3M1IB

Crystal structure of yeast crm1 (xpo1p) in complex with yeast ranbp1 (yrb1p) and yeast rangtp (gsp1pgtp)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
131
structure length
131
Chain Sequence
LEKVDVKTMEEDEEVLYKVRAKLFRFDADAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords GTP-binding nuclear protein GSP1/CNR1
total genus 35
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2010-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3m1iB00
4HB0B 1U5EA 2RLOA 4DXAB 1QC6A 2CY4A 4EKUA 1FHOA 4KAXB 5C79A 1H10A 3BINA 5C16A 4KHOA 1BAKA 5KQ1A 4F7GA 2CY5A 4F7HA 3SYXA 3BJIA 1Y5OA 3TW1A 1OQNA 2PZ1A 3QBVB 4MK0A 1RJ2A 4HAWB 3MPXA 4KHAA 2LG1A 2MKRA 4TYZA 1J19A 1NU2A 2VRWB 4B6HA 2NMBA 2DLWA 1XR0B 1ZC4B 1MPHA 5DHFB 1GC6A 1NTVA 4KHBB 3P7ZA 2DKQA 2L1CA 1X1FA 2Z0PA 2CODA 2DN6A 4NSWA 3QIJA 1NTYA 1NI2A 2CRFA 4WJ7A 3ULBA 3HW2B 3V5WA 1ZVRA 1UPRA 4ZRIA 2K2UA 1TXDA 2LOZA 2X18A 4MT7A 1P5TA 1ZC3B 2AL6A 1Y19B 2G35A 3CIKA 1DBHA 1MKEA 4A6FB 1MIZB 2DA0A 2QKLA 3NSUA 2DYQA 1V88A 1Q67A 3N7CA 2OQBA 2ADZA 4GMVA 5LOPB 5D3WA 3G9WA 3D8EA 4YL8A 5EFXA 1RRPB 2OTXA 3D8DA 1FAOA 4IOYX 2XQNM 3M1IB 1V5MA 4CHMA 1H4RA 2I1KA 2KCJA 5HE1A 1BWNA 2DTCA 2D9VA 3U8ZA 2Y8GA 1WJ1A 1DYNA 2K00A 3SUZA 1DROA 4Z2MB 4CHJA 2ZPYA 1KZ7A 5D3XA 2Z0QA 1LB1A 5D3VA 4XWXA 4D0NB 3A8PA 3AU4A 2EC1A 4NY0A 2EJ8A 1DDWA 4A6HA 2D9XA 4HDOA 4DX8A 3PVUA 1V5UA 1ZM0A 2YS3A 1WI1A 2YRYA 2YT0A 1IRSA 4PNKA 1K5GB 2UZRA 4HAUB 2DFKA 3KRXA 2YF0A 5LONB 5GOWB 4L6EA 2CAYA 1WGQA 5DI9B 1GG3A 1BTKA 2VSZA 5HE3A 2W2XC 3A98B 3HQCA 2RSGA 2YVCA 3LJUX 5DH9B 2UZSA 4HB3B 3WA0A 1U5FA 1WGUA 2IYBA 2FJLA 2W2WA 3TCAA 1FHWA 1TQZA 1X05A 3QWMA 5J3TA 1LW3A 1XX0A 1UPQA 1UNRA 4HAVB 1XCGA 2MWNB 3KY9A 3ZVRA 4TKNA 1FB8A 1V89A 2Y7BA 2D4QA 3DXDA 2IFSA 2JP2A 2AEHA 1WG7A 1TJ6A 5FI1A 2M14A 1DDVA 2RNRB 4GZUA 5DHAB 2UVMA 3FEHA 2RVBB 1XKEA 3VOQA 5J3YA 1SHCA 2H7DA 2LULA 1I2HA 2QKMA 3HK0A 4GN1A 1MK7B 1U5DA 5KCVA 2V76A 2LOXA 3PEGA 3OANA 2GS0A 3KSYA 4GPTB 2COCA 3KZ1A 5C6RA 2W2XD 3KRWA 1OMWA 4K2OA 1XD4A 2N23A 1MIXA 1W1HA 2YS5A 3A8QA 2J59M 4Y94A 1PMSA 2J0MA 3D8FA 3SNHA 5JP4A 3AU5A 4K17A 5JHHA 1I7AA 2I5CA 4A5KA 4HB4B 3PVWA 3PZDA 3SO6A 3IVFA 1XODA 2M38A 4HAZB 2LKOA 1E5WA 2K2JA 2D10A 2HTHB 4IAPA 3ZDTA 1SGHA 1KI1B 2P0DA 5DIFB 2D9YA 1V61A 1Z87A 1MAIA 2KUPA 1X11A 4A6FA 3FM8C 2DHJA 5JLJB 1U27A 1UNQA 2NZ8B 3TO1A 1U29A 1U5GA 1W1DA 1P6SA 4P7IA 1AQCA 1QQGA 2DX1A 4HHVA 1FGZA 1FOEA 1GC7A 1FHXA 1EF1A 2EMSA 2HE7A 1OY2A 3PSCA 4ZRKA 4HAXB 3DXEA 1KZGA 4K81A 3P6AA 1W1GA 4HDQA 2D9WA 5CLQB 2Z0OA 2ROVA 5FI0A 3F0WA 4K2PA 4HATB 5D27A 4WSFA 3VIAA 4HB2B 2D9ZA 1V5PA 2H7EA 2Q13A 2R0DA 4PQ0A 3GYPA 3ODOA 5JHGA 2RUKB 2P8VA 2YS1A 2DYNA 2ROZB 1MK9B 4A6KA 1AWEA 3GYOA 1N3HA 4GXBA 2E2XA 1X1GA 2GCLA 5KQ4A 3PG7A 3T06A 5CLLB 3TVVA 4KVGB 3PVLA 3AJ4A 2D11A 2D2QA 2DHIA 2VKIA 2RGNB 4BBKA 3FSSA 2DHKA 1X86A 2Y8FA 2P0HA 3SV1A 2ELBA 2GJYA 2J0JA 4IFSA 3MDBC 4EJNA 1PFJA 5D3YA 1EVHA 1UEFA 