2QKMA

The crystal structure of fission yeast mrna decapping enzyme dcp1-dcp2 complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
127
structure length
123
Chain Sequence
MEDENILRNAVNLQVLKFHYPEIESIIDIASHVAVYQFDKWLKTSIEGTFFLVKDQRARVGYVILNRNSPENLYLFINHPSNVHLVDRYLIHRTENQHVVGLWMFDPNDMSRIFNIVKESLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of dcp2 recognition and activation by dcp1.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Hydrolase
molecule keywords SPBC3B9.21 protein
total genus 32
structure length 123
sequence length 127
chains with identical sequence C, E, G
ec nomenclature ec 3.6.1.30: Transferred entry: 3.6.1.59 and 3.6.1.62.
pdb deposition date 2007-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2qkmA00
2YT1A 4KHBB 4H8SA 1V89A 2DX5A 2N0YA 3SV1A 4NY0A 2P0FA 3HW2B 1OMWA 2OTXA 4A5KA 4F7GA 1EVHA 1NTVA 2DN6A 1MAIA 2ZPYA 1QC6A 5KCVA 1AWEA 1U5GA 1WVHA 1DDMA 2MKRA 5DI9B 2D9ZA 1LB1A 5D3XA 1DBHA 4DBBA 1ZM0A 2CY4A 1Z87A 3ULBA 2VKIA 3T06A 5HE3A 5DIFB 1WJMA 2D11A 1X11A 2RVBB 4DXAB 5D3VA 2YS1A 3PG7A 1W1GA 4ZRKA 4DX8A 1GC7A 2J0JA 2W2WA 4GMVA 2DKPA 1X86A 2I1JA 1ISNA 1X1GA 3PP2A 1X05A 3TW1A 3KY9A 2AEHA 5KQ4A 2Z0QA 1UNQA 1EAZA 1PFJA 3ML4A 3TVVA 3PSCA 2MDXA 2LULA 3A8PA 1V88A 4MK0A 2YT0A 1NU2A 2COFA 4HHVA 3PVWA 2XQNM 1MK9B 2M14A 2N23A 2KCJA 2P8VA 1SHCA 1MKEA 2YF0A 2R0DA 3FSSA 3GYOA 3VIAA 4K2OA 1ZC3B 3ZVRA 3M1IB 5FI1A 3BJIA 3OANA 1WGQA 5J3YA 1J0WA 2I1KA 3AJ4A 4KAXB 1KZ7A 2DKQA 2L2IA 4HAVB 2H7EA 2GCLA 2RLOA 2FJLA 2G35A 2GCJA 4HB2B 4PNKA 4TYZA 1K5DB 2PZ1A 3CXBB 4MY6A 5C5BB 2AL6A 2D4QA 2DYQA 2DHIA 3ODXA 1KZGA 1FGZA 1H4RA 4A6FB 4P7IA 1B55A 4HAZB 2COAA 1E5WA 4EMOA 3ODOA 2RGNB 2P0HA 4WVFB 2ADZA 4ZRJA 1NI2A 2W2XC 1Q67A 2LG1A 4KHAA 5D27A 3SNHA 2YS3A 3BINA 1RJ2A 2D10A 1U5DA 2Z0PA 2COCA 2IYBA 3KRWA 1NTYA 1V5MA 1FB8A 4C0AA 1TJ6A 4A6HA 1UNRA 4Z2NA 1U27A 3TCAA 1DYNA 2Z0OA 1ZC4B 1V5UA 1ZSQA 3QWMA 2MWNB 3KZ1A 3FEHA 2RSGA 3ODWA 4CHMA 4NSWA 1U5EA 1EF1A 1N3HA 3D8FA 4WSFA 1GC6A 1MIZB 1W1HA 1Y19B 2ROZB 5DHAB 3PVUA 5D3YA 2CAYA 4EKUA 3WYFB 3A98B 2DLWA 3G9WA 1OY2A 2OQBA 3F5RA 2V76A 3QIJA 5GOWB 3P6AA 4B6HA 2JP2A 2EMTA 4A6FA 1P6SA 3TFMA 2DFKA 4BBKA 5JP4A 5FI0A 2D9XA 2D9YA 5JHGA 1MIXA 2K2JA 3KSYA 3HQCA 3ULCA 3IVFA 3PVLA 1M7EA 1BTKA 1XD4A 5HE2A 3U7DA 1IRSA 1V5PA 1P3RA 2ROVA 5C5BA 3PZDA 5CLQB 4CYEA 2KGXB 1FHOA 2RUKB 4Z2MB 3MPXA 4GPTB 2QKLA 2IFSA 4HB0B 4L6EA 4YONA 2KUPA 3A8QA 3DXEA 4Y94A 1U5FA 2EJ8A 2HE7A 1WI1A 3DXCA 1P5TA 3KRXA 1WJ1A 5C16A 5L81A 2LKOA 1WG7A 3MDBC 2NMBA 2EMSA 5LOPB 5J3TA 4F7UP 5C6RA 4CHJA 4D0NB 1EGXA 5DH9B 3N7CA 3V5WA 1FGYA 1BAKA 4YL8A 2K00A 5CLLB 3P7ZA 1OQNA 3U8ZA 1U2BA 4K2PA 3PEGA 2E2XA 2DX1A 2P0DA 2I5CA 5J3QA 4HDQA 2DHKA 2DA0A 2UZSA 2GS0A 1SGHA 1X1FA 2L1CA 2J59M 4HATB 1UPRA 2J0KA 2UVMA 4IFSA 2YS5A 4TKNA 3D8EA 4K81A 2VRWB 1UPQA 2GJYA 5JLJB 4ZRIA 4IOYX 1XX0A 3GYPA 2YRYA 1BWNA 1TXDA 3SUZA 4IAPA 1H10A 2ELBA 4HAYB 1M7RA 4F7HA 2Q13A 4HAUB 4GXBA 3WA0A 1FAOA 5HE0A 