3M1IB

Crystal structure of yeast crm1 (xpo1p) in complex with yeast ranbp1 (yrb1p) and yeast rangtp (gsp1pgtp)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
131
structure length
131
Chain Sequence
LEKVDVKTMEEDEEVLYKVRAKLFRFDADAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein GSP1/CNR1
publication title An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 35
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2010-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3m1iB00
3FM8C 4MT7A 1RJ2A 1H10A 3QIJA 3TW1A 3O96A 3WA0A 1OQNA 1U5FA 2D9VA 4ZRIA 2P0HA 1XODA 1U2BA 3CXBB 3P7ZA 3VOQA 3ZVRA 1EVHA 3DXEA 3SYXA 1V88A 1XKEA 3TCAA 3MDBC 3P6AA 4HHVA 3RCPA 1DBHA 5KQ4A 5C79A 2ADZA 2LOXA 3SUZA 4YL8A 1FOEA 1ZC3B 2DYQA 2HE7A 2DHJA 3A8PA 4HB4B 4CHJA 3PP2A 4WSFA 1U5GA 3TFMA 5DHAB 4DBBA 2EJ8A 2PZ1A 1TQZA 2D2QA 2I1JA 4H8SA 1KZGA 5HE2A 5C5BB 2Y8GA 2YSZA 4DXAB 1W1GA 1WVHA 1UPQA 4HAWB 2RGNB 2V76A 4L6EA 4TYZA 1GG3A 3FSSA 3PG7A 1MAIA 2CRFA 3ODXA 2VRWB 5FI1A 2MFQA 4GXBA 1NTYA 5KCVA 2DHKA 5HE0A 3ULCA 2DX1A 3NSUA 2Q13A 5DIFB 1V61A 4F7HA 5J3YA 2RNRB 3D8EA 4HB0B 1MK9B 2MKRA 5JHGA 2J0MA 1UPRA 2ROVA 3G9WA 1H4RA 2RSGA 5GOWB 2COFA 5J3QA 4TKNA 5D3VA 4B6HA 1TJ6A 1XR0B 2I1KA 2UVMA 3GYPA 1UNRA 5D3WA 5DHFB 5HE1A 1Y5OA 2BCJA 3BJIA 1PFJA 1LB1A 2VKIA 5LOPB 1FB8A 1PLSA 4NY0A 5CLLB 3SV1A 1BWNA 1KI1B 2LYDA 3HQCA 4HATB 3F5RA 3LJUX 2J59M 2QKLA 3VIAA 3A98B 2ROZB 4CYEA 4HDOA 4YONA 2EMSA 2YT0A 5JHHA 1XX0A 1GC6A 2W2WA 1P6SA 2MWNB 3D8DA 4KAXB 1EAZA 4EJNA 1FHOA 1DDVA 4P7IA 3U7DA 1WJMA 2Y7BA 4K2OA 1Q67A 2DN6A 4PNKA 3QWMA 3KRXA 1SGHA 2D9YA 3FEHA 2H7DA 5DH9B 1RRPB 2HTHB 2GCLA 1BTNA 1FAOA 2KGXB 5D3XA 4A6HA 3ODWA 2DLWA 1J0WA 2KCJA 4IOYX 1ISNA 4GMXB 1I7AA 1AQCA 3PSCA 4MK0A 5L81A 2EC1A 2R0DA 1NTVA 2LULA 3KRWA 4GN1A 2RVBB 2K00A 2GS0A 2M14A 1N3HA 2AL6A 2E2XA 3ZDTA 2VSZA 5CLQB 2D4QA 3WYFB 1X1FA 4DX8A 1P3RA 4HAUB 5D27A 5C6RA 2UZRA 3PVWA 1IRSA 2YS5A 2UZSA 2D9XA 4F7GA 1BAKA 4NSWA 1UNQA 2Z0PA 1I2HA 2D9ZA 3TVVA 2P0DA 2DFKA 1X1GA 2ELBA 3F0WA 2K2JA 4HAXB 3TO1A 1DDWA 1U5DA 3V5WA 2DTCA 2DKPA 4A6FA 4A6KA 2IYBA 4GPTB 2N0YA 2QKMA 1U27A 4KHAA 1MK7B 1P5TA 2J0KA 4ZRKA 1MPHA 4EMOA 2X18A 4GMVA 3AU4A 1NU2A 2LKOA 3DXDA 4GZUA 2N23A 4D0NB 2DYNA 1QQGA 3PZDA 1E5WA 1AWEA 1UNPA 1MIXA 3AJ4A 1X86A 2M38A 3ODOA 4ZRJA 2CY4A 1X11A 1FHXA 4KHOA 1WGQA 1U5EA 2OQBA 3KY9A 2RUKB 2DKQA 1ZC4B 2YT1A 2AEHA 3KZ1A 2ZPYA 3N7CA 4BBKA 1DDMA 1XCGA 1DYNA 4XWXA 3PEGA 4PQ0A 3SNHA 2CY5A 2LOZA 2XQNM 2Z0OA 1WG7A 3BINA 2JP2A 1WJ1A 2IFSA 4DX90 5J3TA 5JLJB 4F7UP 4K2PA 4HAZB 1SHCA 3KSYA 2GJYA 3HW2B 2YS1A 1MIZB 2D11A 1K5DB 5EFXA 2I5CA 1FGZA 2J0JA 4HAYB 1B55A 1DROA 4HDQA 4HAVB 5JP4A 1WGUA 1U29A 3OANA 2Z0QA 4IAPA 4Z2MB 2NZ8B 2RLOA 2D9WA 2OTXA 2YF0A 2ELAA 3A8QA 5LONB 5FI0A 3MPXA 4HB2B 1W1DA 1ZM0A 3D8FA 1V5UA 4KHBB 1KZ7A 1V5PA 4K17A 3DXCA 1Y19B 2Y8FA 5HE3A 1PMSA 1ZSQA 4K81A 2H7EA 1M7EA 1V5MA 2DX5A 4WVFB 3GYOA 2YVCA 2DHIA 1LW3A 1GC7A 