2QKMA

The crystal structure of fission yeast mrna decapping enzyme dcp1-dcp2 complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
127
structure length
123
Chain Sequence
MEDENILRNAVNLQVLKFHYPEIESIIDIASHVAVYQFDKWLKTSIEGTFFLVKDQRARVGYVILNRNSPENLYLFINHPSNVHLVDRYLIHRTENQHVVGLWMFDPNDMSRIFNIVKESLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPBC3B9.21 protein
publication title Structural basis of dcp2 recognition and activation by dcp1.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Hydrolase
total genus 32
structure length 123
sequence length 127
chains with identical sequence C, E, G
ec nomenclature ec 3.6.1.30: Transferred entry: 3.6.1.59 and 3.6.1.62.
pdb deposition date 2007-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2qkmA00
2QKMA 1ZC3B 2YT0A 5C16A 5D27A 2N0YA 1UPRA 3DXEA 2YVCA 1V5PA 2K2UA 3WYFB 2P0HA 2K00A 3TFMA 1U5DA 4EKUA 3HK0A 1P3RA 2D9XA 2H7DA 4EMOA 1LW3A 3D8DA 1GC7A 3MDBC 2RUKB 1TXDA 4WJ7A 1M7RA 1GG3A 4YL8A 1XODA 3ML4A 3SUZA 5J3YA 2I5CA 1QC6A 2DTCA 2DX5A 1V5MA 3FSSA 1Y5OA 4ZRIA 1X05A 2GCJA 4A6HA 5D3WA 4HB2B 3F0WA 1AWEA 1Q67A 5L81A 1MPHA 2I1KA 2DLWA 3BINA 1MIZB 4HB3B 1P5TA 1V61A 2VSZA 2M14A 4CHJA 1PLSA 2ROVA 4HDOA 2COFA 1UNQA 1OQNA 4CHMA 1ISNA 4HATB 2LKOA 4L6EA 2Q13A 3AU5A 3ZVRA 3QIJA 1NTVA 4C0AA 2HTHB 2R09A 3A8QA 2GCLA 2DX1A 1GC6A 1V89A 1BTNA 2YSZA 3BJIA 2IYBA 2P8VA 2L1CA 4K2OA 1U27A 1FB8A 1SHCA 1WGUA 1ZM0A 2UZRA 5LONB 2IFSA 5C5BB 2X18A 1U5GA 3KZ1A 2Y8GA 1WJMA 1J0WA 5J3TA 3T06A 1B55A 2G35A 2ZPYA 2XQNM 2DKPA 3SV1A 4DX8A 2D4QA 1MAIA 2ROZB 3M1IB 2AL6A 3ULCA 2LOXA 1UNRA 4MY6A 2D11A 1KI1B 1LB1A 2J0KA 1Y19B 4YONA 5HE1A 1WG7A 2P0FA 2EC1A 5FI1A 4EJNA 3VOQA 2W2WA 1X11A 2V76A 4IFSA 1MK9B 5D3YA 4NY0A 5LOPB 2DA0A 5HE2A 1UEFA 2CAYA 4KHOA 1XR0B 4B6HA 4Z2NA 4K2PA 3D8FA 1MKEA 3DXCA 5GOWB 4PNKA 1Z87A 1H10A 4HAVB 1V5UA 4TKNA 2DN6A 1X86A 1MK7B 3PVLA 1EVHA 5DHAB 1M7EA 5HE0A 2RLOA 3PSCA 3GYPA 4HAWB 4F7HA 3IVFA 3SNHA 1EF1A 1PMSA 4HDQA 3KRWA 1FOEA 2DHIA 2MDXA 1U5FA 3TCAA 3CIKA 3PG7A 2Z0QA 1P6SA 1U2BA 2W2XD 1K5DB 1ZC4B 1UPQA 4GMXB 2RVBB 2OQBA 2MFQA 3AJ4A 1NTYA 4KVGB 1WI1A 4IOYX 2RNRB 3WA0A 2DHJA 2CRFA 4GPTB 2UZSA 1DDVA 3OANA 2H7EA 1FGYA 3KSYA 2LG1A 3A8PA 3TO1A 2COCA 2QKLA 2VRWB 3TVVA 2RSGA 1XKEA 1TJ6A 2Z0PA 4GMVA 1QQGA 2D9WA 3X23A 4DXAB 1IRSA 3PVWA 4WSFA 1UNPA 1NI2A 1KZGA 3PEGA 3O96A 1W1GA 1W1HA 2KUPA 1AQCA 3PVUA 3A98B 2DHKA 5C79A 4GN1A 2COAA 2LOZA 5DIFB 1PFJA 4K17A 2LYDA 3KY9A 4WVFB 4DBBA 1XCGA 1FHWA 5DI9B 2UVMA 4K81A 2RGNB 1ZSQA 2CY5A 3G9WA 4HHVA 4KAXB 4HAUB 3VIAA 4BBKA 1I2HA 2D9ZA 5C5BA 1W1DA 3PZDA 3D8EA 3FM8C 3LJUX 2YRYA 2KCJA 2Y7BA 2J0JA 3AU4A 3RCPA 1X1GA 1DDMA 2GS0A 1WJ1A 3DXDA 4A6FA 1NU2A 1U29A 1BWNA 4KHAA 1RRPB 4F7UP 2EMTA 4A6KA 1DYNA 3QWMA 1MIXA 3N7CA 5C6RA 2YS3A 5CLLB 1V88A 2DFKA 1DROA 3ULBA 4ZRKA 5CLQB 2KGXB 2MWNB 2DYNA 2I1JA 2J0MA 1FGZA 2DYQA 3P6AA 4HAYB 4TYZA 3GYOA 2D10A 3F5RA 5JP4A 4HAXB 2NMBA 1K5GB 1BAKA 1TQZA 1OY2A 5KQ1A 2PZ1A 2ADZA 2FJLA 