1PMSA 4DX90 2VSZA 3SO6A 5KQ1A 2QKMA 2I5FA 4EJNA 1I7AA 1GG3A 1ZVRA 2J0MA 1XODA 1LW3A 1PLSA 1I2HA 4HB4B 1V61A 3HK0A 3O96A 3D8DA 3X23A 2CY5A 1W1DA 1XCGA 4GMXB 1DDVA 5HE1A 2X18A 4GZUA 5EFXA 2EC1A 5JHHA 3ZDTA 2RNRB 1QQGA 3SYXA 5C79A 2K2UA 2CODA 1DDWA 4MT7A 1AQCA 2DYNA 1U29A 2D2QA 4K17A 2Y8GA 4HDOA 4HAWB 2YSZA 1XKEA 2D9VA 2DTCA 2W2XD 3LJUX 2M38A 1FHWA 2R09A 4GN1A 4XWXA 2LYDA 1RRPB 5DHFB 1FOEA 1MPHA 2UZRA 1UEFA 1BTNA 2D9WA 4KVGB 3DXDA 2MFQA 3AU5A 3NSUA 2H7DA 1FHXA 2LOZA 1MK7B 3UZTA 1WGUA 4A6KA 1Y5OA 1KI1B 3AU4A 2ELAA 5D3WA 4PQ0A 2Y7BA 4KHOA 1DROA 4WJ7A 2YVCA 1J19A 2Y8FA 3FM8C 2CRFA 2HTHB 1K5GB 3CIKA 3F0WA 5LONB 2LOXA 2DHJA 2NZ8B 3VOQA 3QBVB 1TQZA 1UNPA 3TO1A 1XR0B 3RCPA 2BCJA 4HB3B 4HAXB
chains in the Genus database with same CATH superfamily
2YT1A 4KHBB 4H8SA 1V89A 2DX5A 2N0YA 3SV1A 1MI1A 4NY0A 2P0FA 3HW2B 1OMWA 2OTXA 4A5KA 4F7GA 1EVHA 2KIGA 1NTVA 2DN6A 1MAIA 3U12A 2ZPYA 1QC6A 5KCVA 1AWEA 1U5GA 1WVHA 1DDMA 2MKRA 5DI9B 2ZKMX 2D9ZA 1LB1A 5D3XA 1DBHA 4DBBA 1ZM0A 2CY4A 1Z87A 3ULBA 2VKIA 3T06A 5HE3A 5DIFB 1WJMA 2D11A 1X11A 2RVBB 4DXAB 5D3VA 2YS1A 3PG7A 1W1GA 4ZRKA 3NWDA 4DX8A 1GC7A 2J0JA 2W2WA 4GMVA 2DKPA 2YT2A 1X86A 2Z13A 2I1JA 1ISNA 1X1GA 3PP2A 1X05A 3TW1A 3KY9A 2AEHA 5KQ4A 2Z0QA 1UNQA 1EAZA 1PFJA 3ML4A 3TVVA 3PSCA 2MDXA 2LULA 3A8PA 4CSQA 1V88A 4MK0A 2YT0A 1NU2A 2KR0A 2COFA 4HHVA 3PVWA 2XQNM 1MK9B 2M14A 2N23A 2KCJA 5M4YB 2P8VA 1SHCA 1MKEA 3NWFA 2YF0A 2R0DA 3FSSA 3GYOA 3VIAA 3HSAA 4K2OA 1ZC3B 3ZVRA 3M1IB 2Z59A 5FI1A 3BJIA 3OANA 5IRSA 1WGQA 5J3YA 1J0WA 2I1KA 3AJ4A 1KZ7A 4KAXB 2DKQA 2L2IA 4HAVB 2H7EA 2GCLA 2RLOA 4OSNA 2FJLA 2G35A 2GCJA 4HB2B 4PNKA 4TYZA 1K5DB 2PZ1A 3CXBB 4MY6A 5C5BB 2AL6A 2D4QA 2DYQA 2DHIA 3ODXA 1KZGA 1FGZA 1H4RA 4A6FB 4P7IA 1B55A 4HAZB 2COAA 1E5WA 4EMOA 3ODOA 2RGNB 2P0HA 4WVFB 2ADZA 4ZRJA 1NI2A 2W2XC 1Q67A 2LG1A 4KHAA 5D27A 3SNHA 4D6WA 2YS3A 3BINA 1RJ2A 3DCXA 2D10A 1U5DA 2Z0PA 2COCA 2IYBA 3KRWA 1NTYA 1V5MA 1FB8A 4C0AA 1TJ6A 4A6HA 1UNRA 4Z2NA 1U27A 3TCAA 2KUQA 1DYNA 2Z0OA 1ZC4B 2KIEA 1V5UA 1ZSQA 3QWMA 2MWNB 3KZ1A 3FEHA 2RSGA 3ODWA 4CHMA 4NSWA 1U5EA 1EF1A 1N3HA 3D8FA 4WSFA 1GC6A 1MIZB 1W1HA 1Y19B 2ROZB 5DHAB 3PVUA 5D3YA 2CAYA 4EKUA 3WYFB 3A98B 2DLWA 3G9WA 1OY2A 2OQBA 3F5RA 2V76A 3QIJA 5GOWB 3P6AA 4B6HA 2JP2A 2EMTA 4A6FA 4OT1A 1P6SA 3TFMA 2DFKA 4BBKA 5JP4A 5FI0A 2D9XA 2D9YA 5JHGA 1MIXA 2K2JA 3KSYA 4GOUA 2K49A 3HQCA 3ULCA 3IVFA 3PVLA 1M7EA 1BTKA 1XD4A 3FVCA 5HE2A 3U7DA 1IRSA 1V5PA 1P3RA 2ROVA 5C5BA 3PZDA 5CLQB 4CYEA 2KGXB 4DIXA 4HSIA 1FHOA 2RUKB 4Z2MB 3OHMB 3MPXA 4GPTB 2QKLA 2IFSA 4HB0B 4L6EA 4GNKB 2KUPA 4YONA 3A8QA 3DXEA 4Y94A 1U5FA 2EJ8A 2HE7A 4L1RA 1WI1A 3DXCA 4QXAB 2NBVA 1P5TA 3KRXA 1WJ1A 5C16A 5L81A 2LKOA 1WG7A 3MDBC 2NMBA 2EMSA 5LOPB 5J3TA 4F7UP 5C6RA 4CHJA 4D0NB 1EGXA 5DH9B 3N7CA 3V5WA 1FGYA 1BAKA 4YL8A 2K00A 5CLLB 3P7ZA 1OQNA 3U8ZA 1U2BA 4K2PA 3PEGA 2E2XA 2DX1A 2P0DA 2I5CA 5J3QA 4HDQA 2DHKA 2DA0A 5LG4B 2UZSA 2GS0A 1SGHA 1X1FA 2L1CA 2J59M 2RRFA 4HATB 