3T06A 1FHWA 4MY6A 2G35A 3AU5A 4IFSA 5KQ1A 2EMTA 2I5FA 3ML4A 5C5BA 3HK0A 3UZTA 1QC6A 2K2UA 4WJ7A 1MKEA 1WI1A 3U8ZA 2DA0A 3M1IB 3CIKA 3PVUA 5DI9B 2D10A 4A6FB 2P0FA 3ULBA 4C0AA 4CHMA 1EGXA 1BTKA 2W2XC 2COAA 1TXDA 1OMWA 3SO6A 1XD4A 2KUPA 3IVFA 2FJLA 4EKUA 5C16A 2YS3A 2COCA 2CODA 1UEFA 1OY2A 4KVGB 4HB3B 1NI2A 2MDXA 1J19A 3PVLA 1EF1A 1K5GB 2YRYA 1FGYA 1V89A 1X05A 2P8VA 2W2XD 4A5KA 3QBVB 4Y94A 5D3YA 2L1CA 2R09A 4Z2NA 1M7RA 2GCJA 2NMBA 1W1HA 2LG1A 2L2IA 2CAYA 1ZVRA 3X23A 1Z87A
chains in the Genus database with same CATH superfamily
3FM8C 4MT7A 1RJ2A 1H10A 3QIJA 3TW1A 3O96A 3WA0A 1OQNA 1U5FA 1ZYIA 2D9VA 4ZRIA 2P0HA 1XODA 1U2BA 3CXBB 3P7ZA 3VOQA 3ZVRA 1EVHA 3DXEA 3SYXA 1V88A 1XKEA 3TCAA 3MDBC 3P6AA 4HHVA 3RCPA 1DBHA 5KQ4A 5C79A 2ADZA 2LOXA 3SUZA 4YL8A 1FOEA 1ZC3B 2DYQA 2HE7A 2DHJA 2RRFA 3A8PA 3B77A 4HB4B 4CHJA 3PP2A 4WSFA 1U5GA 4QJ3B 3TFMA 5DHAB 3HSAA 4DBBA 2EJ8A 2PZ1A 1TQZA 2D2QA 2I1JA 4H8SA 1KZGA 5HE2A 5C5BB 2Y8GA 2K49A 2YSZA 4DXAB 1W1GA 1WVHA 1UPQA 1T77A 4HAWB 2RGNB 2V76A 4L6EA 4TYZA 3NWFA 1GG3A 3FSSA 3PG7A 1MAIA 2CRFA 2KUQA 3ODXA 2VRWB 5FI1A 2MFQA 4GXBA 1NTYA 5KCVA 2DHKA 5HE0A 3ULCA 2DX1A 3NSUA 2Q13A 4OT1A 5DIFB 4HSIA 1V61A 4F7HA 5J3YA 2RNRB 3D8EA 4HB0B 1MK9B 2MKRA 5JHGA 2J0MA 1UPRA 5IRSA 2ROVA 3G9WA 1H4RA 2RSGA 5GOWB 2COFA 5J3QA 4TKNA 5D3VA 4B6HA 1TJ6A 1XR0B 2I1KA 2UVMA 3GYPA 1UNRA 5D3WA 5DHFB 5HE1A 1Y5OA 2BCJA 3BJIA 1PFJA 1LB1A 2VKIA 5LOPB 1FB8A 1PLSA 4NY0A 5I2SA 5CLLB 3SV1A 1BWNA 1KI1B 2LYDA 2GUMA 3HQCA 4HATB 3F5RA 3LJUX 3OHMB 2J59M 2QKLA 3VIAA 3A98B 2ROZB 4CYEA 4HDOA 4YONA 2EMSA 3DCXA 2YT0A 5JHHA 1XX0A 1GC6A 2W2WA 1P6SA 2MWNB 3D8DA 4KAXB 1EAZA 4EJNA 1FHOA 3FVCA 1DDVA 4P7IA 3A58A 3U7DA 1WJMA 2Y7BA 4K2OA 5LG4B 1Q67A 2DN6A 4PNKA 3QWMA 3KRXA 1SGHA 2D9YA 3FEHA 2KR0A 2H7DA 5DH9B 1RRPB 2HTHB 2GCLA 1BTNA 1FAOA 2KGXB 1MI1A 5D3XA 4A6HA 3ODWA 2DLWA 1J0WA 4KHBA 2KCJA 4IOYX 1ISNA 4GMXB 1I7AA 1AQCA 3PSCA 4MK0A 5L81A 2EC1A 2R0DA 1NTVA 2LULA 4QJ5B 3KRWA 4GN1A 2RVBB 2K00A 2GS0A 4OSNA 2M14A 1N3HA 2Z4DA 2AL6A 2E2XA 3ZDTA 2VSZA 5CLQB 2D4QA 3NWDA 3WYFB 1X1FA 4L1RA 4DX8A 1P3RA 4HAUB 5D27A 5C6RA 2UZRA 3PVWA 1IRSA 2YS5A 2UZSA 2D9XA 4F7GA 1BAKA 4NSWA 1UNQA 2Z0PA 1I2HA 2D9ZA 4DIXA 3TVVA 2FJUB 2P0DA 2DFKA 1X1GA 2ELBA 3F0WA 2K2JA 4HAXB 3TO1A 1DDWA 1U5DA 3V5WA 2DTCA 2DKPA 4A6FA 4A6KA 2IYBA 4GPTB 2N0YA 2QKMA 1U27A 4KHAA 1MK7B 1P5TA 2J0KA 4ZRKA 1MPHA 4EMOA 2X18A 4GMVA 3AU4A 1NU2A 2LKOA 3DXDA 4GZUA 2N23A 4D0NB 2DYNA 1QQGA 3NWAA 3PZDA 1E5WA 1AWEA 1UNPA 1MIXA 3AJ4A 1X86A 2M38A 3ODOA 4ZRJA 2CY4A 1X11A 1FHXA 4KHOA 2KIGA 1WGQA 1U5EA 2OQBA 3KY9A 3NW8A 2RUKB 5M4YB 2DKQA 1ZC4B 2YT1A 2AEHA 2ZPYA 3KZ1A 3N7CA 4BBKA 1DDMA 1XCGA 1DYNA 4XWXA 3PEGA 4PQ0A 3SNHA 2CY5A 2LOZA 2XQNM 2Z0OA 1WG7A 3BINA 2JP2A 1WJ1A 2IFSA 4DX90 5J3TA 5JLJB 4F7UP 4K2PA 4HAZB 1SHCA 3KSYA 2GJYA 3HW2B 2YS1A 1MIZB 2D11A 1K5DB 4GOUA 5EFXA 2I5CA 1FGZA 2J0JA 4HAYB 1B55A 1DROA 4HDQA 4HAVB 5JP4A 1WGUA 1U29A 3OANA 