3WYFB 4H8SA 4C0AA 3U7DA 1UNPA 4YONA 1BTNA 3PP2A 2L2IA 2DKPA 5C5BB 3RCPA 2MDXA 1P3RA 1U2BA 4ZRJA 4MY6A 1B55A 3O96A 2COAA 1M7RA 2N0YA 3F5RA 5C5BA 2YSZA 2EMTA 2I5FA 2COFA 4F7UP 3CXBB 2LYDA 1J0WA 2YT1A 4DX90 2MFQA 3DXCA 5J3QA 1WJMA 2ELAA 2BCJA 4Z2NA 1ISNA 4EMOA 3TFMA 3ODXA 5L81A 2KGXB 3ODWA 4GMXB 5HE2A 4DBBA 1DDMA 1EGXA 2J0KA 1WVHA 2R09A 1M7EA 4WVFB 3X23A 4HAYB 2I1JA 2DX5A 1ZSQA 3ULCA 5HE0A 3UZTA 3ML4A 1EAZA 1PLSA 1FGYA 2GCJA 2P0FA 4CYEA 1K5DB
chains in the Genus database with same CATH superfamily
4HB0B 1U5EA 2RLOA 4DXAB 1QC6A 2CY4A 4EKUA 1FHOA 2RRFA 4KAXB 5C79A 1H10A 2Z59A 3BINA 5C16A 4KHOA 4GNKB 1BAKA 5KQ1A 4QJ5B 4F7GA 2CY5A 4F7HA 3SYXA 3BJIA 1Y5OA 3TW1A 1OQNA 2PZ1A 3QBVB 2K49A 1RJ2A 4MK0A 4HAWB 3MPXA 4KHAA 2LG1A 2MKRA 4TYZA 1J19A 1NU2A 2VRWB 4B6HA 2NMBA 2DLWA 1XR0B 4GOUA 1ZC4B 1MPHA 5DHFB 1GC6A 1NTVA 4KHBB 3P7ZA 2DKQA 2L1CA 1X1FA 2Z0PA 2FJUB 2CODA 2DN6A 4NSWA 1ZYIA 3QIJA 1NTYA 1NI2A 2CRFA 4WJ7A 3ULBA 3HW2B 3V5WA 1ZVRA 4OSNA 1UPRA 4ZRIA 2K2UA 1TXDA 2LOZA 2YT2A 2X18A 4MT7A 1P5TA 1ZC3B 2AL6A 1Y19B 2G35A 2Z14A 3CIKA 1DBHA 1MKEA 4A6FB 1MIZB 2DA0A 2QKLA 3NSUA 2DYQA 1V88A 1Q67A 3N7CA 2Z13A 2OQBA 2ADZA 4GMVA 5LOPB 5D3WA 3G9WA 3D8EA 4YL8A 5EFXA 1RRPB 2OTXA 3D8DA 1FAOA 4IOYX 2XQNM 3A58A 3M1IB 1V5MA 4CHMA 1H4RA 1T77A 2I1KA 2KCJA 5HE1A 1BWNA 2DTCA 2D9VA 2Z4DA 2Y8GA 3U8ZA 1WJ1A 1DYNA 2K00A 3SUZA 1DROA 4Z2MB 4CHJA 2ZPYA 1KZ7A 5D3XA 2Z0QA 1LB1A 5D3VA 4XWXA 4D0NB 3A8PA 3OHMB 3AU4A 2EC1A 4NY0A 2EJ8A 1DDWA 4DIXA 4A6HA 2D9XA 4HDOA 4DX8A 3PVUA 1V5UA 3B77A 1ZM0A 2YS3A 1WI1A 2YRYA 2YT0A 1IRSA 4PNKA 1K5GB 2UZRA 4HAUB 2DFKA 3KRXA 2YF0A 5LONB 5GOWB 4L6EA 2CAYA 1WGQA 5DI9B 1GG3A 1BTKA 2VSZA 5HE3A 2W2XC 3A98B 3HQCA 2GUMA 2RSGA 2YVCA 5I2MA 3LJUX 5DH9B 2UZSA 2KIEA 4HB3B 3WA0A 1U5FA 1WGUA 2IYBA 2FJLA 2W2WA 3TCAA 1FHWA 1TQZA 1X05A 3QWMA 5J3TA 5LG4B 1LW3A 1XX0A 1UPQA 1UNRA 4HAVB 3NWDA 1XCGA 2MWNB 3KY9A 3ZVRA 4TKNA 1FB8A 1V89A 2Y7BA 2D4QA 4CSQA 3DXDA 2IFSA 2JP2A 2AEHA 1WG7A 1TJ6A 5FI1A 2M14A 1DDVA 2RNRB 4GZUA 5DHAB 2UVMA 3FEHA 2RVBB 5IRSA 1XKEA 3VOQA 5J3YA 1SHCA 2H7DA 2LULA 1I2HA 2QKMA 3HK0A 4GN1A 1MK7B 1U5DA 5KCVA 2V76A 2LOXA 3PEGA 3OANA 2GS0A 3KSYA 4GPTB 2COCA 3KZ1A 5C6RA 5M4YB 2W2XD 3KRWA 1OMWA 1XD4A 4K2OA 2N23A 1MIXA 1W1HA 2YS5A 3A8QA 2J59M 4Y94A 1PMSA 2J0MA 3D8FA 3SNHA 5JP4A 3AU5A 4K17A 5JHHA 1I7AA 2I5CA 4A5KA 4HB4B 3PVWA 3NW8A 3PZDA 3SO6A 3IVFA 2NBVA 1MI1A 3NWAA 1XODA 2M38A 4HAZB 2LKOA 1E5WA 2K2JA 2D10A 2HTHB 3NWFA 4IAPA 3ZDTA 1SGHA 1KI1B 2P0DA 5DIFB 2D9YA 1V61A 4L1RA 1Z87A 1MAIA 2KUPA 1X11A 4A6FA 3FM8C 2DHJA 5JLJB 1U27A 1UNQA 4KHBA 2NZ8B 3TO1A 3DCXA 1U29A 1U5GA 1W1DA 1P6SA 4P7IA 1AQCA 1QQGA 2DX1A 4HHVA 1FGZA 1FOEA 1GC7A 4QXAB 1FHXA 1EF1A 2EMSA 2HE7A 1OY2A 3PSCA 4ZRKA 3FVCA 4HAXB 3DXEA 1KZGA 4K81A 3P6AA 4QJ4B 1W1GA 4HDQA 2D9WA 5CLQB 2Z0OA 2ROVA 5FI0A 3F0WA 4K2PA 4HATB 5D27A 4WSFA 3VIAA 4HB2B 2D9ZA 1V5PA 2H7EA 2Q13A 4QJ3B 2R0DA 4PQ0A 4D6WA 2KUQA 3GYPA 