3SYXA 1WVHA 4PQ0A 4CYEA 1RJ2A 5JHGA 3P7ZA 3HW2B 1OMWA 1H4RA 5D3XA 2N23A 4Y94A 2I5FA 3KRXA 5FI0A 5KCVA 2YF0A 3CXBB 5KQ4A 5JHHA 1EGXA 1XD4A 2L2IA 3U8ZA 3NSUA 1SGHA 1X1FA 4KHBB 4A5KA 3FEHA 5DH9B 2E2XA 2EJ8A 4F7GA 5D3VA 4GZUA 1DBHA 1FHOA 2JP2A 4P7IA 2YS1A 1FHXA 3SO6A 2D2QA 2YS5A 2K2JA 1KZ7A 2W2XC 2VKIA 1EAZA 2LULA 1I7AA 5J3QA 3MPXA 4H8SA 3U7DA 1XX0A 2MKRA 2Y8FA 2GJYA 1N3HA 4MK0A 1DDWA 4NSWA 2ELAA 1ZVRA 2AEHA 3ODXA 1J19A 2Z0OA 2CODA 3ODWA 4IAPA 3ZDTA 2BCJA 4HAZB 3HQCA 5EFXA 3ODOA 5HE3A 2YT1A 2NZ8B 1WGQA 3TW1A 2P0DA 1U5EA 3PP2A 1BTKA 4DX90 2DKQA 2OTXA 2R0DA 1E5WA 5DHFB 2EMSA 2J59M 5JLJB 4XWXA 4A6FB 4D0NB 4HB0B 3UZTA 3QBVB 2D9YA 2D9VA 2HE7A 1FAOA 4ZRJA 2ELBA 4MT7A 2M38A 4Z2MB 3V5WA 4HB4B 4GXBA 2CY4A
chains in the Genus database with same CATH superfamily
2QKMA 1ZC3B 2YT0A 5C16A 5D27A 2N0YA 1UPRA 3DXEA 2YVCA 1V5PA 2K2UA 3WYFB 2P0HA 2K00A 3TFMA 1U5DA 4EKUA 3HK0A 1P3RA 2D9XA 2H7DA 2Z4DA 4EMOA 1LW3A 3D8DA 1GC7A 3MDBC 2RUKB 1TXDA 4WJ7A 1M7RA 1GG3A 4OSNA 4YL8A 1XODA 3ML4A 3SUZA 5J3YA 2I5CA 1QC6A 2DTCA 2DX5A 1V5MA 3FSSA 2KUQA 1Y5OA 4ZRIA 1X05A 2GCJA 2K49A 4A6HA 5D3WA 4HB2B 3F0WA 1AWEA 2GUMA 1Q67A 2RRFA 5L81A 1MPHA 4L1RA 2I1KA 2DLWA 3BINA 1MIZB 4HB3B 1P5TA 1V61A 2VSZA 2M14A 4CHJA 1PLSA 2ROVA 4HDOA 2COFA 1UNQA 1OQNA 4CHMA 4HSIA 1ISNA 4HATB 2LKOA 4L6EA 2Q13A 3AU5A 3ZVRA 3QIJA 1NTVA 4C0AA 4QJ3B 2HTHB 2R09A 3A8QA 2GCLA 2DX1A 1GC6A 1V89A 1BTNA 2YSZA 4KHBA 3BJIA 4OT1A 2IYBA 2P8VA 2L1CA 4K2OA 1U27A 1FB8A 1SHCA 1WGUA 1ZM0A 2UZRA 5LONB 2IFSA 5C5BB 2X18A 1U5GA 3KZ1A 2Y8GA 1WJMA 1J0WA 1MI1A 5J3TA 1ZYIA 3T06A 1B55A 2G35A 2ZPYA 2XQNM 2DKPA 3SV1A 3HSAA 4DX8A 2D4QA 1MAIA 2ROZB 3M1IB 2AL6A 3ULCA 2LOXA 2KIGA 1UNRA 4MY6A 2D11A 3U12A 1KI1B 1LB1A 2J0KA 1Y19B 4YONA 5HE1A 1WG7A 2P0FA 2EC1A 5FI1A 4QJ5B 4EJNA 3VOQA 2W2WA 1X11A 2R2YA 2V76A 4IFSA 1MK9B 5D3YA 4NY0A 5LOPB 2DA0A 5HE2A 1UEFA 2CAYA 4KHOA 1XR0B 4B6HA 4Z2NA 4K2PA 3A58A 3D8FA 1MKEA 3DXCA 5GOWB 4PNKA 1Z87A 1H10A 4HAVB 1V5UA 4TKNA 2DN6A 1X86A 3OHMB 1MK7B 3PVLA 1EVHA 5DHAB 1M7EA 5HE0A 2RLOA 3PSCA 3GYPA 4HAWB 4F7HA 3IVFA 3SNHA 1EF1A 1PMSA 4HDQA 3KRWA 1FOEA 2DHIA 2KIEA 2MDXA 1U5FA 3TCAA 3CIKA 3PG7A 2Z0QA 1P6SA 1U2BA 2W2XD 1K5DB 1ZC4B 1UPQA 4GMXB 2RVBB 2OQBA 2MFQA 3AJ4A 1NTYA 3DCXA 4KVGB 4GOUA 1WI1A 4IOYX 2RNRB 3WA0A 2DHJA 2CRFA 4GPTB 3FVCA 2UZSA 1DDVA 3OANA 2H7EA 1FGYA 3KSYA 2LG1A 3A8PA 3TO1A 2COCA 2QKLA 2VRWB 3TVVA 2RSGA 1XKEA 2Z59A 1TJ6A 2Z13A 2Z0PA 4GMVA 1QQGA 2D9WA 3X23A 4DXAB 1IRSA 3PVWA 4WSFA 1UNPA 1NI2A 1KZGA 3PEGA 3O96A 1W1GA 1W1HA 2KUPA 1AQCA 3PVUA 5IRSA 3A98B 5I2MA 2DHKA 5C79A 4GN1A 2COAA 2LOZA 5DIFB 1PFJA 4K17A 2LYDA 3KY9A 3NWDA 4WVFB 4DBBA 1XCGA 2YT2A 1FHWA 5M4YB 5DI9B 2UVMA 4K81A 2FJUB 2RGNB 1ZSQA 4CSQA 2CY5A 3G9WA 4HHVA 4KAXB 4HAUB 3VIAA 4BBKA 1I2HA 2D9ZA 4QJ4B 5C5BA 1W1DA 3PZDA 3D8EA 3FM8C 3LJUX 2YRYA 2KCJA 2K8EA 2Y7BA 2J0JA 3AU4A 3RCPA 1X1GA 1DDMA 2GS0A 1WJ1A 3DXDA 4A6FA 1NU2A 2KR0A 3NW8A 1U29A 1BWNA 4KHAA 1RRPB 4F7UP 2EMTA 4A6KA 