2Z0QA 4IAPA 4Z2MB 2NZ8B 2RLOA 2D9WA 2OTXA 2YF0A 2ELAA 3A8QA 5LONB 5FI0A 3MPXA 2KIEA 4HB2B 1W1DA 1ZM0A 3D8FA 1V5UA 4KHBB 1KZ7A 1V5PA 4K17A 3DXCA 1Y19B 2Y8FA 5HE3A 1PMSA 1ZSQA 4K81A 2H7EA 1M7EA 2Z13A 1V5MA 2NBVA 2DX5A 4WVFB 3GYOA 2YVCA 2DHIA 1LW3A 1GC7A 2ZKMX 3T06A 1FHWA 4MY6A 2G35A 3AU5A 4IFSA 5KQ1A 2EMTA 2I5FA 2YT2A 3ML4A 4D6WA 5C5BA 3HK0A 2Z14A 3UZTA 4GNKB 1QC6A 2K2UA 4WJ7A 1MKEA 4QXAB 1WI1A 2Z59A 3U8ZA 2DA0A 3M1IB 3CIKA 3PVUA 2K8EA 5DI9B 2D10A 4A6FB 2P0FA 3ULBA 4C0AA 4CHMA 1EGXA 1BTKA 2W2XC 5I2MA 2COAA 1TXDA 1OMWA 3SO6A 1XD4A 2KUPA 3IVFA 3U12A 4QJ4B 2FJLA 4EKUA 5C16A 2YS3A 2COCA 2CODA 1UEFA 1OY2A 4KVGB 4HB3B 1NI2A 2MDXA 1J19A 2R2YA 3PVLA 1EF1A 1K5GB 2YRYA 1FGYA 1V89A 1X05A 2P8VA 4CSQA 2W2XD 4A5KA 3QBVB 4Y94A 3HIEA 5D3YA 2L1CA 2R09A 4Z2NA 1M7RA 2GCJA 2NMBA 1W1HA 2LG1A 2L2IA 2CAYA 1ZVRA 3X23A 1Z87A
chains in the Genus database with same CATH topology
3FM8C 4MT7A 1RJ2A 1H10A 3QIJA 3TW1A 3O96A 3WA0A 1OQNA 1U5FA 2D9VA 4ZRIA 2P0HA 1XODA 1U2BA 3CXBB 3P7ZA 3VOQA 3ZVRA 1EVHA 3DXEA 3SYXA 1V88A 1XKEA 3TCAA 3MDBC 3P6AA 4HHVA 3RCPA 1DBHA 5KQ4A 5C79A 2ADZA 2LOXA 3SUZA 4YL8A 1FOEA 1ZC3B 2DYQA 2HE7A 2DHJA 3A8PA 4HB4B 4CHJA 3PP2A 4WSFA 1U5GA 3TFMA 5DHAB 4DBBA 2EJ8A 2PZ1A 1TQZA 2D2QA 2I1JA 4H8SA 1KZGA 5HE2A 5C5BB 2Y8GA 2YSZA 4DXAB 1W1GA 1WVHA 1UPQA 4HAWB 2RGNB 2V76A 4L6EA 4TYZA 1GG3A 3FSSA 3PG7A 1MAIA 2CRFA 3ODXA 2VRWB 5FI1A 2MFQA 4GXBA 1NTYA 5KCVA 2DHKA 5HE0A 3ULCA 2DX1A 3NSUA 2Q13A 5DIFB 1V61A 4F7HA 5J3YA 2RNRB 3D8EA 4HB0B 1MK9B 2MKRA 5JHGA 2J0MA 1UPRA 2ROVA 3G9WA 1H4RA 2RSGA 5GOWB 2COFA 5J3QA 4TKNA 5D3VA 4B6HA 1TJ6A 1XR0B 2I1KA 2UVMA 3GYPA 1UNRA 5D3WA 5DHFB 5HE1A 1Y5OA 2BCJA 3BJIA 1PFJA 1LB1A 2VKIA 5LOPB 1FB8A 1PLSA 4NY0A 5CLLB 3SV1A 1BWNA 1KI1B 2LYDA 3HQCA 4HATB 3F5RA 3LJUX 2J59M 2QKLA 3VIAA 3A98B 2ROZB 4CYEA 4HDOA 4YONA 2EMSA 2YT0A 5JHHA 1XX0A 1GC6A 2W2WA 1P6SA 2MWNB 3D8DA 4KAXB 1EAZA 4EJNA 1FHOA 1DDVA 4P7IA 3U7DA 1WJMA 2Y7BA 4K2OA 1Q67A 2DN6A 4PNKA 3QWMA 3KRXA 1SGHA 2D9YA 3FEHA 2H7DA 5DH9B 1RRPB 2HTHB 2GCLA 1BTNA 1FAOA 2KGXB 5D3XA 4A6HA 3ODWA 2DLWA 1J0WA 2KCJA 4IOYX 1ISNA 4GMXB 1I7AA 1AQCA 3PSCA 4MK0A 5L81A 2EC1A 2R0DA 1NTVA 2LULA 3KRWA 4GN1A 2RVBB 2K00A 2GS0A 2M14A 1N3HA 2AL6A 2E2XA 3ZDTA 2VSZA 5CLQB 2D4QA 3WYFB 1X1FA 4DX8A 1P3RA 4HAUB 5D27A 5C6RA 2UZRA 3PVWA 1IRSA 2YS5A 2UZSA 2D9XA 4F7GA 1BAKA 4NSWA 1UNQA 2Z0PA 1I2HA 2D9ZA 3TVVA 2P0DA 2DFKA 1X1GA 2ELBA 3F0WA 2K2JA 4HAXB 3TO1A 1DDWA 1U5DA 3V5WA 2DTCA 2DKPA 4A6FA 4A6KA 2IYBA 4GPTB 2N0YA 2QKMA 1U27A 4KHAA 1MK7B 1P5TA 2J0KA 4ZRKA 1MPHA 4EMOA 2X18A 4GMVA 3AU4A 1NU2A 2LKOA 3DXDA 4GZUA 2N23A 4D0NB 2DYNA 1QQGA 3PZDA 1E5WA 1AWEA 1UNPA 1MIXA 3AJ4A 1X86A 2M38A 3ODOA 4ZRJA 2CY4A 1X11A 1FHXA 4KHOA 1WGQA 1U5EA 2OQBA 3KY9A 2RUKB 2DKQA 1ZC4B 2YT1A 2AEHA 3KZ1A 2ZPYA 3N7CA 4BBKA 1DDMA 1XCGA 1DYNA 4XWXA 3PEGA 4PQ0A 3SNHA 2CY5A 2LOZA 2XQNM 2Z0OA 1WG7A 3BINA 2JP2A 1WJ1A 2IFSA 4DX90 5J3TA 5JLJB 4F7UP 4K2PA 4HAZB 