;  2UZR A;  3F0W A;  3QIJ A;  2DTC A;  2GCJ A;  4GMV A;  2RLO A;  3HK0 A;  1TJ6 A;  1MAI A;  4A6F A;  5C6R A;  4KAX B;  2CY4 A;  3AU4 A;  4EKU A;  2RNR B;  2VSZ A;  2DFK A;  2IFS A;  2NZ8 B;  4CHM A;  1QC6 A;  3QBV B;  4TYZ A;  2X18 A;  2Z0P A;  1FHX A;  2YT0 A;  4Z2M B;  5DI9 B;  4GXB A;  1XKE A;  3SUZ A;  5JLJ B;  3FM8 C;  2XQN M;  4GN1 A;  2LUL A;  3PZD A;  4IAP A;  2DX5 A;  4D0N B;  2N0Y A;  2K00 A;  1PLS A;  2YF0 A;  4GPT B;  2UZS A;  2M14 A;  2COA A;  2D9W A;  4Y94 A;  4A6F B;  4L6E A;  3PVU A;  2QKM A;  1U2B A;  1AQC A;  1XX0 A;  3A8P A;  5JHG A;  2I1J A;  1TQZ A;  3HQC A;  2VKI A;  1LB1 A;  1MIZ B;  3KRX A;  3MDB C;  5DHA B;  5D27 A;  1W1D A;  3KY9 A;  4YL8 A;  2N23 A;  2EMS A;  3PEG A;  3SV1 A;  4KVG B;  3ZVR A;  2CAY A;  1FGY A;  1X1F A;  4A6K A;  2BCJ A;  4TKN A;  2Y8G A;  1NTV A;  1X11 A;  2DKQ A;  1FHW A;  4K2O A;  2YS5 A;  3ML4 A;  2K2U A;  2Z0Q A;  1RRP B;  2Q13 A;  2GS0 A;  4A5K A;  4DX8 A;  3LJU X;  1NI2 A;  2QKL A;  1XD4 A;  2DYQ A;  1V89 A;  2E2X A;  2OTX A;  2YS1 A;  2P0H A;  1M7E A;  3AJ4 A;  3HW2 B;  1DBH A;  1GC7 A;  1K5G B;  1PFJ A;  1BAK A;  2IYB A;  1UNP A;  5FI0 A;  1U5E A;  1WGQ A;  1DDM A;  4KHB B;  2COD A;  5DHF B;  4P7I A;  1W1H A;  5HE1 A;  2MWN B;  3P6A A;  2CRF A;  3A8Q A;  3SO6 A;  2P0D A;  1WJ1 A;  5DIF B;  2J0J A;  1MKE A;  2AL6 A;  4KHO A;  2D2Q A;  1LW3 A;  3CIK A;  2OQB A;  2GCL A;  5HE3 A;  2PZ1 A;  4CHJ A;  3ODX A;  2DA0 A;  1UPR A;  1Q67 A;  2MFQ A;  2L2I A;  3WYF B;  1MIX A;  2J0K A;  1J19 A;  3PG7 A;  2YS3 A;  1H4R A;  4PQ0 A;  4WSF A;  1H10 A;  1W1G A;  1P3R A;  1WJM A;  2ZPY A;  2D9Z A;  2P0F A;  1MK9 B;  4HAV B;  3CXB B;  2HE7 A;  1KZG A;  5KQ4 A;  2D4Q A;  1U29 A;  5LON B;  3M1I B;  4YON A;  3ODW A;  5KCV A;  4BBK A;  3PVW A;  5HE2 A;  2VRW B;  4DX9 0;  2V76 A;  3O96 A;  1J0W A;  3SNH A;  2AEH A;  1BTK A;  4GMX B;  5KQ1 A;  3F5R A;  3V5W A;  1FGZ A;  2W2W A;  1X86 A;  3DXC A;  1EF1 A;  5D3V A;  2I5C A;  2R0D A;  2J59 M;  4HHV A;  3GYP A;  2RGN B;  1Y5O A;  1ISN A;  3UZT A;  