2QKMA

The crystal structure of fission yeast mrna decapping enzyme dcp1-dcp2 complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
127
structure length
123
Chain Sequence
MEDENILRNAVNLQVLKFHYPEIESIIDIASHVAVYQFDKWLKTSIEGTFFLVKDQRARVGYVILNRNSPENLYLFINHPSNVHLVDRYLIHRTENQHVVGLWMFDPNDMSRIFNIVKESLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords SPBC3B9.21 protein
publication title Structural basis of dcp2 recognition and activation by dcp1.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 32
structure length 123
sequence length 127
chains with identical sequence C, E, G
ec nomenclature ec 3.6.1.30: Transferred entry: 3.6.1.59 and 3.6.1.62.
pdb deposition date 2007-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2qkmA00
4KVGB 1TQZA 1GG3A 1ZM0A 5D3XA 5DH9B 4YONA 1K5GB 1V61A 1WJMA 2JP2A 1QC6A 5C6RA 5HE2A 2CAYA 4CHJA 4HAVB 4WSFA 2DFKA 5C79A 3ODWA 4XWXA 1XKEA 1MPHA 5HE0A 2CRFA 5JLJB 1J19A 1GC6A 2DHKA 3QBVB 1V88A 4GZUA 3PVLA 1X1GA 4HHVA 2D4QA 2J0KA 1J0WA 3SNHA 2RNRB 5L81A 1MK7B 3WYFB 2UZRA 2I5CA 3A8QA 5GOWB 2LYDA 4IOYX 4CYEA 1DDVA 1UPQA 1XX0A 5EFXA 3G9WA 2N0YA 4HAUB 4D0NB 2DHIA 1MK9B 2J0JA 2ADZA 4BBKA 1WVHA 4ZRKA 2EMTA 4HAYB 4A6HA 2Z0OA 2D9WA 4HDQA 2N23A 1KZGA 1P6SA 1U5FA 1XODA 5JP4A 3QWMA 2GS0A 3P7ZA 2GCJA 2EC1A 3DXCA 3LJUX 3VIAA 4Z2NA 2D2QA 2Y7BA 4EMOA 1PMSA 3U7DA 1V89A 2E2XA 2LOXA 2DA0A 4HAWB 1WGQA 1FOEA 4EJNA 2VKIA 1ZC3B 2DX5A 1EF1A 1FGZA 4KHAA 1X1FA 1GC7A 4K2PA 4KAXB 2DX1A 2HE7A 2MDXA 2DTCA 4DBBA 4YL8A 2D10A 2MWNB 4ZRJA 2AL6A 4MT7A 4Y94A 5J3YA 3AU5A 2YVCA 2W2WA 2BCJA 3IVFA 3BJIA 1M7EA 3F5RA 1UNRA 3GYPA 1ZVRA 2I1JA 1MKEA 4K81A 1MIZB 3CIKA 3KZ1A 1E5WA 4MY6A 2FJLA 3U8ZA 4DX90 2Q13A 1AWEA 1FGYA 2CODA 4F7HA 1V5MA 2J0MA 2LULA 2RSGA 4K2OA 4HB0B 2MFQA 1OQNA 2L2IA 2YRYA 1XR0B 1W1GA 2YSZA 5DIFB 2M14A 3TW1A 1DDMA 4PNKA 5C16A 3NSUA 1FHOA 4GMXB 1X05A 1X86A 3TVVA 4KHBB 1EGXA 1FHWA 1NTYA 3KRXA 1I7AA 2DLWA 4IAPA 4C0AA 2YS1A 2VSZA 4P7IA 2I5FA 1WGUA 2DYNA 1Y5OA 1Z87A 1KI1B 1W1DA 4HAXB 1XD4A 2D9YA 1NU2A 1K5DB 5CLLB 1U5EA 2LKOA 2MKRA 1Q67A 5DHFB 2UZSA 2Y8GA 3VOQA 1BTKA 3RCPA 5C5BA 4IFSA 1BWNA 2DKQA 3MPXA 2DYQA 2Z0PA 5JHHA 3KY9A 1DBHA 3CXBB 1FB8A 2UVMA 2RLOA 1QQGA 3OANA 1Y19B 4GMVA 4MK0A 2PZ1A 4EKUA 3SYXA 4GXBA 2ROVA 2GCLA 3A98B 3FM8C 4A6FA 3HK0A 3SV1A 3V5WA 2RVBB 1UEFA 2G35A 2IFSA 2OTXA 2Z0QA 5LONB 2RGNB 4WVFB 2YT1A 2D9XA 4F7GA 3FSSA 1BTNA 3KSYA 3PSCA 2KCJA 4Z2MB 1H4RA 3PP2A 2KGXB 2YF0A 3TO1A 5HE3A 3F0WA 1B55A 3PG7A 5D3VA 1SGHA 2YS5A 2EJ8A 2M38A 4DX8A 5C5BB 1UNQA 2QKLA 4GN1A 4NSWA 4HAZB 1TXDA 2L1CA 4ZRIA 2CY4A 3N7CA 3ULCA 1NTVA 1DROA 2H7EA 4HB3B 2I1KA 5KQ4A 4TYZA 4F7UP 2AEHA 2W2XC 3QIJA 4A6FB 4DXAB 2XQNM 2VRWB 3UZTA 2GJYA 1BAKA 1U5DA 1PFJA 3PEGA 4GPTB 1PLSA 1UNPA 2D11A 2KUPA 4K17A 3ULBA 4KHOA 1LB1A 2D9ZA 3P6AA 1U2BA 5LOPB 1W1HA 5DI9B 1DYNA 2ZPYA 3A8PA 1IRSA 1EAZA 1N3HA 3GYOA 3ODOA 1WJ1A 1U27A 3X23A 3DXDA 2P0DA 3FEHA 3TCAA 2YT0A 1U5GA 2R09A 2YS3A 5D3WA 4A6KA 2K2UA 