1SHCA 3KSYA 2GJYA 3HW2B 2YS1A 1MIZB 2D11A 1K5DB 5EFXA 2I5CA 1FGZA 2J0JA 4HAYB 1B55A 1DROA 4HDQA 4HAVB 5JP4A 1WGUA 1U29A 3OANA 2Z0QA 4IAPA 4Z2MB 2NZ8B 2RLOA 2D9WA 2OTXA 2YF0A 2ELAA 3A8QA 5LONB 5FI0A 3MPXA 4HB2B 1W1DA 1ZM0A 3D8FA 1V5UA 4KHBB 1KZ7A 1V5PA 4K17A 3DXCA 1Y19B 2Y8FA 5HE3A 1PMSA 1ZSQA 4K81A 2H7EA 1M7EA 1V5MA 2DX5A 4WVFB 3GYOA 2YVCA 2DHIA 1LW3A 1GC7A 3T06A 1FHWA 4MY6A 2G35A 3AU5A 4IFSA 5KQ1A 2EMTA 2I5FA 3ML4A 5C5BA 3HK0A 3UZTA 1QC6A 2K2UA 4WJ7A 1MKEA 1WI1A 3U8ZA 2DA0A 3M1IB 3CIKA 3PVUA 5DI9B 2D10A 4A6FB 2P0FA 3ULBA 4C0AA 4CHMA 1EGXA 1BTKA 2W2XC 2COAA 1TXDA 1OMWA 3SO6A 1XD4A 2KUPA 3IVFA 2FJLA 4EKUA 5C16A 2YS3A 2COCA 2CODA 1UEFA 1OY2A 4KVGB 4HB3B 1NI2A 2MDXA 1J19A 3PVLA 1EF1A 1K5GB 2YRYA 1FGYA 1V89A 1X05A 2P8VA 2W2XD 4A5KA 3QBVB 4Y94A 5D3YA 2L1CA 2R09A 4Z2NA 1M7RA 2GCJA 2NMBA 1W1HA 2LG1A 2L2IA 2CAYA 1ZVRA 3X23A 1Z87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FM8 C;  4MT7 A;  1RJ2 A;  1H10 A;  3QIJ A;  3TW1 A;  3O96 A;  3WA0 A;  1OQN A;  1U5F A;  2D9V A;  4ZRI A;  2P0H A;  1XOD A;  1U2B A;  3CXB B;  3P7Z A;  3VOQ A;  3ZVR A;  1EVH A;  3DXE A;  3SYX A;  1V88 A;  1XKE A;  3TCA A;  3MDB C;  3P6A A;  4HHV A;  3RCP A;  1DBH A;  5KQ4 A;  5C79 A;  2ADZ A;  2LOX A;  3SUZ A;  4YL8 A;  1FOE A;  1ZC3 B;  2DYQ A;  2HE7 A;  2DHJ A;  3A8P A;  4HB4 B;  4CHJ A;  3PP2 A;  4WSF A;  1U5G A;  3TFM A;  5DHA B;  4DBB A;  2EJ8 A;  2PZ1 A;  1TQZ A;  2D2Q A;  2I1J A;  4H8S A;  1KZG A;  5HE2 A;  5C5B B;  2Y8G A;  2YSZ A;  4DXA B;  1W1G A;  1WVH A;  1UPQ A;  4HAW B;  2RGN B;  2V76 A;  4L6E A;  4TYZ A;  1GG3 A;  3FSS A;  3PG7 A;  1MAI A;  2CRF A;  3ODX A;  2VRW B;  5FI1 A;  2MFQ A;  4GXB A;  1NTY A;  5KCV A;  2DHK A;  5HE0 A;  3ULC A;  2DX1 A;  3NSU A;  2Q13 A;  5DIF B;  1V61 A;  4F7H A;  5J3Y A;  2RNR B;  3D8E A;  4HB0 B;  1MK9 B;  2MKR A;  5JHG A;  2J0M A;  1UPR A;  2ROV A;  3G9W A;  1H4R A;  2RSG A;  5GOW B;  2COF A;  5J3Q A;  4TKN A;  5D3V A;  4B6H A;  1TJ6 A;  1XR0 B;  2I1K A;  2UVM A;  3GYP A;  1UNR A;  5D3W A;  5DHF B;  5HE1 A;  1Y5O A;  2BCJ A;  3BJI A;  1PFJ A;  1LB1 A;  2VKI A;  5LOP B;  1FB8 A;  1PLS A;  4NY0 A;  5CLL B;  3SV1 A;  1BWN A;  1KI1 B;  2LYD A;  3HQC A;  4HAT B;  3F5R A;  3LJU X;  2J59 M;  2QKL A;  3VIA A;  3A98 B;  2ROZ B;  4CYE A;  4HDO A;  4YON A;  2EMS A;  2YT0 A;  5JHH A;  1XX0 A;  1GC6 A;  2W2W A;  1P6S A;  2MWN B;  3D8D A;  4KAX B;  1EAZ A;  4EJN A;  1FHO A;  1DDV A;  4P7I A;  3U7D A;  1WJM A;  2Y7B A;  4K2O A;  1Q67 A;  2DN6 A;  4PNK A;  3QWM A;  3KRX A;  1SGH A;  2D9Y A;  3FEH A;  2H7D A;  5DH9 B;  1RRP B;  2HTH B;  2GCL A;  1BTN A;  1FAO A;  2KGX B;  5D3X A;  4A6H A;  3ODW A;  2DLW A;  1J0W A;  2KCJ A;  4IOY X;  1ISN A;  4GMX B;  1I7A A;  1AQC A;  3PSC A;  4MK0 A;  5L81 A;  2EC1 A;  2R0D A;  1NTV A;  2LUL A;  3KRW A;  4GN1 A;  2RVB B;  2K00 A;  2GS0 A;  2M14 A;  1N3H A;  2AL6 A;  2E2X A;  3ZDT A;  2VSZ A;  5CLQ B;  2D4Q A;  3WYF B;  1X1F A;  4DX8 A;  1P3R A;  4HAU B;  5D27 A;  5C6R A;  2UZR A;  3PVW A;  1IRS A;  2YS5 A;  2UZS A;  2D9X A;  4F7G A;  1BAK A;  4NSW A;  1UNQ A;  2Z0P A;  1I2H A;  2D9Z A;  3TVV A;  2P0D A;  2DFK A;  1X1G A;  2ELB A;  3F0W A;  2K2J A;  4HAX B;  3TO1 A;  1DDW A;  1U5D A;  3V5W A;  2DTC A;  2DKP A;  4A6F A;  4A6K A;  2IYB A;  4GPT B;  2N0Y A;  2QKM A;  1U27 A;  4KHA A;  1MK7 B;  1P5T A;  2J0K A;  4ZRK A;  1MPH A;  4EMO A;  2X18 A;  4GMV A;  3AU4 A;  1NU2 A;  2LKO A;  3DXD A;  4GZU A;  2N23 A;  4D0N B;  2DYN A;  1QQG A;  3PZD A;  1E5W A;  1AWE A;  1UNP A;  1MIX A;  3AJ4 A;  1X86 A;  2M38 A;  3ODO A;  4ZRJ A;  2CY4 A;  1X11 A;  1FHX A;  4KHO A;  1WGQ A;  1U5E A;  2OQB A;  3KY9 A;  2RUK B;  2DKQ A;  1ZC4 B;  2YT1 A;  2AEH A;  3KZ1 A;  2ZPY A;  3N7C A;  4BBK A;  1DDM A;  1XCG A;  1DYN A;  4XWX A;  3PEG A;  4PQ0 A;  3SNH A;  2CY5 A;  2LOZ A;  2XQN M;  2Z0O A;  1WG7 A;  3BIN A;  2JP2 A;  1WJ1 A;  2IFS A;  4DX9 0;  5J3T A;  5JLJ B;  4F7U P;  4K2P A;  4HAZ B;  1SHC A;  3KSY A;  2GJY A;  3HW2 B;  2YS1 A;  1MIZ B;  2D11 A;  1K5D B;  5EFX A;  2I5C A;  1FGZ A;  2J0J A;  4HAY B;  1B55 A;  1DRO A;  4HDQ A;  4HAV B;  5JP4 A;  1WGU A;  1U29 A;  3OAN A;  2Z0Q A;  4IAP A;  4Z2M B;  2NZ8 B;  2RLO A;  2D9W A;  2OTX A;  2YF0 A;  2ELA A;  3A8Q A;  5LON B;  5FI0 A;  3MPX A;  4HB2 B;  1W1D A;  1ZM0 A;  3D8F A;  1V5U A;  4KHB B;  1KZ7 A;  1V5P A;  4K17 A;  3DXC A;  1Y19 B;  2Y8F A;  5HE3 A;  1PMS A;  1ZSQ A;  4K81 A;  2H7E A;  1M7E A;  1V5M A;  2DX5 A;  4WVF B;  3GYO A;  2YVC A;  2DHI A;  1LW3 A;  1GC7 A;  3T06 A;  1FHW A;  4MY6 A;  2G35 A;  3AU5 A;  4IFS A;  5KQ1 A;  2EMT A;  2I5F A;  3ML4 A;  5C5B A;  3HK0 A;  3UZT A;  1QC6 A;  2K2U A;  4WJ7 A;  1MKE A;  1WI1 A;  3U8Z A;  2DA0 A;  3M1I B;  3CIK A;  3PVU A;  5DI9 B;  2D10 A;  4A6F B;  2P0F A;  3ULB A;  4C0A A;  4CHM A;  1EGX A;  1BTK A;  2W2X C;  2COA A;  1TXD A;  1OMW A;  3SO6 A;  1XD4 A;  2KUP A;  3IVF A;  2FJL A;  4EKU A;  5C16 A;  2YS3 A;  2COC A;  2COD A;  1UEF A;  1OY2 A;  4KVG B;  4HB3 B;  1NI2 A;  2MDX A;  1J19 A;  3PVL A;  1EF1 A;  1K5G B;  2YRY A;  1FGY A;  1V89 A;  1X05 A;  2P8V A;  2W2X D;  4A5K A;  3QBV B;  4Y94 A;  5D3Y A;  2L1C A;  2R09 A;  4Z2N A;  1M7R A;  2GCJ A;  2NMB A;  1W1H A;  2LG1 A;  2L2I A;  2CAY A;  1ZVR A;  3X23 A;  1Z87 A; 
#chains in the Genus database with same CATH topology
 3FM8 C;  4MT7 A;  1RJ2 A;  1H10 A;  3QIJ A;  3TW1 A;  3O96 A;  3WA0 A;  1OQN A;  1U5F A;  1ZYI A;  2D9V A;  4ZRI A;  2P0H A;  1XOD A;  1U2B A;  3CXB B;  3P7Z A;  3VOQ A;  3ZVR A;  1EVH A;  3DXE A;  3SYX A;  1V88 A;  1XKE A;  3TCA A;  3MDB C;  3P6A A;  4HHV A;  3RCP A;  1DBH A;  5KQ4 A;  5C79 A;  2ADZ A;  2LOX A;  3SUZ A;  4YL8 A;  1FOE A;  1ZC3 B;  2DYQ A;  2HE7 A;  2DHJ A;  2RRF A;  3A8P A;  3B77 A;  4HB4 B;  4CHJ A;  3PP2 A;  4WSF A;  1U5G A;  4QJ3 B;  3TFM A;  5DHA B;  3HSA A;  