1IRS A;  5JP4 A;  2MDX A;  4DBB A;  4A6H A;  2J0M A;  5C79 A;  3MPX A;  3N7C A;  1ZC3 B;  1MK7 B;  3AU5 A;  2FJL A;  4HDQ A;  5DH9 B;  4ZRJ A;  2Y7B A;  2JP2 A;  4CYE A;  2RVB B;  3VIA A;  2DYN A;  1Y19 B;  2COC A;  2DKP A;  4XWX A;  4NY0 A;  2Y8F A;  2Z0O A;  4ZRI A;  2EJ8 A;  1OMW A;  3DXD A;  5CLL B;  1EGX A;  1U5D A;  1I2H A;  5D3X A;  5C5B A;  4Z2N A;  1M7R A;  4B6H A;  1P5T A;  2D9Y A;  4HAX B;  4GZU A;  4F7G A;  4HB2 B;  5HE0 A;  4HAY B;  2DX1 A;  1U5G A;  2HTH B;  2I1K A;  2RSG A;  2ELB A;  4NSW A;  5J3T A;  2YT1 A;  2H7D A;  4C0A A;  3FEH A;  4ZRK A;  5D3Y A;  4DXA B;  1DRO A;  1XR0 B;  3U7D A;  4HAZ B;  4K81 A;  1TXD A;  1OY2 A;  2H7E A;  3OAN A;  1ZC4 B;  2DHJ A;  3PSC A;  3VOQ A;  1KI1 B;  3TO1 A;  1UPQ A;  2UVM A;  2D9X A;  2DHI A;  1FOE A;  3IVF A;  2DN6 A;  3T06 A;  5C16 A;  4HAT B;  1NTY A;  1WGU A;  2I5F A;  2KGX B;  1DDW A;  1U5F A;  5GOW B;  5J3Y A;  3FSS A; 
#chains in the Genus database with same CATH topology
 2KIE A;  2DLW A;  2ROZ B;  3DXE A;  1OQN A;  1V5U A;  2DHK A;  2LOZ A;  3B77 A;  1K5D B;  4HB3 B;  1E5W A;  4OSN A;  4PNK A;  2D11 A;  4HAU B;  5D3W A;  1FB8 A;  4MT7 A;  2D10 A;  2ELA A;  5LOP B;  2RUK B;  1WI1 A;  3KSY A;  1UNQ A;  4K2P A;  2LG1 A;  2W2X C;  5LG4 B;  1UEF A;  3ODO A;  1FAO A;  1ZSQ A;  2YVC A;  4IFS A;  5L81 A;  1MI1 A;  1N3H A;  1WG7 A;  2EC1 A;  4QJ4 B;  1V88 A;  1KZ7 A;  4HB4 B;  4KHA A;  1GG3 A;  1U27 A;  2ROV A;  1DDV A;  4KHB A;  1XCG A;  1MPH A;  2KR0 A;  4MY6 A;  1EVH A;  2YRY A;  2GJY A;  3NSU A;  3D8E A;  2W2X D;  3G9W A;  1SHC A;  1Z87 A;  5CLQ B;  4QXA B;  1X05 A;  3TFM A;  2EMT A;  3KRW A;  1DYN A;  3NWA A;  1BTN A;  1UNR A;  2K2J A;  4EMO A;  1WVH A;  3ULB A;  1RJ2 A;  3A98 B;  3BIN A;  3BJI A;  5FI1 A;  1NU2 A;  1PMS A;  3D8F A;  1I7A A;  3TVV A;  5EFX A;  3KZ1 A;  3RCP A;  5J3Q A;  2R2Y A;  4IOY X;  5C5B B;  2CY5 A;  4H8S A;  2KCJ A;  5JHH A;  4DIX A;  4HAW B;  3PVL A;  4EJN A;  2COF A;  1AWE A;  3TW1 A;  4HDO A;  2MKR A;  4F7H A;  2ADZ A;  2P8V A;  3X23 A;  