3M1IB

Crystal structure of yeast crm1 (xpo1p) in complex with yeast ranbp1 (yrb1p) and yeast rangtp (gsp1pgtp)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
131
structure length
131
Chain Sequence
LEKVDVKTMEEDEEVLYKVRAKLFRFDADAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords GTP-binding nuclear protein GSP1/CNR1
publication title An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 35
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2010-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3m1iB00
4IAPA 5J3YA 3U8ZA 2W2XD 3PVLA 1DDWA 2DHJA 4EMOA 1NU2A 3TCAA 4TKNA 4MT7A 5JHHA 1W1HA 4C0AA 2D9WA 2QKLA 4H8SA 4A6FA 1FAOA 3ODWA 2CY4A 4HB3B 3UZTA 2V76A 4DX90 1K5DB 2M38A 2KGXB 3DXEA 3TO1A 2IYBA 2E2XA 4DX8A 3AJ4A 1P6SA 1U5GA 4TYZA 5DH9B 1PLSA 1FHWA 2Y8FA 5DHFB 4HB0B 5J3QA 2D9YA 3SV1A 1QQGA 3PVUA 2AL6A 3V5WA 2J59M 2IFSA 2D9XA 3PG7A 4B6HA 2L2IA 1SGHA 5HE3A 4CYEA 1NTVA 3P7ZA 1TXDA 1ISNA 5HE0A 1ZSQA 2X18A 1W1GA 4A5KA 2R09A 1W1DA 2DYQA 2MFQA 3ULCA 3VOQA 4WJ7A 2D4QA 3F5RA 1UPRA 2VRWB 1ZC4B 4DXAB 3SUZA 1UNPA 5CLQB 4Z2NA 3TFMA 1N3HA 1WG7A 2P0FA 2I5FA 4A6KA 1LB1A 2M14A 2EC1A 2HE7A 1MPHA 1NI2A 1P5TA 4HHVA 1WJMA 2DX5A 1H4RA 4KHOA 2Z0OA 3BJIA 3G9WA 4Y94A 1TQZA 4GMVA 1I7AA 2GCJA 5C6RA 3F0WA 1U5EA 1U27A 2W2WA 1XR0B 1Q67A 4PQ0A 3ODXA 2Y7BA 5D3VA 2ELAA 1WGQA 1ZM0A 5D3XA 4A6HA 2KUPA 2YRYA 3PEGA 3ML4A 5C79A 4BBKA 2RLOA 2J0KA 2N0YA 2K2UA 1V88A 4L6EA 3RCPA 3FSSA 5C5BB 4MY6A 4KAXB 3SNHA 3QWMA 1XCGA 5LOPB 4HAUB 3KY9A 2XQNM 4GPTB 3X23A 2I1KA 5KQ1A 3SO6A 3CIKA 1MIZB 4GZUA 1BTNA 4HATB 1U29A 1UNQA 3ULBA 5CLLB 2MKRA 4F7HA 1MK7B 1K5GB 2GJYA 5FI1A 1PMSA 3DXDA 1UNRA 3SYXA 1Z87A 1EAZA 2LOZA 4KHBB 4KVGB 4CHJA 3PZDA 4HAXB 2DN6A 4KHAA 3CXBB 2I5CA 1LW3A 1WJ1A 3QBVB 3KRXA 3LJUX 2H7DA 1XX0A 5C5BA 2DTCA 4HAYB 4EJNA 1PFJA 5LONB 4NSWA 3TW1A 4HAWB 4YONA 3PVWA 2YT1A 2YSZA 2Z0PA 2UZSA 1GC6A 3BINA 4GMXB 4DBBA 3D8DA 1FHXA 2H7EA 3DXCA 3ODOA 1MKEA 3WA0A 1XKEA 5JLJB 2R0DA 5JP4A 1UPQA 3HW2B 4MK0A 1M7RA 2LG1A 4GXBA 2HTHB 5GOWB 1SHCA 1DROA 3GYPA 1I2HA 1RJ2A 2W2XC 1V89A 2Q13A 3D8EA 4K17A 3FM8C 1TJ6A 4IFSA 1H10A 2COFA 2COAA 2OQBA 3NSUA 2CODA 1UEFA 2FJLA 4K2PA 1FHOA 1ZC3B 1B55A 2GCLA 4XWXA 1J0WA 3HK0A 2NMBA 2MDXA 4A6FB 2D11A 1MIXA 1X05A 2OTXA 5JHGA 1EVHA 1X1GA 2ROZB 3KZ1A 4F7GA 2J0MA 2EMSA 3PSCA 3KSYA 2ADZA 5KQ4A 3VIAA 2N23A 3M1IB 2VKIA 1J19A 2CAYA 2DFKA 4Z2MB 2CRFA 3KRWA 4IOYX 1P3RA 2RSGA 3MPXA 1XODA 2BCJA 2UZRA 2P0HA 3A8PA 1U5FA 4GN1A 2NZ8B 3O96A 2ELBA 2LYDA 5HE1A 2RVBB 2PZ1A 2LULA 3FEHA 1KI1B 1OY2A 2DKQA 2DHKA 3U7DA 4D0NB 4HAVB 4PNKA 3D8FA 1DDVA 2AEHA 1V61A 3GYOA 3A8QA 2YS3A 4K2OA 1V5UA 5FI0A 1FB8A 5DHAB 1OMWA 2GS0A 2P8VA 1Y19B 4HDQA 1GG3A 2L1CA 1V5PA 1EGXA 4P7IA 2DX1A 2MWNB 2Y8GA 2DA0A 3MDBC 3PP2A 4ZRJA 2ROVA 5L81A 1AQCA 5D3YA 2COCA 5J3TA 2YS1A 2YS5A 5DI9B 1QC6A 1DYNA 2K00A 2Z0QA 4F7UP 1EF1A 1E5WA 4HDOA 2ZPYA 3T06A 1X86A 2DYNA 1V5MA 4WVFB 2JP2A 1WGUA 3AU4A 4HAZB 2EMTA 