2QKMA

The crystal structure of fission yeast mrna decapping enzyme dcp1-dcp2 complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
127
structure length
123
Chain Sequence
b'MEDENILRNAVNLQVLKFHYPEIESIIDIASHVAVYQFDKWLKTSIEGTFFLVKDQRARVGYVILNRNSPENLYLFINHPSNVHLVDRYLIHRTENQHVVGLWMFDPNDMSRIFNIVKESLLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPBC3B9.21 protein
publication title Structural basis of dcp2 recognition and activation by dcp1.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Hydrolase
total genus 32
structure length 123
sequence length 127
chains with identical sequence C, E, G
ec nomenclature ec 3.6.1.30: Transferred entry: 3.6.1.59 and 3.6.1.62.
pdb deposition date 2007-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2qkmA00
1TXDA 2OQBA 1DYNA 1PFJA 4GMXB 2ROVA 2UZSA 1ZC4B 2M14A 1WG7A 3HQCA 2DYQA 4F7GA 3VIAA 3IVFA 3ML4A 1UNQA 3PSCA 1B55A 5JP4A 4ZRIA 3RCPA 2DHIA 3CIKA 1UEFA 1KZ7A 4GN1A 1X1GA 4WVFB 3QIJA 4YONA 3AU5A 5FI1A 2D2QA 1U5GA 1RJ2A 2DHKA 3A8QA 1P5TA 1GC6A 1I2HA 1WJMA 4KHAA 2PZ1A 3ULBA 2YSZA 5DHAB 1BTNA 4HAXB 1FGYA 4H8SA 3D8DA 1BTKA 2N0YA 4ZRJA 3PVUA 5JHHA 5KQ1A 2R09A 1ZC3B 3OANA 3AU4A 4CHJA 1U2BA 3ODXA 1UPQA 4Y94A 5LONB 3PVLA 1V61A 1UNRA 2D10A 2I1KA 1ZVRA 2D9ZA 4A6FB 2GJYA 4EMOA 2VRWB 2GCLA 4MT7A 3PG7A 1BAKA 1WGQA 1XX0A 2HTHB 5JHGA 1FHOA 3UZTA 1E5WA 2I5FA 3U7DA 2ELBA 5HE3A 4DX90 3DXEA 4TYZA 1X1FA 4GXBA 1KZGA 2FJLA 2IFSA 2DKPA 2J0KA 2DX1A 1EF1A 4PNKA 1K5GB 1EVHA 1LB1A 2GCJA 3QBVB 3SV1A 1X05A 2V76A 1GC7A 4NY0A 2YT1A 2LYDA 3O96A 2UZRA 4YL8A 3D8FA 5D3WA 2P8VA 4L6EA 4K2PA 4B6HA 1MIXA 3TCAA 3BJIA 4GZUA 2L1CA 2Z0PA 3GYOA 2N23A 3D8EA 2AEHA 3ZVRA 2LG1A 2IYBA 2D9VA 3AJ4A 3MDBC 1W1HA 2RSGA 1EAZA 4CYEA 2LOZA 2NZ8B 5J3TA 1AWEA 5DIFB 2ELAA 1XCGA 3CXBB 1NU2A 4Z2MB 4DX8A 1QC6A 2YS1A 4HATB 4P7IA 1WVHA 1RRPB 3WYFB 2LOXA 1FGZA 3T06A 2Z0OA 1ZSQA 2KGXB 4D0NB 1MAIA 1QQGA 4HAYB 5C5BA 1X86A 3SO6A 4TKNA 1XR0B 4BBKA 1Y5OA 2COCA 1V5MA 4IAPA 2RGNB 4HB3B 2Y7BA 1J0WA 2KUPA 5C79A 2D11A 2OTXA 4PQ0A 1OQNA 4MY6A 2XQNM 5D3YA 3HK0A 3LJUX 1PMSA 1Z87A 2W2WA 1M7EA 3PEGA 2ADZA 2D9YA 1DBHA 4DBBA 2H7EA 5L81A 1I7AA 2BCJA 2I1JA 3A8PA 3TO1A 4HAWB 2MDXA 5HE1A 3NSUA 2K2JA 3KZ1A 2J59M 1DDMA 3KSYA 3GYPA 2EC1A 2MFQA 3BINA 4KHBB 1P3RA 2Q13A 4GMVA 2CAYA 5HE2A 1J19A 2K2UA 2DKQA 3U8ZA 3N7CA 4HB2B 2DLWA 5DI9B 2DN6A 3ZDTA 4HB0B 1FHXA 1ISNA 2L2IA 1MPHA 1V5PA 2Z0QA 5CLLB 3M1IB 2DHJA 2DX5A 4KAXB 3P7ZA 5D27A 3PZDA 4XWXA 3TFMA 1XD4A 5KCVA 1EGXA 4Z2NA 2ROZB 2P0DA 4IOYX 3ODOA 4KHOA 1SGHA 4ZRKA 3QWMA 3FM8C 2RNRB 4A5KA 2D9WA 2W2XD 5DHFB 2UVMA 2R0DA 2I5CA 4K17A 4K81A 4GPTB 4CHMA 5J3YA 1NTVA 1NTYA 1OY2A 1OMWA 1AQCA 1V88A 1NI2A 2MWNB 2COAA 3SYXA 1DDVA 4F7UP 2P0HA 1H4RA 2YT0A 3V5WA 3X23A 4MK0A 2RUKB 2LULA 2ZPYA 4NSWA 2LKOA 3DXDA 2G35A 1ZM0A 2COFA 2DFKA 1TJ6A 2CRFA 2Y8FA 4EJNA 2M38A 3SNHA 4EKUA 3P6AA 3KY9A 4C0AA 2VKIA 1X11A 3FEHA 2RLOA 2CY5A 4IFSA 2VSZA 2J0MA 2P0FA 1W1DA 1U5FA 1WGUA 1V5UA 5LOPB 