1EAZ A;  4K17 A;  3QWM A;  3NWD A;  3D8D A;  3TCA A;  3ZDT A;  4F7U P;  4WJ7 A;  2LYD A;  1X1G A;  1ZVR A;  1B55 A;  2G35 A;  3ULC A;  2Z4D A;  1GC6 A;  3WA0 A;  1XOD A;  1BWN A;  2YSZ A;  1P6S A;  2D9V A;  3GYO A;  2LOX A;  3SYX A;  2KUP A;  3P7Z A;  2GUM A;  2KUQ A;  4HB0 B;  1FHO A;  1ZM0 A;  4MK0 A;  2M38 A;  1V5P A;  1QQG A;  2R09 A;  2LKO A;  2NBV A;  4WVF B;  1SGH A;  1V5M A;  1V61 A;  2NMB A;  3U8Z A;  2L1C A;  3PP2 A;  2UZR A;  3F0W A;  3QIJ A;  2DTC A;  2GCJ A;  4GMV A;  2RLO A;  3HK0 A;  1TJ6 A;  1MAI A;  4A6F A;  5C6R A;  2K49 A;  2YT2 A;  4KAX B;  2CY4 A;  3AU4 A;  5M4Y B;  4EKU A;  2RNR B;  2VSZ A;  2DFK A;  2IFS A;  2NZ8 B;  4CHM A;  1QC6 A;  3QBV B;  4TYZ A;  2X18 A;  2Z0P A;  1FHX A;  2YT0 A;  4Z2M B;  5DI9 B;  4GXB A;  1XKE A;  3SUZ A;  5JLJ B;  3FM8 C;  2XQN M;  4GN1 A;  2LUL A;  3PZD A;  4IAP A;  2DX5 A;  4D0N B;  2N0Y A;  2K00 A;  1PLS A;  2YF0 A;  4GPT B;  2UZS A;  2M14 A;  2COA A;  2D9W A;  2RRF A;  4Y94 A;  4A6F B;  4L6E A;  3PVU A;  2QKM A;  1U2B A;  4OT1 A;  1AQC A;  1XX0 A;  3A8P A;  5JHG A;  2I1J A;  1TQZ A;  3HQC A;  2VKI A;  1LB1 A;  1MIZ B;  3KRX A;  3MDB C;  4L1R A;  5DHA B;  5D27 A;  1W1D A;  3KY9 A;  4YL8 A;  2N23 A;  2EMS A;  3PEG A;  3SV1 A;  4KVG B;  3ZVR A;  2CAY A;  1FGY A;  3FVC A;  1X1F A;  4A6K A;  2BCJ A;  4TKN A;  2Y8G A;  1NTV A;  1X11 A;  2DKQ A;  1FHW A;  4K2O A;  1ZYI A;  2YS5 A;  3ML4 A;  2K2U A;  2Z0Q A;  1RRP B;  2Q13 A;  2GS0 A;  3HIE A;  4A5K A;  4DX8 A;  3LJU X;  5IRS A;  1NI2 A;  2QKL A;  1XD4 A;  2DYQ A;  1V89 A;  2E2X A;  2OTX A;  2YS1 A;  2P0H A;  1M7E A;  3AJ4 A;  3HW2 B;  1DBH A;  1GC7 A;  1K5G B;  2Z13 A;  1PFJ A;  1BAK A;  3A58 A;  2IYB A;  1UNP A;  5FI0 A;  1U5E A;  1WGQ A;  2FJU B;  1DDM A;  4KHB B;  2COD A;  5DHF B;  4P7I A;  1W1H A;  5HE1 A;  2MWN B;  3P6A A;  2CRF A;  3A8Q A;  3SO6 A;  3NWF A;  2P0D A;  1WJ1 A;  5DIF B;  2J0J A;  1MKE A;  2AL6 A;  4KHO A;  2D2Q A;  1LW3 A;  3U12 A;  3CIK A;  2OQB A;  2GCL A;  5HE3 A;  2PZ1 A;  4CHJ A;  3ODX A;  3NW8 A;  