5EFXA 3ZVRA 2UVMA 2I1JA 5HE2A 2RNRB 4CHMA 5DIFB 1DBHA 2P0DA 5C16A 2KCJA 1IRSA 2CY5A 1DDMA 1MAIA 1OQNA 1GC7A 1KZGA 3P6AA 1WI1A 1BAKA 1NTYA 5D3WA 2D9ZA 3ZDTA 2DKPA 1ZVRA 5KCVA 1AWEA 1U5DA 1FGZA 2D2QA 4HB2B 4ZRKA 1Y5OA 2RGNB 2G35A 1WVHA 2J0JA 3OANA 4ZRIA 4K81A 1FOEA 2YT0A 3A98B 2VSZA 1RRPB 2EJ8A 3QIJA 1FGYA 2DHIA 4WSFA 3TVVA 1X11A 1KZ7A 2YF0A 2QKMA 4EKUA 3WYFB 4HB4B 2RUKB 5D27A 3HQCA 1M7EA 2YVCA 3IVFA 1MK9B 2D9VA 4YL8A 1XD4A 3AU5A 1BTKA 1X1FA 2LKOA 2LOXA 1U2BA 2D10A 2K2JA 2DLWA 1BWNA 3N7CA 4NY0A
chains in the Genus database with same CATH superfamily
4IAPA 5J3YA 3U8ZA 2W2XD 3PVLA 1DDWA 2DHJA 4EMOA 1NU2A 3TCAA 4TKNA 4MT7A 5JHHA 1W1HA 4C0AA 2D9WA 2QKLA 2R2YA 4QJ5B 5I2SA 4H8SA 4A6FA 1FAOA 3ODWA 2CY4A 2RRFA 4HB3B 3UZTA 2V76A 4DX90 1K5DB 2M38A 2KGXB 3DXEA 3TO1A 2IYBA 2E2XA 4DX8A 3AJ4A 1P6SA 1U5GA 3NWDA 4TYZA 5DH9B 1PLSA 2KR0A 1FHWA 2Y8FA 5DHFB 4HB0B 5J3QA 2D9YA 2KIGA 3SV1A 1QQGA 3PVUA 2AL6A 3V5WA 2J59M 2IFSA 2D9XA 3PG7A 4B6HA 2L2IA 1SGHA 5HE3A 4CYEA 1NTVA 3P7ZA 1TXDA 1ISNA 5HE0A 1ZSQA 3NW8A 2X18A 1W1GA 4A5KA 2R09A 1W1DA 2GUMA 2DYQA 2MFQA 3ULCA 3VOQA 4WJ7A 2D4QA 3F5RA 4QXAB 1UPRA 2VRWB 2Z59A 1ZC4B 4DXAB 3SUZA 1UNPA 5CLQB 4Z2NA 3TFMA 1N3HA 1WG7A 2P0FA 4QJ3B 2I5FA 4A6KA 1LB1A 2M14A 2EC1A 2HE7A 1MPHA 1NI2A 1P5TA 4HHVA 1WJMA 2DX5A 1H4RA 4KHOA 2Z0OA 3BJIA 3G9WA 4Y94A 1TQZA 4GMVA 1I7AA 2GCJA 5C6RA 3F0WA 1U5EA 1U27A 2W2WA 1XR0B 1Q67A 4PQ0A 3ODXA 2Y7BA 5D3VA 3FVCA 2ELAA 1WGQA 1ZM0A 5D3XA 4A6HA 2KUPA 2YRYA 3PEGA 3ML4A 5C79A 4BBKA 2RLOA 2J0KA 2N0YA 2K2UA 1V88A 4L6EA 3RCPA 3FSSA 5C5BB 4MY6A 4KAXB 3SNHA 3QWMA 1XCGA 5LOPB 4OT1A 4HAUB 3KY9A 2XQNM 4GPTB 4QJ4B 3X23A 2I1KA 5KQ1A 5M4YB 3SO6A 3CIKA 1MIZB 4GZUA 4DIXA 2K49A 3NWAA 1BTNA 2K8EA 4HSIA 4HATB 1U29A 1UNQA 3ULBA 5CLLB 2MKRA 4F7HA 1MK7B 1K5GB 2GJYA 2NBVA 5FI1A 5IRSA 3OHMB 1PMSA 3DXDA 1UNRA 3SYXA 1Z87A 3A58A 1EAZA 2LOZA 4KHBB 4KVGB 4GOUA 4CHJA 3PZDA 4HAXB 2DN6A 4KHAA 3CXBB 2I5CA 1LW3A 1WJ1A 3QBVB 4GNKB 3KRXA 3LJUX 2H7DA 1XX0A 5C5BA 2DTCA 4HAYB 4EJNA 1PFJA 5LONB 4NSWA 3TW1A 4HAWB 4YONA 4D6WA 3PVWA 2YT1A 2YSZA 2Z0PA 2UZSA 1GC6A 3BINA 4GMXB 4DBBA 1MI1A 3D8DA 1FHXA 2H7EA 3DXCA 3ODOA 1MKEA 3WA0A 1XKEA 5JLJB 2R0DA 5JP4A 1UPQA 3HW2B 4MK0A 1M7RA 2LG1A 2Z4DA 4GXBA 2HTHB 5GOWB 1SHCA 3DCXA 1DROA 3GYPA 1I2HA 1RJ2A 2W2XC 1V89A 2Q13A 3D8EA 4K17A 3FM8C 1TJ6A 4IFSA 1H10A 2COFA 2COAA 2OQBA 3NSUA 2CODA 1UEFA 2FJLA 4K2PA 1FHOA 1ZC3B 1B55A 2GCLA 2KUQA 4XWXA 1J0WA 3HK0A 2NMBA 2MDXA 4A6FB 2Z13A 1T77A 2D11A 1MIXA 1X05A 2OTXA 5JHGA 1EVHA 1X1GA 2ROZB 3KZ1A 4F7GA 2J0MA 2EMSA 3PSCA 3KSYA 2ADZA 5KQ4A 3VIAA 2N23A 3M1IB 2VKIA 1J19A 2CAYA 2DFKA 4Z2MB 2CRFA 3KRWA 2ZKMX 4IOYX 1P3RA 2RSGA 3MPXA 1XODA 2BCJA 1ZYIA 2UZRA 2P0HA 3A8PA 1U5FA 4GN1A 2NZ8B 3NWFA 3O96A 2ELBA 2LYDA 5HE1A 2RVBB 2PZ1A 2LULA 3FEHA 1KI1B 1OY2A 2DKQA 2DHKA 3U7DA 4D0NB 2Z14A 4HAVB 4PNKA 3D8FA 1DDVA 2AEHA 1V61A 3GYOA 3A8QA 2YS3A 4K2OA 1V5UA 5FI0A 1FB8A 5DHAB 1OMWA 2GS0A 2P8VA 