1DYNA 3QWMA 1MIXA 3N7CA 5C6RA 2YS3A 5CLLB 1V88A 2DFKA 1DROA 3ULBA 4ZRKA 5CLQB 2KGXB 2MWNB 2DYNA 2I1JA 2J0MA 1FGZA 2DYQA 3P6AA 4HAYB 4QXAB 4TYZA 3GYOA 2D10A 3F5RA 5JP4A 4HAXB 2NMBA 1K5GB 1BAKA 1TQZA 1OY2A 5KQ1A 2PZ1A 2ADZA 2FJLA 3SYXA 1WVHA 4PQ0A 4CYEA 1RJ2A 5JHGA 3P7ZA 3HW2B 1OMWA 1H4RA 5D3XA 2N23A 4Y94A 2I5FA 3KRXA 5FI0A 5KCVA 2YF0A 3CXBB 5KQ4A 3HIEA 5JHHA 1EGXA 1XD4A 2L2IA 3U8ZA 3NSUA 4GNKB 1SGHA 1X1FA 4KHBB 4A5KA 3FEHA 5DH9B 2E2XA 2EJ8A 4F7GA 1T77A 5D3VA 4GZUA 1DBHA 1FHOA 2JP2A 4P7IA 2YS1A 1FHXA 3SO6A 2D2QA 2YS5A 2K2JA 1KZ7A 2W2XC 2VKIA 1EAZA 2LULA 1I7AA 5J3QA 3MPXA 4H8SA 3U7DA 1XX0A 3B77A 2MKRA 2Y8FA 2GJYA 1N3HA 4MK0A 1DDWA 4NSWA 2ELAA 5I2SA 1ZVRA 4DIXA 2AEHA 1J19A 3ODXA 2Z0OA 2CODA 3ODWA 4IAPA 3ZDTA 2BCJA 4HAZB 2Z14A 3HQCA 5EFXA 3ODOA 5HE3A 2YT1A 2NZ8B 1WGQA 3TW1A 2P0DA 5LG4B 2ZKMX 1U5EA 1BTKA 3PP2A 4DX90 2DKQA 2OTXA 2R0DA 1E5WA 5DHFB 2EMSA 2J59M 5JLJB 4XWXA 4A6FB 4D0NB 4HB0B 3UZTA 3QBVB 2D9YA 3NWAA 2NBVA 2D9VA 2HE7A 1FAOA 3NWFA 4ZRJA 2ELBA 4MT7A 2M38A 4Z2MB 3V5WA 4D6WA 4HB4B 4GXBA 2CY4A
chains in the Genus database with same CATH topology
2QKMA 1ZC3B 2YT0A 5C16A 5D27A 2N0YA 1UPRA 3DXEA 2YVCA 1V5PA 2K2UA 3WYFB 2P0HA 2K00A 3TFMA 1U5DA 4EKUA 3HK0A 1P3RA 2D9XA 2H7DA 4EMOA 1LW3A 3D8DA 1GC7A 3MDBC 2RUKB 1TXDA 4WJ7A 1M7RA 1GG3A 4YL8A 1XODA 3ML4A 3SUZA 5J3YA 2I5CA 1QC6A 2DTCA 2DX5A 1V5MA 3FSSA 1Y5OA 4ZRIA 1X05A 2GCJA 4A6HA 5D3WA 4HB2B 3F0WA 1AWEA 1Q67A 5L81A 1MPHA 2I1KA 2DLWA 3BINA 1MIZB 4HB3B 1P5TA 1V61A 2VSZA 2M14A 4CHJA 1PLSA 2ROVA 4HDOA 2COFA 1UNQA 1OQNA 4CHMA 1ISNA 4HATB 2LKOA 4L6EA 2Q13A 3AU5A 3ZVRA 3QIJA 1NTVA 4C0AA 2HTHB 2R09A 3A8QA 2GCLA 2DX1A 1GC6A 1V89A 1BTNA 2YSZA 3BJIA 2IYBA 2P8VA 2L1CA 4K2OA 1U27A 1FB8A 1SHCA 1WGUA 1ZM0A 2UZRA 5LONB 2IFSA 5C5BB 2X18A 1U5GA 3KZ1A 2Y8GA 1WJMA 1J0WA 5J3TA 3T06A 1B55A 2G35A 2ZPYA 2XQNM 2DKPA 3SV1A 4DX8A 2D4QA 1MAIA 2ROZB 3M1IB 2AL6A 3ULCA 2LOXA 1UNRA 4MY6A 2D11A 1KI1B 1LB1A 2J0KA 1Y19B 4YONA 5HE1A 1WG7A 2P0FA 2EC1A 5FI1A 4EJNA 3VOQA 2W2WA 1X11A 2V76A 4IFSA 1MK9B 5D3YA 4NY0A 5LOPB 2DA0A 5HE2A 1UEFA 2CAYA 4KHOA 1XR0B 4B6HA 4Z2NA 4K2PA 3D8FA 1MKEA 3DXCA 5GOWB 4PNKA 1Z87A 1H10A 4HAVB 1V5UA 4TKNA 2DN6A 1X86A 1MK7B 3PVLA 1EVHA 5DHAB 1M7EA 5HE0A 2RLOA 3PSCA 3GYPA 4HAWB 4F7HA 3IVFA 3SNHA 1EF1A 1PMSA 4HDQA 3KRWA 1FOEA 2DHIA 2MDXA 1U5FA 3TCAA 3CIKA 3PG7A 2Z0QA 1P6SA 1U2BA 2W2XD 1K5DB 1ZC4B 1UPQA 4GMXB 2RVBB 2OQBA 2MFQA 3AJ4A 1NTYA 4KVGB 1WI1A 4IOYX 2RNRB 3WA0A 2DHJA 2CRFA 4GPTB 2UZSA 1DDVA 3OANA 2H7EA 1FGYA 3KSYA 2LG1A 3A8PA 3TO1A 2COCA 2QKLA 2VRWB 3TVVA 2RSGA 1XKEA 1TJ6A 2Z0PA 4GMVA 1QQGA 2D9WA 3X23A 4DXAB 1IRSA 3PVWA 4WSFA 1UNPA 1NI2A 1KZGA 3PEGA 3O96A 1W1GA 1W1HA 2KUPA 1AQCA 3PVUA 3A98B 2DHKA 5C79A 4GN1A 2COAA 2LOZA 5DIFB 1PFJA 4K17A 2LYDA 3KY9A 4WVFB 4DBBA 1XCGA 1FHWA 5DI9B 2UVMA 4K81A 2RGNB 1ZSQA 2CY5A 3G9WA 4HHVA 4KAXB 4HAUB 3VIAA 4BBKA 1I2HA 2D9ZA 5C5BA 1W1DA 3PZDA 3D8EA 3FM8C 3LJUX 2YRYA 2KCJA 2Y7BA 2J0JA 3AU4A 3RCPA 1X1GA 