3ODOA 5JHGA 2RUKB 2P8VA 2YS1A 2DYNA 2ROZB 1MK9B 4A6KA 1AWEA 3GYOA 1N3HA 4GXBA 2E2XA 1X1GA 2GCLA 2KR0A 5KQ4A 3PG7A 3T06A 5CLLB 3TVVA 4KVGB 2R2YA 3PVLA 3AJ4A 2D11A 2D2QA 2DHIA 2VKIA 2RGNB 4BBKA 3FSSA 2DHKA 1X86A 2Y8FA 2P0HA 3SV1A 2ELBA 2GJYA 2J0JA 4IFSA 5I2SA 3MDBC 4EJNA 1PFJA 5D3YA 3U12A 1EVHA 1UEFA 3WYFB 4H8SA 4C0AA 3U7DA 1UNPA 4YONA 1BTNA 3PP2A 2L2IA 2DKPA 5C5BB 3RCPA 2MDXA 1P3RA 1U2BA 4ZRJA 4MY6A 1B55A 2ZKMX 3O96A 2COAA 3HIEA 1M7RA 4HSIA 2N0YA 3F5RA 5C5BA 2YSZA 2EMTA 2I5FA 2COFA 4F7UP 3CXBB 2LYDA 1J0WA 2YT1A 4DX90 2MFQA 3DXCA 5J3QA 1WJMA 2ELAA 2BCJA 4Z2NA 1ISNA 4EMOA 3TFMA 3ODXA 5L81A 2KGXB 3ODWA 4GMXB 5HE2A 4DBBA 1DDMA 2KIGA 1EGXA 2J0KA 1WVHA 2R09A 1M7EA 4WVFB 3X23A 4HAYB 2I1JA 2DX5A 1ZSQA 3ULCA 5HE0A 3UZTA 3ML4A 4OT1A 3HSAA 1EAZA 2K8EA 1PLSA 1FGYA 2GCJA 2P0FA 4CYEA 1K5DB
chains in the Genus database with same CATH topology
4HB0B 1U5EA 2RLOA 4DXAB 1QC6A 2CY4A 4EKUA 1FHOA 4KAXB 5C79A 1H10A 3BINA 5C16A 4KHOA 1BAKA 5KQ1A 4F7GA 2CY5A 4F7HA 3SYXA 3BJIA 1Y5OA 3TW1A 1OQNA 2PZ1A 3QBVB 4MK0A 1RJ2A 4HAWB 3MPXA 4KHAA 2LG1A 2MKRA 4TYZA 1J19A 1NU2A 2VRWB 4B6HA 2NMBA 2DLWA 1XR0B 1ZC4B 1MPHA 5DHFB 1GC6A 1NTVA 4KHBB 3P7ZA 2DKQA 2L1CA 1X1FA 2Z0PA 2CODA 2DN6A 4NSWA 3QIJA 1NTYA 1NI2A 2CRFA 4WJ7A 3ULBA 3HW2B 3V5WA 1ZVRA 1UPRA 4ZRIA 2K2UA 1TXDA 2LOZA 2X18A 4MT7A 1P5TA 1ZC3B 2AL6A 1Y19B 2G35A 3CIKA 1DBHA 1MKEA 4A6FB 1MIZB 2DA0A 2QKLA 3NSUA 2DYQA 1V88A 1Q67A 3N7CA 2OQBA 2ADZA 4GMVA 5LOPB 5D3WA 3G9WA 3D8EA 4YL8A 5EFXA 1RRPB 2OTXA 3D8DA 1FAOA 4IOYX 2XQNM 3M1IB 1V5MA 4CHMA 1H4RA 2I1KA 2KCJA 5HE1A 1BWNA 2DTCA 2D9VA 3U8ZA 2Y8GA 1WJ1A 1DYNA 2K00A 3SUZA 1DROA 4Z2MB 4CHJA 2ZPYA 1KZ7A 5D3XA 2Z0QA 1LB1A 5D3VA 4XWXA 4D0NB 3A8PA 3AU4A 2EC1A 4NY0A 2EJ8A 1DDWA 4A6HA 2D9XA 4HDOA 4DX8A 3PVUA 1V5UA 1ZM0A 2YS3A 1WI1A 2YRYA 2YT0A 1IRSA 4PNKA 1K5GB 2UZRA 4HAUB 2DFKA 3KRXA 2YF0A 5LONB 5GOWB 4L6EA 2CAYA 1WGQA 5DI9B 1GG3A 1BTKA 2VSZA 5HE3A 2W2XC 3A98B 3HQCA 2RSGA 2YVCA 3LJUX 5DH9B 2UZSA 4HB3B 3WA0A 1U5FA 1WGUA 2IYBA 2FJLA 2W2WA 3TCAA 1FHWA 1TQZA 1X05A 3QWMA 5J3TA 1LW3A 1XX0A 1UPQA 1UNRA 4HAVB 1XCGA 2MWNB 3KY9A 3ZVRA 4TKNA 1FB8A 1V89A 2Y7BA 2D4QA 3DXDA 2IFSA 2JP2A 2AEHA 1WG7A 1TJ6A 5FI1A 2M14A 1DDVA 2RNRB 4GZUA 5DHAB 2UVMA 3FEHA 2RVBB 1XKEA 3VOQA 5J3YA 1SHCA 2H7DA 2LULA 1I2HA 2QKMA 3HK0A 4GN1A 1MK7B 1U5DA 5KCVA 2V76A 2LOXA 3PEGA 3OANA 2GS0A 3KSYA 4GPTB 2COCA 3KZ1A 5C6RA 2W2XD 3KRWA 1OMWA 4K2OA 1XD4A 2N23A 1MIXA 1W1HA 2YS5A 3A8QA 2J59M 4Y94A 1PMSA 2J0MA 3D8FA 3SNHA 5JP4A 3AU5A 4K17A 5JHHA 1I7AA 2I5CA 4A5KA 4HB4B 3PVWA 3PZDA 3SO6A 3IVFA 1XODA 2M38A 4HAZB 2LKOA 1E5WA 2K2JA 2D10A 2HTHB 4IAPA 3ZDTA 1SGHA 1KI1B 2P0DA 5DIFB 2D9YA 1V61A 1Z87A 1MAIA 2KUPA 1X11A 4A6FA 3FM8C 2DHJA 5JLJB 1U27A 1UNQA 2NZ8B 3TO1A 1U29A 1U5GA 1W1DA 1P6SA 4P7IA 1AQCA 1QQGA 2DX1A 4HHVA 1FGZA 1FOEA 1GC7A 1FHXA 1EF1A 2EMSA 2HE7A 1OY2A 3PSCA 4ZRKA 4HAXB 3DXEA 1KZGA 4K81A 3P6AA 1W1GA 4HDQA 2D9WA 5CLQB 2Z0OA 