1Y19B 4HDQA 4L1RA 1GG3A 2L1CA 1V5PA 1EGXA 4P7IA 2DX1A 2MWNB 4CSQA 2Y8GA 2DA0A 3MDBC 3PP2A 4ZRJA 2ROVA 5L81A 1AQCA 5D3YA 4OSNA 2COCA 5J3TA 2YS1A 2YS5A 5DI9B 2YT2A 1QC6A 1DYNA 2K00A 2Z0QA 5LG4B 4F7UP 1EF1A 2KIEA 1E5WA 4HDOA 2ZPYA 3T06A 1X86A 2DYNA 1V5MA 4WVFB 4KHBA 2JP2A 1WGUA 3AU4A 4HAZB 2EMTA 5EFXA 3ZVRA 2UVMA 3B77A 2I1JA 5HE2A 2RNRB 4CHMA 5DIFB 1DBHA 2P0DA 5C16A 2KCJA 1IRSA 2CY5A 2FJUB 3HIEA 1MAIA 1OQNA 1DDMA 1GC7A 1KZGA 3P6AA 1WI1A 5I2MA 1BAKA 1NTYA 5D3WA 2D9ZA 3ZDTA 2DKPA 1ZVRA 5KCVA 1AWEA 1U5DA 1FGZA 2D2QA 3HSAA 4HB2B 4ZRKA 1Y5OA 3U12A 2RGNB 2G35A 1WVHA 2J0JA 3OANA 4ZRIA 4K81A 1FOEA 2YT0A 3A98B 2VSZA 1RRPB 2EJ8A 3QIJA 1FGYA 2DHIA 4WSFA 3TVVA 1X11A 1KZ7A 2YF0A 2QKMA 4EKUA 3WYFB 4HB4B 2RUKB 5D27A 3HQCA 1M7EA 2YVCA 3IVFA 1MK9B 2D9VA 4YL8A 1XD4A 3AU5A 1BTKA 1X1FA 2LKOA 2LOXA 1U2BA 2D10A 2K2JA 2DLWA 1BWNA 3N7CA 4NY0A
chains in the Genus database with same CATH topology
4IAPA 5J3YA 3U8ZA 2W2XD 3PVLA 1DDWA 2DHJA 4EMOA 1NU2A 3TCAA 4TKNA 4MT7A 5JHHA 1W1HA 4C0AA 2D9WA 2QKLA 4H8SA 4A6FA 1FAOA 3ODWA 2CY4A 4HB3B 3UZTA 2V76A 4DX90 1K5DB 2M38A 2KGXB 3DXEA 3TO1A 2IYBA 2E2XA 4DX8A 3AJ4A 1P6SA 1U5GA 4TYZA 5DH9B 1PLSA 1FHWA 2Y8FA 5DHFB 4HB0B 5J3QA 2D9YA 3SV1A 1QQGA 3PVUA 2AL6A 3V5WA 2J59M 2IFSA 2D9XA 3PG7A 4B6HA 2L2IA 1SGHA 5HE3A 4CYEA 1NTVA 3P7ZA 1TXDA 1ISNA 5HE0A 1ZSQA 2X18A 1W1GA 4A5KA 2R09A 1W1DA 2DYQA 2MFQA 3ULCA 3VOQA 4WJ7A 2D4QA 3F5RA 1UPRA 2VRWB 1ZC4B 4DXAB 3SUZA 1UNPA 5CLQB 4Z2NA 3TFMA 1N3HA 1WG7A 2P0FA 2I5FA 4A6KA 1LB1A 2M14A 2EC1A 2HE7A 1MPHA 1NI2A 1P5TA 4HHVA 1WJMA 2DX5A 1H4RA 4KHOA 2Z0OA 3BJIA 3G9WA 4Y94A 1TQZA 4GMVA 1I7AA 2GCJA 5C6RA 3F0WA 1U5EA 1U27A 2W2WA 1XR0B 1Q67A 4PQ0A 3ODXA 2Y7BA 5D3VA 2ELAA 1WGQA 1ZM0A 5D3XA 4A6HA 2KUPA 2YRYA 3PEGA 3ML4A 5C79A 4BBKA 2RLOA 2J0KA 2N0YA 2K2UA 1V88A 4L6EA 3RCPA 3FSSA 5C5BB 4MY6A 4KAXB 3SNHA 3QWMA 1XCGA 5LOPB 4HAUB 3KY9A 2XQNM 4GPTB 3X23A 2I1KA 5KQ1A 3SO6A 3CIKA 1MIZB 4GZUA 1BTNA 4HATB 1U29A 1UNQA 3ULBA 5CLLB 2MKRA 4F7HA 1MK7B 1K5GB 2GJYA 5FI1A 1PMSA 3DXDA 1UNRA 3SYXA 1Z87A 1EAZA 2LOZA 4KHBB 4KVGB 4CHJA 3PZDA 4HAXB 2DN6A 4KHAA 3CXBB 2I5CA 1LW3A 1WJ1A 3QBVB 3KRXA 3LJUX 2H7DA 1XX0A 5C5BA 2DTCA 4HAYB 4EJNA 1PFJA 5LONB 4NSWA 3TW1A 4HAWB 4YONA 3PVWA 2YT1A 2YSZA 2Z0PA 2UZSA 1GC6A 3BINA 4GMXB 4DBBA 3D8DA 1FHXA 2H7EA 3DXCA 3ODOA 1MKEA 3WA0A 1XKEA 5JLJB 2R0DA 5JP4A 1UPQA 3HW2B 4MK0A 1M7RA 2LG1A 4GXBA 2HTHB 5GOWB 1SHCA 1DROA 3GYPA 1I2HA 1RJ2A 2W2XC 1V89A 2Q13A 3D8EA 4K17A 3FM8C 1TJ6A 4IFSA 1H10A 2COFA 2COAA 2OQBA 3NSUA 2CODA 1UEFA 2FJLA 4K2PA 1FHOA 1ZC3B 1B55A 2GCLA 4XWXA 1J0WA 3HK0A 2NMBA 2MDXA 4A6FB 2D11A 1MIXA 1X05A 2OTXA 5JHGA 1EVHA 1X1GA 2ROZB 3KZ1A 4F7GA 2J0MA 2EMSA 3PSCA 3KSYA 2ADZA 5KQ4A 3VIAA 2N23A 3M1IB 2VKIA 1J19A 2CAYA 2DFKA 4Z2MB 2CRFA 3KRWA 4IOYX 1P3RA 2RSGA 3MPXA 1XODA 2BCJA 2UZRA 2P0HA 3A8PA 1U5FA 4GN1A 2NZ8B 3O96A 2ELBA 2LYDA 5HE1A 2RVBB 2PZ1A 2LULA 3FEHA 1KI1B 1OY2A 2DKQA 2DHKA 3U7DA 4D0NB 