1DDMA 2GS0A 1WJ1A 3DXDA 4A6FA 1NU2A 1U29A 1BWNA 4KHAA 1RRPB 4F7UP 2EMTA 4A6KA 1DYNA 3QWMA 1MIXA 3N7CA 5C6RA 2YS3A 5CLLB 1V88A 2DFKA 1DROA 3ULBA 4ZRKA 5CLQB 2KGXB 2MWNB 2DYNA 2I1JA 2J0MA 1FGZA 2DYQA 3P6AA 4HAYB 4TYZA 3GYOA 2D10A 3F5RA 5JP4A 4HAXB 2NMBA 1K5GB 1BAKA 1TQZA 1OY2A 5KQ1A 2PZ1A 2ADZA 2FJLA 3SYXA 1WVHA 4PQ0A 4CYEA 1RJ2A 5JHGA 3P7ZA 3HW2B 1OMWA 1H4RA 5D3XA 2N23A 4Y94A 2I5FA 3KRXA 5FI0A 5KCVA 2YF0A 3CXBB 5KQ4A 5JHHA 1EGXA 1XD4A 2L2IA 3U8ZA 3NSUA 1SGHA 1X1FA 4KHBB 4A5KA 3FEHA 5DH9B 2E2XA 2EJ8A 4F7GA 5D3VA 4GZUA 1DBHA 1FHOA 2JP2A 4P7IA 2YS1A 1FHXA 3SO6A 2D2QA 2YS5A 2K2JA 1KZ7A 2W2XC 2VKIA 1EAZA 2LULA 1I7AA 5J3QA 3MPXA 4H8SA 3U7DA 1XX0A 2MKRA 2Y8FA 2GJYA 1N3HA 4MK0A 1DDWA 4NSWA 2ELAA 1ZVRA 2AEHA 3ODXA 1J19A 2Z0OA 2CODA 3ODWA 4IAPA 3ZDTA 2BCJA 4HAZB 3HQCA 5EFXA 3ODOA 5HE3A 2YT1A 2NZ8B 1WGQA 3TW1A 2P0DA 1U5EA 3PP2A 1BTKA 4DX90 2DKQA 2OTXA 2R0DA 1E5WA 5DHFB 2EMSA 2J59M 5JLJB 4XWXA 4A6FB 4D0NB 4HB0B 3UZTA 3QBVB 2D9YA 2D9VA 2HE7A 1FAOA 4ZRJA 2ELBA 4MT7A 2M38A 4Z2MB 3V5WA 4HB4B 4GXBA 2CY4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QKM A;  1ZC3 B;  2YT0 A;  5C16 A;  5D27 A;  2N0Y A;  1UPR A;  3DXE A;  2YVC A;  1V5P A;  2K2U A;  3WYF B;  2P0H A;  2K00 A;  3TFM A;  1U5D A;  4EKU A;  3HK0 A;  1P3R A;  2D9X A;  2H7D A;  4EMO A;  1LW3 A;  3D8D A;  1GC7 A;  3MDB C;  2RUK B;  1TXD A;  4WJ7 A;  1M7R A;  1GG3 A;  4YL8 A;  1XOD A;  3ML4 A;  3SUZ A;  5J3Y A;  2I5C A;  1QC6 A;  2DTC A;  2DX5 A;  1V5M A;  3FSS A;  1Y5O A;  4ZRI A;  1X05 A;  2GCJ A;  4A6H A;  5D3W A;  4HB2 B;  3F0W A;  1AWE A;  1Q67 A;  5L81 A;  1MPH A;  2I1K A;  2DLW A;  3BIN A;  1MIZ B;  4HB3 B;  1P5T A;  1V61 A;  2VSZ A;  2M14 A;  4CHJ A;  1PLS A;  2ROV A;  4HDO A;  2COF A;  1UNQ A;  1OQN A;  4CHM A;  1ISN A;  4HAT B;  2LKO A;  4L6E A;  2Q13 A;  3AU5 A;  3ZVR A;  3QIJ A;  1NTV A;  4C0A A;  2HTH B;  2R09 A;  3A8Q A;  2GCL A;  2DX1 A;  1GC6 A;  1V89 A;  1BTN A;  2YSZ A;  3BJI A;  2IYB A;  2P8V A;  2L1C A;  4K2O A;  1U27 A;  1FB8 A;  1SHC A;  1WGU A;  1ZM0 A;  2UZR A;  5LON B;  2IFS A;  5C5B B;  2X18 A;  1U5G A;  3KZ1 A;  2Y8G A;  1WJM A;  1J0W A;  5J3T A;  3T06 A;  1B55 A;  2G35 A;  2ZPY A;  2XQN M;  2DKP A;  3SV1 A;  4DX8 A;  2D4Q A;  1MAI A;  2ROZ B;  3M1I B;  2AL6 A;  3ULC A;  2LOX A;  1UNR A;  4MY6 A;  2D11 A;  1KI1 B;  1LB1 A;  2J0K A;  1Y19 B;  4YON A;  5HE1 A;  1WG7 A;  2P0F A;  2EC1 A;  5FI1 A;  4EJN A;  3VOQ A;  2W2W A;  1X11 A;  2V76 A;  4IFS A;  1MK9 B;  5D3Y A;  4NY0 A;  5LOP B;  2DA0 A;  5HE2 A;  1UEF A;  2CAY A;  4KHO A;  1XR0 B;  4B6H A;  4Z2N A;  4K2P A;  3D8F A;  1MKE A;  3DXC A;  5GOW B;  4PNK A;  1Z87 A;  1H10 A;  4HAV B;  1V5U A;  4TKN A;  2DN6 A;  1X86 A;  1MK7 B;  3PVL A;  1EVH A;  5DHA B;  1M7E A;  5HE0 A;  2RLO A;  3PSC A;  3GYP A;  4HAW B;  4F7H A;  3IVF A;  3SNH A;  1EF1 A;  1PMS A;  4HDQ A;  3KRW A;  1FOE A;  2DHI A;  2MDX A;  1U5F A;  3TCA A;  3CIK A;  3PG7 A;  2Z0Q A;  1P6S