3M1IB

Crystal structure of yeast crm1 (xpo1p) in complex with yeast ranbp1 (yrb1p) and yeast rangtp (gsp1pgtp)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
131
structure length
131
Chain Sequence
LEKVDVKTMEEDEEVLYKVRAKLFRFDADAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords GTP-binding nuclear protein GSP1/CNR1
total genus 35
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2010-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3m1iB00
1GC6A 2DYNA 2YRYA 5C79A 1MIZB 1FHOA 4BBKA 2ELAA 4C0AA 2RVBB 2RLOA 2ZPYA 1WVHA 2CODA 2Y8FA 2D2QA 2YVCA 3IVFA 4A6FB 3F0WA 4IOYX 3D8FA 4F7GA 4CHJA 1DYNA 1UEFA 4EJNA 1TJ6A 5C6RA 1ZSQA 1X1GA 1OQNA 2VRWB 5JHGA 5JHHA 2I1KA 3TFMA 2GCJA 2D9VA 3ML4A 2I5CA 5CLLB 4K2PA 4GXBA 1Q67A 2H7EA 3BINA 4P7IA 1WJMA 2MFQA 2Q13A 4DX8A 2HTHB 2COAA 2DN6A 2BCJA 1OMWA 3KY9A 1V61A 2N0YA 2IYBA 3P7ZA 2J59M 5D3XA 5JLJB 5J3QA 1FHXA 2HE7A 1MK9B 1FAOA 3MPXA 3TO1A 1XD4A 1M7EA 3PVLA 1QQGA 1LW3A 2MWNB 2IFSA 4DBBA 1BAKA 2RNRB 2DFKA 4HHVA 3VIAA 3PVWA 1N3HA 1UNPA 2PZ1A 3U7DA 2EJ8A 1WGUA 2EMTA 4K17A 3ODOA 5GOWB 3SUZA 5C5BB 2YT0A 4A6HA 5HE3A 1V88A 4PQ0A 3ZDTA 4EKUA 4KHBB 2JP2A 4HB3B 1P5TA 4DX90 2RGNB 1RRPB 2GCLA 4NY0A 3UZTA 5DHFB 1X11A 5L81A 1ZC4B 3HQCA 1KZGA 3PEGA 1FGZA 4D0NB 1SHCA 2D9WA 2R09A 2DHKA 2QKMA 3MDBC 2CAYA 3HK0A 4HAWB 2D9ZA 2UZSA 2DHIA 4B6HA 2D4QA 1KI1B 1GG3A 3A98B 3HW2B 2XQNM 3O96A 3X23A 2LYDA 3SYXA 4YL8A 3N7CA 1FGYA 4YONA 3P6AA 1V5UA 5FI1A 1V89A 3F5RA 1ZVRA 1WI1A 5JP4A 4A6KA 1FOEA 2K2JA 2LKOA 2YS3A 3TVVA 1W1GA 1U5FA 3DXCA 3GYPA 1EF1A 1QC6A 3TCAA 2KCJA 4NSWA 3V5WA 5EFXA 5KQ1A 3PP2A 2Z0OA 2ELBA 1RJ2A 3AU5A 2DX5A 1MK7B 4K81A 1X05A 1UNQA 2P0HA 1EGXA 1ZC3B 5HE1A 2DLWA 1KZ7A 4A5KA 2VKIA 1NI2A 2FJLA 5D27A 2Z0QA 4F7UP 5DH9B 