2D4QA 2W2XC 2EMSA 3VOQA 2DYNA 1MIZB 1U27A 1V89A 5HE0A 3KRWA 4A6HA 1TQZA 1P6SA 4HAVB 2QKMA 4KVGB 3HW2B 4WJ7A 2QKLA 3TW1A 1UPRA 1LW3A 2EJ8A 1W1GA 3MPXA 1DDWA 1KI1B 2JP2A 1IRSA 4F7HA 4DXAB 5EFXA 2CODA 1PLSA 1N3HA 5J3QA 3PVWA 1MK7B 4WSFA 1GG3A 4HDOA 2NMBA 4HAZB 2GS0A 2YRYA 2X18A 5D3XA 5C16A 4HHVA 4HAUB 1DROA 2CY4A 2H7DA 3F5RA 3KRXA 3PP2A 3FSSA 1FOEA 1Q67A 3TVVA 3SUZA 1WI1A 5DH9B 4HDQA 2AL6A 1XODA 2YS3A 3DXCA 1U29A 1U5DA 2Y8GA 1FB8A 1BWNA 2EMTA 2MKRA 3G9WA 2E2XA 2DA0A 1XKEA 1MKEA 5CLQB 3ULCA 5JLJB 3F0WA 2YVCA 5D3VA 4HB4B 2HE7A 1H10A 1MK9B 2YF0A 1FHWA 4A6FA 1FAOA 1Y19B 2YS5A 2RVBB 4K2OA 2J0JA 3WA0A 1UNPA 1SHCA 3ODWA 1U5EA 5GOWB 4A6KA 1M7RA 2DTCA 1WJ1A 5KQ4A 2K00A 5C6RA 1K5DB 2D9XA 5C5BB 2KCJA 5FI0A 3A98B
chains in the Genus database with same CATH superfamily
1TXDA 2OQBA 1DYNA 1PFJA 4GMXB 2ROVA 2UZSA 1ZC4B 2M14A 1WG7A 3DCXA 3HQCA 2DYQA 4F7GA 3VIAA 3IVFA 4OT1A 3ML4A 1UNQA 3PSCA 3NW8A 1B55A 5JP4A 4ZRIA 3RCPA 2DHIA 3CIKA 1UEFA 1KZ7A 4GN1A 1X1GA 4WVFB 3QIJA 4YONA 3AU5A 5FI1A 2D2QA 5LG4B 1U5GA 1RJ2A 2DHKA 2KIGA 4HSIA 2KR0A 3A8QA 1P5TA 1GC6A 1I2HA 1WJMA 4KHAA 2PZ1A 3ULBA 2YSZA 5DHAB 1BTNA 4HAXB 1FGYA 4H8SA 3D8DA 1BTKA 2KIEA 2NBVA 2N0YA 4ZRJA 3PVUA 5JHHA 5KQ1A 2R09A 1ZC3B 3OANA 2K49A 2RRFA 3AU4A 4CHJA 1U2BA 2ZKMX 3ODXA 1UPQA 4Y94A 5LONB 3PVLA 1V61A 1UNRA 3FVCA 2D10A 2I1KA 1ZVRA 2D9ZA 4A6FB 5IRSA 2GJYA 4EMOA 2VRWB 2GCLA 4MT7A 3PG7A 1BAKA 1WGQA 1XX0A 2HTHB 5JHGA 1FHOA 3UZTA 2FJUB 1E5WA 4CSQA 4GOUA 2I5FA 3U7DA 2ELBA 5HE3A 4DX90 4QXAB 3DXEA 4TYZA 1X1FA 4GXBA 1KZGA 2FJLA 2IFSA 2DKPA 2J0KA 2DX1A 1EF1A 4PNKA 1K5GB 1EVHA 1LB1A 2GCJA 3QBVB 2KUQA 3SV1A 2K8EA 1X05A 2V76A 1GC7A 4NY0A 2YT1A 2LYDA 3O96A 2UZRA 4YL8A 3D8FA 5D3WA 2P8VA 4D6WA 4L6EA 4K2PA 4B6HA 1MIXA 3TCAA 3BJIA 4GZUA 2L1CA 2Z0PA 3GYOA 2N23A 3D8EA 2AEHA 3ZVRA 2LG1A 2IYBA 2D9VA 3AJ4A 3MDBC 1W1HA 2RSGA 4DIXA 4QJ4B 1EAZA 4CYEA 2LOZA 2NZ8B 5J3TA 1AWEA 5DIFB 2ELAA 1XCGA 3CXBB 1NU2A 4Z2MB 4DX8A 1QC6A 2YS1A 4HATB 4P7IA 1WVHA 1RRPB 1ZYIA 3WYFB 2LOXA 1FGZA 3T06A 2Z0OA 1ZSQA 2KGXB 4D0NB 1MAIA 1QQGA 4HAYB 5C5BA 1X86A 3SO6A 4TKNA 1XR0B 4BBKA 1Y5OA 3NWAA 2GUMA 2COCA 1V5MA 4IAPA 2RGNB 2YT2A 4HB3B 2Y7BA 1J0WA 2KUPA 5C79A 2D11A 2OTXA 4PQ0A 4L1RA 3NWFA 1OQNA 4MY6A 2XQNM 5D3YA 3HK0A 4GNKB 3LJUX 1PMSA 1Z87A 2W2WA 1M7EA 3PEGA 2ADZA 2D9YA 1DBHA 4DBBA 1T77A 2H7EA 5L81A 1I7AA 2BCJA 2I1JA 3A8PA 3TO1A 4HAWB 2MDXA 5HE1A 3NSUA 2K2JA 3KZ1A 2J59M 1DDMA 3KSYA 3GYPA 2EC1A 2MFQA 3BINA 4KHBB 1P3RA 2Q13A 4GMVA 2CAYA 1MI1A 1J19A 5HE2A 2K2UA 2DKQA 3U8ZA 3N7CA 4HB2B 2DLWA 5DI9B 2DN6A 3ZDTA 4HB0B 1FHXA 1ISNA 3NWDA 2L2IA 1MPHA 1V5PA 2Z0QA 5CLLB 3M1IB 2DHJA 2DX5A 2Z4DA 4KAXB 3P7ZA 5D27A 3PZDA 4XWXA 3TFMA 1XD4A 5KCVA 1EGXA 4Z2NA 2ROZB 2P0DA 4IOYX 3ODOA 4KHOA 1SGHA 4ZRKA 3QWMA 3FM8C 2RNRB 4A5KA 2D9WA 2W2XD 5DHFB 2UVMA 2R0DA 2I5CA 4K17A 5I2SA 3A58A 4K81A 4GPTB 4CHMA 5J3YA 1NTVA 1NTYA 1OY2A 3OHMB 1OMWA 1AQCA 1V88A 1NI2A 2MWNB 2COAA 3SYXA 1DDVA 4F7UP 4QJ3B 2P0HA 1H4RA 2YT0A 