4HB4B 1FAOA 1P3RA 4CHMA 4HB2B 3HW2B 5J3TA 2HTHB 1X11A 1NI2A 2CY5A 3ML4A 4HDOA 4L6EA 5J3QA 2ROZB 2LOZA 1RRPB 2EMSA 2COAA 5D3YA 4TKNA 3TFMA 3ODXA 1MAIA 3BINA 5FI1A 1OMWA 4NY0A 5D27A 1EVHA 2LG1A 5FI0A 1M7RA 2H7DA 4A5KA 2DN6A 1DDWA 1I2HA 1LW3A 2DHJA 3D8EA 3PZDA 4PQ0A 3M1IB 2ELAA 1AQCA 2DKPA 1ZSQA 1WI1A 2Y8FA 3DXEA 1H10A 1SHCA 1UPRA 3WA0A 3O96A 4B6HA 1V5PA 1KZ7A 5KCVA 1P5TA 2P8VA 2V76A 2ELBA 5DHAB 4WJ7A 5HE1A 2COCA 1ZC4B 2P0FA 3AJ4A 2W2XD 2J59M 3ZDTA 2K2JA 3KRWA 4H8SA 1V5UA 3AU4A 3D8DA 3D8FA 2OQBA 5CLQB 1WG7A 1U29A 5JHGA 1MIXA 3T06A 2D9VA 4HATB 2R0DA 1FHXA 1RJ2A 2QKMA 3HQCA 3ZVRA 3SUZA 1ISNA 3MDBC 2IYBA 2NZ8B 5KQ1A 3SO6A 2NMBA 1OY2A 1XCGA 3PVWA 3PVUA 2RUKB 2P0HA 1TJ6A 2K00A 2X18A 2COFA
chains in the Genus database with same CATH superfamily
4KVGB 5I2MA 1TQZA 1GG3A 1ZM0A 5D3XA 5DH9B 3NWAA 4YONA 1K5GB 1V61A 1WJMA 2JP2A 1QC6A 5C6RA 5HE2A 2CAYA 4CHJA 4HAVB 4WSFA 2DFKA 5C79A 3ODWA 4XWXA 4HSIA 1XKEA 1MPHA 4OSNA 5HE0A 3NWFA 2CRFA 5JLJB 3NW8A 1J19A 1GC6A 2DHKA 3QBVB 1V88A 4GZUA 3PVLA 1X1GA 4HHVA 2D4QA 2J0KA 1J0WA 3SNHA 4L1RA 2RNRB 5L81A 1MK7B 3WYFB 2UZRA 2I5CA 3A8QA 2COFA 5GOWB 2LYDA 4IOYX 4CYEA 1DDVA 1UPQA 1XX0A 4QJ3B 5EFXA 3G9WA 2N0YA 4HAUB 3OHMB 4D0NB 2DHIA 1MK9B 2J0JA 2ADZA 4BBKA 1WVHA 4ZRKA 2EMTA 4HAYB 2Z13A 4A6HA 2Z0OA 2D9WA 4HDQA 2N23A 1KZGA 1P6SA 1U5FA 1XODA 5JP4A 3QWMA 2GS0A 3P7ZA 2GCJA 2EC1A 3DXCA 3LJUX 3VIAA 4Z2NA 2D2QA 2Y7BA 4EMOA 1PMSA 3U7DA 1V89A 2E2XA 2LOXA 2DA0A 4QXAB 4HAWB 3B77A 1WGQA 1FOEA 4EJNA 2VKIA 2KR0A 1ZC3B 2DX5A 1EF1A 1FGZA 4KHAA 1X1FA 1GC7A 4K2PA 4KAXB 2DX1A 2HE7A 3U12A 2MDXA 2DTCA 4DBBA 4YL8A 2D10A 2MWNB 4ZRJA 2AL6A 4MT7A 4Y94A 4QJ5B 5J3YA 3AU5A 4KHBA 2YVCA 2W2WA 2BCJA 3IVFA 2Z59A 3BJIA 1M7EA 3F5RA 1UNRA 3GYPA 2KIGA 1ZVRA 2I1JA 1MKEA 4K81A 4CSQA 1MIZB 3CIKA 3KZ1A 1E5WA 4MY6A 2FJLA 3U8ZA 4DX90 2Q13A 1AWEA 1FGYA 2CODA 4F7HA 1V5MA 2J0MA 2LULA 2RSGA 4K2OA 4HB0B 2MFQA 1OQNA 2L2IA 2YRYA 1XR0B 1W1GA 2YSZA 5DIFB 5M4YB 2M14A 1MI1A 3TW1A 1DDMA 4PNKA 3NWDA 5C16A 3NSUA 1FHOA 4GMXB 1X05A 1X86A 3TVVA 4KHBB 1EGXA 1FHWA 4OT1A 1NTYA 2K49A 3KRXA 1I7AA 2DLWA 4IAPA 2R2YA 4C0AA 2YS1A 2VSZA 4P7IA 2I5FA 1WGUA 2DYNA 1Y5OA 1Z87A 1KI1B 1W1DA 4HAXB 1XD4A 2D9YA 5LG4B 1NU2A 1K5DB 5CLLB 1U5EA 2LKOA 2YT2A 2MKRA 1Q67A 5DHFB 2UZSA 2Y8GA 3VOQA 1BTKA 3RCPA 2KUQA 5C5BA 4IFSA 1BWNA 2DKQA 3MPXA 2DYQA 2Z0PA 5JHHA 3KY9A 1DBHA 3CXBB 1FB8A 2UVMA 2RLOA 1QQGA 3OANA 1Y19B 4GMVA 4MK0A 2PZ1A 4GOUA 4EKUA 3SYXA 3FVCA 4GXBA 2ROVA 2GCLA 3A98B 3FM8C 4A6FA 3HK0A 3SV1A 3V5WA 2RVBB 1UEFA 2G35A 2IFSA 2OTXA 2Z0QA 5LONB 2RRFA 2RGNB 4WVFB 2YT1A 2D9XA 4F7GA 3FSSA 1BTNA 3KSYA 3PSCA 2KCJA 4Z2MB 1H4RA 3PP2A 2KGXB 2YF0A 3TO1A 5HE3A 3F0WA 1B55A 3PG7A 5D3VA 1SGHA 2YS5A 2EJ8A 2M38A 4DX8A 2Z14A 5C5BB 1UNQA 2QKLA 4GN1A 4NSWA 4HAZB 1TXDA 2L1CA 4ZRIA 2CY4A 3N7CA 3ULCA 1NTVA 1DROA 2H7EA 4HB3B 2I1KA 5KQ4A 4TYZA 4F7UP 2AEHA 2W2XC 3QIJA 4A6FB 4DXAB 2XQNM 2VRWB 3UZTA 2GJYA 1BAKA 1U5DA 5I2SA 1PFJA 3PEGA 4GPTB 1PLSA 1UNPA 