4DBB A;  2EJ8 A;  2PZ1 A;  1TQZ A;  2D2Q A;  2I1J A;  4H8S A;  1KZG A;  5HE2 A;  5C5B B;  2Y8G A;  2K49 A;  2YSZ A;  4DXA B;  1W1G A;  1WVH A;  1UPQ A;  1T77 A;  4HAW B;  2RGN B;  2V76 A;  4L6E A;  4TYZ A;  3NWF A;  1GG3 A;  3FSS A;  3PG7 A;  1MAI A;  2CRF A;  2KUQ A;  3ODX A;  2VRW B;  5FI1 A;  2MFQ A;  4GXB A;  1NTY A;  5KCV A;  2DHK A;  5HE0 A;  3ULC A;  2DX1 A;  3NSU A;  2Q13 A;  4OT1 A;  5DIF B;  4HSI A;  1V61 A;  4F7H A;  5J3Y A;  2RNR B;  3D8E A;  4HB0 B;  1MK9 B;  2MKR A;  5JHG A;  2J0M A;  1UPR A;  5IRS A;  2ROV A;  3G9W A;  1H4R A;  2RSG A;  5GOW B;  2COF A;  5J3Q A;  4TKN A;  5D3V A;  4B6H A;  1TJ6 A;  1XR0 B;  2I1K A;  2UVM A;  3GYP A;  1UNR A;  5D3W A;  5DHF B;  5HE1 A;  1Y5O A;  2BCJ A;  3BJI A;  1PFJ A;  1LB1 A;  2VKI A;  5LOP B;  1FB8 A;  1PLS A;  4NY0 A;  5I2S A;  5CLL B;  3SV1 A;  1BWN A;  1KI1 B;  2LYD A;  2GUM A;  3HQC A;  4HAT B;  3F5R A;  3LJU X;  3OHM B;  2J59 M;  2QKL A;  3VIA A;  3A98 B;  2ROZ B;  4CYE A;  4HDO A;  4YON A;  2EMS A;  3DCX A;  2YT0 A;  5JHH A;  1XX0 A;  1GC6 A;  2W2W A;  1P6S A;  2MWN B;  3D8D A;  4KAX B;  1EAZ A;  4EJN A;  1FHO A;  3FVC A;  1DDV A;  4P7I A;  3A58 A;  3U7D A;  1WJM A;  2Y7B A;  4K2O A;  5LG4 B;  1Q67 A;  2DN6 A;  4PNK A;  3QWM A;  3KRX A;  1SGH A;  2D9Y A;  3FEH A;  2KR0 A;  2H7D A;  5DH9 B;  1RRP B;  2HTH B;  2GCL A;  1BTN A;  1FAO A;  2KGX B;  1MI1 A;  5D3X A;  4A6H A;  3ODW A;  2DLW A;  1J0W A;  4KHB A;  2KCJ A;  4IOY X;  1ISN A;  4GMX B;  1I7A A;  1AQC A;  3PSC A;  4MK0 A;  5L81 A;  2EC1 A;  2R0D A;  1NTV A;  2LUL A;  4QJ5 B;  3KRW A;  4GN1 A;  2RVB B;  2K00 A;  2GS0 A;  4OSN A;  2M14 A;  1N3H A;  2Z4D A;  2AL6 A;  2E2X A;  3ZDT A;  2VSZ A;  5CLQ B;  2D4Q A;  3NWD A;  3WYF B;  1X1F A;  4L1R A;  4DX8 A;  1P3R A;  4HAU B;  5D27 A;  5C6R A;  2UZR A;  3PVW A;  1IRS A;  2YS5 A;  2UZS A;  2D9X A;  4F7G A;  1BAK A;  4NSW A;  1UNQ A;  2Z0P A;  1I2H A;  2D9Z A;  4DIX A;  3TVV A;  2FJU B;  2P0D A;  2DFK A;  1X1G A;  2ELB A;  3F0W A;  2K2J A;  4HAX B;  3TO1 A;  1DDW A;  1U5D A;  3V5W A;  2DTC A;  2DKP A;  4A6F A;  4A6K A;  2IYB A;  4GPT B;  2N0Y A;  2QKM A;  1U27 A;  4KHA A;  1MK7 B;  1P5T A;  2J0K A;  4ZRK A;  1MPH A;  4EMO A;  2X18 A;  4GMV A;  3AU4 A;  1NU2 A;  2LKO A;  3DXD A;  4GZU A;  2N23 A;  4D0N B;  2DYN A;  1QQG A;  3NWA A;  3PZD A;  1E5W A;  1AWE A;  1UNP A;  1MIX A;  3AJ4 A;  1X86 A;  2M38 A;  3ODO A;  4ZRJ A;  2CY4 A;  1X11 A;  1FHX A;  4KHO A;  2KIG A;  1WGQ A;  1U5E A;  2OQB A;  3KY9 A;  3NW8 A;  2RUK B;  5M4Y B;  2DKQ A;  1ZC4 B;  2YT1 A;  2AEH A;  2ZPY A;  3KZ1 A;  3N7C A;  4BBK A;  1DDM A;  1XCG A;  1DYN A;  4XWX A;  3PEG A;  4PQ0 A;  3SNH A;  2CY5 A;  2LOZ A;  2XQN M;  2Z0O A;  1WG7 A;  3BIN A;  2JP2 A;  1WJ1 A;  2IFS A;  4DX9 0;  5J3T A;  5JLJ B;  4F7U P;  4K2P A;  4HAZ B;  1SHC A;  3KSY A;  2GJY A;  3HW2 B;  2YS1 A;  1MIZ B;  2D11 A;  1K5D B;  4GOU A;  5EFX A;  