1M7RA 3SNHA 3TW1A 1PFJA 5J3YA 1AQCA 2OTXA 2YS1A 1U5EA 2RUKB 1SGHA 1MPHA 1J19A 1EVHA 3PG7A 1Z87A 2KGXB 4A6FA 2H7DA 5D3WA 2J0MA 4MK0A 4ZRIA 2MKRA 2MDXA 5CLQB 1WJ1A 4WVFB 3PSCA 3QWMA 4KHOA 3GYOA 1B55A 2UZRA 2I1JA 2J0KA 2ADZA 3A8QA 5C16A 3WA0A 1BTNA 2GJYA 2AL6A 2D11A 1PMSA 1K5DB 1WG7A 2DX1A 4Z2NA 4EMOA 1H4RA 1MKEA 4IAPA 3SO6A 5HE2A 4GN1A 2YSZA 3CIKA 2OQBA 3OANA 2EC1A 2J0JA 2CY5A 3QIJA 1W1HA 2L1CA 3M1IB 3AJ4A 1MAIA 1X1FA 3AU4A 2LOXA 4F7HA 2LULA 4GZUA 2K2UA 1DDMA 4GMXB 3FEHA 4DXAB 1TXDA 4WSFA 2D9XA 1GC7A 1DDVA 4TKNA 3FSSA 2X18A 2DA0A 2ROVA 1DROA 3A8PA 2YF0A 2W2XC 3KRXA 2AEHA 4HB4B 4KVGB 1H10A 1UPQA 2LG1A 1TQZA 1Y19B 5DHAB 2LOZA 1U5DA 2L2IA 3ULBA 2R0DA 5C5BA 1PLSA 2ROZB 4ZRJA 1NU2A 4Y94A 2NMBA 4KAXB 3SV1A 1AWEA 2I5FA 2KUPA 3CXBB 3DXDA 2QKLA 2Y8GA 4L6EA 1NTVA 4HDQA 3ULCA 1BWNA 4HDOA 1E5WA 1U5GA 4HAXB 2M38A 3KSYA 3NSUA 5LONB 1MIXA 2M14A 5FI0A 5J3TA 4MY6A 1IRSA 4HAVB 2COCA 1DBHA 1UPRA 1U29A 3ODWA 4MT7A 2P8VA 1OY2A 2DYQA 4HB2B 5DI9B 3T06A 2D10A 2RSGA 1UNRA 3U8ZA 2NZ8B 5HE0A 4Z2MB 4PNKA 4H8SA 1XODA 5DIFB 2E2XA 3ZVRA 4HB0B 4KHAA 5LOPB 1U27A 3QBVB 3KZ1A 2W2XD 4WJ7A 2P0FA 2G35A 3KRWA 1P3RA 4GPTB 3FM8C 1LB1A 5KCVA 2DKQA 1FHWA 2GS0A 3ODXA 1V5MA 2N23A 3PVUA 5D3VA 4HAYB 4ZRKA 2CY4A 1Y5OA 1J0WA 3D8DA 2W2WA 1W1DA 1I2HA 1DDWA 2P0DA 2COFA 4GMVA 1P6SA 2DHJA 3PZDA 3G9WA 1X86A 2DKPA 4HATB 1I7AA 1U2BA 2V76A 3DXEA 1EAZA 1XX0A 4CYEA 2Z0PA 1ISNA 1XCGA 4TYZA 1WGQA 1K5GB 2Y7BA 1V5PA 2YT1A 3RCPA 3VOQA 2YS5A 1XKEA 3D8EA 4K2OA 2CRFA 3WYFB 1NTYA 2D9YA 3BJIA 2K00A 2EMSA 1BTKA 4HAZB 3LJUX 1XR0B 4HAUB 1ZM0A 4CHMA 2UVMA 5D3YA 2DTCA 4XWXA 2VSZA 4IFSA 1FB8A 5KQ4A
chains in the Genus database with same CATH superfamily