2D11A 2GUMA 2KUPA 4K17A 3ULBA 4KHOA 1LB1A 2D9ZA 3P6AA 1U2BA 5LOPB 1W1HA 5DI9B 1DYNA 2ZPYA 3A8PA 1IRSA 1EAZA 1N3HA 3GYOA 2ZKMX 3ODOA 1WJ1A 1U27A 3X23A 2P0DA 3DXDA 3FEHA 3TCAA 4QJ4B 2YT0A 1U5GA 2R09A 2YS3A 5D3WA 4A6KA 2K2UA 4HB4B 5IRSA 1FAOA 1P3RA 4CHMA 4HB2B 3HW2B 5J3TA 2K8EA 2HTHB 1X11A 4GNKB 1NI2A 2CY5A 3ML4A 4HDOA 4L6EA 5J3QA 2ROZB 1T77A 2LOZA 1RRPB 3HIEA 2EMSA 2COAA 5D3YA 4TKNA 4DIXA 3TFMA 3ODXA 1MAIA 3BINA 5FI1A 1OMWA 4NY0A 5D27A 1EVHA 2FJUB 2LG1A 5FI0A 1M7RA 2H7DA 4A5KA 2DN6A 1DDWA 3DCXA 2Z4DA 1I2HA 1LW3A 2DHJA 3D8EA 3PZDA 1ZYIA 4PQ0A 3M1IB 2ELAA 1AQCA 2DKPA 1ZSQA 1WI1A 2Y8FA 3DXEA 1H10A 1SHCA 1UPRA 3HSAA 3WA0A 3O96A 4B6HA 1V5PA 1KZ7A 5KCVA 3A58A 1P5TA 2P8VA 2V76A 2ELBA 5DHAB 4WJ7A 5HE1A 2COCA 1ZC4B 2P0FA 3AJ4A 2W2XD 2J59M 3ZDTA 2K2JA 3KRWA 4H8SA 1V5UA 3AU4A 3D8DA 3D8FA 2NBVA 2OQBA 5CLQB 1WG7A 1U29A 5JHGA 1MIXA 3T06A 2D9VA 4HATB 2R0DA 1FHXA 1RJ2A 2QKMA 3HQCA 3ZVRA 3SUZA 1ISNA 3MDBC 2IYBA 2NZ8B 5KQ1A 3SO6A 2NMBA 1OY2A 1XCGA 3PVWA 4D6WA 3PVUA 2RUKB 2P0HA 1TJ6A 2K00A 2X18A 2KIEA
chains in the Genus database with same CATH topology
4KVGB 1TQZA 1GG3A 1ZM0A 5D3XA 5DH9B 4YONA 1K5GB 1V61A 1WJMA 2JP2A 1QC6A 5C6RA 5HE2A 2CAYA 4CHJA 4HAVB 4WSFA 2DFKA 5C79A 3ODWA 4XWXA 1XKEA 1MPHA 5HE0A 2CRFA 5JLJB 1J19A 1GC6A 2DHKA 3QBVB 1V88A 4GZUA 3PVLA 1X1GA 4HHVA 2D4QA 2J0KA 1J0WA 3SNHA 2RNRB 5L81A 1MK7B 3WYFB 2UZRA 2I5CA 3A8QA 5GOWB 2LYDA 4IOYX 4CYEA 1DDVA 1UPQA 1XX0A 5EFXA 3G9WA 2N0YA 4HAUB 4D0NB 2DHIA 1MK9B 2J0JA 2ADZA 4BBKA 1WVHA 4ZRKA 2EMTA 4HAYB 4A6HA 2Z0OA 2D9WA 4HDQA 2N23A 1KZGA 1P6SA 1U5FA 1XODA 5JP4A 3QWMA 2GS0A 3P7ZA 2GCJA 2EC1A 3DXCA 3LJUX 3VIAA 4Z2NA 2D2QA 2Y7BA 4EMOA 1PMSA 3U7DA 1V89A 2E2XA 2LOXA 2DA0A 4HAWB 1WGQA 1FOEA 4EJNA 2VKIA 1ZC3B 2DX5A 1EF1A 1FGZA 4KHAA 1X1FA 1GC7A 4K2PA 4KAXB 2DX1A 2HE7A 2MDXA 2DTCA 4DBBA 4YL8A 2D10A 2MWNB 4ZRJA 2AL6A 4MT7A 4Y94A 5J3YA 3AU5A 2YVCA 2W2WA 2BCJA 3IVFA 3BJIA 1M7EA 3F5RA 1UNRA 3GYPA 1ZVRA 2I1JA 1MKEA 4K81A 1MIZB 3CIKA 3KZ1A 1E5WA 4MY6A 2FJLA 3U8ZA 4DX90 2Q13A 1AWEA 1FGYA 2CODA 4F7HA 1V5MA 2J0MA 2LULA 2RSGA 4K2OA 4HB0B 2MFQA 1OQNA 2L2IA 2YRYA 1XR0B 1W1GA 2YSZA 5DIFB 2M14A 3TW1A 1DDMA 4PNKA 5C16A 3NSUA 1FHOA 4GMXB 1X05A 1X86A 3TVVA 4KHBB 1EGXA 1FHWA 1NTYA 3KRXA 1I7AA 2DLWA 4IAPA 4C0AA 2YS1A 2VSZA 4P7IA 2I5FA 1WGUA 2DYNA 1Y5OA 1Z87A 1KI1B 1W1DA 4HAXB 1XD4A 2D9YA 1NU2A 1K5DB 5CLLB 1U5EA 2LKOA 2MKRA 1Q67A 5DHFB 2UZSA 2Y8GA 3VOQA 1BTKA 3RCPA 5C5BA 4IFSA 1BWNA 2DKQA 3MPXA 2DYQA 2Z0PA 5JHHA 3KY9A 1DBHA 3CXBB 1FB8A 2UVMA 2RLOA 1QQGA 3OANA 1Y19B 4GMVA 4MK0A 2PZ1A 4EKUA 3SYXA 4GXBA 2ROVA 2GCLA 3A98B 3FM8C 4A6FA 3HK0A 3SV1A 3V5WA 2RVBB 1UEFA 2G35A 2IFSA 2OTXA 2Z0QA 5LONB 2RGNB 4WVFB 2YT1A 2D9XA 4F7GA 3FSSA 1BTNA 3KSYA 3PSCA 2KCJA 4Z2MB 1H4RA 3PP2A 2KGXB 2YF0A 3TO1A 5HE3A 3F0WA 1B55A 3PG7A 5D3VA 1SGHA 2YS5A 2EJ8A 2M38A 4DX8A 5C5BB 1UNQA 2QKLA 4GN1A 4NSWA 4HAZB 1TXDA 2L1CA 4ZRIA 2CY4A 3N7CA 3ULCA 1NTVA 1DROA 2H7EA 4HB3B 2I1KA 5KQ4A 4TYZA 4F7UP 