2I5C A;  1FGZ A;  2J0J A;  4HAY B;  1B55 A;  1DRO A;  4HDQ A;  4HAV B;  5JP4 A;  1WGU A;  1U29 A;  3OAN A;  2Z0Q A;  4IAP A;  4Z2M B;  2NZ8 B;  2RLO A;  2D9W A;  2OTX A;  2YF0 A;  2ELA A;  3A8Q A;  5LON B;  5FI0 A;  3MPX A;  2KIE A;  4HB2 B;  1W1D A;  1ZM0 A;  3D8F A;  1V5U A;  4KHB B;  1KZ7 A;  1V5P A;  4K17 A;  3DXC A;  1Y19 B;  2Y8F A;  5HE3 A;  1PMS A;  1ZSQ A;  4K81 A;  2H7E A;  1M7E A;  2Z13 A;  1V5M A;  2NBV A;  2DX5 A;  4WVF B;  3GYO A;  2YVC A;  2DHI A;  1LW3 A;  1GC7 A;  2ZKM X;  3T06 A;  1FHW A;  4MY6 A;  2G35 A;  3AU5 A;  4IFS A;  5KQ1 A;  2EMT A;  2I5F A;  2YT2 A;  3ML4 A;  4D6W A;  5C5B A;  3HK0 A;  2Z14 A;  3UZT A;  4GNK B;  1QC6 A;  2K2U A;  4WJ7 A;  1MKE A;  4QXA B;  1WI1 A;  2Z59 A;  3U8Z A;  2DA0 A;  3M1I B;  3CIK A;  3PVU A;  2K8E A;  5DI9 B;  2D10 A;  4A6F B;  2P0F A;  3ULB A;  4C0A A;  4CHM A;  1EGX A;  1BTK A;  2W2X C;  5I2M A;  2COA A;  1TXD A;  1OMW A;  3SO6 A;  1XD4 A;  2KUP A;  3IVF A;  3U12 A;  4QJ4 B;  2FJL A;  4EKU A;  5C16 A;  2YS3 A;  2COC A;  2COD A;  1UEF A;  1OY2 A;  4KVG B;  4HB3 B;  1NI2 A;  2MDX A;  1J19 A;  2R2Y A;  3PVL A;  1EF1 A;  1K5G B;  2YRY A;  1FGY A;  1V89 A;  1X05 A;  2P8V A;  4CSQ A;  2W2X D;  4A5K A;  3QBV B;  4Y94 A;  3HIE A;  5D3Y A;  2L1C A;  2R09 A;  4Z2N A;  1M7R A;  2GCJ A;  2NMB A;  1W1H A;  2LG1 A;  2L2I A;  2CAY A;  1ZVR A;  3X23 A;  1Z87 A; 
#chains in the Genus database with same CATH homology
 3FM8 C;  4MT7 A;  1RJ2 A;  1H10 A;  3QIJ A;  3TW1 A;  3O96 A;  3WA0 A;  1OQN A;  1U5F A;  2D9V A;  4ZRI A;  2P0H A;  1XOD A;  1U2B A;  3CXB B;  3P7Z A;  3VOQ A;  3ZVR A;  1EVH A;  3DXE A;  3SYX A;  1V88 A;  1XKE A;  3TCA A;  3MDB C;  3P6A A;  4HHV A;  3RCP A;  1DBH A;  5KQ4 A;  5C79 A;  2ADZ A;  2LOX A;  3SUZ A;  4YL8 A;  1FOE A;  1ZC3 B;  2DYQ A;  2HE7 A;  2DHJ A;  3A8P A;  4HB4 B;  4CHJ A;  3PP2 A;  4WSF A;  1U5G A;  3TFM A;  5DHA B;  4DBB A;  2EJ8 A;  2PZ1 A;  1TQZ A;  2D2Q A;  2I1J A;  4H8S A;  1KZG A;  5HE2 A;  5C5B B;  2Y8G A;  2YSZ A;  4DXA B;  1W1G A;  1WVH A;  1UPQ A;  4HAW B;  2RGN B;  2V76 A;  4L6E A;  4TYZ A;  1GG3 A;  3FSS A;  3PG7 A;  1MAI A;  2CRF A;  3ODX A;  2VRW B;  5FI1 A;  2MFQ A;  4GXB A;  1NTY A;  5KCV A;  2DHK A;  5HE0 A;  3ULC A;  2DX1 A;  3NSU A;  2Q13 A;  5DIF B;  1V61 A;  4F7H A;  5J3Y A;  2RNR B;  3D8E A;  4HB0 B;  1MK9 B;  2MKR A;  5JHG A;  2J0M A;  1UPR A;  2ROV A;  3G9W A;  1H4R A;  2RSG A;  5GOW B;  2COF A;  5J3Q A;  4TKN A;  5D3V A;  4B6H A;  1TJ6 A;  1XR0 B;  2I1K A;  2UVM A;  3GYP A;  1UNR A;  5D3W A;  5DHF B;  5HE1 A;  1Y5O A;  2BCJ A;  3BJI A;  1PFJ A;  1LB1 A;  2VKI A;  5LOP B;  1FB8 A;  1PLS A;  4NY0 A;  5CLL B;  3SV1 A;  1BWN A;  1KI1 B;  2LYD A;  3HQC A;  4HAT B;  3F5R A;  3LJU X;  2J59 M;  2QKL A;  3VIA A;  3A98 B;  2ROZ B;  4CYE A;  4HDO A;  4YON A;  2EMS A;  2YT0 A;  5JHH A;  1XX0 A;  1GC6 A;  2W2W A;  1P6S A;  2MWN B;  3D8D A;  4KAX B;  