4HAVB 4PNKA 3D8FA 1DDVA 2AEHA 1V61A 3GYOA 3A8QA 2YS3A 4K2OA 1V5UA 5FI0A 1FB8A 5DHAB 1OMWA 2GS0A 2P8VA 1Y19B 4HDQA 1GG3A 2L1CA 1V5PA 1EGXA 4P7IA 2DX1A 2MWNB 2Y8GA 2DA0A 3MDBC 3PP2A 4ZRJA 2ROVA 5L81A 1AQCA 5D3YA 2COCA 5J3TA 2YS1A 2YS5A 5DI9B 1QC6A 1DYNA 2K00A 2Z0QA 4F7UP 1EF1A 1E5WA 4HDOA 2ZPYA 3T06A 1X86A 2DYNA 1V5MA 4WVFB 2JP2A 1WGUA 3AU4A 4HAZB 2EMTA 5EFXA 3ZVRA 2UVMA 2I1JA 5HE2A 2RNRB 4CHMA 5DIFB 1DBHA 2P0DA 5C16A 2KCJA 1IRSA 2CY5A 1DDMA 1MAIA 1OQNA 1GC7A 1KZGA 3P6AA 1WI1A 1BAKA 1NTYA 5D3WA 2D9ZA 3ZDTA 2DKPA 1ZVRA 5KCVA 1AWEA 1U5DA 1FGZA 2D2QA 4HB2B 4ZRKA 1Y5OA 2RGNB 2G35A 1WVHA 2J0JA 3OANA 4ZRIA 4K81A 1FOEA 2YT0A 3A98B 2VSZA 1RRPB 2EJ8A 3QIJA 1FGYA 2DHIA 4WSFA 3TVVA 1X11A 1KZ7A 2YF0A 2QKMA 4EKUA 3WYFB 4HB4B 2RUKB 5D27A 3HQCA 1M7EA 2YVCA 3IVFA 1MK9B 2D9VA 4YL8A 1XD4A 3AU5A 1BTKA 1X1FA 2LKOA 2LOXA 1U2BA 2D10A 2K2JA 2DLWA 1BWNA 3N7CA 4NY0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IAP A;  5J3Y A;  3U8Z A;  2W2X D;  3PVL A;  1DDW A;  2DHJ A;  4EMO A;  1NU2 A;  3TCA A;  4TKN A;  4MT7 A;  5JHH A;  1W1H A;  4C0A A;  2D9W A;  2QKL A;  4H8S A;  4A6F A;  1FAO A;  3ODW A;  2CY4 A;  4HB3 B;  3UZT A;  2V76 A;  4DX9 0;  1K5D B;  2M38 A;  2KGX B;  3DXE A;  3TO1 A;  2IYB A;  2E2X A;  4DX8 A;  3AJ4 A;  1P6S A;  1U5G A;  4TYZ A;  5DH9 B;  1PLS A;  1FHW A;  2Y8F A;  5DHF B;  4HB0 B;  5J3Q A;  2D9Y A;  3SV1 A;  1QQG A;  3PVU A;  2AL6 A;  3V5W A;  2J59 M;  2IFS A;  2D9X A;  3PG7 A;  4B6H A;  2L2I A;  1SGH A;  5HE3 A;  4CYE A;  1NTV A;  3P7Z A;  1TXD A;  1ISN A;  5HE0 A;  1ZSQ A;  2X18 A;  1W1G A;  4A5K A;  2R09 A;  1W1D A;  2DYQ A;  2MFQ A;  3ULC A;  3VOQ A;  4WJ7 A;  2D4Q A;  3F5R A;  1UPR A;  2VRW B;  1ZC4 B;  4DXA B;  3SUZ A;  1UNP A;  5CLQ B;  4Z2N A;  3TFM A;  1N3H A;  1WG7 A;  2P0F A;  2I5F A;  4A6K A;  1LB1 A;  2M14 A;  2EC1 A;  2HE7 A;  1MPH A;  1NI2 A;  1P5T A;  4HHV A;  1WJM A;  2DX5 A;  1H4R A;  4KHO A;  2Z0O A;  3BJI A;  3G9W A;  4Y94 A;  1TQZ A;  4GMV A;  1I7A A;  2GCJ A;  5C6R A;  3F0W A;  1U5E A;  1U27 A;  2W2W A;  1XR0 B;  1Q67 A;  4PQ0 A;  3ODX A;  2Y7B A;  5D3V A;  2ELA A;  1WGQ A;  1ZM0 A;  5D3X A;  4A6H A;  2KUP A;  2YRY A;  3PEG A;  3ML4 A;  5C79 A;  4BBK A;  2RLO A;  2J0K A;  2N0Y A;  2K2U A;  1V88 A;  4L6E A;  3RCP A;  3FSS A;  5C5B B;  4MY6 A;  4KAX B;  3SNH A;  3QWM A;  1XCG A;  5LOP B;  4HAU B;  3KY9 A;  2XQN M;  4GPT B;  3X23 A;  2I1K A;  5KQ1 A;  3SO6 A;  3CIK A;  1MIZ B;  4GZU A;  1BTN A;  4HAT B;  1U29 A;  1UNQ A;  3ULB A;  5CLL B;  2MKR A;  4F7H A;  1MK7 B;  1K5G B;  2GJY A;  5FI1 A;  1PMS A;  3DXD A;  1UNR A;  3SYX A;  1Z87 A;  1EAZ A;  2LOZ A;  4KHB B;  4KVG B;  4CHJ A;  3PZD A;  4HAX B;  2DN6 A;  4KHA A;  3CXB B;  2I5C A;  1LW3 A;  1WJ1 A;  3QBV B;  3KRX A;  3LJU X;  2H7D A;  1XX0 A;  5C5B A;  2DTC A;  4HAY B;  4EJN A;  1PFJ A;  5LON B;  4NSW A;  3TW1 A;  4HAW B;  4YON A;  3PVW A;  2YT1 A;  2YSZ A;  2Z0P A;  