3V5WA 3X23A 4MK0A 2RUKB 2LULA 2ZPYA 5M4YB 4NSWA 2LKOA 3DXDA 2G35A 1ZM0A 2COFA 2DFKA 1TJ6A 2CRFA 2Y8FA 4EJNA 2M38A 3SNHA 4EKUA 4OSNA 3P6AA 3KY9A 4C0AA 2VKIA 1X11A 3FEHA 2RLOA 2CY5A 4IFSA 2VSZA 2J0MA 2P0FA 1W1DA 1U5FA 1WGUA 1V5UA 5LOPB 2D4QA 2W2XC 2EMSA 3VOQA 2DYNA 1MIZB 1U27A 1V89A 5HE0A 3KRWA 4A6HA 1TQZA 1P6SA 4HAVB 2QKMA 4KVGB 3HW2B 4WJ7A 2QKLA 3TW1A 1UPRA 1LW3A 2EJ8A 1W1GA 3MPXA 1DDWA 1KI1B 2JP2A 1IRSA 4F7HA 4DXAB 3HIEA 5EFXA 2CODA 2Z14A 1PLSA 1N3HA 5J3QA 3PVWA 1MK7B 4WSFA 1GG3A 4HDOA 2NMBA 4HAZB 2GS0A 2YRYA 2X18A 5D3XA 5C16A 4HHVA 4HAUB 1DROA 2CY4A 2H7DA 3F5RA 3KRXA 3PP2A 3FSSA 1FOEA 1Q67A 3TVVA 3SUZA 1WI1A 5DH9B 4HDQA 2AL6A 1XODA 2YS3A 3DXCA 1U29A 1U5DA 2Y8GA 1FB8A 1BWNA 2EMTA 2MKRA 3G9WA 2E2XA 3HSAA 2DA0A 1XKEA 1MKEA 5CLQB 3ULCA 5I2MA 5JLJB 3F0WA 2YVCA 3B77A 5D3VA 4HB4B 2HE7A 1H10A 1MK9B 2YF0A 1FHWA 4A6FA 1FAOA 1Y19B 4KHBA 2YS5A 2RVBB 3U12A 2Z59A 4K2OA 2J0JA 3WA0A 4QJ5B 1UNPA 1SHCA 3ODWA 1U5EA 5GOWB 2R2YA 4A6KA 1M7RA 2DTCA 1WJ1A 5KQ4A 2K00A 5C6RA 1K5DB 2D9XA 5C5BB 2KCJA 5FI0A 3A98B 2Z13A
chains in the Genus database with same CATH topology
1TXDA 2OQBA 1DYNA 1PFJA 4GMXB 2ROVA 2UZSA 1ZC4B 2M14A 1WG7A 3HQCA 2DYQA 4F7GA 3VIAA 3IVFA 3ML4A 1UNQA 3PSCA 1B55A 5JP4A 4ZRIA 3RCPA 2DHIA 3CIKA 1UEFA 1KZ7A 4GN1A 1X1GA 4WVFB 3QIJA 4YONA 3AU5A 5FI1A 2D2QA 1U5GA 1RJ2A 2DHKA 3A8QA 1P5TA 1GC6A 1I2HA 1WJMA 4KHAA 2PZ1A 3ULBA 2YSZA 5DHAB 1BTNA 4HAXB 1FGYA 4H8SA 3D8DA 1BTKA 2N0YA 4ZRJA 3PVUA 5JHHA 5KQ1A 2R09A 1ZC3B 3OANA 3AU4A 4CHJA 1U2BA 3ODXA 1UPQA 4Y94A 5LONB 3PVLA 1V61A 1UNRA 2D10A 2I1KA 1ZVRA 2D9ZA 4A6FB 2GJYA 4EMOA 2VRWB 2GCLA 4MT7A 3PG7A 1BAKA 1WGQA 1XX0A 2HTHB 5JHGA 1FHOA 3UZTA 1E5WA 2I5FA 3U7DA 2ELBA 5HE3A 4DX90 3DXEA 4TYZA 1X1FA 4GXBA 1KZGA 2FJLA 2IFSA 2DKPA 2J0KA 2DX1A 1EF1A 4PNKA 1K5GB 1EVHA 1LB1A 2GCJA 3QBVB 3SV1A 1X05A 2V76A 1GC7A 4NY0A 2YT1A 2LYDA 3O96A 2UZRA 4YL8A 3D8FA 5D3WA 2P8VA 4L6EA 4K2PA 4B6HA 1MIXA 3TCAA 3BJIA 4GZUA 2L1CA 2Z0PA 3GYOA 2N23A 3D8EA 2AEHA 3ZVRA 2LG1A 2IYBA 2D9VA 3AJ4A 3MDBC 1W1HA 2RSGA 1EAZA 4CYEA 2LOZA 2NZ8B 5J3TA 1AWEA 5DIFB 2ELAA 1XCGA 3CXBB 1NU2A 4Z2MB 4DX8A 1QC6A 2YS1A 4HATB 4P7IA 1WVHA 1RRPB 3WYFB 2LOXA 1FGZA 3T06A 2Z0OA 1ZSQA 2KGXB 4D0NB 1MAIA 1QQGA 4HAYB 5C5BA 1X86A 3SO6A 4TKNA 1XR0B 4BBKA 1Y5OA 2COCA 1V5MA 4IAPA 2RGNB 4HB3B 2Y7BA 1J0WA 2KUPA 5C79A 2D11A 2OTXA 4PQ0A 1OQNA 4MY6A 2XQNM 5D3YA 3HK0A 3LJUX 1PMSA 1Z87A 2W2WA 1M7EA 3PEGA 2ADZA 2D9YA 1DBHA 4DBBA 2H7EA 5L81A 1I7AA 2BCJA 2I1JA 3A8PA 3TO1A 4HAWB 2MDXA 5HE1A 3NSUA 2K2JA 3KZ1A 2J59M 1DDMA 3KSYA 3GYPA 2EC1A 2MFQA 3BINA 4KHBB 1P3RA 2Q13A 4GMVA 2CAYA 5HE2A 1J19A 2K2UA 2DKQA 3U8ZA 3N7CA 4HB2B 2DLWA 5DI9B 2DN6A 3ZDTA 4HB0B 1FHXA 1ISNA 2L2IA 1MPHA 1V5PA 2Z0QA 5CLLB 3M1IB 2DHJA 2DX5A 4KAXB 3P7ZA 5D27A 3PZDA 4XWXA 3TFMA 1XD4A 5KCVA 1EGXA 4Z2NA 2ROZB 2P0DA 4IOYX 3ODOA 4KHOA 1SGHA 4ZRKA 3QWMA 3FM8C 2RNRB 4A5KA 2D9WA 2W2XD 5DHFB 2UVMA 2R0DA 2I5CA 4K17A 4K81A 4GPTB 4CHMA 5J3YA 1NTVA 1NTYA 1OY2A 