2ROVA 5FI0A 3F0WA 4K2PA 4HATB 5D27A 4WSFA 3VIAA 4HB2B 2D9ZA 1V5PA 2H7EA 2Q13A 2R0DA 4PQ0A 3GYPA 3ODOA 5JHGA 2RUKB 2P8VA 2YS1A 2DYNA 2ROZB 1MK9B 4A6KA 1AWEA 3GYOA 1N3HA 4GXBA 2E2XA 1X1GA 2GCLA 5KQ4A 3PG7A 3T06A 5CLLB 3TVVA 4KVGB 3PVLA 3AJ4A 2D11A 2D2QA 2DHIA 2VKIA 2RGNB 4BBKA 3FSSA 2DHKA 1X86A 2Y8FA 2P0HA 3SV1A 2ELBA 2GJYA 2J0JA 4IFSA 3MDBC 4EJNA 1PFJA 5D3YA 1EVHA 1UEFA 3WYFB 4H8SA 4C0AA 3U7DA 1UNPA 4YONA 1BTNA 3PP2A 2L2IA 2DKPA 5C5BB 3RCPA 2MDXA 1P3RA 1U2BA 4ZRJA 4MY6A 1B55A 3O96A 2COAA 1M7RA 2N0YA 3F5RA 5C5BA 2YSZA 2EMTA 2I5FA 2COFA 4F7UP 3CXBB 2LYDA 1J0WA 2YT1A 4DX90 2MFQA 3DXCA 5J3QA 1WJMA 2ELAA 2BCJA 4Z2NA 1ISNA 4EMOA 3TFMA 3ODXA 5L81A 2KGXB 3ODWA 4GMXB 5HE2A 4DBBA 1DDMA 1EGXA 2J0KA 1WVHA 2R09A 1M7EA 4WVFB 3X23A 4HAYB 2I1JA 2DX5A 1ZSQA 3ULCA 5HE0A 3UZTA 3ML4A 1EAZA 1PLSA 1FGYA 2GCJA 2P0FA 4CYEA 1K5DB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HB0 B;  1U5E A;  2RLO A;  4DXA B;  1QC6 A;  2CY4 A;  4EKU A;  1FHO A;  4KAX B;  5C79 A;  1H10 A;  3BIN A;  5C16 A;  4KHO A;  1BAK A;  5KQ1 A;  4F7G A;  2CY5 A;  4F7H A;  3SYX A;  3BJI A;  1Y5O A;  3TW1 A;  1OQN A;  2PZ1 A;  3QBV B;  4MK0 A;  1RJ2 A;  4HAW B;  3MPX A;  4KHA A;  2LG1 A;  2MKR A;  4TYZ A;  1J19 A;  1NU2 A;  2VRW B;  4B6H A;  2NMB A;  2DLW A;  1XR0 B;  1ZC4 B;  1MPH A;  5DHF B;  1GC6 A;  1NTV A;  4KHB B;  3P7Z A;  2DKQ A;  2L1C A;  1X1F A;  2Z0P A;  2COD A;  2DN6 A;  4NSW A;  3QIJ A;  1NTY A;  1NI2 A;  2CRF A;  4WJ7 A;  3ULB A;  3HW2 B;  3V5W A;  1ZVR A;  1UPR A;  4ZRI A;  2K2U A;  1TXD A;  2LOZ A;  2X18 A;  4MT7 A;  1P5T A;  1ZC3 B;  2AL6 A;  1Y19 B;  2G35 A;  3CIK A;  1DBH A;  1MKE A;  4A6F B;  1MIZ B;  2DA0 A;  2QKL A;  3NSU A;  2DYQ A;  1V88 A;  1Q67 A;  3N7C A;  2OQB A;  2ADZ A;  4GMV A;  5LOP B;  5D3W A;  3G9W A;  3D8E A;  4YL8 A;  5EFX A;  1RRP B;  2OTX A;  3D8D A;  1FAO A;  4IOY X;  2XQN M;  3M1I B;  1V5M A;  4CHM A;  1H4R A;  2I1K A;  2KCJ A;  5HE1 A;  1BWN A;  2DTC A;  2D9V A;  3U8Z A;  2Y8G A;  1WJ1 A;  1DYN A;  2K00 A;  3SUZ A;  1DRO A;  4Z2M B;  4CHJ A;  2ZPY A;  1KZ7 A;  5D3X A;  2Z0Q A;  1LB1 A;  5D3V A;  4XWX A;  4D0N B;  3A8P A;  3AU4 A;  2EC1 A;  4NY0 A;  2EJ8 A;  1DDW A;  4A6H A;  2D9X A;  4HDO A;  4DX8 A;  3PVU A;  1V5U A;  1ZM0 A;  2YS3 A;  1WI1 A;  2YRY A;  2YT0 A;  1IRS A;  4PNK A;  1K5G B;  2UZR A;  4HAU B;  2DFK A;  3KRX A;  2YF0 A;  5LON B;  5GOW B;  4L6E A;  2CAY A;  1WGQ A;  5DI9 B;  1GG3 A;  1BTK A;  2VSZ A;  5HE3 A;  2W2X C;  3A98 B;  3HQC A;  2RSG A;  2YVC A;  3LJU X;  5DH9 B;  2UZS A;  4HB3 B;  3WA0 A;  1U5F A;  1WGU A;  2IYB A;  2FJL A;  2W2W A;  3TCA A;  1FHW A;  1TQZ A;  1X05 A;  3QWM A;  5J3T A;  1LW3 A;  1XX0 A;  1UPQ A;  1UNR A;  4HAV B;  1XCG A;  2MWN B;  3KY9 A;  3ZVR A;  4TKN A;  1FB8 A;  1V89 A;  2Y7B A;  2D4Q A;  3DXD A;  2IFS A;  2JP2 A;  2AEH A;  1WG7 A;  1TJ6 A;  5FI1 A;  2M14 A;  1DDV A;  2RNR B;  4GZU A;  5DHA B;  2UVM