1UPRA 2J0KA 2UVMA 4IFSA 2YS5A 4KHBA 4TKNA 3D8EA 4K81A 2VRWB 1UPQA 2GJYA 5JLJB 2Z4DA 4ZRIA 4IOYX 1T77A 1XX0A 3GYPA 2YRYA 1BWNA 1TXDA 3SUZA 4IAPA 2R2YA 1H10A 2ELBA 4HAYB 1M7RA 4F7HA 2Q13A 4HAUB 5I2SA 4GXBA 3WA0A 1FAOA 5HE0A 1PMSA 4DX90 2VSZA 3SO6A 2GUMA 5KQ1A 2QKMA 2I5FA 4EJNA 1I7AA 1GG3A 1ZVRA 2J0MA 1XODA 1LW3A 1PLSA 1I2HA 4HB4B 1V61A 3HK0A 3O96A 3D8DA 3HIEA 2CY5A 3X23A 1W1DA 1XCGA 4GMXB 1DDVA 5HE1A 2Z14A 2FJUB 2X18A 4GZUA 5EFXA 2EC1A 5JHHA 3ZDTA 2RNRB 2K8EA 1QQGA 3SYXA 5C79A 3NW8A 2K2UA 2CODA 1DDWA 3NWAA 4MT7A 1AQCA 2DYNA 1U29A 2D2QA 1ZYIA 4K17A 2Y8GA 4HDOA 4HAWB 2YSZA 1XKEA 2D9VA 2DTCA 2W2XD 3A58A 3LJUX 5I2MA 2M38A 1FHWA 2R09A 4QJ5B 4GN1A 4XWXA 2LYDA 1RRPB 5DHFB 1FOEA 1MPHA 2UZRA 1UEFA 1BTNA 2D9WA 4KVGB 3DXDA 2MFQA 3AU5A 3NSUA 2H7DA 1FHXA 2LOZA 1MK7B 3UZTA 1WGUA 4A6KA 1Y5OA 1KI1B 3AU4A 2ELAA 5D3WA 4PQ0A 2Y7BA 4KHOA 1DROA 4WJ7A 2YVCA 1J19A 2Y8FA 3FM8C 2CRFA 2HTHB 1K5GB 3CIKA 3F0WA 5LONB 2LOXA 2DHJA 2NZ8B 3VOQA 3QBVB 4QJ4B 1TQZA 4QJ3B 1UNPA 3TO1A 1XR0B 3RCPA 3B77A 2BCJA 4HB3B 4HAXB
chains in the Genus database with same CATH topology
2YT1A 4KHBB 4H8SA 1V89A 2DX5A 2N0YA 3SV1A 4NY0A 2P0FA 3HW2B 1OMWA 2OTXA 4A5KA 4F7GA 1EVHA 1NTVA 2DN6A 1MAIA 2ZPYA 1QC6A 5KCVA 1AWEA 1U5GA 1WVHA 1DDMA 2MKRA 5DI9B 2D9ZA 1LB1A 5D3XA 1DBHA 4DBBA 1ZM0A 2CY4A 1Z87A 3ULBA 2VKIA 3T06A 5HE3A 5DIFB 1WJMA 2D11A 1X11A 2RVBB 4DXAB 5D3VA 2YS1A 3PG7A 1W1GA 4ZRKA 4DX8A 1GC7A 2J0JA 2W2WA 4GMVA 2DKPA 1X86A 2I1JA 1ISNA 1X1GA 3PP2A 1X05A 3TW1A 3KY9A 2AEHA 5KQ4A 2Z0QA 1UNQA 1EAZA 1PFJA 3ML4A 3TVVA 3PSCA 2MDXA 2LULA 3A8PA 1V88A 4MK0A 2YT0A 1NU2A 2COFA 4HHVA 3PVWA 2XQNM 1MK9B 2M14A 2N23A 2KCJA 2P8VA 1SHCA 1MKEA 2YF0A 2R0DA 3FSSA 3GYOA 3VIAA 4K2OA 1ZC3B 3ZVRA 3M1IB 5FI1A 3BJIA 3OANA 1WGQA 5J3YA 1J0WA 2I1KA 3AJ4A 4KAXB 1KZ7A 2DKQA 2L2IA 4HAVB 2H7EA 2GCLA 2RLOA 2FJLA 2G35A 2GCJA 4HB2B 4PNKA 4TYZA 1K5DB 2PZ1A 3CXBB 4MY6A 5C5BB 2AL6A 2D4QA 2DYQA 2DHIA 3ODXA 1KZGA 1FGZA 1H4RA 4A6FB 4P7IA 1B55A 4HAZB 2COAA 1E5WA 4EMOA 3ODOA 2RGNB 2P0HA 4WVFB 2ADZA 4ZRJA 1NI2A 2W2XC 1Q67A 2LG1A 4KHAA 5D27A 3SNHA 2YS3A 3BINA 1RJ2A 2D10A 1U5DA 2Z0PA 2COCA 2IYBA 3KRWA 1NTYA 1V5MA 1FB8A 4C0AA 1TJ6A 4A6HA 1UNRA 4Z2NA 1U27A 3TCAA 1DYNA 2Z0OA 1ZC4B 1V5UA 1ZSQA 3QWMA 2MWNB 3KZ1A 3FEHA 2RSGA 3ODWA 4CHMA 4NSWA 1U5EA 1EF1A 1N3HA 3D8FA 4WSFA 1GC6A 1MIZB 1W1HA 1Y19B 2ROZB 5DHAB 3PVUA 5D3YA 2CAYA 4EKUA 3WYFB 3A98B 2DLWA 3G9WA 1OY2A 2OQBA 3F5RA 2V76A 3QIJA 5GOWB 3P6AA 4B6HA 2JP2A 2EMTA 4A6FA 1P6SA 3TFMA 2DFKA 4BBKA 5JP4A 5FI0A 2D9XA 2D9YA 5JHGA 1MIXA 2K2JA 3KSYA 3HQCA 3ULCA 3IVFA 3PVLA 1M7EA 1BTKA 1XD4A 5HE2A 3U7DA 1IRSA 1V5PA 1P3RA 2ROVA 5C5BA 3PZDA 5CLQB 4CYEA 2KGXB 1FHOA 2RUKB 4Z2MB 3MPXA 4GPTB 2QKLA 2IFSA 4HB0B 4L6EA 4YONA 2KUPA 3A8QA 3DXEA 4Y94A 1U5FA 2EJ8A 2HE7A 1WI1A 3DXCA 1P5TA 3KRXA 1WJ1A 5C16A 5L81A 2LKOA 1WG7A 3MDBC 2NMBA 2EMSA 5LOPB 5J3TA 4F7UP 5C6RA 4CHJA 4D0NB 1EGXA 5DH9B 3N7CA 3V5WA 1FGYA 1BAKA 4YL8A 2K00A 5CLLB 3P7ZA 1OQNA 3U8ZA 