1GC6A 2DYNA 2YRYA 5C79A 3U12A 1MIZB 1FHOA 4BBKA 2ELAA 4C0AA 4GOUA 2RVBB 2RLOA 2ZPYA 1WVHA 2CODA 2Y8FA 2D2QA 2YVCA 3IVFA 4A6FB 3F0WA 2R2YA 4IOYX 4GNKB 3D8FA 4F7GA 4CHJA 1DYNA 4QJ5B 2KUQA 1UEFA 4EJNA 1TJ6A 5C6RA 1ZSQA 5I2SA 1X1GA 1OQNA 2VRWB 5JHGA 5JHHA 2I1KA 3TFMA 2GCJA 2D9VA 2K8EA 3ML4A 2I5CA 5CLLB 4K2PA 4GXBA 1Q67A 2H7EA 3BINA 4P7IA 1WJMA 2MFQA 2Q13A 4DX8A 2HTHB 2COAA 2DN6A 4QJ3B 2BCJA 1OMWA 3KY9A 1V61A 2N0YA 2IYBA 1ZYIA 3P7ZA 2J59M 5D3XA 5JLJB 5J3QA 1FHXA 2HE7A 1MK9B 1FAOA 3MPXA 3TO1A 1XD4A 1M7EA 3PVLA 1QQGA 1LW3A 2MWNB 2IFSA 4DBBA 2Z13A 2RNRB 1BAKA 2DFKA 4HHVA 3VIAA 3PVWA 1N3HA 1UNPA 2PZ1A 2YT2A 3U7DA 2EJ8A 1WGUA 2EMTA 4K17A 3ODOA 5GOWB 3SUZA 5C5BB 2YT0A 4A6HA 5HE3A 1V88A 4PQ0A 3ZDTA 4EKUA 4KHBB 4OSNA 2JP2A 4HB3B 1P5TA 4DX90 2RGNB 1RRPB 2GCLA 4NY0A 3UZTA 5DHFB 1X11A 5L81A 1ZC4B 3HQCA 4CSQA 1KZGA 3PEGA 1FGZA 4D0NB 1SHCA 2D9WA 2R09A 2DHKA 2QKMA 3MDBC 2RRFA 3NWDA 5M4YB 2CAYA 3HK0A 4HAWB 2D9ZA 2UZSA 3B77A 2DHIA 4B6HA 2D4QA 1KI1B 1GG3A 3A98B 3HW2B 2XQNM 3O96A 3X23A 2LYDA 3SYXA 4YL8A 3N7CA 3HSAA 1FGYA 4YONA 3P6AA 1V5UA 5FI1A 1V89A 3F5RA 1ZVRA 1WI1A 5JP4A 4A6KA 2ZKMX 1FOEA 2K2JA 2LKOA 2KR0A 2YS3A 3TVVA 1W1GA 1U5FA 3DXCA 3GYPA 1EF1A 1QC6A 3TCAA 2KCJA 4NSWA 3V5WA 5EFXA 5KQ1A 3PP2A 2Z0OA 2ELBA 1RJ2A 3AU5A 2DX5A 2NBVA 1MI1A 1MK7B 4K81A 1X05A 1UNQA 2P0HA 3FVCA 5IRSA 1ZC3B 5HE1A 1EGXA 2DLWA 1KZ7A 4A5KA 2VKIA 1NI2A 2GUMA 2FJLA 2Z59A 5D27A 2Z0QA 4F7UP 5DH9B 1M7RA 3SNHA 3TW1A 1PFJA 5J3YA 1AQCA 2OTXA 2YS1A 1U5EA 2RUKB 3OHMB 1SGHA 1MPHA 1J19A 1EVHA 3PG7A 1Z87A 2KGXB 4A6FA 2H7DA 5D3WA 2J0MA 4MK0A 4ZRIA 2MKRA 2MDXA 5CLQB 1WJ1A 4WVFB 3PSCA 3QWMA 2KIGA 4KHOA 3GYOA 1B55A 2UZRA 2I1JA 4QJ4B 2J0KA 2ADZA 3A8QA 5C16A 3WA0A 1BTNA 2GJYA 2AL6A 2D11A 4DIXA 1PMSA 1K5DB 1WG7A 2DX1A 4Z2NA 4EMOA 3DCXA 1H4RA 1MKEA 4IAPA 3SO6A 5HE2A 4GN1A 2YSZA 