2DA0 A;  4GNK B;  1UPR A;  1Q67 A;  2MFQ A;  2L2I A;  3WYF B;  1MIX A;  2J0K A;  1J19 A;  3PG7 A;  3OHM B;  2YS3 A;  1H4R A;  4PQ0 A;  4WSF A;  1H10 A;  1W1G A;  1P3R A;  1WJM A;  2ZPY A;  2D9Z A;  2P0F A;  4CSQ A;  1MK9 B;  4HAV B;  3CXB B;  2HE7 A;  1KZG A;  5KQ4 A;  2D4Q A;  1U29 A;  5LON B;  3M1I B;  4YON A;  3ODW A;  5KCV A;  4BBK A;  3PVW A;  4QJ3 B;  5HE2 A;  2VRW B;  4DX9 0;  2V76 A;  3O96 A;  1J0W A;  4HSI A;  2K8E A;  3SNH A;  2AEH A;  1BTK A;  4GMX B;  5KQ1 A;  3F5R A;  3V5W A;  3DCX A;  1FGZ A;  2W2W A;  1X86 A;  3DXC A;  1EF1 A;  5D3V A;  2I5C A;  2R0D A;  2J59 M;  4HHV A;  3GYP A;  2RGN B;  2KIG A;  1Y5O A;  1ISN A;  3UZT A;  3HSA A;  5I2S A;  1IRS A;  5JP4 A;  2MDX A;  4DBB A;  4A6H A;  2J0M A;  5C79 A;  3MPX A;  3N7C A;  1ZC3 B;  1MK7 B;  3AU5 A;  2FJL A;  4HDQ A;  5DH9 B;  4ZRJ A;  2Y7B A;  2JP2 A;  4CYE A;  2RVB B;  3VIA A;  1T77 A;  2DYN A;  1Y19 B;  2COC A;  5I2M A;  2DKP A;  4XWX A;  4NY0 A;  2Y8F A;  2Z0O A;  4ZRI A;  2EJ8 A;  1OMW A;  2Z14 A;  3DXD A;  5CLL B;  1EGX A;  1U5D A;  1I2H A;  5D3X A;  5C5B A;  4Z2N A;  1M7R A;  4B6H A;  1P5T A;  2D9Y A;  4HAX B;  4GZU A;  4F7G A;  4HB2 B;  5HE0 A;  4HAY B;  2DX1 A;  1U5G A;  2HTH B;  2I1K A;  2RSG A;  2ELB A;  4NSW A;  5J3T A;  2YT1 A;  2H7D A;  4C0A A;  3FEH A;  4ZRK A;  4D6W A;  5D3Y A;  4DXA B;  1DRO A;  1XR0 B;  3U7D A;  4HAZ B;  4K81 A;  1TXD A;  1OY2 A;  2H7E A;  3OAN A;  2ZKM X;  1ZC4 B;  2DHJ A;  3PSC A;  3VOQ A;  1KI1 B;  3TO1 A;  4QJ5 B;  1UPQ A;  2UVM A;  2D9X A;  2DHI A;  1FOE A;  3IVF A;  2DN6 A;  3T06 A;  5C16 A;  4HAT B;  1NTY A;  1WGU A;  2I5F A;  2KGX B;  1DDW A;  1U5F A;  5GOW B;  5J3Y A;  2Z59 A;  3FSS A;  4GOU A; 
#chains in the Genus database with same CATH homology