2UZS A;  1GC6 A;  3BIN A;  4GMX B;  4DBB A;  3D8D A;  1FHX A;  2H7E A;  3DXC A;  3ODO A;  1MKE A;  3WA0 A;  1XKE A;  5JLJ B;  2R0D A;  5JP4 A;  1UPQ A;  3HW2 B;  4MK0 A;  1M7R A;  2LG1 A;  4GXB A;  2HTH B;  5GOW B;  1SHC A;  1DRO A;  3GYP A;  1I2H A;  1RJ2 A;  2W2X C;  1V89 A;  2Q13 A;  3D8E A;  4K17 A;  3FM8 C;  1TJ6 A;  4IFS A;  1H10 A;  2COF A;  2COA A;  2OQB A;  3NSU A;  2COD A;  1UEF A;  2FJL A;  4K2P A;  1FHO A;  1ZC3 B;  1B55 A;  2GCL A;  4XWX A;  1J0W A;  3HK0 A;  2NMB A;  2MDX A;  4A6F B;  2D11 A;  1MIX A;  1X05 A;  2OTX A;  5JHG A;  1EVH A;  1X1G A;  2ROZ B;  3KZ1 A;  4F7G A;  2J0M A;  2EMS A;  3PSC A;  3KSY A;  2ADZ A;  5KQ4 A;  3VIA A;  2N23 A;  3M1I B;  2VKI A;  1J19 A;  2CAY A;  2DFK A;  4Z2M B;  2CRF A;  3KRW A;  4IOY X;  1P3R A;  2RSG A;  3MPX A;  1XOD A;  2BCJ A;  2UZR A;  2P0H A;  3A8P A;  1U5F A;  4GN1 A;  2NZ8 B;  3O96 A;  2ELB A;  2LYD A;  5HE1 A;  2RVB B;  2PZ1 A;  2LUL A;  3FEH A;  1KI1 B;  1OY2 A;  2DKQ A;  2DHK A;  3U7D A;  4D0N B;  4HAV B;  4PNK A;  3D8F A;  1DDV A;  2AEH A;  1V61 A;  3GYO A;  3A8Q A;  2YS3 A;  4K2O A;  1V5U A;  5FI0 A;  1FB8 A;  5DHA B;  1OMW A;  2GS0 A;  2P8V A;  1Y19 B;  4HDQ A;  1GG3 A;  2L1C A;  1V5P A;  1EGX A;  4P7I A;  2DX1 A;  2MWN B;  2Y8G A;  2DA0 A;  3MDB C;  3PP2 A;  4ZRJ A;  2ROV A;  5L81 A;  1AQC A;  5D3Y A;  2COC A;  5J3T A;  2YS1 A;  2YS5 A;  5DI9 B;  1QC6 A;  1DYN A;  2K00 A;  2Z0Q A;  4F7U P;  1EF1 A;  1E5W A;  4HDO A;  2ZPY A;  3T06 A;  1X86 A;  2DYN A;  1V5M A;  4WVF B;  2JP2 A;  1WGU A;  3AU4 A;  4HAZ B;  2EMT A;  5EFX A;  3ZVR A;  2UVM A;  2I1J A;  5HE2 A;  2RNR B;  4CHM A;  5DIF B;  1DBH A;  2P0D A;  5C16 A;  2KCJ A;  1IRS A;  2CY5 A;  1DDM A;  1MAI A;  1OQN A;  1GC7 A;  1KZG A;  3P6A A;  1WI1 A;  1BAK A;  1NTY A;  5D3W A;  2D9Z A;  3ZDT A;  2DKP A;  1ZVR A;  5KCV A;  1AWE A;  1U5D A;  1FGZ A;  2D2Q A;  4HB2 B;  4ZRK A;  1Y5O A;  2RGN B;  2G35 A;  1WVH A;  2J0J A;  3OAN A;  4ZRI A;  4K81 A;  1FOE A;  2YT0 A;  3A98 B;  2VSZ A;  1RRP B;  2EJ8 A;  3QIJ A;  1FGY A;  2DHI A;  4WSF A;  3TVV A;  1X11 A;  1KZ7 A;  2YF0 A;  2QKM A;  4EKU A;  3WYF B;  4HB4 B;  2RUK B;  5D27 A;  3HQC A;  1M7E A;  2YVC A;  3IVF A;  1MK9 B;  2D9V A;  4YL8 A;  1XD4 A;  3AU5 A;  1BTK A;  1X1F A;  2LKO A;  2LOX A;  1U2B A;  2D10 A;  2K2J A;  2DLW A;  1BWN A;  3N7C A;  4NY0 A; 
#chains in the Genus database with same CATH topology
 4IAP A;  5J3Y A;  3U8Z A;  2W2X D;  3PVL A;  1DDW A;  2DHJ A;  4EMO A;  1NU2 A;  3TCA A;  4TKN A;  4MT7 A;  5JHH A;  1W1H A;  4C0A A;  2D9W A;  2QKL A;  2R2Y A;  4QJ5 B;  5I2S A;  4H8S A;  4A6F A;  1FAO A;  3ODW A;  2CY4 A;  2RRF A;  4HB3 B;  3UZT A;  2V76 A;  4DX9 0;  1K5D B;  2M38 A;  2KGX B;  3DXE A;  3TO1 A;  2IYB A;  2E2X A;  4DX8 A;  3AJ4 A;  1P6S A;  1U5G A;  3NWD A;  4TYZ A;  5DH9 B;  1PLS A;  2KR0 A;  1FHW A;  2Y8F A;  5DHF B;  4HB0 B;  5J3Q A;  2D9Y A;  2KIG A;  