1U2BA 4K2PA 3PEGA 2E2XA 2DX1A 2P0DA 2I5CA 5J3QA 4HDQA 2DHKA 2DA0A 2UZSA 2GS0A 1SGHA 1X1FA 2L1CA 2J59M 4HATB 1UPRA 2J0KA 2UVMA 4IFSA 2YS5A 4TKNA 3D8EA 4K81A 2VRWB 1UPQA 2GJYA 5JLJB 4ZRIA 4IOYX 1XX0A 3GYPA 2YRYA 1BWNA 1TXDA 3SUZA 4IAPA 1H10A 2ELBA 4HAYB 1M7RA 4F7HA 2Q13A 4HAUB 4GXBA 3WA0A 1FAOA 5HE0A 1PMSA 4DX90 2VSZA 3SO6A 5KQ1A 2QKMA 2I5FA 4EJNA 1I7AA 1GG3A 1ZVRA 2J0MA 1XODA 1LW3A 1PLSA 1I2HA 4HB4B 1V61A 3HK0A 3O96A 3D8DA 3X23A 2CY5A 1W1DA 1XCGA 4GMXB 1DDVA 5HE1A 2X18A 4GZUA 5EFXA 2EC1A 5JHHA 3ZDTA 2RNRB 1QQGA 3SYXA 5C79A 2K2UA 2CODA 1DDWA 4MT7A 1AQCA 2DYNA 1U29A 2D2QA 4K17A 2Y8GA 4HDOA 4HAWB 2YSZA 1XKEA 2D9VA 2DTCA 2W2XD 3LJUX 2M38A 1FHWA 2R09A 4GN1A 4XWXA 2LYDA 1RRPB 5DHFB 1FOEA 1MPHA 2UZRA 1UEFA 1BTNA 2D9WA 4KVGB 3DXDA 2MFQA 3AU5A 3NSUA 2H7DA 1FHXA 2LOZA 1MK7B 3UZTA 1WGUA 4A6KA 1Y5OA 1KI1B 3AU4A 2ELAA 5D3WA 4PQ0A 2Y7BA 4KHOA 1DROA 4WJ7A 2YVCA 1J19A 2Y8FA 3FM8C 2CRFA 2HTHB 1K5GB 3CIKA 3F0WA 5LONB 2LOXA 2DHJA 2NZ8B 3VOQA 3QBVB 1TQZA 1UNPA 3TO1A 1XR0B 3RCPA 2BCJA 4HB3B 4HAXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YT1 A;  4KHB B;  4H8S A;  1V89 A;  2DX5 A;  2N0Y A;  3SV1 A;  4NY0 A;  2P0F A;  3HW2 B;  1OMW A;  2OTX A;  4A5K A;  4F7G A;  1EVH A;  1NTV A;  2DN6 A;  1MAI A;  2ZPY A;  1QC6 A;  5KCV A;  1AWE A;  1U5G A;  1WVH A;  1DDM A;  2MKR A;  5DI9 B;  2D9Z A;  1LB1 A;  5D3X A;  1DBH A;  4DBB A;  1ZM0 A;  2CY4 A;  1Z87 A;  3ULB A;  2VKI A;  3T06 A;  5HE3 A;  5DIF B;  1WJM A;  2D11 A;  1X11 A;  2RVB B;  4DXA B;  5D3V A;  2YS1 A;  3PG7 A;  1W1G A;  4ZRK A;  4DX8 A;  1GC7 A;  2J0J A;  2W2W A;  4GMV A;  2DKP A;  1X86 A;  2I1J A;  1ISN A;  1X1G A;  3PP2 A;  1X05 A;  3TW1 A;  3KY9 A;  2AEH A;  5KQ4 A;  2Z0Q A;  1UNQ A;  1EAZ A;  1PFJ A;  3ML4 A;  3TVV A;  3PSC A;  2MDX A;  2LUL A;  3A8P A;  1V88 A;  4MK0 A;  2YT0 A;  1NU2 A;  2COF A;  4HHV A;  3PVW A;  2XQN M;  1MK9 B;  2M14 A;  2N23 A;  2KCJ A;  2P8V A;  1SHC A;  1MKE A;  2YF0 A;  2R0D A;  3FSS A;  3GYO A;  3VIA A;  4K2O A;  1ZC3 B;  3ZVR A;  3M1I B;  5FI1 A;  3BJI A;  3OAN A;  1WGQ A;  5J3Y A;  1J0W A;  2I1K A;  3AJ4 A;  4KAX B;  1KZ7 A;  2DKQ A;  2L2I A;  4HAV B;  2H7E A;  2GCL A;  2RLO A;  2FJL A;  2G35 A;  2GCJ A;  4HB2 B;  4PNK A;  4TYZ A;  1K5D B;  2PZ1 A;  3CXB B;  4MY6 A;  5C5B B;  2AL6 A;  2D4Q A;  2DYQ A;  2DHI A;  3ODX A;  1KZG A;  1FGZ A;  1H4R A;  4A6F B;  4P7I A;  1B55 A;  4HAZ B;  2COA A;  1E5W A;  4EMO A;  3ODO A;  2RGN B;  2P0H A;  4WVF B;  2ADZ A;  4ZRJ A;  1NI2 A;  2W2X C;  1Q67 A;  2LG1 A;  4KHA A;  5D27 A;  3SNH A;  2YS3 A;  3BIN A;  1RJ2 A;  2D10 A;  1U5D A;  2Z0P A;  2COC A;  2IYB A;  3KRW A;  1NTY A;  1V5M A;  1FB8 A;  4C0A A;  1TJ6 A;  4A6H A;  1UNR A;  4Z2N A;  1U27 A;  3TCA A;  1DYN A;  2Z0O A;  1ZC4 B;  1V5U A;  1ZSQ A;  3QWM A;  2MWN B;  3KZ1 A;  3FEH A;  2RSG A;  3ODW A;  4CHM A;  4NSW A;  1U5E A;  1EF1 A;  1N3H A;  3D8F A;  4WSF A;  1GC6 A;  1MIZ B;  1W1H A;  1Y19 B;  2ROZ B;  5DHA B;  3PVU A;  5D3Y A;  2CAY A;  4EKU A;  3WYF B;  3A98 B;  2DLW A;  3G9W A;  1OY2 A;  2OQB A;  3F5R A;  2V76 A;  3QIJ A;  5GOW B;  3P6A A;  4B6H A;  2JP2 A;  2EMT A;  4A6F A;  1P6S A;  3TFM A;  2DFK A;  4BBK A;  5JP4 A;  5FI0 A;  2D9X A;  2D9Y A;  5JHG A;  1MIX A;  2K2J A;  3KSY A;  3HQC A;  3ULC A;  3IVF A;  3PVL A;  1M7E A;  1BTK A;  1XD4 A;  5HE2 A;  3U7D A;  1IRS A;  1V5P A;  1P3R A;  2ROV A;  5C5B A;  3PZD A;  5CLQ B;  4CYE A;  2KGX B;  1FHO A;  2RUK B;  4Z2M B;  3MPX A;  4GPT B;  2QKL A;  2IFS A;  4HB0 B;  4L6E A;  4YON A;  2KUP A;  3A8Q A;  3DXE A;  4Y94 A;  1U5F A;  2EJ8 A;  2HE7 A;  1WI1 A;  3DXC A;  1P5T A;  3KRX A;  1WJ1 A;  5C16 A;  5L81 A;  2LKO A;  1WG7 A;  3MDB C;  2NMB A;  2EMS A;  5LOP B;  5J3T A;  4F7U P;  5C6R A;  4CHJ A;  4D0N B;  1EGX A;  5DH9 B;  3N7C A;  3V5W A;  1FGY A;  1BAK A;  4YL8 A;  2K00 A;  5CLL B;  3P7Z A;  1OQN A;  3U8Z A;  1U2B A;  4K2P A;  3PEG A;  2E2X A;  2DX1 A;  2P0D A;  2I5C A;  5J3Q A;  4HDQ A;  2DHK A;  2DA0 A;  2UZS A;  2GS0 A;  1SGH A;  1X1F A;  2L1C A;  2J59 M;  4HAT B;  1UPR A;  2J0K A;  2UVM A;  4IFS A;  2YS5 A;  4TKN A;  3D8E A;  4K81 A;  2VRW B;  1UPQ A;  2GJY A;  5JLJ B;  4ZRI A;  4IOY X;  1XX0 A;  3GYP A;  2YRY A;  1BWN A;  1TXD A;  3SUZ A;  4IAP A;  1H10 A;  2ELB A;  4HAY B;  1M7R A;  4F7H A;  2Q13 A;  4HAU B;  4GXB A;  3WA0 A;  1FAO A;  5HE0 A;  1PMS A;  4DX9 0;  2VSZ A;  3SO6 A;  5KQ1 A;  2QKM A;  2I5F A;  4EJN A;  1I7A A;  1GG3 A;  1ZVR A;  2J0M A;  1XOD A;  1LW3 A;  1PLS A;  1I2H A;  4HB4 B;  1V61 A;  3HK0 A;  3O96 A;  3D8D A;  3X23 A;  2CY5 A;  1W1D A;  1XCG A;  4GMX B;  1DDV A;  5HE1 A;  2X18 A;  4GZU A;  5EFX A;  2EC1 A;  5JHH A;  3ZDT A;  2RNR B;  1QQG A;  3SYX A;  5C79 A;  2K2U A;  2COD A;  1DDW A;  4MT7 A;  1AQC A;  2DYN A;  1U29 A;  2D2Q A;  4K17 A;  2Y8G A;  4HDO A;  4HAW B;  2YSZ A;  1XKE A;  2D9V A;  2DTC A;  2W2X D;  3LJU X;  2M38 A;  1FHW A;  2R09 A;  4GN1 A;  4XWX A;  2LYD A;  1RRP B;  5DHF B;  1FOE A;  1MPH A;  2UZR A;  1UEF A;  1BTN A;  2D9W A;  4KVG B;  3DXD A;  2MFQ A;  3AU5 A;  3NSU A;  2H7D A;  1FHX A;  2LOZ A;  1MK7 B;  3UZT A;  1WGU A;  4A6K A;  1Y5O A;  1KI1 B;  3AU4 A;  2ELA A;  5D3W A;  4PQ0 A;  2Y7B A;  4KHO A;  1DRO A;  4WJ7 A;  2YVC A;  1J19 A;  2Y8F A;  3FM8 C;  2CRF A;  2HTH B;  1K5G B;  3CIK A;  3F0W A;  5LON B;  2LOX A;  2DHJ A;  2NZ8 B;  3VOQ A;  3QBV B;  1TQZ A;  1UNP A;  3TO1 A;  1XR0 B;  3RCP A;  2BCJ A;  4HB3 B;  4HAX B; 
#chains in the Genus database with same CATH topology