 2DLW A;  2ROZ B;  3DXE A;  1OQN A;  1V5U A;  2DHK A;  2LOZ A;  1K5D B;  4HB3 B;  1E5W A;  4PNK A;  2D11 A;  4HAU B;  5D3W A;  1FB8 A;  4MT7 A;  2D10 A;  2ELA A;  5LOP B;  2RUK B;  1WI1 A;  3KSY A;  1UNQ A;  4K2P A;  2LG1 A;  2W2X C;  1UEF A;  3ODO A;  1FAO A;  1ZSQ A;  2YVC A;  4IFS A;  5L81 A;  1N3H A;  1WG7 A;  2EC1 A;  1V88 A;  1KZ7 A;  4HB4 B;  4KHA A;  1GG3 A;  1U27 A;  2ROV A;  1DDV A;  1XCG A;  1MPH A;  4MY6 A;  1EVH A;  2YRY A;  2GJY A;  3NSU A;  3D8E A;  2W2X D;  3G9W A;  1SHC A;  1Z87 A;  5CLQ B;  1X05 A;  3TFM A;  2EMT A;  3KRW A;  1DYN A;  1BTN A;  1UNR A;  2K2J A;  4EMO A;  1WVH A;  3ULB A;  1RJ2 A;  3A98 B;  3BIN A;  3BJI A;  5FI1 A;  1NU2 A;  1PMS A;  3D8F A;  1I7A A;  3TVV A;  5EFX A;  3KZ1 A;  3RCP A;  5J3Q A;  4IOY X;  5C5B B;  2CY5 A;  4H8S A;  2KCJ A;  5JHH A;  4HAW B;  3PVL A;  4EJN A;  2COF A;  1AWE A;  3TW1 A;  4HDO A;  2MKR A;  4F7H A;  2ADZ A;  2P8V A;  3X23 A;  1EAZ A;  4K17 A;  3QWM A;  3D8D A;  3TCA A;  3ZDT A;  4F7U P;  4WJ7 A;  2LYD A;  1X1G A;  1ZVR A;  1B55 A;  2G35 A;  3ULC A;  1GC6 A;  3WA0 A;  1XOD A;  1BWN A;  2YSZ A;  1P6S A;  2D9V A;  3GYO A;  2LOX A;  3SYX A;  2KUP A;  3P7Z A;  4HB0 B;  1FHO A;  1ZM0 A;  4MK0 A;  2M38 A;  1V5P A;  1QQG A;  2R09 A;  2LKO A;  4WVF B;  1SGH A;  1V5M A;  1V61 A;  2NMB A;  3U8Z A;  2L1C A;  3PP2 A;  2UZR A;  3F0W A;  3QIJ A;  2DTC A;  2GCJ A;  4GMV A;  2RLO A;  3HK0 A;  1TJ6 A;  1MAI A;  4A6F A;  5C6R A;  4KAX B;  2CY4 A;  3AU4 A;  4EKU A;  2RNR B;  2VSZ A;  2DFK A;  2IFS A;  2NZ8 B;  4CHM A;  1QC6 A;  3QBV B;  4TYZ A;  2X18 A;  2Z0P A;  1FHX A;  2YT0 A;  4Z2M B;  5DI9 B;  4GXB A;  1XKE A;  3SUZ A;  5JLJ B;  3FM8 C;  2XQN M;  4GN1 A;  2LUL A;  3PZD A;  4IAP A;  2DX5 A;  4D0N B;  2N0Y A;  2K00 A;  1PLS A;  2YF0 A;  4GPT B;  2UZS A;  2M14 A;  2COA A;  2D9W A;  4Y94 A;  4A6F B;  4L6E A;  3PVU A;  2QKM A;  1U2B A;  1AQC A;  1XX0 A;  3A8P A;  5JHG A;  2I1J A;  1TQZ A;  3HQC A;  2VKI A;  1LB1 A;  1MIZ B;  3KRX A;  3MDB C;  5DHA B;  5D27 A;  1W1D A;  3KY9 A;  4YL8 A;  2N23 A;  2EMS A;  3PEG A;  3SV1 A;  4KVG B;  3ZVR A;  2CAY A;  1FGY A;  1X1F A;  4A6K A;  2BCJ A;  4TKN A;  2Y8G A;  1NTV A;  1X11 A;  2DKQ A;  1FHW A;  4K2O A;  2YS5 A;  3ML4 A;  2K2U A;  2Z0Q A;  1RRP B;  2Q13 A;  2GS0 A;  4A5K A;  4DX8 A;  3LJU X;  1NI2 A;  2QKL