1EAZ A;  4EJN A;  1FHO A;  1DDV A;  4P7I A;  3U7D A;  1WJM A;  2Y7B A;  4K2O A;  1Q67 A;  2DN6 A;  4PNK A;  3QWM A;  3KRX A;  1SGH A;  2D9Y A;  3FEH A;  2H7D A;  5DH9 B;  1RRP B;  2HTH B;  2GCL A;  1BTN A;  1FAO A;  2KGX B;  5D3X A;  4A6H A;  3ODW A;  2DLW A;  1J0W A;  2KCJ A;  4IOY X;  1ISN A;  4GMX B;  1I7A A;  1AQC A;  3PSC A;  4MK0 A;  5L81 A;  2EC1 A;  2R0D A;  1NTV A;  2LUL A;  3KRW A;  4GN1 A;  2RVB B;  2K00 A;  2GS0 A;  2M14 A;  1N3H A;  2AL6 A;  2E2X A;  3ZDT A;  2VSZ A;  5CLQ B;  2D4Q A;  3WYF B;  1X1F A;  4DX8 A;  1P3R A;  4HAU B;  5D27 A;  5C6R A;  2UZR A;  3PVW A;  1IRS A;  2YS5 A;  2UZS A;  2D9X A;  4F7G A;  1BAK A;  4NSW A;  1UNQ A;  2Z0P A;  1I2H A;  2D9Z A;  3TVV A;  2P0D A;  2DFK A;  1X1G A;  2ELB A;  3F0W A;  2K2J A;  4HAX B;  3TO1 A;  1DDW A;  1U5D A;  3V5W A;  2DTC A;  2DKP A;  4A6F A;  4A6K A;  2IYB A;  4GPT B;  2N0Y A;  2QKM A;  1U27 A;  4KHA A;  1MK7 B;  1P5T A;  2J0K A;  4ZRK A;  1MPH A;  4EMO A;  2X18 A;  4GMV A;  3AU4 A;  1NU2 A;  2LKO A;  3DXD A;  4GZU A;  2N23 A;  4D0N B;  2DYN A;  1QQG A;  3PZD A;  1E5W A;  1AWE A;  1UNP A;  1MIX A;  3AJ4 A;  1X86 A;  2M38 A;  3ODO A;  4ZRJ A;  2CY4 A;  1X11 A;  1FHX A;  4KHO A;  1WGQ A;  1U5E A;  2OQB A;  3KY9 A;  2RUK B;  2DKQ A;  1ZC4 B;  2YT1 A;  2AEH A;  3KZ1 A;  2ZPY A;  3N7C A;  4BBK A;  1DDM A;  1XCG A;  1DYN A;  4XWX A;  3PEG A;  4PQ0 A;  3SNH A;  2CY5 A;  2LOZ A;  2XQN M;  2Z0O A;  1WG7 A;  3BIN A;  2JP2 A;  1WJ1 A;  2IFS A;  4DX9 0;  5J3T A;  5JLJ B;  4F7U P;  4K2P A;  4HAZ B;  1SHC A;  3KSY A;  2GJY A;  3HW2 B;  2YS1 A;  1MIZ B;  2D11 A;  1K5D B;  5EFX A;  2I5C A;  1FGZ A;  2J0J A;  4HAY B;  1B55 A;  1DRO A;  4HDQ A;  4HAV B;  5JP4 A;  1WGU A;  1U29 A;  3OAN A;  2Z0Q A;  4IAP A;  4Z2M B;  2NZ8 B;  2RLO A;  2D9W A;  2OTX A;  2YF0 A;  2ELA A;  3A8Q A;  5LON B;  5FI0 A;  3MPX A;  4HB2 B;  1W1D A;  1ZM0 A;  3D8F A;  1V5U A;  4KHB B;  1KZ7 A;  1V5P A;  4K17 A;  3DXC A;  1Y19 B;  2Y8F A;  5HE3 A;  1PMS A;  1ZSQ A;  4K81 A;  2H7E A;  1M7E A;  1V5M A;  2DX5 A;  4WVF B;  3GYO A;  2YVC A;  2DHI A;  1LW3 A;  1GC7 A;  3T06 A;  1FHW A;  4MY6 A;  2G35 A;  3AU5 A;  4IFS A;  5KQ1 A;  2EMT A;  2I5F A;  3ML4 A;  5C5B A;  3HK0 A;  3UZT A;  1QC6 A;  2K2U A;  4WJ7 A;  1MKE A;  1WI1 A;  3U8Z A;  2DA0 A;  3M1I B;  3CIK A;  3PVU A;  5DI9 B;  2D10 A;  4A6F B;  2P0F A;  3ULB A;  4C0A A;  4CHM A;  1EGX A;  1BTK A;  2W2X C;  2COA A;  1TXD A;  1OMW A;  3SO6 A;  1XD4 A;  2KUP A;  3IVF A;  2FJL A;  4EKU A;  5C16 A;  2YS3 A;  2COC A;  2COD A;  1UEF A;  1OY2 A;  4KVG B;  4HB3 B;  1NI2 A;  2MDX A;  1J19 A;  3PVL A;  1EF1 A;  1K5G B;  2YRY A;  1FGY A;  1V89 A;  1X05 A;  2P8V A;  2W2X D;  4A5K A;  3QBV B;  4Y94 A;  5D3Y A;  2L1C A;  2R09 A;  4Z2N A;  1M7R A;  2GCJ A;  2NMB A;  1W1H A;  2LG1 A;  2L2I A;  2CAY A;  1ZVR A;  3X23 A;  1Z87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...