1OMWA 1AQCA 1V88A 1NI2A 2MWNB 2COAA 3SYXA 1DDVA 4F7UP 2P0HA 1H4RA 2YT0A 3V5WA 3X23A 4MK0A 2RUKB 2LULA 2ZPYA 4NSWA 2LKOA 3DXDA 2G35A 1ZM0A 2COFA 2DFKA 1TJ6A 2CRFA 2Y8FA 4EJNA 2M38A 3SNHA 4EKUA 3P6AA 3KY9A 4C0AA 2VKIA 1X11A 3FEHA 2RLOA 2CY5A 4IFSA 2VSZA 2J0MA 2P0FA 1W1DA 1U5FA 1WGUA 1V5UA 5LOPB 2D4QA 2W2XC 2EMSA 3VOQA 2DYNA 1MIZB 1U27A 1V89A 5HE0A 3KRWA 4A6HA 1TQZA 1P6SA 4HAVB 2QKMA 4KVGB 3HW2B 4WJ7A 2QKLA 3TW1A 1UPRA 1LW3A 2EJ8A 1W1GA 3MPXA 1DDWA 1KI1B 2JP2A 1IRSA 4F7HA 4DXAB 5EFXA 2CODA 1PLSA 1N3HA 5J3QA 3PVWA 1MK7B 4WSFA 1GG3A 4HDOA 2NMBA 4HAZB 2GS0A 2YRYA 2X18A 5D3XA 5C16A 4HHVA 4HAUB 1DROA 2CY4A 2H7DA 3F5RA 3KRXA 3PP2A 3FSSA 1FOEA 1Q67A 3TVVA 3SUZA 1WI1A 5DH9B 4HDQA 2AL6A 1XODA 2YS3A 3DXCA 1U29A 1U5DA 2Y8GA 1FB8A 1BWNA 2EMTA 2MKRA 3G9WA 2E2XA 2DA0A 1XKEA 1MKEA 5CLQB 3ULCA 5JLJB 3F0WA 2YVCA 5D3VA 4HB4B 2HE7A 1H10A 1MK9B 2YF0A 1FHWA 4A6FA 1FAOA 1Y19B 2YS5A 2RVBB 4K2OA 2J0JA 3WA0A 1UNPA 1SHCA 3ODWA 1U5EA 5GOWB 4A6KA 1M7RA 2DTCA 1WJ1A 5KQ4A 2K00A 5C6RA 1K5DB 2D9XA 5C5BB 2KCJA 5FI0A 3A98B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TXD A;  2OQB A;  1DYN A;  1PFJ A;  4GMX B;  2ROV A;  2UZS A;  1ZC4 B;  2M14 A;  1WG7 A;  3HQC A;  2DYQ A;  4F7G A;  3VIA A;  3IVF A;  3ML4 A;  1UNQ A;  3PSC A;  1B55 A;  5JP4 A;  4ZRI A;  3RCP A;  2DHI A;  3CIK A;  1UEF A;  1KZ7 A;  4GN1 A;  1X1G A;  4WVF B;  3QIJ A;  4YON A;  3AU5 A;  5FI1 A;  2D2Q A;  1U5G A;  1RJ2 A;  2DHK A;  3A8Q A;  1P5T A;  1GC6 A;  1I2H A;  1WJM A;  4KHA A;  2PZ1 A;  3ULB A;  2YSZ A;  5DHA B;  1BTN A;  4HAX B;  1FGY A;  4H8S A;  3D8D A;  1BTK A;  2N0Y A;  4ZRJ A;  3PVU A;  5JHH A;  5KQ1 A;  2R09 A;  1ZC3 B;  3OAN A;  3AU4 A;  4CHJ A;  1U2B A;  3ODX A;  1UPQ A;  4Y94 A;  5LON B;  3PVL A;  1V61 A;  1UNR A;  2D10 A;  2I1K A;  1ZVR A;  2D9Z A;  4A6F B;  2GJY A;  4EMO A;  2VRW B;  2GCL A;  4MT7 A;  3PG7 A;  1BAK A;  1WGQ A;  1XX0 A;  2HTH B;  5JHG A;  1FHO A;  3UZT A;  1E5W A;  2I5F A;  3U7D A;  2ELB A;  5HE3 A;  4DX9 0;  3DXE A;  4TYZ A;  1X1F A;  4GXB A;  1KZG A;  2FJL A;  2IFS A;  2DKP A;  2J0K A;  2DX1 A;  1EF1 A;  4PNK A;  1K5G B;  1EVH A;  1LB1 A;  2GCJ A;  3QBV B;  3SV1 A;  1X05 A;  2V76 A;  1GC7 A;  4NY0 A;  2YT1 A;  2LYD A;  3O96 A;  2UZR A;  4YL8 A;  3D8F A;  5D3W A;  2P8V A;  4L6E A;  4K2P A;  4B6H A;  1MIX A;  3TCA A;  3BJI A;  4GZU A;  2L1C A;  2Z0P A;  3GYO A;  2N23 A;  3D8E A;  2AEH A;  3ZVR A;  2LG1 A;  2IYB A;  2D9V A;  3AJ4 A;  3MDB C;  1W1H A;  2RSG A;  1EAZ A;  4CYE A;  2LOZ A;  2NZ8 B;  5J3T A;  1AWE A;  5DIF B;  2ELA A;  1XCG A;  3CXB B;  1NU2 A;  4Z2M B;  4DX8 A;  1QC6 A;  2YS1 A;  4HAT B;  4P7I A;  1WVH A;  1RRP B;  3WYF B;  2LOX A;  1FGZ A;  3T06 A;  2Z0O A;  1ZSQ A;  2KGX B;  4D0N B;  1MAI A;  1QQG A;  4HAY B;  5C5B A;  1X86 A;  3SO6 A;  4TKN A;  1XR0 B;  4BBK A;  1Y5O A;  2COC A;  1V5M A;  4IAP A;  2RGN B;  4HB3 B;  2Y7B A;  1J0W A;  2KUP A;  5C79 A;  2D11 A;  2OTX A;  4PQ0 A;  1OQN