3SV1 A;  1QQG A;  3PVU A;  2AL6 A;  3V5W A;  2J59 M;  2IFS A;  2D9X A;  3PG7 A;  4B6H A;  2L2I A;  1SGH A;  5HE3 A;  4CYE A;  1NTV A;  3P7Z A;  1TXD A;  1ISN A;  5HE0 A;  1ZSQ A;  3NW8 A;  2X18 A;  1W1G A;  4A5K A;  2R09 A;  1W1D A;  2GUM A;  2DYQ A;  2MFQ A;  3ULC A;  3VOQ A;  4WJ7 A;  2D4Q A;  3F5R A;  4QXA B;  1UPR A;  2VRW B;  2Z59 A;  1ZC4 B;  4DXA B;  3SUZ A;  1UNP A;  5CLQ B;  4Z2N A;  3TFM A;  1N3H A;  1WG7 A;  2P0F A;  4QJ3 B;  2I5F A;  4A6K A;  1LB1 A;  2M14 A;  2EC1 A;  2HE7 A;  1MPH A;  1NI2 A;  1P5T A;  4HHV A;  1WJM A;  2DX5 A;  1H4R A;  4KHO A;  2Z0O A;  3BJI A;  3G9W A;  4Y94 A;  1TQZ A;  4GMV A;  1I7A A;  2GCJ A;  5C6R A;  3F0W A;  1U5E A;  1U27 A;  2W2W A;  1XR0 B;  1Q67 A;  4PQ0 A;  3ODX A;  2Y7B A;  5D3V A;  3FVC A;  2ELA A;  1WGQ A;  1ZM0 A;  5D3X A;  4A6H A;  2KUP A;  2YRY A;  3PEG A;  3ML4 A;  5C79 A;  4BBK A;  2RLO A;  2J0K A;  2N0Y A;  2K2U A;  1V88 A;  4L6E A;  3RCP A;  3FSS A;  5C5B B;  4MY6 A;  4KAX B;  3SNH A;  3QWM A;  1XCG A;  5LOP B;  4OT1 A;  4HAU B;  3KY9 A;  2XQN M;  4GPT B;  4QJ4 B;  3X23 A;  2I1K A;  5KQ1 A;  5M4Y B;  3SO6 A;  3CIK A;  1MIZ B;  4GZU A;  4DIX A;  2K49 A;  3NWA A;  1BTN A;  2K8E A;  4HSI A;  4HAT B;  1U29 A;  1UNQ A;  3ULB A;  5CLL B;  2MKR A;  4F7H A;  1MK7 B;  1K5G B;  2GJY A;  2NBV A;  5FI1 A;  5IRS A;  3OHM B;  1PMS A;  3DXD A;  1UNR A;  3SYX A;  1Z87 A;  3A58 A;  1EAZ A;  2LOZ A;  4KHB B;  4KVG B;  4GOU A;  4CHJ A;  3PZD A;  4HAX B;  2DN6 A;  4KHA A;  3CXB B;  2I5C A;  1LW3 A;  1WJ1 A;  3QBV B;  4GNK B;  3KRX A;  3LJU X;  2H7D A;  1XX0 A;  5C5B A;  2DTC A;  4HAY B;  4EJN A;  1PFJ A;  5LON B;  4NSW A;  3TW1 A;  4HAW B;  4YON A;  4D6W A;  3PVW A;  2YT1 A;  2YSZ A;  2Z0P A;  2UZS A;  1GC6 A;  3BIN A;  4GMX B;  4DBB A;  1MI1 A;  3D8D A;  1FHX A;  2H7E A;  3DXC A;  3ODO A;  1MKE A;  3WA0 A;  1XKE A;  5JLJ B;  2R0D A;  5JP4 A;  1UPQ A;  3HW2 B;  4MK0 A;  1M7R A;  2LG1 A;  2Z4D A;  4GXB A;  2HTH B;  5GOW B;  1SHC A;  3DCX A;  1DRO A;  3GYP A;  1I2H A;  1RJ2 A;  2W2X C;  1V89 A;  2Q13 A;  3D8E A;  4K17 A;  3FM8 C;  1TJ6 A;  4IFS A;  1H10 A;  2COF A;  2COA A;  2OQB A;  3NSU A;  2COD A;  1UEF A;  2FJL A;  4K2P A;  1FHO A;  1ZC3 B;  1B55 A;  2GCL A;  2KUQ A;  4XWX A;  1J0W A;  3HK0 A;  2NMB A;  2MDX A;  4A6F B;  2Z13 A;  1T77 A;  2D11 A;  1MIX A;  1X05 A;  2OTX A;  5JHG A;  1EVH A;  1X1G A;  2ROZ B;  3KZ1 A;  4F7G A;  2J0M A;  2EMS A;  3PSC A;  3KSY A;  2ADZ A;  5KQ4 A;  3VIA A;  2N23 A;  3M1I B;  2VKI A;  1J19 A;  2CAY A;  2DFK A;  4Z2M B;  2CRF A;  3KRW A;  2ZKM X;  4IOY X;  1P3R A;  2RSG A;  3MPX A;  1XOD A;  2BCJ A;  1ZYI A;  2UZR A;  2P0H A;  3A8P A;  1U5F A;  4GN1 A;  2NZ8 B;  3NWF A;  3O96 A;  2ELB A;  2LYD A;  5HE1 A;  2RVB B;  2PZ1 A;  2LUL A;  3FEH A;  1KI1 B;  1OY2 A;  2DKQ A;  2DHK A;  3U7D A;  4D0N B;  2Z14 A;  4HAV B;  4PNK A;  3D8F A;  1DDV A;  2AEH A;  1V61 A;  3GYO A;  