A;  1U2B A;  2W2X D;  1K5D B;  1ZC4 B;  1UPQ A;  4GMX B;  2RVB B;  2OQB A;  2MFQ A;  3AJ4 A;  1NTY A;  4KVG B;  1WI1 A;  4IOY X;  2RNR B;  3WA0 A;  2DHJ A;  2CRF A;  4GPT B;  2UZS A;  1DDV A;  3OAN A;  2H7E A;  1FGY A;  3KSY A;  2LG1 A;  3A8P A;  3TO1 A;  2COC A;  2QKL A;  2VRW B;  3TVV A;  2RSG A;  1XKE A;  1TJ6 A;  2Z0P A;  4GMV A;  1QQG A;  2D9W A;  3X23 A;  4DXA B;  1IRS A;  3PVW A;  4WSF A;  1UNP A;  1NI2 A;  1KZG A;  3PEG A;  3O96 A;  1W1G A;  1W1H A;  2KUP A;  1AQC A;  3PVU A;  3A98 B;  2DHK A;  5C79 A;  4GN1 A;  2COA A;  2LOZ A;  5DIF B;  1PFJ A;  4K17 A;  2LYD A;  3KY9 A;  4WVF B;  4DBB A;  1XCG A;  1FHW A;  5DI9 B;  2UVM A;  4K81 A;  2RGN B;  1ZSQ A;  2CY5 A;  3G9W A;  4HHV A;  4KAX B;  4HAU B;  3VIA A;  4BBK A;  1I2H A;  2D9Z A;  5C5B A;  1W1D A;  3PZD A;  3D8E A;  3FM8 C;  3LJU X;  2YRY A;  2KCJ A;  2Y7B A;  2J0J A;  3AU4 A;  3RCP A;  1X1G A;  1DDM A;  2GS0 A;  1WJ1 A;  3DXD A;  4A6F A;  1NU2 A;  1U29 A;  1BWN A;  4KHA A;  1RRP B;  4F7U P;  2EMT A;  4A6K A;  1DYN A;  3QWM A;  1MIX A;  3N7C A;  5C6R A;  2YS3 A;  5CLL B;  1V88 A;  2DFK A;  1DRO A;  3ULB A;  4ZRK A;  5CLQ B;  2KGX B;  2MWN B;  2DYN A;  2I1J A;  2J0M A;  1FGZ A;  2DYQ A;  3P6A A;  4HAY B;  4TYZ A;  3GYO A;  2D10 A;  3F5R A;  5JP4 A;  4HAX B;  2NMB A;  1K5G B;  1BAK A;  1TQZ A;  1OY2 A;  5KQ1 A;  2PZ1 A;  2ADZ A;  2FJL A;  3SYX A;  1WVH A;  4PQ0 A;  4CYE A;  1RJ2 A;  5JHG A;  3P7Z A;  3HW2 B;  1OMW A;  1H4R A;  5D3X A;  2N23 A;  4Y94 A;  2I5F A;  3KRX A;  5FI0 A;  5KCV A;  2YF0 A;  3CXB B;  5KQ4 A;  5JHH A;  1EGX A;  1XD4 A;  2L2I A;  3U8Z A;  3NSU A;  1SGH A;  1X1F A;  4KHB B;  4A5K A;  3FEH A;  5DH9 B;  2E2X A;  2EJ8 A;  4F7G A;  5D3V A;  4GZU A;  1DBH A;  1FHO A;  2JP2 A;  4P7I A;  2YS1 A;  1FHX A;  3SO6 A;  2D2Q A;  2YS5 A;  2K2J A;  1KZ7 A;  2W2X C;  2VKI A;  1EAZ A;  2LUL A;  1I7A A;  5J3Q A;  3MPX A;  4H8S A;  3U7D A;  1XX0 A;  2MKR A;  2Y8F A;  2GJY A;  1N3H A;  4MK0 A;  1DDW A;  4NSW A;  2ELA A;  1ZVR A;  2AEH A;  3ODX A;  1J19 A;  2Z0O A;  2COD A;  3ODW A;  4IAP A;  3ZDT A;  2BCJ A;  4HAZ B;  3HQC A;  5EFX A;  3ODO A;  5HE3 A;  2YT1 A;  2NZ8 B;  1WGQ A;  3TW1 A;  2P0D A;  1U5E A;  3PP2 A;  1BTK A;  4DX9 0;  2DKQ A;  2OTX A;  2R0D A;  1E5W A;  5DHF B;  2EMS A;  2J59 M;  5JLJ B;  4XWX A;  4A6F B;  4D0N B;  4HB0 B;  3UZT A;  3QBV B;  2D9Y A;  2D9V A;  2HE7 A;  1FAO A;  4ZRJ A;  2ELB A;  4MT7 A;  2M38 A;  4Z2M B;  3V5W A;  4HB4 B;  4GXB A;  2CY4 A; 
#chains in the Genus database with same CATH topology