A;  4MY6 A;  2XQN M;  5D3Y A;  3HK0 A;  3LJU X;  1PMS A;  1Z87 A;  2W2W A;  1M7E A;  3PEG A;  2ADZ A;  2D9Y A;  1DBH A;  4DBB A;  2H7E A;  5L81 A;  1I7A A;  2BCJ A;  2I1J A;  3A8P A;  3TO1 A;  4HAW B;  2MDX A;  5HE1 A;  3NSU A;  2K2J A;  3KZ1 A;  2J59 M;  1DDM A;  3KSY A;  3GYP A;  2EC1 A;  2MFQ A;  3BIN A;  4KHB B;  1P3R A;  2Q13 A;  4GMV A;  2CAY A;  5HE2 A;  1J19 A;  2K2U A;  2DKQ A;  3U8Z A;  3N7C A;  4HB2 B;  2DLW A;  5DI9 B;  2DN6 A;  3ZDT A;  4HB0 B;  1FHX A;  1ISN A;  2L2I A;  1MPH A;  1V5P A;  2Z0Q A;  5CLL B;  3M1I B;  2DHJ A;  2DX5 A;  4KAX B;  3P7Z A;  5D27 A;  3PZD A;  4XWX A;  3TFM A;  1XD4 A;  5KCV A;  1EGX A;  4Z2N A;  2ROZ B;  2P0D A;  4IOY X;  3ODO A;  4KHO A;  1SGH A;  4ZRK A;  3QWM A;  3FM8 C;  2RNR B;  4A5K A;  2D9W A;  2W2X D;  5DHF B;  2UVM A;  2R0D A;  2I5C A;  4K17 A;  4K81 A;  4GPT B;  4CHM A;  5J3Y A;  1NTV A;  1NTY A;  1OY2 A;  1OMW A;  1AQC A;  1V88 A;  1NI2 A;  2MWN B;  2COA A;  3SYX A;  1DDV A;  4F7U P;  2P0H A;  1H4R A;  2YT0 A;  3V5W A;  3X23 A;  4MK0 A;  2RUK B;  2LUL A;  2ZPY A;  4NSW A;  2LKO A;  3DXD A;  2G35 A;  1ZM0 A;  2COF A;  2DFK A;  1TJ6 A;  2CRF A;  2Y8F A;  4EJN A;  2M38 A;  3SNH A;  4EKU A;  3P6A A;  3KY9 A;  4C0A A;  2VKI A;  1X11 A;  3FEH A;  2RLO A;  2CY5 A;  4IFS A;  2VSZ A;  2J0M A;  2P0F A;  1W1D A;  1U5F A;  1WGU A;  1V5U A;  5LOP B;  2D4Q A;  2W2X C;  2EMS A;  3VOQ A;  2DYN A;  1MIZ B;  1U27 A;  1V89 A;  5HE0 A;  3KRW A;  4A6H A;  1TQZ A;  1P6S A;  4HAV B;  2QKM A;  4KVG B;  3HW2 B;  4WJ7 A;  2QKL A;  3TW1 A;  1UPR A;  1LW3 A;  2EJ8 A;  1W1G A;  3MPX A;  1DDW A;  1KI1 B;  2JP2 A;  1IRS A;  4F7H A;  4DXA B;  5EFX A;  2COD A;  1PLS A;  1N3H A;  5J3Q A;  3PVW A;  1MK7 B;  4WSF A;  1GG3 A;  4HDO A;  2NMB A;  4HAZ B;  2GS0 A;  2YRY A;  2X18 A;  5D3X A;  5C16 A;  4HHV A;  4HAU B;  1DRO A;  2CY4 A;  2H7D A;  3F5R A;  3KRX A;  3PP2 A;  3FSS A;  1FOE A;  1Q67 A;  3TVV A;  3SUZ A;  1WI1 A;  5DH9 B;  4HDQ A;  2AL6 A;  1XOD A;  2YS3 A;  3DXC A;  1U29 A;  1U5D A;  2Y8G A;  1FB8 A;  1BWN A;  2EMT A;  2MKR A;  3G9W A;  2E2X A;  2DA0 A;  1XKE A;  1MKE A;  5CLQ B;  3ULC A;  5JLJ B;  3F0W A;  2YVC A;  5D3V A;  4HB4 B;  2HE7 A;  1H10 A;  1MK9 B;  2YF0 A;  1FHW A;  4A6F A;  1FAO A;  1Y19 B;  2YS5 A;  2RVB B;  4K2O A;  2J0J A;  3WA0 A;  1UNP A;  1SHC A;  3ODW A;  1U5E A;  5GOW B;  4A6K A;  1M7R A;  2DTC A;  1WJ1 A;  5KQ4 A;  2K00 A;  5C6R A;  1K5D B;  2D9X A;  5C5B B;  2KCJ A;  5FI0 A;  3A98 B; 
#chains in the Genus database with same CATH topology