 2YT1 A;  4KHB B;  4H8S A;  1V89 A;  2DX5 A;  2N0Y A;  3SV1 A;  1MI1 A;  4NY0 A;  2P0F A;  3HW2 B;  1OMW A;  2OTX A;  4A5K A;  4F7G A;  1EVH A;  2KIG A;  1NTV A;  2DN6 A;  1MAI A;  3U12 A;  2ZPY A;  1QC6 A;  5KCV A;  1AWE A;  1U5G A;  1WVH A;  1DDM A;  2MKR A;  5DI9 B;  2ZKM X;  2D9Z A;  1LB1 A;  5D3X A;  1DBH A;  4DBB A;  1ZM0 A;  2CY4 A;  1Z87 A;  3ULB A;  2VKI A;  3T06 A;  5HE3 A;  5DIF B;  1WJM A;  2D11 A;  1X11 A;  2RVB B;  4DXA B;  5D3V A;  2YS1 A;  3PG7 A;  1W1G A;  4ZRK A;  3NWD A;  4DX8 A;  1GC7 A;  2J0J A;  2W2W A;  4GMV A;  2DKP A;  2YT2 A;  1X86 A;  2Z13 A;  2I1J A;  1ISN A;  1X1G A;  3PP2 A;  1X05 A;  3TW1 A;  3KY9 A;  2AEH A;  5KQ4 A;  2Z0Q A;  1UNQ A;  1EAZ A;  1PFJ A;  3ML4 A;  3TVV A;  3PSC A;  2MDX A;  2LUL A;  3A8P A;  4CSQ A;  1V88 A;  4MK0 A;  2YT0 A;  1NU2 A;  2KR0 A;  2COF A;  4HHV A;  3PVW A;  2XQN M;  1MK9 B;  2M14 A;  2N23 A;  2KCJ A;  5M4Y B;  2P8V A;  1SHC A;  1MKE A;  3NWF A;  2YF0 A;  2R0D A;  3FSS A;  3GYO A;  3VIA A;  3HSA A;  4K2O A;  1ZC3 B;  3ZVR A;  3M1I B;  2Z59 A;  5FI1 A;  3BJI A;  3OAN A;  5IRS A;  1WGQ A;  5J3Y A;  1J0W A;  2I1K A;  3AJ4 A;  1KZ7 A;  4KAX B;  2DKQ A;  2L2I A;  4HAV B;  2H7E A;  2GCL A;  2RLO A;  4OSN A;  2FJL A;  2G35 A;  2GCJ A;  4HB2 B;  4PNK A;  4TYZ A;  1K5D B;  2PZ1 A;  3CXB B;  4MY6 A;  5C5B B;  2AL6 A;  2D4Q A;  2DYQ A;  2DHI A;  3ODX A;  1KZG A;  1FGZ A;  1H4R A;  4A6F B;  4P7I A;  1B55 A;  4HAZ B;  2COA A;  1E5W A;  4EMO A;  3ODO A;  2RGN B;  2P0H A;  4WVF B;  2ADZ A;  4ZRJ A;  1NI2 A;  2W2X C;  1Q67 A;  2LG1 A;  4KHA A;  5D27 A;  3SNH A;  4D6W A;  2YS3 A;  3BIN A;  1RJ2 A;  3DCX A;  2D10 A;  1U5D A;  2Z0P A;  2COC A;  2IYB A;  3KRW A;  1NTY A;  1V5M A;  1FB8 A;  4C0A A;  1TJ6 A;  4A6H A;  1UNR A;  4Z2N A;  1U27 A;  3TCA A;  2KUQ A;  1DYN A;  2Z0O A;  1ZC4 B;  2KIE A;  1V5U A;  1ZSQ A;  3QWM A;  2MWN B;  3KZ1 A;  3FEH A;  2RSG A;  3ODW A;  4CHM A;  4NSW A;  1U5E A;  1EF1 A;  1N3H A;  3D8F A;  4WSF A;  1GC6 A;  1MIZ B;  1W1H A;  1Y19 B;  2ROZ B;  5DHA B;  3PVU A;  5D3Y A;  2CAY A;  4EKU A;  3WYF B;  3A98 B;  2DLW A;  3G9W A;  1OY2 A;  2OQB A;  3F5R A;  2V76 A;  3QIJ A;  5GOW B;  3P6A A;  4B6H A;  2JP2 A;  2EMT A;  4A6F A;  4OT1 A;  1P6S A;  3TFM A;  2DFK A;  4BBK A;  5JP4 A;  5FI0 A;  2D9X A;  2D9Y A;  5JHG A;  1MIX A;  2K2J A;  3KSY A;  4GOU A;  2K49 A;  3HQC A;  3ULC A;  3IVF A;  3PVL A;  1M7E A;  1BTK A;  1XD4 A;  3FVC A;  5HE2 A;  3U7D A;  1IRS A;  1V5P A;  1P3R A;  2ROV A;  5C5B A;  3PZD A;  5CLQ B;  4CYE A;  2KGX B;  4DIX A;  4HSI A;  1FHO A;  2RUK B;  4Z2M B;  3OHM B;  3MPX A;  4GPT B;  2QKL A;  2IFS A;  4HB0 B;  4L6E A;  4GNK B;  2KUP A;  4YON A;  3A8Q A;  3DXE A;  4Y94 A;  1U5F A;  2EJ8 A;  2HE7 A;  4L1R A;  1WI1 A;  3DXC A;  4QXA B;  2NBV A;  1P5T A;  3KRX A;  1WJ1 A;  5C16 A;  5L81 A;  2LKO A;  1WG7 A;  3MDB C;  2NMB A;  2EMS A;  5LOP B;  5J3T A;  4F7U P;  5C6R A;  4CHJ A;  4D0N B;  1EGX A;  5DH9 B;  3N7C A;  3V5W A;  1FGY A;  1BAK A;  4YL8 A;  2K00 A;  5CLL B;  3P7Z A;  1OQN A;  3U8Z A;  1U2B A;  4K2P A;  3PEG A;  2E2X A;  2DX1 A;  2P0D A;  2I5C A;  5J3Q A;  4HDQ A;  2DHK A;  2DA0 A;  5LG4 B;  2UZS A;  2GS0 A;  1SGH A;  1X1F A;  2L1C A;  2J59 M;  2RRF A;  4HAT B;  1UPR A;  2J0K A;  2UVM A;  4IFS A;  2YS5 A;  4KHB A;  4TKN A;  3D8E A;  4K81 A;  2VRW B;  1UPQ A;  2GJY A;  