A;  3FEH A;  2RVB B;  1XKE A;  3VOQ A;  5J3Y A;  1SHC A;  2H7D A;  2LUL A;  1I2H A;  2QKM A;  3HK0 A;  4GN1 A;  1MK7 B;  1U5D A;  5KCV A;  2V76 A;  2LOX A;  3PEG A;  3OAN A;  2GS0 A;  3KSY A;  4GPT B;  2COC A;  3KZ1 A;  5C6R A;  2W2X D;  3KRW A;  1OMW A;  4K2O A;  1XD4 A;  2N23 A;  1MIX A;  1W1H A;  2YS5 A;  3A8Q A;  2J59 M;  4Y94 A;  1PMS A;  2J0M A;  3D8F A;  3SNH A;  5JP4 A;  3AU5 A;  4K17 A;  5JHH A;  1I7A A;  2I5C A;  4A5K A;  4HB4 B;  3PVW A;  3PZD A;  3SO6 A;  3IVF A;  1XOD A;  2M38 A;  4HAZ B;  2LKO A;  1E5W A;  2K2J A;  2D10 A;  2HTH B;  4IAP A;  3ZDT A;  1SGH A;  1KI1 B;  2P0D A;  5DIF B;  2D9Y A;  1V61 A;  1Z87 A;  1MAI A;  2KUP A;  1X11 A;  4A6F A;  3FM8 C;  2DHJ A;  5JLJ B;  1U27 A;  1UNQ A;  2NZ8 B;  3TO1 A;  1U29 A;  1U5G A;  1W1D A;  1P6S A;  4P7I A;  1AQC A;  1QQG A;  2DX1 A;  4HHV A;  1FGZ A;  1FOE A;  1GC7 A;  1FHX A;  1EF1 A;  2EMS A;  2HE7 A;  1OY2 A;  3PSC A;  4ZRK A;  4HAX B;  3DXE A;  1KZG A;  4K81 A;  3P6A A;  1W1G A;  4HDQ A;  2D9W A;  5CLQ B;  2Z0O A;  2ROV A;  5FI0 A;  3F0W A;  4K2P A;  4HAT B;  5D27 A;  4WSF A;  3VIA A;  4HB2 B;  2D9Z A;  1V5P A;  2H7E A;  2Q13 A;  2R0D A;  4PQ0 A;  3GYP A;  3ODO A;  5JHG A;  2RUK B;  2P8V A;  2YS1 A;  2DYN A;  2ROZ B;  1MK9 B;  4A6K A;  1AWE A;  3GYO A;  1N3H A;  4GXB A;  2E2X A;  1X1G A;  2GCL A;  5KQ4 A;  3PG7 A;  3T06 A;  5CLL B;  3TVV A;  4KVG B;  3PVL A;  3AJ4 A;  2D11 A;  2D2Q A;  2DHI A;  2VKI A;  2RGN B;  4BBK A;  3FSS A;  2DHK A;  1X86 A;  2Y8F A;  2P0H A;  3SV1 A;  2ELB A;  2GJY A;  2J0J A;  4IFS A;  3MDB C;  4EJN A;  1PFJ A;  5D3Y A;  1EVH A;  1UEF A;  3WYF B;  4H8S A;  4C0A A;  3U7D A;  1UNP A;  4YON A;  1BTN A;  3PP2 A;  2L2I A;  2DKP A;  5C5B B;  3RCP A;  2MDX A;  1P3R A;  1U2B A;  4ZRJ A;  4MY6 A;  1B55 A;  3O96 A;  2COA A;  1M7R A;  2N0Y A;  3F5R A;  5C5B A;  2YSZ A;  2EMT A;  2I5F A;  2COF A;  4F7U P;  3CXB B;  2LYD A;  1J0W A;  2YT1 A;  4DX9 0;  2MFQ A;  3DXC A;  5J3Q A;  1WJM A;  2ELA A;  2BCJ A;  4Z2N A;  1ISN A;  4EMO A;  3TFM A;  3ODX A;  5L81 A;  2KGX B;  3ODW A;  4GMX B;  5HE2 A;  4DBB A;  1DDM A;  1EGX A;  2J0K A;  1WVH A;  2R09 A;  1M7E A;  4WVF B;  3X23 A;  4HAY B;  2I1J A;  2DX5 A;  1ZSQ A;  3ULC A;  5HE0 A;  3UZT A;  3ML4 A;  1EAZ A;  1PLS A;  1FGY A;  2GCJ A;  2P0F A;  4CYE A;  1K5D B; 
#chains in the Genus database with same CATH topology
 4HB0 B;  1U5E A;  2RLO A;  4DXA B;  1QC6 A;  2CY4 A;  4EKU A;  1FHO A;  2RRF A;  4KAX B;  5C79 A;  1H10 A;  2Z59 A;  3BIN A;  5C16 A;  4KHO A;  4GNK B;  1BAK A;  5KQ1 A;  4QJ5 B;  4F7G A;  2CY5 A;  4F7H A;  3SYX A;  3BJI A;  1Y5O A;  3TW1 A;  1OQN A;  2PZ1 A;  3QBV B;  2K49 A;  1RJ2 A;  4MK0 A;  4HAW B;  3MPX A;  4KHA A;  2LG1 A;  2MKR A;  4TYZ A;  1J19 A;  1NU2 A;  2VRW B;  4B6H A;  2NMB A;  2DLW A;  1XR0 B;  4GOU A;  1ZC4 B;  1MPH A;  5DHF B;  1GC6 A;  1NTV A;  4KHB B;  3P7Z A;  2DKQ A;  2L1C A;  1X1F A;  2Z0P A;  2FJU B;  2COD A;  2DN6 A;  4NSW A;  1ZYI A;  3QIJ A;  1NTY A;  1NI2 A;  2CRF A;  4WJ7 A;  3ULB A;  3HW2 B;  3V5W A;  1ZVR A;  4OSN A;  1UPR A;  4ZRI A;  2K2U A;  1TXD A;  2LOZ A;  2YT2 A;  2X18 A;  4MT7 A;  1P5T A;  1ZC3 B;  2AL6 A;  1Y19 B;  2G35 A;  2Z14 A;  3CIK A;  1DBH A;  1MKE A;  4A6F B;  1MIZ B;  2DA0 A;  2QKL A;  3NSU A;  2DYQ A;  1V88 A;  1Q67 A;  3N7C A;  2Z13 A;  2OQB A;  2ADZ A;  4GMV A;  5LOP B;  5D3W A;  3G9W A;  3D8E A;  4YL8 A;  5EFX A;  1RRP B;  2OTX A;  3D8D A;  1FAO A;  4IOY X;  2XQN M;  3A58 A;  3M1I B;  1V5M A;  4CHM A;  1H4R A;  1T77 A;  2I1K A;  2KCJ A;  5HE1 A;  1BWN A;  2DTC A;  2D9V A;  2Z4D A;  2Y8G A;  3U8Z A;  1WJ1 A;  1DYN A;  2K00 A;  3SUZ A;  1DRO A;  4Z2M B;  4CHJ A;  2ZPY A;  1KZ7 A;  5D3X A;  2Z0Q A;  1LB1 A;  5D3V A;  4XWX A;  4D0N B;  3A8P A;  3OHM B;  3AU4 A;  2EC1 A;  4NY0 A;  2EJ8 A;  1DDW A;  4DIX A;  4A6H A;  2D9X A;  4HDO A;  4DX8 A;  3PVU A;  1V5U A;  3B77 A;  1ZM0 A;  2YS3 A;  1WI1 A;  2YRY A;  2YT0 A;  1IRS A;  4PNK A;  1K5G B;  2UZR A;  4HAU B;  2DFK A;  3KRX A;  2YF0 A;  5LON B;  5GOW B;  4L6E A;  2CAY A;  1WGQ A;  5DI9 B;  1GG3 A;  1BTK A;  2VSZ A;  5HE3 A;  2W2X C;  3A98 B;  3HQC A;  2GUM A;  2RSG A;  2YVC A;  5I2M A;  3LJU X;  5DH9 B;  2UZS A;  2KIE A;  4HB3 B;  3WA0 A;  1U5F A;  1WGU A;  2IYB A;  2FJL A;  2W2W A;  3TCA A;  1FHW A;  1TQZ A;  1X05 A;  3QWM A;  5J3T A;  5LG4 B;  1LW3 A;  1XX0 A;  1UPQ A;  1UNR A;  4HAV B;  3NWD A;  1XCG A;  2MWN B;  3KY9 A;  3ZVR A;  4TKN A;  1FB8 A;  1V89 A;  2Y7B A;  2D4Q A;  4CSQ A;  3DXD A;  2IFS A;  2JP2 A;  2AEH A;  1WG7 A;  1TJ6 A;  5FI1 A;  2M14 A;  1DDV A;  2RNR B;  4GZU A;  5DHA B;  2UVM A;  3FEH A;  2RVB B;  5IRS A;  1XKE A;  3VOQ A;  5J3Y A;  1SHC A;  2H7D A;  2LUL A;  1I2H A;  2QKM A;  3HK0 A;  4GN1 A;  1MK7 B;  1U5D A;  5KCV A;  2V76 A;  2LOX A;  3PEG A;  3OAN A;  2GS0 A;  3KSY A;  4GPT B;  2COC A;  3KZ1 A;  5C6R A;  5M4Y B;  2W2X D;  3KRW A;  1OMW A;  1XD4 A;  4K2O A;  2N23 A;  1MIX A;  1W1H A;  2YS5 A;  3A8Q A;  2J59 M;  4Y94 A;  1PMS A;  2J0M A;  3D8F A;  3SNH A;  5JP4 A;  3AU5 A;  4K17 A;  5JHH A;  1I7A A;  2I5C A;  4A5K A;  4HB4 B;  3PVW A;  3NW8 A;  3PZD A;  3SO6 A;  3IVF A;  2NBV A;  1MI1 A;  3NWA A;  1XOD A;  2M38 A;  4HAZ B;  2LKO A;  1E5W A;  2K2J A;  2D10 A;  2HTH B;  3NWF A;  4IAP A;  3ZDT A;  1SGH A;  1KI1 B;  2P0D A;  5DIF B;  2D9Y A;  1V61 A;  4L1R A;  1Z87 A;  1MAI A;  2KUP A;  1X11 A;  4A6F A;  3FM8 C;  2DHJ A;  5JLJ B;  1U27 A;  1UNQ A;  4KHB A;  2NZ8 B;  3TO1 A;  3DCX A;  1U29 A;  1U5G A;  1W1D A;  1P6S A;  4P7I A;  1AQC A;  1QQG A;  2DX1 A;  4HHV A;  1FGZ A;  1FOE A;  1GC7 A;  4QXA B;  1FHX A;  1EF1 A;  2EMS A;  2HE7 A;  1OY2 A;  3PSC A;  4ZRK A;  3FVC A;  4HAX B;  3DXE A;  1KZG A;  4K81 A;  3P6A A;  4QJ4 B;  1W1G A;  4HDQ A;  2D9W A;  5CLQ B;  2Z0O A;  2ROV A;  5FI0 A;  3F0W A;  4K2P A;  