 1TXD A;  2OQB A;  1DYN A;  1PFJ A;  4GMX B;  2ROV A;  2UZS A;  1ZC4 B;  2M14 A;  1WG7 A;  3DCX A;  3HQC A;  2DYQ A;  4F7G A;  3VIA A;  3IVF A;  4OT1 A;  3ML4 A;  1UNQ A;  3PSC A;  3NW8 A;  1B55 A;  5JP4 A;  4ZRI A;  3RCP A;  2DHI A;  3CIK A;  1UEF A;  1KZ7 A;  4GN1 A;  1X1G A;  4WVF B;  3QIJ A;  4YON A;  3AU5 A;  5FI1 A;  2D2Q A;  5LG4 B;  1U5G A;  1RJ2 A;  2DHK A;  2KIG A;  4HSI A;  2KR0 A;  3A8Q A;  1P5T A;  1GC6 A;  1I2H A;  1WJM A;  4KHA A;  2PZ1 A;  3ULB A;  2YSZ A;  5DHA B;  1BTN A;  4HAX B;  1FGY A;  4H8S A;  3D8D A;  1BTK A;  2KIE A;  2NBV A;  2N0Y A;  4ZRJ A;  3PVU A;  5JHH A;  5KQ1 A;  2R09 A;  1ZC3 B;  3OAN A;  2K49 A;  2RRF A;  3AU4 A;  4CHJ A;  1U2B A;  2ZKM X;  3ODX A;  1UPQ A;  4Y94 A;  5LON B;  3PVL A;  1V61 A;  1UNR A;  3FVC A;  2D10 A;  2I1K A;  1ZVR A;  2D9Z A;  4A6F B;  5IRS A;  2GJY A;  4EMO A;  2VRW B;  2GCL A;  4MT7 A;  3PG7 A;  1BAK A;  1WGQ A;  1XX0 A;  2HTH B;  5JHG A;  1FHO A;  3UZT A;  2FJU B;  1E5W A;  4CSQ A;  4GOU A;  2I5F A;  3U7D A;  2ELB A;  5HE3 A;  4DX9 0;  4QXA B;  3DXE A;  4TYZ A;  1X1F A;  4GXB A;  1KZG A;  2FJL A;  2IFS A;  2DKP A;  2J0K A;  2DX1 A;  1EF1 A;  4PNK A;  1K5G B;  1EVH A;  1LB1 A;  2GCJ A;  3QBV B;  2KUQ A;  3SV1 A;  2K8E A;  1X05 A;  2V76 A;  1GC7 A;  4NY0 A;  2YT1 A;  2LYD A;  3O96 A;  2UZR A;  4YL8 A;  3D8F A;  5D3W A;  2P8V A;  4D6W A;  4L6E A;  4K2P A;  4B6H A;  1MIX A;  3TCA A;  3BJI A;  4GZU A;  2L1C A;  2Z0P A;  3GYO A;  2N23 A;  3D8E A;  2AEH A;  3ZVR A;  2LG1 A;  2IYB A;  2D9V A;  3AJ4 A;  3MDB C;  1W1H A;  2RSG A;  4DIX A;  4QJ4 B;  1EAZ A;  4CYE A;  2LOZ A;  2NZ8 B;  5J3T A;  1AWE A;  5DIF B;  2ELA A;  1XCG A;  3CXB B;  1NU2 A;  4Z2M B;  4DX8 A;  1QC6 A;  2YS1 A;  4HAT B;  4P7I A;  1WVH A;  1RRP B;  1ZYI A;  3WYF B;  2LOX A;  1FGZ A;  3T06 A;  2Z0O A;  1ZSQ A;  2KGX B;  4D0N B;  1MAI A;  1QQG A;  4HAY B;  5C5B A;  1X86 A;  3SO6 A;  4TKN A;  1XR0 B;  4BBK A;  1Y5O A;  3NWA A;  2GUM A;  2COC A;  1V5M A;  4IAP A;  2RGN B;  2YT2 A;  4HB3 B;  2Y7B A;  1J0W A;  2KUP A;  5C79 A;  2D11 A;  2OTX A;  4PQ0 A;  4L1R A;  3NWF A;  1OQN A;  4MY6 A;  2XQN M;  5D3Y A;  3HK0 A;  4GNK B;  3LJU X;  1PMS A;  1Z87 A;  2W2W A;  1M7E A;  3PEG A;  2ADZ A;  2D9Y A;  1DBH A;  4DBB A;  1T77 A;  2H7E A;  5L81 A;  1I7A A;  2BCJ A;  2I1J A;  3A8P A;  3TO1 A;  4HAW B;  2MDX A;  5HE1 A;  3NSU A;  2K2J A;  3KZ1 A;  2J59 M;  1DDM A;  3KSY A;  3GYP A;  2EC1 A;  2MFQ A;  3BIN A;  4KHB B;  1P3R A;  2Q13 A;  4GMV A;  2CAY A;  1MI1 A;  1J19 A;  5HE2 A;  2K2U A;  2DKQ A;  3U8Z A;  3N7C A;  4HB2 B;  2DLW A;  5DI9 B;  2DN6 A;  3ZDT A;  4HB0 B;  1FHX A;  1ISN A;  3NWD A;  2L2I A;  1MPH A;  1V5P A;  2Z0Q A;  5CLL B;  3M1I B;  2DHJ A;  2DX5 A;  2Z4D A;  4KAX B;  3P7Z A;  5D27 A;  3PZD A;  4XWX A;  3TFM A;  1XD4 A;  5KCV A;  1EGX A;  4Z2N A;  2ROZ B;  2P0D A;  4IOY X;  3ODO A;  4KHO A;  1SGH A;  4ZRK A;  3QWM A;  3FM8 C;  2RNR B;  4A5K A;  2D9W A;  2W2X D;  5DHF B;  2UVM A;  2R0D A;  2I5C A;  4K17 A;  5I2S A;  3A58 A;  4K81 A;  4GPT B;  4CHM A;  5J3Y A;  1NTV A;  1NTY A;  1OY2 A;  3OHM B;  1OMW A;  1AQC A;  1V88 A;  1NI2 A;  2MWN B;  2COA A;  3SYX A;  1DDV A;  4F7U P;  4QJ3 B;  2P0H A;  1H4R A;  2YT0 A;  3V5W A;  3X23 A;  4MK0 A;  2RUK B;  2LUL A;  2ZPY A;  5M4Y B;  4NSW A;  2LKO A;  3DXD A;  2G35 A;  1ZM0 A;  2COF A;  2DFK