3A8Q A;  2YS3 A;  4K2O A;  1V5U A;  5FI0 A;  1FB8 A;  5DHA B;  1OMW A;  2GS0 A;  2P8V A;  1Y19 B;  4HDQ A;  4L1R A;  1GG3 A;  2L1C A;  1V5P A;  1EGX A;  4P7I A;  2DX1 A;  2MWN B;  4CSQ A;  2Y8G A;  2DA0 A;  3MDB C;  3PP2 A;  4ZRJ A;  2ROV A;  5L81 A;  1AQC A;  5D3Y A;  4OSN A;  2COC A;  5J3T A;  2YS1 A;  2YS5 A;  5DI9 B;  2YT2 A;  1QC6 A;  1DYN A;  2K00 A;  2Z0Q A;  5LG4 B;  4F7U P;  1EF1 A;  2KIE A;  1E5W A;  4HDO A;  2ZPY A;  3T06 A;  1X86 A;  2DYN A;  1V5M A;  4WVF B;  4KHB A;  2JP2 A;  1WGU A;  3AU4 A;  4HAZ B;  2EMT A;  5EFX A;  3ZVR A;  2UVM A;  3B77 A;  2I1J A;  5HE2 A;  2RNR B;  4CHM A;  5DIF B;  1DBH A;  2P0D A;  5C16 A;  2KCJ A;  1IRS A;  2CY5 A;  2FJU B;  3HIE A;  1MAI A;  1OQN A;  1DDM A;  1GC7 A;  1KZG A;  3P6A A;  1WI1 A;  5I2M A;  1BAK A;  1NTY A;  5D3W A;  2D9Z A;  3ZDT A;  2DKP A;  1ZVR A;  5KCV A;  1AWE A;  1U5D A;  1FGZ A;  2D2Q A;  3HSA A;  4HB2 B;  4ZRK A;  1Y5O A;  3U12 A;  2RGN B;  2G35 A;  1WVH A;  2J0J A;  3OAN A;  4ZRI A;  4K81 A;  1FOE A;  2YT0 A;  3A98 B;  2VSZ A;  1RRP B;  2EJ8 A;  3QIJ A;  1FGY A;  2DHI A;  4WSF A;  3TVV A;  1X11 A;  1KZ7 A;  2YF0 A;  2QKM A;  4EKU A;  3WYF B;  4HB4 B;  2RUK B;  5D27 A;  3HQC A;  1M7E A;  2YVC A;  3IVF A;  1MK9 B;  2D9V A;  4YL8 A;  1XD4 A;  3AU5 A;  1BTK A;  1X1F A;  2LKO A;  2LOX A;  1U2B A;  2D10 A;  2K2J A;  2DLW A;  1BWN A;  3N7C A;  4NY0 A; 
#chains in the Genus database with same CATH homology
 4IAP A;  5J3Y A;  3U8Z A;  2W2X D;  3PVL A;  1DDW A;  2DHJ A;  4EMO A;  1NU2 A;  3TCA A;  4TKN A;  4MT7 A;  5JHH A;  1W1H A;  4C0A A;  2D9W A;  2QKL A;  4H8S A;  4A6F A;  1FAO A;  3ODW A;  2CY4 A;  4HB3 B;  3UZT A;  2V76 A;  4DX9 0;  1K5D B;  2M38 A;  2KGX B;  3DXE A;  3TO1 A;  2IYB A;  2E2X A;  4DX8 A;  3AJ4 A;  1P6S A;  1U5G A;  4TYZ A;  5DH9 B;  1PLS A;  1FHW A;  2Y8F A;  5DHF B;  4HB0 B;  5J3Q A;  2D9Y A;  3SV1 A;  1QQG A;  3PVU A;  2AL6 A;  3V5W A;  2J59 M;  2IFS A;  2D9X A;  3PG7 A;  4B6H A;  2L2I A;  1SGH A;  5HE3 A;  4CYE A;  1NTV A;  3P7Z A;  1TXD A;  1ISN A;  5HE0 A;  1ZSQ A;  2X18 A;  1W1G A;  4A5K A;  2R09 A;  1W1D A;  2DYQ A;  2MFQ A;  3ULC A;  3VOQ A;  4WJ7 A;  2D4Q A;  3F5R A;  1UPR A;  2VRW B;  1ZC4 B;  4DXA B;  3SUZ A;  1UNP A;  5CLQ B;  4Z2N A;  3TFM A;  1N3H A;  1WG7 A;  2P0F A;  2I5F A;  4A6K A;  1LB1 A;  2M14 A;  2EC1 A;  2HE7 A;  1MPH A;  1NI2 A;  1P5T A;  4HHV A;  1WJM A;  2DX5 A;  1H4R A;  4KHO A;  2Z0O A;  3BJI A;  3G9W A;  4Y94 A;  1TQZ A;  4GMV A;  1I7A A;  2GCJ A;  5C6R A;  3F0W A;  1U5E A;  1U27 A;  2W2W A;  1XR0 B;  1Q67 A;  4PQ0 A;  3ODX A;  2Y7B A;  5D3V A;  2ELA A;  1WGQ A;  1ZM0 A;  5D3X A;  4A6H A;  2KUP A;  2YRY A;  3PEG A;  3ML4 A;  5C79 A;  4BBK A;  2RLO A;  2J0K A;  2N0Y A;  2K2U A;  1V88 A;  4L6E A;  3RCP A;  3FSS A;  5C5B B;  4MY6 A;  4KAX B;  3SNH A;  3QWM A;  1XCG A;  5LOP B;  4HAU B;  3KY9 A;  2XQN M;  4GPT B;  3X23 A;  2I1K A;  5KQ1 