2AEHA 2W2XC 3QIJA 4A6FB 4DXAB 2XQNM 2VRWB 3UZTA 2GJYA 1BAKA 1U5DA 1PFJA 3PEGA 4GPTB 1PLSA 1UNPA 2D11A 2KUPA 4K17A 3ULBA 4KHOA 1LB1A 2D9ZA 3P6AA 1U2BA 5LOPB 1W1HA 5DI9B 1DYNA 2ZPYA 3A8PA 1IRSA 1EAZA 1N3HA 3GYOA 3ODOA 1WJ1A 1U27A 3X23A 3DXDA 2P0DA 3FEHA 3TCAA 2YT0A 1U5GA 2R09A 2YS3A 5D3WA 4A6KA 2K2UA 4HB4B 1FAOA 1P3RA 4CHMA 4HB2B 3HW2B 5J3TA 2HTHB 1X11A 1NI2A 2CY5A 3ML4A 4HDOA 4L6EA 5J3QA 2ROZB 2LOZA 1RRPB 2EMSA 2COAA 5D3YA 4TKNA 3TFMA 3ODXA 1MAIA 3BINA 5FI1A 1OMWA 4NY0A 5D27A 1EVHA 2LG1A 5FI0A 1M7RA 2H7DA 4A5KA 2DN6A 1DDWA 1I2HA 1LW3A 2DHJA 3D8EA 3PZDA 4PQ0A 3M1IB 2ELAA 1AQCA 2DKPA 1ZSQA 1WI1A 2Y8FA 3DXEA 1H10A 1SHCA 1UPRA 3WA0A 3O96A 4B6HA 1V5PA 1KZ7A 5KCVA 1P5TA 2P8VA 2V76A 2ELBA 5DHAB 4WJ7A 5HE1A 2COCA 1ZC4B 2P0FA 3AJ4A 2W2XD 2J59M 3ZDTA 2K2JA 3KRWA 4H8SA 1V5UA 3AU4A 3D8DA 3D8FA 2OQBA 5CLQB 1WG7A 1U29A 5JHGA 1MIXA 3T06A 2D9VA 4HATB 2R0DA 1FHXA 1RJ2A 2QKMA 3HQCA 3ZVRA 3SUZA 1ISNA 3MDBC 2IYBA 2NZ8B 5KQ1A 3SO6A 2NMBA 1OY2A 1XCGA 3PVWA 3PVUA 2RUKB 2P0HA 1TJ6A 2K00A 2X18A 2COFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KVG B;  1TQZ A;  1GG3 A;  1ZM0 A;  5D3X A;  5DH9 B;  4YON A;  1K5G B;  1V61 A;  1WJM A;  2JP2 A;  1QC6 A;  5C6R A;  5HE2 A;  2CAY A;  4CHJ A;  4HAV B;  4WSF A;  2DFK A;  5C79 A;  3ODW A;  4XWX A;  1XKE A;  1MPH A;  5HE0 A;  2CRF A;  5JLJ B;  1J19 A;  1GC6 A;  2DHK A;  3QBV B;  1V88 A;  4GZU A;  3PVL A;  1X1G A;  4HHV A;  2D4Q A;  2J0K A;  1J0W A;  3SNH A;  2RNR B;  5L81 A;  1MK7 B;  3WYF B;  2UZR A;  2I5C A;  3A8Q A;  5GOW B;  2LYD A;  4IOY X;  4CYE A;  1DDV A;  1UPQ A;  1XX0 A;  5EFX A;  3G9W A;  2N0Y A;  4HAU B;  4D0N B;  2DHI A;  1MK9 B;  2J0J A;  2ADZ A;  4BBK A;  1WVH A;  4ZRK A;  2EMT A;  4HAY B;  4A6H A;  2Z0O A;  2D9W A;  4HDQ A;  2N23 A;  1KZG A;  1P6S A;  1U5F A;  1XOD A;  5JP4 A;  3QWM A;  2GS0 A;  3P7Z A;  2GCJ A;  2EC1 A;  3DXC A;  3LJU X;  3VIA A;  4Z2N A;  2D2Q A;  2Y7B A;  4EMO A;  1PMS A;  3U7D A;  1V89 A;  2E2X A;  2LOX A;  2DA0 A;  4HAW B;  1WGQ A;  1FOE A;  4EJN A;  2VKI A;  1ZC3 B;  2DX5 A;  1EF1 A;  1FGZ A;  4KHA A;  1X1F A;  1GC7 A;  4K2P A;  4KAX B;  2DX1 A;  2HE7 A;  2MDX A;  2DTC A;  4DBB A;  4YL8 A;  2D10 A;  2MWN B;  4ZRJ A;  2AL6 A;  4MT7 A;  4Y94 A;  5J3Y A;  3AU5 A;  2YVC A;  2W2W A;  2BCJ A;  3IVF A;  3BJI A;  1M7E A;  3F5R A;  1UNR A;  3GYP A;  1ZVR A;  2I1J A;  1MKE A;  4K81 A;  1MIZ B;  3CIK A;  3KZ1 A;  1E5W A;  4MY6 A;  2FJL A;  3U8Z A;  4DX9 0;  2Q13 A;  1AWE A;  1FGY A;  2COD A;  4F7H A;  1V5M A;  2J0M A;  2LUL A;  2RSG A;  4K2O A;  4HB0 B;  2MFQ A;  1OQN A;  2L2I A;  2YRY A;  1XR0 B;  1W1G A;  2YSZ A;  5DIF B;  2M14 A;  3TW1 A;  1DDM A;  4PNK A;  5C16 A;  3NSU A;  1FHO A;  4GMX B;  1X05 A;  1X86 A;  3TVV A;  4KHB B;  1EGX A;  1FHW A;  1NTY A;  3KRX A;  1I7A A;  2DLW A;  4IAP A;  4C0A A;  2YS1 A;  2VSZ A;  4P7I A;  2I5F A;  1WGU A;  2DYN A;  1Y5O A;  1Z87 A;  1KI1 B;  1W1D A;  4HAX B;  1XD4 A;  2D9Y