A;  1TJ6 A;  2CRF A;  2Y8F A;  4EJN A;  2M38 A;  3SNH A;  4EKU A;  4OSN A;  3P6A A;  3KY9 A;  4C0A A;  2VKI A;  1X11 A;  3FEH A;  2RLO A;  2CY5 A;  4IFS A;  2VSZ A;  2J0M A;  2P0F A;  1W1D A;  1U5F A;  1WGU A;  1V5U A;  5LOP B;  2D4Q A;  2W2X C;  2EMS A;  3VOQ A;  2DYN A;  1MIZ B;  1U27 A;  1V89 A;  5HE0 A;  3KRW A;  4A6H A;  1TQZ A;  1P6S A;  4HAV B;  2QKM A;  4KVG B;  3HW2 B;  4WJ7 A;  2QKL A;  3TW1 A;  1UPR A;  1LW3 A;  2EJ8 A;  1W1G A;  3MPX A;  1DDW A;  1KI1 B;  2JP2 A;  1IRS A;  4F7H A;  4DXA B;  3HIE A;  5EFX A;  2COD A;  2Z14 A;  1PLS A;  1N3H A;  5J3Q A;  3PVW A;  1MK7 B;  4WSF A;  1GG3 A;  4HDO A;  2NMB A;  4HAZ B;  2GS0 A;  2YRY A;  2X18 A;  5D3X A;  5C16 A;  4HHV A;  4HAU B;  1DRO A;  2CY4 A;  2H7D A;  3F5R A;  3KRX A;  3PP2 A;  3FSS A;  1FOE A;  1Q67 A;  3TVV A;  3SUZ A;  1WI1 A;  5DH9 B;  4HDQ A;  2AL6 A;  1XOD A;  2YS3 A;  3DXC A;  1U29 A;  1U5D A;  2Y8G A;  1FB8 A;  1BWN A;  2EMT A;  2MKR A;  3G9W A;  2E2X A;  3HSA A;  2DA0 A;  1XKE A;  1MKE A;  5CLQ B;  3ULC A;  5I2M A;  5JLJ B;  3F0W A;  2YVC A;  3B77 A;  5D3V A;  4HB4 B;  2HE7 A;  1H10 A;  1MK9 B;  2YF0 A;  1FHW A;  4A6F A;  1FAO A;  1Y19 B;  4KHB A;  2YS5 A;  2RVB B;  3U12 A;  2Z59 A;  4K2O A;  2J0J A;  3WA0 A;  4QJ5 B;  1UNP A;  1SHC A;  3ODW A;  1U5E A;  5GOW B;  2R2Y A;  4A6K A;  1M7R A;  2DTC A;  1WJ1 A;  5KQ4 A;  2K00 A;  5C6R A;  1K5D B;  2D9X A;  5C5B B;  2KCJ A;  5FI0 A;  3A98 B;  2Z13 A; 
#chains in the Genus database with same CATH homology
 1TXD A;  2OQB A;  1DYN A;  1PFJ A;  4GMX B;  2ROV A;  2UZS A;  1ZC4 B;  2M14 A;  1WG7 A;  3HQC A;  2DYQ A;  4F7G A;  3VIA A;  3IVF A;  3ML4 A;  1UNQ A;  3PSC A;  1B55 A;  5JP4 A;  4ZRI A;  3RCP A;  2DHI A;  3CIK A;  1UEF A;  1KZ7 A;  4GN1 A;  1X1G A;  4WVF B;  3QIJ A;  4YON A;  3AU5 A;  5FI1 A;  2D2Q A;  1U5G A;  1RJ2 A;  2DHK A;  3A8Q A;  1P5T A;  1GC6 A;  1I2H A;  1WJM A;  4KHA A;  2PZ1 A;  3ULB A;  2YSZ A;  5DHA B;  1BTN A;  4HAX B;  1FGY A;  4H8S A;  3D8D A;  1BTK A;  2N0Y A;  4ZRJ A;  3PVU A;  5JHH A;  5KQ1 A;  2R09 A;  1ZC3 B;  3OAN A;  3AU4 A;  4CHJ A;  1U2B A;  3ODX A;  1UPQ A;  4Y94 A;  5LON B;  3PVL A;  1V61 A;  1UNR A;  2D10 A;  2I1K A;  1ZVR A;  2D9Z A;  4A6F B;  2GJY A;  4EMO A;  2VRW B;  2GCL A;  4MT7 A;  3PG7 A;  1BAK A;  1WGQ A;  1XX0 A;  2HTH B;  5JHG A;  1FHO A;  3UZT A;  1E5W A;  2I5F A;  3U7D A;  2ELB A;  5HE3 A;  4DX9 0;  3DXE A;  4TYZ A;  1X1F A;  4GXB A;  1KZG A;  2FJL A;  2IFS A;  2DKP A;  2J0K A;  2DX1 A;  1EF1 A;  4PNK A;  1K5G B;  1EVH A;  1LB1 A;  2GCJ A;  3QBV B;  3SV1 A;  1X05 A;  2V76 A;  1GC7 A;  4NY0 A;  2YT1 A;  2LYD A;  3O96 A;  2UZR A;  4YL8 A;  3D8F A;  5D3W A;  2P8V A;  4L6E A;  4K2P A;  4B6H A;  1MIX A;  3TCA A;  3BJI A;  4GZU A;  2L1C A;  2Z0P A;  3GYO A;  2N23 A;  3D8E A;  2AEH A;  3ZVR A;  2LG1 A;  2IYB A;  2D9V A;  3AJ4 A;  3MDB C;  1W1H A;  2RSG A;  1EAZ A;  4CYE A;  2LOZ A;  2NZ8 B;  5J3T A;  1AWE A;  