5JLJ B;  2Z4D A;  4ZRI A;  4IOY X;  1T77 A;  1XX0 A;  3GYP A;  2YRY A;  1BWN A;  1TXD A;  3SUZ A;  4IAP A;  2R2Y A;  1H10 A;  2ELB A;  4HAY B;  1M7R A;  4F7H A;  2Q13 A;  4HAU B;  5I2S A;  4GXB A;  3WA0 A;  1FAO A;  5HE0 A;  1PMS A;  4DX9 0;  2VSZ A;  3SO6 A;  2GUM A;  5KQ1 A;  2QKM A;  2I5F A;  4EJN A;  1I7A A;  1GG3 A;  1ZVR A;  2J0M A;  1XOD A;  1LW3 A;  1PLS A;  1I2H A;  4HB4 B;  1V61 A;  3HK0 A;  3O96 A;  3D8D A;  3HIE A;  2CY5 A;  3X23 A;  1W1D A;  1XCG A;  4GMX B;  1DDV A;  5HE1 A;  2Z14 A;  2FJU B;  2X18 A;  4GZU A;  5EFX A;  2EC1 A;  5JHH A;  3ZDT A;  2RNR B;  2K8E A;  1QQG A;  3SYX A;  5C79 A;  3NW8 A;  2K2U A;  2COD A;  1DDW A;  3NWA A;  4MT7 A;  1AQC A;  2DYN A;  1U29 A;  2D2Q A;  1ZYI A;  4K17 A;  2Y8G A;  4HDO A;  4HAW B;  2YSZ A;  1XKE A;  2D9V A;  2DTC A;  2W2X D;  3A58 A;  3LJU X;  5I2M A;  2M38 A;  1FHW A;  2R09 A;  4QJ5 B;  4GN1 A;  4XWX A;  2LYD A;  1RRP B;  5DHF B;  1FOE A;  1MPH A;  2UZR A;  1UEF A;  1BTN A;  2D9W A;  4KVG B;  3DXD A;  2MFQ A;  3AU5 A;  3NSU A;  2H7D A;  1FHX A;  2LOZ A;  1MK7 B;  3UZT A;  1WGU A;  4A6K A;  1Y5O A;  1KI1 B;  3AU4 A;  2ELA A;  5D3W A;  4PQ0 A;  2Y7B A;  4KHO A;  1DRO A;  4WJ7 A;  2YVC A;  1J19 A;  2Y8F A;  3FM8 C;  2CRF A;  2HTH B;  1K5G B;  3CIK A;  3F0W A;  5LON B;  2LOX A;  2DHJ A;  2NZ8 B;  3VOQ A;  3QBV B;  4QJ4 B;  1TQZ A;  4QJ3 B;  1UNP A;  3TO1 A;  1XR0 B;  3RCP A;  3B77 A;  2BCJ A;  4HB3 B;  4HAX B; 
#chains in the Genus database with same CATH homology
 2YT1 A;  4KHB B;  4H8S A;  1V89 A;  2DX5 A;  2N0Y A;  3SV1 A;  4NY0 A;  2P0F A;  3HW2 B;  1OMW A;  2OTX A;  4A5K A;  4F7G A;  1EVH A;  1NTV A;  2DN6 A;  1MAI A;  2ZPY A;  1QC6 A;  5KCV A;  1AWE A;  1U5G A;  1WVH A;  1DDM A;  2MKR A;  5DI9 B;  2D9Z A;  1LB1 A;  5D3X A;  1DBH A;  4DBB A;  1ZM0 A;  2CY4 A;  1Z87 A;  3ULB A;  2VKI A;  3T06 A;  5HE3 A;  5DIF B;  1WJM A;  2D11 A;  1X11 A;  2RVB B;  4DXA B;  5D3V A;  2YS1 A;  3PG7 A;  1W1G A;  4ZRK A;  4DX8 A;  1GC7 A;  2J0J A;  2W2W A;  4GMV A;  2DKP A;  1X86 A;  2I1J A;  1ISN A;  1X1G A;  3PP2 A;  1X05 A;  3TW1 A;  3KY9 A;  2AEH A;  5KQ4 A;  2Z0Q A;  1UNQ A;  1EAZ A;  1PFJ A;  3ML4 A;  3TVV A;  3PSC A;  2MDX A;  2LUL A;  3A8P A;  1V88 A;  4MK0 A;  2YT0 A;  1NU2 A;  2COF A;  4HHV A;  3PVW A;  2XQN M;  1MK9 B;  2M14 A;  2N23 A;  2KCJ A;  2P8V A;  1SHC A;  1MKE A;  2YF0 A;  2R0D A;  3FSS A;  3GYO A;  3VIA A;  4K2O A;  1ZC3 B;  3ZVR A;  3M1I B;  5FI1 A;  3BJI A;  3OAN A;  1WGQ A;  5J3Y A;  1J0W A;  2I1K A;  3AJ4 A;  4KAX B;  1KZ7 A;  2DKQ A;  2L2I A;  4HAV B;  2H7E A;  2GCL A;  2RLO A;  2FJL A;  2G35 A;  2GCJ A;  4HB2 B;  4PNK A;  4TYZ A;  1K5D B;  2PZ1 A;  3CXB B;  4MY6 A;  5C5B B;  2AL6 A;  2D4Q A;  2DYQ A;  2DHI A;  3ODX A;  1KZG A;  1FGZ A;  1H4R A;  4A6F B;  4P7I A;  1B55 A;  4HAZ B;  2COA A;  1E5W A;  4EMO A;  3ODO A;  2RGN B;  2P0H A;  4WVF B;  2ADZ A;  4ZRJ A;  1NI2 A;  2W2X C;  1Q67 A;  2LG1 A;  4KHA