 2QKM A;  1ZC3 B;  2YT0 A;  5C16 A;  5D27 A;  2N0Y A;  1UPR A;  3DXE A;  2YVC A;  1V5P A;  2K2U A;  3WYF B;  2P0H A;  2K00 A;  3TFM A;  1U5D A;  4EKU A;  3HK0 A;  1P3R A;  2D9X A;  2H7D A;  2Z4D A;  4EMO A;  1LW3 A;  3D8D A;  1GC7 A;  3MDB C;  2RUK B;  1TXD A;  4WJ7 A;  1M7R A;  1GG3 A;  4OSN A;  4YL8 A;  1XOD A;  3ML4 A;  3SUZ A;  5J3Y A;  2I5C A;  1QC6 A;  2DTC A;  2DX5 A;  1V5M A;  3FSS A;  2KUQ A;  1Y5O A;  4ZRI A;  1X05 A;  2GCJ A;  2K49 A;  4A6H A;  5D3W A;  4HB2 B;  3F0W A;  1AWE A;  2GUM A;  1Q67 A;  2RRF A;  5L81 A;  1MPH A;  4L1R A;  2I1K A;  2DLW A;  3BIN A;  1MIZ B;  4HB3 B;  1P5T A;  1V61 A;  2VSZ A;  2M14 A;  4CHJ A;  1PLS A;  2ROV A;  4HDO A;  2COF A;  1UNQ A;  1OQN A;  4CHM A;  4HSI A;  1ISN A;  4HAT B;  2LKO A;  4L6E A;  2Q13 A;  3AU5 A;  3ZVR A;  3QIJ A;  1NTV A;  4C0A A;  4QJ3 B;  2HTH B;  2R09 A;  3A8Q A;  2GCL A;  2DX1 A;  1GC6 A;  1V89 A;  1BTN A;  2YSZ A;  4KHB A;  3BJI A;  4OT1 A;  2IYB A;  2P8V A;  2L1C A;  4K2O A;  1U27 A;  1FB8 A;  1SHC A;  1WGU A;  1ZM0 A;  2UZR A;  5LON B;  2IFS A;  5C5B B;  2X18 A;  1U5G A;  3KZ1 A;  2Y8G A;  1WJM A;  1J0W A;  1MI1 A;  5J3T A;  1ZYI A;  3T06 A;  1B55 A;  2G35 A;  2ZPY A;  2XQN M;  2DKP A;  3SV1 A;  3HSA A;  4DX8 A;  2D4Q A;  1MAI A;  2ROZ B;  3M1I B;  2AL6 A;  3ULC A;  2LOX A;  2KIG A;  1UNR A;  4MY6 A;  2D11 A;  3U12 A;  1KI1 B;  1LB1 A;  2J0K A;  1Y19 B;  4YON A;  5HE1 A;  1WG7 A;  2P0F A;  2EC1 A;  5FI1 A;  4QJ5 B;  4EJN A;  3VOQ A;  2W2W A;  1X11 A;  2R2Y A;  2V76 A;  4IFS A;  1MK9 B;  5D3Y A;  4NY0 A;  5LOP B;  2DA0 A;  5HE2 A;  1UEF A;  2CAY A;  4KHO A;  1XR0 B;  4B6H A;  4Z2N A;  4K2P A;  3A58 A;  3D8F A;  1MKE A;  3DXC A;  5GOW B;  4PNK A;  1Z87 A;  1H10 A;  4HAV B;  1V5U A;  4TKN A;  2DN6 A;  1X86 A;  3OHM B;  1MK7 B;  3PVL A;  1EVH A;  5DHA B;  1M7E A;  5HE0 A;  2RLO A;  3PSC A;  3GYP A;  4HAW B;  4F7H A;  3IVF A;  3SNH A;  1EF1 A;  1PMS A;  4HDQ A;  3KRW A;  1FOE A;  2DHI A;  2KIE A;  2MDX A;  1U5F A;  3TCA A;  3CIK A;  3PG7 A;  2Z0Q A;  1P6S A;  1U2B A;  2W2X D;  1K5D B;  1ZC4 B;  1UPQ A;  4GMX B;  2RVB B;  2OQB A;  2MFQ A;  3AJ4 A;  1NTY A;  3DCX A;  4KVG B;  4GOU A;  1WI1 A;  4IOY X;  2RNR B;  3WA0 A;  2DHJ A;  2CRF A;  4GPT B;  3FVC A;  2UZS A;  1DDV A;  3OAN A;  2H7E A;  1FGY A;  3KSY A;  2LG1 A;  3A8P A;  3TO1 A;  2COC A;  2QKL A;  2VRW B;  3TVV A;  2RSG A;  1XKE A;  2Z59 A;  1TJ6 A;  2Z13 A;  2Z0P A;  4GMV A;  1QQG A;  2D9W A;  3X23 A;  4DXA B;  1IRS A;  3PVW A;  4WSF A;  1UNP A;  1NI2 A;  1KZG A;  3PEG A;  3O96 A;  1W1G A;  1W1H A;  2KUP A;  1AQC A;  3PVU A;  5IRS A;  3A98 B;  5I2M A;  2DHK A;  5C79 A;  4GN1 A;  2COA A;  2LOZ A;  5DIF B;  1PFJ A;  4K17 A;  2LYD A;  3KY9 A;  3NWD A;  4WVF B;  4DBB A;  1XCG A;  2YT2 A;  1FHW A;  5M4Y B;  5DI9 B;  2UVM A;  4K81 A;  2FJU B;  2RGN B;  1ZSQ A;  4CSQ A;  2CY5 A;  3G9W A;  4HHV A;  4KAX B;  4HAU B;  3VIA A;  4BBK A;  1I2H A;  2D9Z A;  4QJ4 B;  5C5B A;  1W1D A;  3PZD A;  3D8E A;  3FM8 C;  3LJU X;  2YRY A;  2KCJ A;  2K8E A;  2Y7B A;  2J0J A;  3AU4 A;  3RCP A;  1X1G A;  1DDM A;  2GS0 A;  1WJ1 A;  3DXD A;  4A6F A;  1NU2 A;  2KR0 A;  3NW8 A;  1U29 A;  1BWN A;  4KHA A;  1RRP B;  4F7U P;  2EMT A;  4A6K A;  1DYN A;  3QWM A;  1MIX A;  3N7C A;  5C6R A;  2YS3 A;  5CLL B;  1V88 A;  2DFK A;  1DRO A;  3ULB A;  4ZRK A;  5CLQ B;  2KGX