A;  1XD4 A;  2DYQ A;  1V89 A;  2E2X A;  2OTX A;  2YS1 A;  2P0H A;  1M7E A;  3AJ4 A;  3HW2 B;  1DBH A;  1GC7 A;  1K5G B;  1PFJ A;  1BAK A;  2IYB A;  1UNP A;  5FI0 A;  1U5E A;  1WGQ A;  1DDM A;  4KHB B;  2COD A;  5DHF B;  4P7I A;  1W1H A;  5HE1 A;  2MWN B;  3P6A A;  2CRF A;  3A8Q A;  3SO6 A;  2P0D A;  1WJ1 A;  5DIF B;  2J0J A;  1MKE A;  2AL6 A;  4KHO A;  2D2Q A;  1LW3 A;  3CIK A;  2OQB A;  2GCL A;  5HE3 A;  2PZ1 A;  4CHJ A;  3ODX A;  2DA0 A;  1UPR A;  1Q67 A;  2MFQ A;  2L2I A;  3WYF B;  1MIX A;  2J0K A;  1J19 A;  3PG7 A;  2YS3 A;  1H4R A;  4PQ0 A;  4WSF A;  1H10 A;  1W1G A;  1P3R A;  1WJM A;  2ZPY A;  2D9Z A;  2P0F A;  1MK9 B;  4HAV B;  3CXB B;  2HE7 A;  1KZG A;  5KQ4 A;  2D4Q A;  1U29 A;  5LON B;  3M1I B;  4YON A;  3ODW A;  5KCV A;  4BBK A;  3PVW A;  5HE2 A;  2VRW B;  4DX9 0;  2V76 A;  3O96 A;  1J0W A;  3SNH A;  2AEH A;  1BTK A;  4GMX B;  5KQ1 A;  3F5R A;  3V5W A;  1FGZ A;  2W2W A;  1X86 A;  3DXC A;  1EF1 A;  5D3V A;  2I5C A;  2R0D A;  2J59 M;  4HHV A;  3GYP A;  2RGN B;  1Y5O A;  1ISN A;  3UZT A;  1IRS A;  5JP4 A;  2MDX A;  4DBB A;  4A6H A;  2J0M A;  5C79 A;  3MPX A;  3N7C A;  1ZC3 B;  1MK7 B;  3AU5 A;  2FJL A;  4HDQ A;  5DH9 B;  4ZRJ A;  2Y7B A;  2JP2 A;  4CYE A;  2RVB B;  3VIA A;  2DYN A;  1Y19 B;  2COC A;  2DKP A;  4XWX A;  4NY0 A;  2Y8F A;  2Z0O A;  4ZRI A;  2EJ8 A;  1OMW A;  3DXD A;  5CLL B;  1EGX A;  1U5D A;  1I2H A;  5D3X A;  5C5B A;  4Z2N A;  1M7R A;  4B6H A;  1P5T A;  2D9Y A;  4HAX B;  4GZU A;  4F7G A;  4HB2 B;  5HE0 A;  4HAY B;  2DX1 A;  1U5G A;  2HTH B;  2I1K A;  2RSG A;  2ELB A;  4NSW A;  5J3T A;  2YT1 A;  2H7D A;  4C0A A;  3FEH A;  4ZRK A;  5D3Y A;  4DXA B;  1DRO A;  1XR0 B;  3U7D A;  4HAZ B;  4K81 A;  1TXD A;  1OY2 A;  2H7E A;  3OAN A;  1ZC4 B;  2DHJ A;  3PSC A;  3VOQ A;  1KI1 B;  3TO1 A;  1UPQ A;  2UVM A;  2D9X A;  2DHI A;  1FOE A;  3IVF A;  2DN6 A;  3T06 A;  5C16 A;  4HAT B;  1NTY A;  1WGU A;  2I5F A;  2KGX B;  1DDW A;  1U5F A;  5GOW B;  5J3Y A;  3FSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...