A;  3SO6 A;  3CIK A;  1MIZ B;  4GZU A;  1BTN A;  4HAT B;  1U29 A;  1UNQ A;  3ULB A;  5CLL B;  2MKR A;  4F7H A;  1MK7 B;  1K5G B;  2GJY A;  5FI1 A;  1PMS A;  3DXD A;  1UNR A;  3SYX A;  1Z87 A;  1EAZ A;  2LOZ A;  4KHB B;  4KVG B;  4CHJ A;  3PZD A;  4HAX B;  2DN6 A;  4KHA A;  3CXB B;  2I5C A;  1LW3 A;  1WJ1 A;  3QBV B;  3KRX A;  3LJU X;  2H7D A;  1XX0 A;  5C5B A;  2DTC A;  4HAY B;  4EJN A;  1PFJ A;  5LON B;  4NSW A;  3TW1 A;  4HAW B;  4YON A;  3PVW A;  2YT1 A;  2YSZ A;  2Z0P A;  2UZS A;  1GC6 A;  3BIN A;  4GMX B;  4DBB A;  3D8D A;  1FHX A;  2H7E A;  3DXC A;  3ODO A;  1MKE A;  3WA0 A;  1XKE A;  5JLJ B;  2R0D A;  5JP4 A;  1UPQ A;  3HW2 B;  4MK0 A;  1M7R A;  2LG1 A;  4GXB A;  2HTH B;  5GOW B;  1SHC A;  1DRO A;  3GYP A;  1I2H A;  1RJ2 A;  2W2X C;  1V89 A;  2Q13 A;  3D8E A;  4K17 A;  3FM8 C;  1TJ6 A;  4IFS A;  1H10 A;  2COF A;  2COA A;  2OQB A;  3NSU A;  2COD A;  1UEF A;  2FJL A;  4K2P A;  1FHO A;  1ZC3 B;  1B55 A;  2GCL A;  4XWX A;  1J0W A;  3HK0 A;  2NMB A;  2MDX A;  4A6F B;  2D11 A;  1MIX A;  1X05 A;  2OTX A;  5JHG A;  1EVH A;  1X1G A;  2ROZ B;  3KZ1 A;  4F7G A;  2J0M A;  2EMS A;  3PSC A;  3KSY A;  2ADZ A;  5KQ4 A;  3VIA A;  2N23 A;  3M1I B;  2VKI A;  1J19 A;  2CAY A;  2DFK A;  4Z2M B;  2CRF A;  3KRW A;  4IOY X;  1P3R A;  2RSG A;  3MPX A;  1XOD A;  2BCJ A;  2UZR A;  2P0H A;  3A8P A;  1U5F A;  4GN1 A;  2NZ8 B;  3O96 A;  2ELB A;  2LYD A;  5HE1 A;  2RVB B;  2PZ1 A;  2LUL A;  3FEH A;  1KI1 B;  1OY2 A;  2DKQ A;  2DHK A;  3U7D A;  4D0N B;  4HAV B;  4PNK A;  3D8F A;  1DDV A;  2AEH A;  1V61 A;  3GYO A;  3A8Q A;  2YS3 A;  4K2O A;  1V5U A;  5FI0 A;  1FB8 A;  5DHA B;  1OMW A;  2GS0 A;  2P8V A;  1Y19 B;  4HDQ A;  1GG3 A;  2L1C A;  1V5P A;  1EGX A;  4P7I A;  2DX1 A;  2MWN B;  2Y8G A;  2DA0 A;  3MDB C;  3PP2 A;  4ZRJ A;  2ROV A;  5L81 A;  1AQC A;  5D3Y A;  2COC A;  5J3T A;  2YS1 A;  2YS5 A;  5DI9 B;  1QC6 A;  1DYN A;  2K00 A;  2Z0Q A;  4F7U P;  1EF1 A;  1E5W A;  4HDO A;  2ZPY A;  3T06 A;  1X86 A;  2DYN A;  1V5M A;  4WVF B;  2JP2 A;  1WGU A;  3AU4 A;  4HAZ B;  2EMT A;  5EFX A;  3ZVR A;  2UVM A;  2I1J A;  5HE2 A;  2RNR B;  4CHM A;  5DIF B;  1DBH A;  2P0D A;  5C16 A;  2KCJ A;  1IRS A;  2CY5 A;  1DDM A;  1MAI A;  1OQN A;  1GC7 A;  1KZG A;  3P6A A;  1WI1 A;  1BAK A;  1NTY A;  5D3W A;  2D9Z A;  3ZDT A;  2DKP A;  1ZVR A;  5KCV A;  1AWE A;  1U5D A;  1FGZ A;  2D2Q A;  4HB2 B;  4ZRK A;  1Y5O A;  2RGN B;  2G35 A;  1WVH A;  2J0J A;  3OAN A;  4ZRI A;  4K81 A;  1FOE A;  2YT0 A;  3A98 B;  2VSZ A;  1RRP B;  2EJ8 A;  3QIJ A;  1FGY A;  2DHI A;  4WSF A;  3TVV A;  1X11 A;  1KZ7 A;  2YF0 A;  2QKM A;  4EKU A;  3WYF B;  4HB4 B;  2RUK B;  5D27 A;  3HQC A;  1M7E A;  2YVC A;  3IVF A;  1MK9 B;  2D9V A;  4YL8 A;  1XD4 A;  3AU5 A;  1BTK A;  1X1F A;  2LKO A;  2LOX A;  1U2B A;  2D10 A;  2K2J A;  2DLW A;  1BWN A;  3N7C A;  4NY0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...