A;  1NU2 A;  1K5D B;  5CLL B;  1U5E A;  2LKO A;  2MKR A;  1Q67 A;  5DHF B;  2UZS A;  2Y8G A;  3VOQ A;  1BTK A;  3RCP A;  5C5B A;  4IFS A;  1BWN A;  2DKQ A;  3MPX A;  2DYQ A;  2Z0P A;  5JHH A;  3KY9 A;  1DBH A;  3CXB B;  1FB8 A;  2UVM A;  2RLO A;  1QQG A;  3OAN A;  1Y19 B;  4GMV A;  4MK0 A;  2PZ1 A;  4EKU A;  3SYX A;  4GXB A;  2ROV A;  2GCL A;  3A98 B;  3FM8 C;  4A6F A;  3HK0 A;  3SV1 A;  3V5W A;  2RVB B;  1UEF A;  2G35 A;  2IFS A;  2OTX A;  2Z0Q A;  5LON B;  2RGN B;  4WVF B;  2YT1 A;  2D9X A;  4F7G A;  3FSS A;  1BTN A;  3KSY A;  3PSC A;  2KCJ A;  4Z2M B;  1H4R A;  3PP2 A;  2KGX B;  2YF0 A;  3TO1 A;  5HE3 A;  3F0W A;  1B55 A;  3PG7 A;  5D3V A;  1SGH A;  2YS5 A;  2EJ8 A;  2M38 A;  4DX8 A;  5C5B B;  1UNQ A;  2QKL A;  4GN1 A;  4NSW A;  4HAZ B;  1TXD A;  2L1C A;  4ZRI A;  2CY4 A;  3N7C A;  3ULC A;  1NTV A;  1DRO A;  2H7E A;  4HB3 B;  2I1K A;  5KQ4 A;  4TYZ A;  4F7U P;  2AEH A;  2W2X C;  3QIJ A;  4A6F B;  4DXA B;  2XQN M;  2VRW B;  3UZT A;  2GJY A;  1BAK A;  1U5D A;  1PFJ A;  3PEG A;  4GPT B;  1PLS A;  1UNP A;  2D11 A;  2KUP A;  4K17 A;  3ULB A;  4KHO A;  1LB1 A;  2D9Z A;  3P6A A;  1U2B A;  5LOP B;  1W1H A;  5DI9 B;  1DYN A;  2ZPY A;  3A8P A;  1IRS A;  1EAZ A;  1N3H A;  3GYO A;  3ODO A;  1WJ1 A;  1U27 A;  3X23 A;  3DXD A;  2P0D A;  3FEH A;  3TCA A;  2YT0 A;  1U5G A;  2R09 A;  2YS3 A;  5D3W A;  4A6K A;  2K2U A;  4HB4 B;  1FAO A;  1P3R A;  4CHM A;  4HB2 B;  3HW2 B;  5J3T A;  2HTH B;  1X11 A;  1NI2 A;  2CY5 A;  3ML4 A;  4HDO A;  4L6E A;  5J3Q A;  2ROZ B;  2LOZ A;  1RRP B;  2EMS A;  2COA A;  5D3Y A;  4TKN A;  3TFM A;  3ODX A;  1MAI A;  3BIN A;  5FI1 A;  1OMW A;  4NY0 A;  5D27 A;  1EVH A;  2LG1 A;  5FI0 A;  1M7R A;  2H7D A;  4A5K A;  2DN6 A;  1DDW A;  1I2H A;  1LW3 A;  2DHJ A;  3D8E A;  3PZD A;  4PQ0 A;  3M1I B;  2ELA A;  1AQC A;  2DKP A;  1ZSQ A;  1WI1 A;  2Y8F A;  3DXE A;  1H10 A;  1SHC A;  1UPR A;  3WA0 A;  3O96 A;  4B6H A;  1V5P A;  1KZ7 A;  5KCV A;  1P5T A;  2P8V A;  2V76 A;  2ELB A;  5DHA B;  4WJ7 A;  5HE1 A;  2COC A;  1ZC4 B;  2P0F A;  3AJ4 A;  2W2X D;  2J59 M;  3ZDT A;  2K2J A;  3KRW A;  4H8S A;  1V5U A;  3AU4 A;  3D8D A;  3D8F A;  2OQB A;  5CLQ B;  1WG7 A;  1U29 A;  5JHG A;  1MIX A;  3T06 A;  2D9V A;  4HAT B;  2R0D A;  1FHX A;  1RJ2 A;  2QKM A;  3HQC A;  3ZVR A;  3SUZ A;  1ISN A;  3MDB C;  2IYB A;  2NZ8 B;  5KQ1 A;  3SO6 A;  2NMB A;  1OY2 A;  1XCG A;  3PVW A;  3PVU A;  2RUK B;  2P0H A;  1TJ6 A;  2K00 A;  2X18 A;  2COF A; 
#chains in the Genus database with same CATH topology