5DIF B;  2ELA A;  1XCG A;  3CXB B;  1NU2 A;  4Z2M B;  4DX8 A;  1QC6 A;  2YS1 A;  4HAT B;  4P7I A;  1WVH A;  1RRP B;  3WYF B;  2LOX A;  1FGZ A;  3T06 A;  2Z0O A;  1ZSQ A;  2KGX B;  4D0N B;  1MAI A;  1QQG A;  4HAY B;  5C5B A;  1X86 A;  3SO6 A;  4TKN A;  1XR0 B;  4BBK A;  1Y5O A;  2COC A;  1V5M A;  4IAP A;  2RGN B;  4HB3 B;  2Y7B A;  1J0W A;  2KUP A;  5C79 A;  2D11 A;  2OTX A;  4PQ0 A;  1OQN A;  4MY6 A;  2XQN M;  5D3Y A;  3HK0 A;  3LJU X;  1PMS A;  1Z87 A;  2W2W A;  1M7E A;  3PEG A;  2ADZ A;  2D9Y A;  1DBH A;  4DBB A;  2H7E A;  5L81 A;  1I7A A;  2BCJ A;  2I1J A;  3A8P A;  3TO1 A;  4HAW B;  2MDX A;  5HE1 A;  3NSU A;  2K2J A;  3KZ1 A;  2J59 M;  1DDM A;  3KSY A;  3GYP A;  2EC1 A;  2MFQ A;  3BIN A;  4KHB B;  1P3R A;  2Q13 A;  4GMV A;  2CAY A;  5HE2 A;  1J19 A;  2K2U A;  2DKQ A;  3U8Z A;  3N7C A;  4HB2 B;  2DLW A;  5DI9 B;  2DN6 A;  3ZDT A;  4HB0 B;  1FHX A;  1ISN A;  2L2I A;  1MPH A;  1V5P A;  2Z0Q A;  5CLL B;  3M1I B;  2DHJ A;  2DX5 A;  4KAX B;  3P7Z A;  5D27 A;  3PZD A;  4XWX A;  3TFM A;  1XD4 A;  5KCV A;  1EGX A;  4Z2N A;  2ROZ B;  2P0D A;  4IOY X;  3ODO A;  4KHO A;  1SGH A;  4ZRK A;  3QWM A;  3FM8 C;  2RNR B;  4A5K A;  2D9W A;  2W2X D;  5DHF B;  2UVM A;  2R0D A;  2I5C A;  4K17 A;  4K81 A;  4GPT B;  4CHM A;  5J3Y A;  1NTV A;  1NTY A;  1OY2 A;  1OMW A;  1AQC A;  1V88 A;  1NI2 A;  2MWN B;  2COA A;  3SYX A;  1DDV A;  4F7U P;  2P0H A;  1H4R A;  2YT0 A;  3V5W A;  3X23 A;  4MK0 A;  2RUK B;  2LUL A;  2ZPY A;  4NSW A;  2LKO A;  3DXD A;  2G35 A;  1ZM0 A;  2COF A;  2DFK A;  1TJ6 A;  2CRF A;  2Y8F A;  4EJN A;  2M38 A;  3SNH A;  4EKU A;  3P6A A;  3KY9 A;  4C0A A;  2VKI A;  1X11 A;  3FEH A;  2RLO A;  2CY5 A;  4IFS A;  2VSZ A;  2J0M A;  2P0F A;  1W1D A;  1U5F A;  1WGU A;  1V5U A;  5LOP B;  2D4Q A;  2W2X C;  2EMS A;  3VOQ A;  2DYN A;  1MIZ B;  1U27 A;  1V89 A;  5HE0 A;  3KRW A;  4A6H A;  1TQZ A;  1P6S A;  4HAV B;  2QKM A;  4KVG B;  3HW2 B;  4WJ7 A;  2QKL A;  3TW1 A;  1UPR A;  1LW3 A;  2EJ8 A;  1W1G A;  3MPX A;  1DDW A;  1KI1 B;  2JP2 A;  1IRS A;  4F7H A;  4DXA B;  5EFX A;  2COD A;  1PLS A;  1N3H A;  5J3Q A;  3PVW A;  1MK7 B;  4WSF A;  1GG3 A;  4HDO A;  2NMB A;  4HAZ B;  2GS0 A;  2YRY A;  2X18 A;  5D3X A;  5C16 A;  4HHV A;  4HAU B;  1DRO A;  2CY4 A;  2H7D A;  3F5R A;  3KRX A;  3PP2 A;  3FSS A;  1FOE A;  1Q67 A;  3TVV A;  3SUZ A;  1WI1 A;  5DH9 B;  4HDQ A;  2AL6 A;  1XOD A;  2YS3 A;  3DXC A;  1U29 A;  1U5D A;  2Y8G A;  1FB8 A;  1BWN A;  2EMT A;  2MKR A;  3G9W A;  2E2X A;  2DA0 A;  1XKE A;  1MKE A;  5CLQ B;  3ULC A;  5JLJ B;  3F0W A;  2YVC A;  5D3V A;  4HB4 B;  2HE7 A;  1H10 A;  1MK9 B;  2YF0 A;  1FHW A;  4A6F A;  1FAO A;  1Y19 B;  2YS5 A;  2RVB B;  4K2O A;  2J0J A;  3WA0 A;  1UNP A;  1SHC A;  3ODW A;  1U5E A;  5GOW B;  4A6K A;  1M7R A;  2DTC A;  1WJ1 A;  5KQ4 A;  2K00 A;  5C6R A;  1K5D B;  2D9X A;  5C5B B;  2KCJ A;  5FI0 A;  3A98 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...