B;  2MWN B;  2DYN A;  2I1J A;  2J0M A;  1FGZ A;  2DYQ A;  3P6A A;  4HAY B;  4QXA B;  4TYZ A;  3GYO A;  2D10 A;  3F5R A;  5JP4 A;  4HAX B;  2NMB A;  1K5G B;  1BAK A;  1TQZ A;  1OY2 A;  5KQ1 A;  2PZ1 A;  2ADZ A;  2FJL A;  3SYX A;  1WVH A;  4PQ0 A;  4CYE A;  1RJ2 A;  5JHG A;  3P7Z A;  3HW2 B;  1OMW A;  1H4R A;  5D3X A;  2N23 A;  4Y94 A;  2I5F A;  3KRX A;  5FI0 A;  5KCV A;  2YF0 A;  3CXB B;  5KQ4 A;  3HIE A;  5JHH A;  1EGX A;  1XD4 A;  2L2I A;  3U8Z A;  3NSU A;  4GNK B;  1SGH A;  1X1F A;  4KHB B;  4A5K A;  3FEH A;  5DH9 B;  2E2X A;  2EJ8 A;  4F7G A;  1T77 A;  5D3V A;  4GZU A;  1DBH A;  1FHO A;  2JP2 A;  4P7I A;  2YS1 A;  1FHX A;  3SO6 A;  2D2Q A;  2YS5 A;  2K2J A;  1KZ7 A;  2W2X C;  2VKI A;  1EAZ A;  2LUL A;  1I7A A;  5J3Q A;  3MPX A;  4H8S A;  3U7D A;  1XX0 A;  3B77 A;  2MKR A;  2Y8F A;  2GJY A;  1N3H A;  4MK0 A;  1DDW A;  4NSW A;  2ELA A;  5I2S A;  1ZVR A;  4DIX A;  2AEH A;  1J19 A;  3ODX A;  2Z0O A;  2COD A;  3ODW A;  4IAP A;  3ZDT A;  2BCJ A;  4HAZ B;  2Z14 A;  3HQC A;  5EFX A;  3ODO A;  5HE3 A;  2YT1 A;  2NZ8 B;  1WGQ A;  3TW1 A;  2P0D A;  5LG4 B;  2ZKM X;  1U5E A;  1BTK A;  3PP2 A;  4DX9 0;  2DKQ A;  2OTX A;  2R0D A;  1E5W A;  5DHF B;  2EMS A;  2J59 M;  5JLJ B;  4XWX A;  4A6F B;  4D0N B;  4HB0 B;  3UZT A;  3QBV B;  2D9Y A;  3NWA A;  2NBV A;  2D9V A;  2HE7 A;  1FAO A;  3NWF A;  4ZRJ A;  2ELB A;  4MT7 A;  2M38 A;  4Z2M B;  3V5W A;  4D6W A;  4HB4 B;  4GXB A;  2CY4 A; 
#chains in the Genus database with same CATH homology
 2QKM A;  1ZC3 B;  2YT0 A;  5C16 A;  5D27 A;  2N0Y A;  1UPR A;  3DXE A;  2YVC A;  1V5P A;  2K2U A;  3WYF B;  2P0H A;  2K00 A;  3TFM A;  1U5D A;  4EKU A;  3HK0 A;  1P3R A;  2D9X A;  2H7D A;  4EMO A;  1LW3 A;  3D8D A;  1GC7 A;  3MDB C;  2RUK B;  1TXD A;  4WJ7 A;  1M7R A;  1GG3 A;  4YL8 A;  1XOD A;  3ML4 A;  3SUZ A;  5J3Y A;  2I5C A;  1QC6 A;  2DTC A;  2DX5 A;  1V5M A;  3FSS A;  1Y5O A;  4ZRI A;  1X05 A;  2GCJ A;  4A6H A;  5D3W A;  4HB2 B;  3F0W A;  1AWE A;  1Q67 A;  5L81 A;  1MPH A;  2I1K A;  2DLW A;  3BIN A;  1MIZ B;  4HB3 B;  1P5T A;  1V61 A;  2VSZ A;  2M14 A;  4CHJ A;  1PLS A;  2ROV A;  4HDO A;  2COF A;  1UNQ A;  1OQN A;  4CHM A;  1ISN A;  4HAT B;  2LKO A;  4L6E A;  2Q13 A;  3AU5 A;  3ZVR A;  3QIJ A;  1NTV A;  4C0A A;  2HTH B;  2R09 A;  3A8Q A;  2GCL A;  2DX1 A;  1GC6 A;  1V89 A;  1BTN A;  2YSZ A;  3BJI A;  2IYB A;  2P8V A;  2L1C A;  4K2O A;  1U27 A;  1FB8 A;  1SHC A;  1WGU A;  1ZM0 A;  2UZR A;  5LON B;  2IFS A;  5C5B B;  2X18 A;  1U5G A;  3KZ1 A;  2Y8G A;  1WJM A;  1J0W A;  5J3T A;  3T06 A;  1B55 A;  2G35 A;  2ZPY A;  2XQN M;  2DKP A;  3SV1 A;  4DX8 A;  2D4Q A;  1MAI A;  2ROZ B;  3M1I B;  2AL6 A;  3ULC A;  2LOX A;  1UNR A;  4MY6 A;  2D11 A;  1KI1 B;  1LB1 A;  2J0K A;  1Y19 B;  4YON A;  5HE1 A;  1WG7 A;  2P0F A;  2EC1 A;  5FI1 A;  4EJN A;  3VOQ A;  2W2W A;  1X11 A;  2V76 A;  4IFS A;  1MK9 B;  5D3Y A;  4NY0 A;  5LOP B;  2DA0 A;  5HE2 A;  1UEF A;  