3CIKA 4HSIA 2OQBA 3OANA 2EC1A 2J0JA 2CY5A 3QIJA 1W1HA 2L1CA 3M1IB 3AJ4A 1MAIA 1X1FA 3AU4A 2Z14A 2LOXA 4F7HA 2LULA 4GZUA 2K2UA 2Z4DA 1DDMA 4GMXB 3FEHA 4DXAB 1TXDA 4WSFA 2D9XA 1GC7A 1DDVA 4TKNA 3FSSA 2X18A 2DA0A 2ROVA 1DROA 3A8PA 2YF0A 2W2XC 3NW8A 3KRXA 2AEHA 4HB4B 4KVGB 3HIEA 2K49A 1H10A 1UPQA 2LG1A 1TQZA 1Y19B 5DHAB 2LOZA 1U5DA 2L2IA 3ULBA 2R0DA 5C5BA 1PLSA 2ROZB 4ZRJA 1NU2A 4Y94A 2NMBA 4KAXB 3SV1A 4KHBA 1AWEA 2I5FA 2KUPA 3CXBB 3DXDA 2QKLA 2Y8GA 4L6EA 1NTVA 1T77A 4HDQA 3ULCA 1BWNA 2FJUB 4HDOA 1E5WA 1U5GA 4HAXB 2M38A 3KSYA 3NSUA 5LONB 1MIXA 2M14A 5FI0A 3A58A 5J3TA 4MY6A 1IRSA 4HAVB 2COCA 1DBHA 1UPRA 1U29A 5LG4B 3ODWA 4MT7A 2P8VA 1OY2A 2DYQA 4HB2B 5DI9B 3T06A 2D10A 2RSGA 4OT1A 1UNRA 3U8ZA 2NZ8B 5HE0A 4Z2MB 4PNKA 4H8SA 1XODA 5DIFB 4L1RA 2E2XA 3ZVRA 4D6WA 4HB0B 4KHAA 5LOPB 1U27A 4QXAB 5I2MA 3QBVB 3KZ1A 2W2XD 4WJ7A 2P0FA 2G35A 3KRWA 1P3RA 4GPTB 3FM8C 1LB1A 5KCVA 2DKQA 1FHWA 2GS0A 3ODXA 1V5MA 2N23A 3PVUA 5D3VA 4HAYB 4ZRKA 2CY4A 1Y5OA 1J0WA 3D8DA 2KIEA 2W2WA 1W1DA 1I2HA 1DDWA 2P0DA 2COFA 4GMVA 1P6SA 2DHJA 3PZDA 3G9WA 3NWAA 1X86A 2DKPA 4HATB 1I7AA 1U2BA 2V76A 3DXEA 1EAZA 1XX0A 4CYEA 2Z0PA 1ISNA 1XCGA 4TYZA 1WGQA 1K5GB 2Y7BA 1V5PA 2YT1A 3RCPA 3VOQA 2YS5A 1XKEA 3D8EA 4K2OA 2CRFA 3WYFB 1NTYA 3NWFA 2D9YA 3BJIA 2K00A 2EMSA 1BTKA 4HAZB 3LJUX 1XR0B 4HAUB 1ZM0A 4CHMA 2UVMA 5D3YA 2DTCA 4XWXA 2VSZA 4IFSA 1FB8A 5KQ4A
chains in the Genus database with same CATH topology
1GC6A 2DYNA 2YRYA 5C79A 1MIZB 1FHOA 4BBKA 2ELAA 4C0AA 2RVBB 2RLOA 2ZPYA 1WVHA 2CODA 2Y8FA 2D2QA 2YVCA 3IVFA 4A6FB 3F0WA 4IOYX 3D8FA 4F7GA 4CHJA 1DYNA 1UEFA 4EJNA 1TJ6A 5C6RA 1ZSQA 1X1GA 1OQNA 2VRWB 5JHGA 5JHHA 2I1KA 3TFMA 2GCJA 2D9VA 3ML4A 2I5CA 5CLLB 4K2PA 4GXBA 1Q67A 2H7EA 3BINA 4P7IA 1WJMA 2MFQA 