 4KVG B;  5I2M A;  1TQZ A;  1GG3 A;  1ZM0 A;  5D3X A;  5DH9 B;  3NWA A;  4YON A;  1K5G B;  1V61 A;  1WJM A;  2JP2 A;  1QC6 A;  5C6R A;  5HE2 A;  2CAY A;  4CHJ A;  4HAV B;  4WSF A;  2DFK A;  5C79 A;  3ODW A;  4XWX A;  4HSI A;  1XKE A;  1MPH A;  4OSN A;  5HE0 A;  3NWF A;  2CRF A;  5JLJ B;  3NW8 A;  1J19 A;  1GC6 A;  2DHK A;  3QBV B;  1V88 A;  4GZU A;  3PVL A;  1X1G A;  4HHV A;  2D4Q A;  2J0K A;  1J0W A;  3SNH A;  4L1R A;  2RNR B;  5L81 A;  1MK7 B;  3WYF B;  2UZR A;  2I5C A;  3A8Q A;  2COF A;  5GOW B;  2LYD A;  4IOY X;  4CYE A;  1DDV A;  1UPQ A;  1XX0 A;  4QJ3 B;  5EFX A;  3G9W A;  2N0Y A;  4HAU B;  3OHM B;  4D0N B;  2DHI A;  1MK9 B;  2J0J A;  2ADZ A;  4BBK A;  1WVH A;  4ZRK A;  2EMT A;  4HAY B;  2Z13 A;  4A6H A;  2Z0O A;  2D9W A;  4HDQ A;  2N23 A;  1KZG A;  1P6S A;  1U5F A;  1XOD A;  5JP4 A;  3QWM A;  2GS0 A;  3P7Z A;  2GCJ A;  2EC1 A;  3DXC A;  3LJU X;  3VIA A;  4Z2N A;  2D2Q A;  2Y7B A;  4EMO A;  1PMS A;  3U7D A;  1V89 A;  2E2X A;  2LOX A;  2DA0 A;  4QXA B;  4HAW B;  3B77 A;  1WGQ A;  1FOE A;  4EJN A;  2VKI A;  2KR0 A;  1ZC3 B;  2DX5 A;  1EF1 A;  1FGZ A;  4KHA A;  1X1F A;  1GC7 A;  4K2P A;  4KAX B;  2DX1 A;  2HE7 A;  3U12 A;  2MDX A;  2DTC A;  4DBB A;  4YL8 A;  2D10 A;  2MWN B;  4ZRJ A;  2AL6 A;  4MT7 A;  4Y94 A;  4QJ5 B;  5J3Y A;  3AU5 A;  4KHB A;  2YVC A;  2W2W A;  2BCJ A;  3IVF A;  2Z59 A;  3BJI A;  1M7E A;  3F5R A;  1UNR A;  3GYP A;  2KIG A;  1ZVR A;  2I1J A;  1MKE A;  4K81 A;  4CSQ A;  1MIZ B;  3CIK A;  3KZ1 A;  1E5W A;  4MY6 A;  2FJL A;  3U8Z A;  4DX9 0;  2Q13 A;  1AWE A;  1FGY A;  2COD A;  4F7H A;  1V5M A;  2J0M A;  2LUL A;  2RSG A;  4K2O A;  4HB0 B;  2MFQ A;  1OQN A;  2L2I A;  2YRY A;  1XR0 B;  1W1G A;  2YSZ A;  5DIF B;  5M4Y B;  2M14 A;  1MI1 A;  3TW1 A;  1DDM A;  4PNK A;  3NWD A;  5C16 A;  3NSU A;  1FHO A;  4GMX B;  1X05 A;  1X86 A;  3TVV A;  4KHB B;  1EGX A;  1FHW A;  4OT1 A;  1NTY A;  2K49 A;  3KRX A;  1I7A A;  2DLW A;  4IAP A;  2R2Y A;  4C0A A;  2YS1 A;  2VSZ A;  4P7I A;  2I5F A;  1WGU A;  2DYN A;  1Y5O A;  1Z87 A;  1KI1 B;  1W1D A;  4HAX B;  1XD4 A;  2D9Y A;  5LG4 B;  1NU2 A;  1K5D B;  5CLL B;  1U5E A;  2LKO A;  2YT2 A;  2MKR A;  1Q67 A;  5DHF B;  2UZS A;  2Y8G A;  3VOQ A;  1BTK A;  3RCP A;  2KUQ A;  5C5B A;  4IFS A;  1BWN A;  2DKQ A;  3MPX A;  2DYQ A;  2Z0P A;  5JHH A;  3KY9 A;  1DBH A;  3CXB B;  1FB8 A;  2UVM A;  2RLO A;  1QQG A;  3OAN A;  1Y19 B;  4GMV A;  4MK0 A;  2PZ1 A;  4GOU A;  4EKU A;  3SYX A;  3FVC A;  4GXB A;  2ROV A;  2GCL A;  3A98 B;  3FM8 C;  4A6F A;  3HK0 A;  3SV1 A;  3V5W A;  2RVB B;  1UEF A;  2G35 A;  2IFS A;  2OTX A;  2Z0Q A;  5LON B;  2RRF A;  2RGN B;  4WVF B;  2YT1 A;  2D9X A;  4F7G A;  3FSS A;  1BTN A;  3KSY A;  3PSC A;  2KCJ A;  4Z2M B;  1H4R A;  3PP2 A;  2KGX B;  2YF0 A;  3TO1 A;  5HE3 A;  3F0W A;  1B55 A;  3PG7 A;  5D3V A;  1SGH A;  2YS5 A;  2EJ8 A;  2M38 A;  4DX8 A;  2Z14 A;  5C5B B;  1UNQ A;  2QKL A;  4GN1 A;  4NSW A;  4HAZ B;  1TXD A;  2L1C A;  4ZRI A;  2CY4 A;  3N7C A;  3ULC A;  1NTV A;  1DRO A;  2H7E A;  4HB3 B;  2I1K A;  5KQ4 A;  4TYZ A;  4F7U P;  2AEH A;  2W2X C;  3QIJ A;  4A6F B;  4DXA B;  2XQN M;  2VRW B;  3UZT A;  2GJY A;  1BAK A;  1U5D A;  5I2S A;  1PFJ A;  3PEG A;  4GPT B;  1PLS A;  1UNP A;  2D11 A;  2GUM A;  2KUP A;  4K17 A;  3ULB A;  4KHO A;  1LB1 A;  2D9Z A;  3P6A A;  1U2B A;  5LOP B;  1W1H A;  5DI9 B;  1DYN A;  2ZPY A;  3A8P A;  1IRS A;  1EAZ A;  1N3H A;  3GYO A;  2ZKM X;  3ODO A;  1WJ1 A;  1U27 A;  3X23 A;  2P0D A;  3DXD A;  3FEH A;  3TCA A;  4QJ4 B;  2YT0 A;  1U5G A;  2R09 A;  2YS3 A;  5D3W A;  4A6K A;  2K2U A;  4HB4 B;  5IRS A;  1FAO A;  1P3R A;  4CHM A;  4HB2 B;  3HW2 B;  5J3T A;  2K8E A;  2HTH B;  1X11 A;  4GNK B;  1NI2 A;  2CY5 A;  3ML4 A;  4HDO A;  4L6E A;  5J3Q A;  2ROZ B;  1T77 A;  2LOZ A;  1RRP B;  3HIE A;  2EMS A;  2COA A;  5D3Y A;  4TKN A;  4DIX A;  3TFM A;  3ODX A;  1MAI A;  3BIN A;  5FI1 A;  1OMW A;  4NY0 A;  5D27 A;  1EVH A;  2FJU B;  2LG1 A;  5FI0 A;  1M7R A;  2H7D A;  4A5K A;  2DN6 A;  1DDW A;  3DCX A;  2Z4D A;  1I2H A;  1LW3 A;  2DHJ A;  3D8E A;  3PZD A;  1ZYI A;  4PQ0 A;  3M1I B;  2ELA A;  1AQC A;  2DKP A;  1ZSQ A;  1WI1 A;  2Y8F A;  3DXE A;  1H10 A;  1SHC A;  1UPR A;  3HSA A;  3WA0 A;  3O96 A;  4B6H A;  1V5P A;  1KZ7 A;  5KCV A;  3A58 A;  1P5T A;  2P8V A;  2V76 A;  2ELB A;  5DHA B;  4WJ7 A;  5HE1 A;  2COC A;  1ZC4 B;  2P0F A;  3AJ4 A;  2W2X D;  2J59 M;  3ZDT A;  2K2J A;  3KRW A;  4H8S A;  1V5U A;  3AU4 A;  3D8D A;  3D8F A;  2NBV A;  2OQB A;  5CLQ B;  1WG7 A;  1U29 A;  5JHG A;  1MIX A;  3T06 A;  2D9V A;  4HAT B;  2R0D A;  1FHX A;  1RJ2 A;  2QKM A;  3HQC A;  3ZVR A;  3SUZ A;  1ISN A;  3MDB C;  2IYB A;  2NZ8 B;  5KQ1 A;  3SO6 A;  2NMB A;  1OY2 A;  1XCG A;  3PVW A;  4D6W A;  3PVU A;  2RUK B;  2P0H A;  1TJ6 A;  2K00 A;  2X18 A;  2KIE A; 
#chains in the Genus database with same CATH homology
 4KVG B;  1TQZ A;  1GG3 A;  1ZM0 A;  5D3X A;  5DH9 B;  4YON A;  1K5G B;  1V61 A;  1WJM A;  2JP2 A;  1QC6 A;  5C6R A;  5HE2 A;  2CAY A;  4CHJ A;  4HAV B;  4WSF A;  2DFK A;  5C79 A;  3ODW A;  4XWX A;  1XKE A;  1MPH A;  5HE0 A;  2CRF A;  5JLJ B;  1J19 A;  1GC6 A;  2DHK A;  3QBV B;  1V88 A;  4GZU A;  3PVL A;  1X1G A;  4HHV A;  2D4Q A;  2J0K A;  1J0W A;  3SNH A;  2RNR B;  5L81 A;  1MK7 B;  3WYF B;  2UZR A;  2I5C A;  3A8Q A;  5GOW B;  2LYD A;  4IOY X;  4CYE A;  1DDV A;  1UPQ A;  1XX0 A;  5EFX A;  3G9W A;  2N0Y A;  4HAU B;  4D0N B;  2DHI A;  1MK9 B;  2J0J A;  2ADZ A;  4BBK A;  1WVH A;  4ZRK A;  2EMT A;  4HAY B;  4A6H A;  2Z0O A;  2D9W A;  4HDQ A;  2N23 A;  1KZG A;  1P6S A;  1U5F A;  1XOD A;  5JP4 A;  3QWM A;  2GS0 A;  3P7Z A;  2GCJ A;  2EC1 A;  3DXC A;  3LJU X;  3VIA A;  4Z2N A;  2D2Q A;  2Y7B A;  4EMO A;  1PMS A;  3U7D A;  1V89 A;  2E2X A;  2LOX A;  2DA0 A;  4HAW B;  1WGQ A;  1FOE A;  4EJN A;  2VKI A;  1ZC3 B;  2DX5 A;  1EF1 A;  1FGZ A;  4KHA A;  1X1F A;  1GC7 A;  4K2P A;  4KAX B;  2DX1 A;  2HE7 A;  2MDX A;  2DTC A;  4DBB A;  4YL8 A;  2D10 A;  2MWN B;  4ZRJ A;  2AL6 A;  4MT7 A;  4Y94 A;  5J3Y A;  3AU5 A;  2YVC A;  2W2W A;  2BCJ A;  3IVF A;  3BJI A;  1M7E A;  3F5R A;  1UNR A;  3GYP A;  1ZVR A;  2I1J A;  1MKE A;  4K81 A;  1MIZ B;  3CIK A;  3KZ1 A;  1E5W A;  4MY6 A;  2FJL A;  3U8Z A;  4DX9 0;  2Q13 A;  1AWE A;  1FGY A;  2COD A;  4F7H A;  1V5M A;  2J0M A;  2LUL