2CAY A;  4KHO A;  1XR0 B;  4B6H A;  4Z2N A;  4K2P A;  3D8F A;  1MKE A;  3DXC A;  5GOW B;  4PNK A;  1Z87 A;  1H10 A;  4HAV B;  1V5U A;  4TKN A;  2DN6 A;  1X86 A;  1MK7 B;  3PVL A;  1EVH A;  5DHA B;  1M7E A;  5HE0 A;  2RLO A;  3PSC A;  3GYP A;  4HAW B;  4F7H A;  3IVF A;  3SNH A;  1EF1 A;  1PMS A;  4HDQ A;  3KRW A;  1FOE A;  2DHI A;  2MDX A;  1U5F A;  3TCA A;  3CIK A;  3PG7 A;  2Z0Q A;  1P6S A;  1U2B A;  2W2X D;  1K5D B;  1ZC4 B;  1UPQ A;  4GMX B;  2RVB B;  2OQB A;  2MFQ A;  3AJ4 A;  1NTY A;  4KVG B;  1WI1 A;  4IOY X;  2RNR B;  3WA0 A;  2DHJ A;  2CRF A;  4GPT B;  2UZS A;  1DDV A;  3OAN A;  2H7E A;  1FGY A;  3KSY A;  2LG1 A;  3A8P A;  3TO1 A;  2COC A;  2QKL A;  2VRW B;  3TVV A;  2RSG A;  1XKE A;  1TJ6 A;  2Z0P A;  4GMV A;  1QQG A;  2D9W A;  3X23 A;  4DXA B;  1IRS A;  3PVW A;  4WSF A;  1UNP A;  1NI2 A;  1KZG A;  3PEG A;  3O96 A;  1W1G A;  1W1H A;  2KUP A;  1AQC A;  3PVU A;  3A98 B;  2DHK A;  5C79 A;  4GN1 A;  2COA A;  2LOZ A;  5DIF B;  1PFJ A;  4K17 A;  2LYD A;  3KY9 A;  4WVF B;  4DBB A;  1XCG A;  1FHW A;  5DI9 B;  2UVM A;  4K81 A;  2RGN B;  1ZSQ A;  2CY5 A;  3G9W A;  4HHV A;  4KAX B;  4HAU B;  3VIA A;  4BBK A;  1I2H A;  2D9Z A;  5C5B A;  1W1D A;  3PZD A;  3D8E A;  3FM8 C;  3LJU X;  2YRY A;  2KCJ A;  2Y7B A;  2J0J A;  3AU4 A;  3RCP A;  1X1G A;  1DDM A;  2GS0 A;  1WJ1 A;  3DXD A;  4A6F A;  1NU2 A;  1U29 A;  1BWN A;  4KHA A;  1RRP B;  4F7U P;  2EMT A;  4A6K A;  1DYN A;  3QWM A;  1MIX A;  3N7C A;  5C6R A;  2YS3 A;  5CLL B;  1V88 A;  2DFK A;  1DRO A;  3ULB A;  4ZRK A;  5CLQ B;  2KGX B;  2MWN B;  2DYN A;  2I1J A;  2J0M A;  1FGZ A;  2DYQ A;  3P6A A;  4HAY B;  4TYZ A;  3GYO A;  2D10 A;  3F5R A;  5JP4 A;  4HAX B;  2NMB A;  1K5G B;  1BAK A;  1TQZ A;  1OY2 A;  5KQ1 A;  2PZ1 A;  2ADZ A;  2FJL A;  3SYX A;  1WVH A;  4PQ0 A;  4CYE A;  1RJ2 A;  5JHG A;  3P7Z A;  3HW2 B;  1OMW A;  1H4R A;  5D3X A;  2N23 A;  4Y94 A;  2I5F A;  3KRX A;  5FI0 A;  5KCV A;  2YF0 A;  3CXB B;  5KQ4 A;  5JHH A;  1EGX A;  1XD4 A;  2L2I A;  3U8Z A;  3NSU A;  1SGH A;  1X1F A;  4KHB B;  4A5K A;  3FEH A;  5DH9 B;  2E2X A;  2EJ8 A;  4F7G A;  5D3V A;  4GZU A;  1DBH A;  1FHO A;  2JP2 A;  4P7I A;  2YS1 A;  1FHX A;  3SO6 A;  2D2Q A;  2YS5 A;  2K2J A;  1KZ7 A;  2W2X C;  2VKI A;  1EAZ A;  2LUL A;  1I7A A;  5J3Q A;  3MPX A;  4H8S A;  3U7D A;  1XX0 A;  2MKR A;  2Y8F A;  2GJY A;  1N3H A;  4MK0 A;  1DDW A;  4NSW A;  2ELA A;  1ZVR A;  2AEH A;  3ODX A;  1J19 A;  2Z0O A;  2COD A;  3ODW A;  4IAP A;  3ZDT A;  2BCJ A;  4HAZ B;  3HQC A;  5EFX A;  3ODO A;  5HE3 A;  2YT1 A;  2NZ8 B;  1WGQ A;  3TW1 A;  2P0D A;  1U5E A;  3PP2 A;  1BTK A;  4DX9 0;  2DKQ A;  2OTX A;  2R0D A;  1E5W A;  5DHF B;  2EMS A;  2J59 M;  5JLJ B;  4XWX A;  4A6F B;  4D0N B;  4HB0 B;  3UZT A;  3QBV B;  2D9Y A;  2D9V A;  2HE7 A;  1FAO A;  4ZRJ A;  2ELB A;  4MT7 A;  2M38 A;  4Z2M B;  3V5W A;  4HB4 B;  4GXB A;  2CY4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...