4HAT B;  5D27 A;  4WSF A;  3VIA A;  4HB2 B;  2D9Z A;  1V5P A;  2H7E A;  2Q13 A;  4QJ3 B;  2R0D A;  4PQ0 A;  4D6W A;  2KUQ A;  3GYP A;  3ODO A;  5JHG A;  2RUK B;  2P8V A;  2YS1 A;  2DYN A;  2ROZ B;  1MK9 B;  4A6K A;  1AWE A;  3GYO A;  1N3H A;  4GXB A;  2E2X A;  1X1G A;  2GCL A;  2KR0 A;  5KQ4 A;  3PG7 A;  3T06 A;  5CLL B;  3TVV A;  4KVG B;  2R2Y A;  3PVL A;  3AJ4 A;  2D11 A;  2D2Q A;  2DHI A;  2VKI A;  2RGN B;  4BBK A;  3FSS A;  2DHK A;  1X86 A;  2Y8F A;  2P0H A;  3SV1 A;  2ELB A;  2GJY A;  2J0J A;  4IFS A;  5I2S A;  3MDB C;  4EJN A;  1PFJ A;  5D3Y A;  3U12 A;  1EVH A;  1UEF A;  3WYF B;  4H8S A;  4C0A A;  3U7D A;  1UNP A;  4YON A;  1BTN A;  3PP2 A;  2L2I A;  2DKP A;  5C5B B;  3RCP A;  2MDX A;  1P3R A;  1U2B A;  4ZRJ A;  4MY6 A;  1B55 A;  2ZKM X;  3O96 A;  2COA A;  3HIE A;  1M7R A;  4HSI A;  2N0Y A;  3F5R A;  5C5B A;  2YSZ A;  2EMT A;  2I5F A;  2COF A;  4F7U P;  3CXB B;  2LYD A;  1J0W A;  2YT1 A;  4DX9 0;  2MFQ A;  3DXC A;  5J3Q A;  1WJM A;  2ELA A;  2BCJ A;  4Z2N A;  1ISN A;  4EMO A;  3TFM A;  3ODX A;  5L81 A;  2KGX B;  3ODW A;  4GMX B;  5HE2 A;  4DBB A;  1DDM A;  2KIG A;  1EGX A;  2J0K A;  1WVH A;  2R09 A;  1M7E A;  4WVF B;  3X23 A;  4HAY B;  2I1J A;  2DX5 A;  1ZSQ A;  3ULC A;  5HE0 A;  3UZT A;  3ML4 A;  4OT1 A;  3HSA A;  1EAZ A;  2K8E A;  1PLS A;  1FGY A;  2GCJ A;  2P0F A;  4CYE A;  1K5D B; 
#chains in the Genus database with same CATH homology
 4HB0 B;  1U5E A;  2RLO A;  4DXA B;  1QC6 A;  2CY4 A;  4EKU A;  1FHO A;  4KAX B;  5C79 A;  1H10 A;  3BIN A;  5C16 A;  4KHO A;  1BAK A;  5KQ1 A;  4F7G A;  2CY5 A;  4F7H A;  3SYX A;  3BJI A;  1Y5O A;  3TW1 A;  1OQN A;  2PZ1 A;  3QBV B;  4MK0 A;  1RJ2 A;  4HAW B;  3MPX A;  4KHA A;  2LG1 A;  2MKR A;  4TYZ A;  1J19 A;  1NU2 A;  2VRW B;  4B6H A;  2NMB A;  2DLW A;  1XR0 B;  1ZC4 B;  1MPH A;  5DHF B;  1GC6 A;  1NTV A;  4KHB B;  3P7Z A;  2DKQ A;  2L1C A;  1X1F A;  2Z0P A;  2COD A;  2DN6 A;  4NSW A;  3QIJ A;  1NTY A;  1NI2 A;  2CRF A;  4WJ7 A;  3ULB A;  3HW2 B;  3V5W A;  1ZVR A;  1UPR A;  4ZRI A;  2K2U A;  1TXD A;  2LOZ A;  2X18 A;  4MT7 A;  1P5T A;  1ZC3 B;  2AL6 A;  1Y19 B;  2G35 A;  3CIK A;  1DBH A;  1MKE A;  4A6F B;  1MIZ B;  2DA0 A;  2QKL A;  3NSU A;  2DYQ A;  1V88 A;  1Q67 A;  3N7C A;  2OQB A;  2ADZ A;  4GMV A;  5LOP B;  5D3W A;  3G9W A;  3D8E A;  4YL8 A;  5EFX A;  1RRP B;  2OTX A;  3D8D A;  1FAO A;  4IOY X;  2XQN M;  3M1I B;  1V5M A;  4CHM A;  1H4R A;  2I1K A;  2KCJ A;  5HE1 A;  1BWN A;  2DTC A;  2D9V A;  3U8Z A;  2Y8G A;  1WJ1 A;  1DYN A;  2K00 A;  3SUZ A;  1DRO A;  4Z2M B;  4CHJ A;  2ZPY A;  1KZ7 A;  5D3X A;  2Z0Q A;  1LB1 A;  5D3V A;  4XWX A;  4D0N B;  3A8P A;  3AU4 A;  2EC1 A;  4NY0 A;  2EJ8 A;  1DDW A;  4A6H A;  2D9X A;  4HDO A;  4DX8 A;  3PVU A;  1V5U A;  1ZM0 A;  2YS3 A;  1WI1 A;  2YRY A;  2YT0 A;  1IRS A;  4PNK A;  1K5G B;  2UZR A;  4HAU B;  2DFK A;  3KRX A;  2YF0 A;  5LON B;  5GOW