A;  5D27 A;  3SNH A;  2YS3 A;  3BIN A;  1RJ2 A;  2D10 A;  1U5D A;  2Z0P A;  2COC A;  2IYB A;  3KRW A;  1NTY A;  1V5M A;  1FB8 A;  4C0A A;  1TJ6 A;  4A6H A;  1UNR A;  4Z2N A;  1U27 A;  3TCA A;  1DYN A;  2Z0O A;  1ZC4 B;  1V5U A;  1ZSQ A;  3QWM A;  2MWN B;  3KZ1 A;  3FEH A;  2RSG A;  3ODW A;  4CHM A;  4NSW A;  1U5E A;  1EF1 A;  1N3H A;  3D8F A;  4WSF A;  1GC6 A;  1MIZ B;  1W1H A;  1Y19 B;  2ROZ B;  5DHA B;  3PVU A;  5D3Y A;  2CAY A;  4EKU A;  3WYF B;  3A98 B;  2DLW A;  3G9W A;  1OY2 A;  2OQB A;  3F5R A;  2V76 A;  3QIJ A;  5GOW B;  3P6A A;  4B6H A;  2JP2 A;  2EMT A;  4A6F A;  1P6S A;  3TFM A;  2DFK A;  4BBK A;  5JP4 A;  5FI0 A;  2D9X A;  2D9Y A;  5JHG A;  1MIX A;  2K2J A;  3KSY A;  3HQC A;  3ULC A;  3IVF A;  3PVL A;  1M7E A;  1BTK A;  1XD4 A;  5HE2 A;  3U7D A;  1IRS A;  1V5P A;  1P3R A;  2ROV A;  5C5B A;  3PZD A;  5CLQ B;  4CYE A;  2KGX B;  1FHO A;  2RUK B;  4Z2M B;  3MPX A;  4GPT B;  2QKL A;  2IFS A;  4HB0 B;  4L6E A;  4YON A;  2KUP A;  3A8Q A;  3DXE A;  4Y94 A;  1U5F A;  2EJ8 A;  2HE7 A;  1WI1 A;  3DXC A;  1P5T A;  3KRX A;  1WJ1 A;  5C16 A;  5L81 A;  2LKO A;  1WG7 A;  3MDB C;  2NMB A;  2EMS A;  5LOP B;  5J3T A;  4F7U P;  5C6R A;  4CHJ A;  4D0N B;  1EGX A;  5DH9 B;  3N7C A;  3V5W A;  1FGY A;  1BAK A;  4YL8 A;  2K00 A;  5CLL B;  3P7Z A;  1OQN A;  3U8Z A;  1U2B A;  4K2P A;  3PEG A;  2E2X A;  2DX1 A;  2P0D A;  2I5C A;  5J3Q A;  4HDQ A;  2DHK A;  2DA0 A;  2UZS A;  2GS0 A;  1SGH A;  1X1F A;  2L1C A;  2J59 M;  4HAT B;  1UPR A;  2J0K A;  2UVM A;  4IFS A;  2YS5 A;  4TKN A;  3D8E A;  4K81 A;  2VRW B;  1UPQ A;  2GJY A;  5JLJ B;  4ZRI A;  4IOY X;  1XX0 A;  3GYP A;  2YRY A;  1BWN A;  1TXD A;  3SUZ A;  4IAP A;  1H10 A;  2ELB A;  4HAY B;  1M7R A;  4F7H A;  2Q13 A;  4HAU B;  4GXB A;  3WA0 A;  1FAO A;  5HE0 A;  1PMS A;  4DX9 0;  2VSZ A;  3SO6 A;  5KQ1 A;  2QKM A;  2I5F A;  4EJN A;  1I7A A;  1GG3 A;  1ZVR A;  2J0M A;  1XOD A;  1LW3 A;  1PLS A;  1I2H A;  4HB4 B;  1V61 A;  3HK0 A;  3O96 A;  3D8D A;  3X23 A;  2CY5 A;  1W1D A;  1XCG A;  4GMX B;  1DDV A;  5HE1 A;  2X18 A;  4GZU A;  5EFX A;  2EC1 A;  5JHH A;  3ZDT A;  2RNR B;  1QQG A;  3SYX A;  5C79 A;  2K2U A;  2COD A;  1DDW A;  4MT7 A;  1AQC A;  2DYN A;  1U29 A;  2D2Q A;  4K17 A;  2Y8G A;  4HDO A;  4HAW B;  2YSZ A;  1XKE A;  2D9V A;  2DTC A;  2W2X D;  3LJU X;  2M38 A;  1FHW A;  2R09 A;  4GN1 A;  4XWX A;  2LYD A;  1RRP B;  5DHF B;  1FOE A;  1MPH A;  2UZR A;  1UEF A;  1BTN A;  2D9W A;  4KVG B;  3DXD A;  2MFQ A;  3AU5 A;  3NSU A;  2H7D A;  1FHX A;  2LOZ A;  1MK7 B;  3UZT A;  1WGU A;  4A6K A;  1Y5O A;  1KI1 B;  3AU4 A;  2ELA A;  5D3W A;  4PQ0 A;  2Y7B A;  4KHO A;  1DRO A;  4WJ7 A;  2YVC A;  1J19 A;  2Y8F A;  3FM8 C;  2CRF A;  2HTH B;  1K5G B;  3CIK A;  3F0W A;  5LON B;  2LOX A;  2DHJ A;  2NZ8 B;  3VOQ A;  3QBV B;  1TQZ A;  1UNP A;  3TO1 A;  1XR0 B;  3RCP A;  2BCJ A;  4HB3 B;  4HAX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...