A;  2RSG A;  4K2O A;  4HB0 B;  2MFQ A;  1OQN A;  2L2I A;  2YRY A;  1XR0 B;  1W1G A;  2YSZ A;  5DIF B;  2M14 A;  3TW1 A;  1DDM A;  4PNK A;  5C16 A;  3NSU A;  1FHO A;  4GMX B;  1X05 A;  1X86 A;  3TVV A;  4KHB B;  1EGX A;  1FHW A;  1NTY A;  3KRX A;  1I7A A;  2DLW A;  4IAP A;  4C0A A;  2YS1 A;  2VSZ A;  4P7I A;  2I5F A;  1WGU A;  2DYN A;  1Y5O A;  1Z87 A;  1KI1 B;  1W1D A;  4HAX B;  1XD4 A;  2D9Y A;  1NU2 A;  1K5D B;  5CLL B;  1U5E A;  2LKO A;  2MKR A;  1Q67 A;  5DHF B;  2UZS A;  2Y8G A;  3VOQ A;  1BTK A;  3RCP A;  5C5B A;  4IFS A;  1BWN A;  2DKQ A;  3MPX A;  2DYQ A;  2Z0P A;  5JHH A;  3KY9 A;  1DBH A;  3CXB B;  1FB8 A;  2UVM A;  2RLO A;  1QQG A;  3OAN A;  1Y19 B;  4GMV A;  4MK0 A;  2PZ1 A;  4EKU A;  3SYX A;  4GXB A;  2ROV A;  2GCL A;  3A98 B;  3FM8 C;  4A6F A;  3HK0 A;  3SV1 A;  3V5W A;  2RVB B;  1UEF A;  2G35 A;  2IFS A;  2OTX A;  2Z0Q A;  5LON B;  2RGN B;  4WVF B;  2YT1 A;  2D9X A;  4F7G A;  3FSS A;  1BTN A;  3KSY A;  3PSC A;  2KCJ A;  4Z2M B;  1H4R A;  3PP2 A;  2KGX B;  2YF0 A;  3TO1 A;  5HE3 A;  3F0W A;  1B55 A;  3PG7 A;  5D3V A;  1SGH A;  2YS5 A;  2EJ8 A;  2M38 A;  4DX8 A;  5C5B B;  1UNQ A;  2QKL A;  4GN1 A;  4NSW A;  4HAZ B;  1TXD A;  2L1C A;  4ZRI A;  2CY4 A;  3N7C A;  3ULC A;  1NTV A;  1DRO A;  2H7E A;  4HB3 B;  2I1K A;  5KQ4 A;  4TYZ A;  4F7U P;  2AEH A;  2W2X C;  3QIJ A;  4A6F B;  4DXA B;  2XQN M;  2VRW B;  3UZT A;  2GJY A;  1BAK A;  1U5D A;  1PFJ A;  3PEG A;  4GPT B;  1PLS A;  1UNP A;  2D11 A;  2KUP A;  4K17 A;  3ULB A;  4KHO A;  1LB1 A;  2D9Z A;  3P6A A;  1U2B A;  5LOP B;  1W1H A;  5DI9 B;  1DYN A;  2ZPY A;  3A8P A;  1IRS A;  1EAZ A;  1N3H A;  3GYO A;  3ODO A;  1WJ1 A;  1U27 A;  3X23 A;  3DXD A;  2P0D A;  3FEH A;  3TCA A;  2YT0 A;  1U5G A;  2R09 A;  2YS3 A;  5D3W A;  4A6K A;  2K2U A;  4HB4 B;  1FAO A;  1P3R A;  4CHM A;  4HB2 B;  3HW2 B;  5J3T A;  2HTH B;  1X11 A;  1NI2 A;  2CY5 A;  3ML4 A;  4HDO A;  4L6E A;  5J3Q A;  2ROZ B;  2LOZ A;  1RRP B;  2EMS A;  2COA A;  5D3Y A;  4TKN A;  3TFM A;  3ODX A;  1MAI A;  3BIN A;  5FI1 A;  1OMW A;  4NY0 A;  5D27 A;  1EVH A;  2LG1 A;  5FI0 A;  1M7R A;  2H7D A;  4A5K A;  2DN6 A;  1DDW A;  1I2H A;  1LW3 A;  2DHJ A;  3D8E A;  3PZD A;  4PQ0 A;  3M1I B;  2ELA A;  1AQC A;  2DKP A;  1ZSQ A;  1WI1 A;  2Y8F A;  3DXE A;  1H10 A;  1SHC A;  1UPR A;  3WA0 A;  3O96 A;  4B6H A;  1V5P A;  1KZ7 A;  5KCV A;  1P5T A;  2P8V A;  2V76 A;  2ELB A;  5DHA B;  4WJ7 A;  5HE1 A;  2COC A;  1ZC4 B;  2P0F A;  3AJ4 A;  2W2X D;  2J59 M;  3ZDT A;  2K2J A;  3KRW A;  4H8S A;  1V5U A;  3AU4 A;  3D8D A;  3D8F A;  2OQB A;  5CLQ B;  1WG7 A;  1U29 A;  5JHG A;  1MIX A;  3T06 A;  2D9V A;  4HAT B;  2R0D A;  1FHX A;  1RJ2 A;  2QKM A;  3HQC A;  3ZVR A;  3SUZ A;  1ISN A;  3MDB C;  2IYB A;  2NZ8 B;  5KQ1 A;  3SO6 A;  2NMB A;  1OY2 A;  1XCG A;  3PVW A;  3PVU A;  2RUK B;  2P0H A;  1TJ6 A;  2K00 A;  2X18 A;  2COF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...