B;  4L6E A;  2CAY A;  1WGQ A;  5DI9 B;  1GG3 A;  1BTK A;  2VSZ A;  5HE3 A;  2W2X C;  3A98 B;  3HQC A;  2RSG A;  2YVC A;  3LJU X;  5DH9 B;  2UZS A;  4HB3 B;  3WA0 A;  1U5F A;  1WGU A;  2IYB A;  2FJL A;  2W2W A;  3TCA A;  1FHW A;  1TQZ A;  1X05 A;  3QWM A;  5J3T A;  1LW3 A;  1XX0 A;  1UPQ A;  1UNR A;  4HAV B;  1XCG A;  2MWN B;  3KY9 A;  3ZVR A;  4TKN A;  1FB8 A;  1V89 A;  2Y7B A;  2D4Q A;  3DXD A;  2IFS A;  2JP2 A;  2AEH A;  1WG7 A;  1TJ6 A;  5FI1 A;  2M14 A;  1DDV A;  2RNR B;  4GZU A;  5DHA B;  2UVM A;  3FEH A;  2RVB B;  1XKE A;  3VOQ A;  5J3Y A;  1SHC A;  2H7D A;  2LUL A;  1I2H A;  2QKM A;  3HK0 A;  4GN1 A;  1MK7 B;  1U5D A;  5KCV A;  2V76 A;  2LOX A;  3PEG A;  3OAN A;  2GS0 A;  3KSY A;  4GPT B;  2COC A;  3KZ1 A;  5C6R A;  2W2X D;  3KRW A;  1OMW A;  4K2O A;  1XD4 A;  2N23 A;  1MIX A;  1W1H A;  2YS5 A;  3A8Q A;  2J59 M;  4Y94 A;  1PMS A;  2J0M A;  3D8F A;  3SNH A;  5JP4 A;  3AU5 A;  4K17 A;  5JHH A;  1I7A A;  2I5C A;  4A5K A;  4HB4 B;  3PVW A;  3PZD A;  3SO6 A;  3IVF A;  1XOD A;  2M38 A;  4HAZ B;  2LKO A;  1E5W A;  2K2J A;  2D10 A;  2HTH B;  4IAP A;  3ZDT A;  1SGH A;  1KI1 B;  2P0D A;  5DIF B;  2D9Y A;  1V61 A;  1Z87 A;  1MAI A;  2KUP A;  1X11 A;  4A6F A;  3FM8 C;  2DHJ A;  5JLJ B;  1U27 A;  1UNQ A;  2NZ8 B;  3TO1 A;  1U29 A;  1U5G A;  1W1D A;  1P6S A;  4P7I A;  1AQC A;  1QQG A;  2DX1 A;  4HHV A;  1FGZ A;  1FOE A;  1GC7 A;  1FHX A;  1EF1 A;  2EMS A;  2HE7 A;  1OY2 A;  3PSC A;  4ZRK A;  4HAX B;  3DXE A;  1KZG A;  4K81 A;  3P6A A;  1W1G A;  4HDQ A;  2D9W A;  5CLQ B;  2Z0O A;  2ROV A;  5FI0 A;  3F0W A;  4K2P A;  4HAT B;  5D27 A;  4WSF A;  3VIA A;  4HB2 B;  2D9Z A;  1V5P A;  2H7E A;  2Q13 A;  2R0D A;  4PQ0 A;  3GYP A;  3ODO A;  5JHG A;  2RUK B;  2P8V A;  2YS1 A;  2DYN A;  2ROZ B;  1MK9 B;  4A6K A;  1AWE A;  3GYO A;  1N3H A;  4GXB A;  2E2X A;  1X1G A;  2GCL A;  5KQ4 A;  3PG7 A;  3T06 A;  5CLL B;  3TVV A;  4KVG B;  3PVL A;  3AJ4 A;  2D11 A;  2D2Q A;  2DHI A;  2VKI A;  2RGN B;  4BBK A;  3FSS A;  2DHK A;  1X86 A;  2Y8F A;  2P0H A;  3SV1 A;  2ELB A;  2GJY A;  2J0J A;  4IFS A;  3MDB C;  4EJN A;  1PFJ A;  5D3Y A;  1EVH A;  1UEF A;  3WYF B;  4H8S A;  4C0A A;  3U7D A;  1UNP A;  4YON A;  1BTN A;  3PP2 A;  2L2I A;  2DKP A;  5C5B B;  3RCP A;  2MDX A;  1P3R A;  1U2B A;  4ZRJ A;  4MY6 A;  1B55 A;  3O96 A;  2COA A;  1M7R A;  2N0Y A;  3F5R A;  5C5B A;  2YSZ A;  2EMT A;  2I5F A;  2COF A;  4F7U P;  3CXB B;  2LYD A;  1J0W A;  2YT1 A;  4DX9 0;  2MFQ A;  3DXC A;  5J3Q A;  1WJM A;  2ELA A;  2BCJ A;  4Z2N A;  1ISN A;  4EMO A;  3TFM A;  3ODX A;  5L81 A;  2KGX B;  3ODW A;  4GMX B;  5HE2 A;  4DBB A;  1DDM A;  1EGX A;  2J0K A;  1WVH A;  2R09 A;  1M7E A;  4WVF B;  3X23 A;  4HAY B;  2I1J A;  2DX5 A;  1ZSQ A;  3ULC A;  5HE0 A;  3UZT A;  3ML4 A;  1EAZ A;  1PLS A;  1FGY A;  2GCJ A;  2P0F A;  4CYE A;  1K5D B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...