2Q13A 4DX8A 2HTHB 2COAA 2DN6A 2BCJA 1OMWA 3KY9A 1V61A 2N0YA 2IYBA 3P7ZA 2J59M 5D3XA 5JLJB 5J3QA 1FHXA 2HE7A 1MK9B 1FAOA 3MPXA 3TO1A 1XD4A 1M7EA 3PVLA 1QQGA 1LW3A 2MWNB 2IFSA 4DBBA 1BAKA 2RNRB 2DFKA 4HHVA 3VIAA 3PVWA 1N3HA 1UNPA 2PZ1A 3U7DA 2EJ8A 1WGUA 2EMTA 4K17A 3ODOA 5GOWB 3SUZA 5C5BB 2YT0A 4A6HA 5HE3A 1V88A 4PQ0A 3ZDTA 4EKUA 4KHBB 2JP2A 4HB3B 1P5TA 4DX90 2RGNB 1RRPB 2GCLA 4NY0A 3UZTA 5DHFB 1X11A 5L81A 1ZC4B 3HQCA 1KZGA 3PEGA 1FGZA 4D0NB 1SHCA 2D9WA 2R09A 2DHKA 2QKMA 3MDBC 2CAYA 3HK0A 4HAWB 2D9ZA 2UZSA 2DHIA 4B6HA 2D4QA 1KI1B 1GG3A 3A98B 3HW2B 2XQNM 3O96A 3X23A 2LYDA 3SYXA 4YL8A 3N7CA 1FGYA 4YONA 3P6AA 1V5UA 5FI1A 1V89A 3F5RA 1ZVRA 1WI1A 5JP4A 4A6KA 1FOEA 2K2JA 2LKOA 2YS3A 3TVVA 1W1GA 1U5FA 3DXCA 3GYPA 1EF1A 1QC6A 3TCAA 2KCJA 4NSWA 3V5WA 5EFXA 5KQ1A 3PP2A 2Z0OA 2ELBA 1RJ2A 3AU5A 2DX5A 1MK7B 4K81A 1X05A 1UNQA 2P0HA 1EGXA 1ZC3B 5HE1A 2DLWA 1KZ7A 4A5KA 2VKIA 1NI2A 2FJLA 5D27A 2Z0QA 4F7UP 5DH9B 1M7RA 3SNHA 3TW1A 1PFJA 5J3YA 1AQCA 2OTXA 2YS1A 1U5EA 2RUKB 1SGHA 1MPHA 1J19A 1EVHA 3PG7A 1Z87A 2KGXB 4A6FA 2H7DA 5D3WA 2J0MA 4MK0A 4ZRIA 2MKRA 2MDXA 5CLQB 1WJ1A 4WVFB 3PSCA 3QWMA 4KHOA 3GYOA 1B55A 2UZRA 2I1JA 2J0KA 2ADZA 3A8QA 5C16A 3WA0A 1BTNA 2GJYA 2AL6A 2D11A 1PMSA 1K5DB 1WG7A 2DX1A 4Z2NA 4EMOA 1H4RA 1MKEA 4IAPA 3SO6A 5HE2A 4GN1A 2YSZA 3CIKA 2OQBA 3OANA 2EC1A 2J0JA 2CY5A 3QIJA 1W1HA 2L1CA 3M1IB 3AJ4A 1MAIA 1X1FA 3AU4A 2LOXA 4F7HA 2LULA 4GZUA 2K2UA 1DDMA 4GMXB 3FEHA 4DXAB 1TXDA 4WSFA 2D9XA 1GC7A 1DDVA 4TKNA 3FSSA 2X18A 2DA0A 2ROVA 1DROA 3A8PA 2YF0A 2W2XC 3KRXA 2AEHA 4HB4B 4KVGB 1H10A 1UPQA 2LG1A 1TQZA 1Y19B 5DHAB 2LOZA 1U5DA 2L2IA 3ULBA 2R0DA 5C5BA 1PLSA 2ROZB 4ZRJA 1NU2A 4Y94A 2NMBA 4KAXB 3SV1A 1AWEA 2I5FA 2KUPA 3CXBB 3DXDA 2QKLA 2Y8GA 4L6EA 1NTVA 4HDQA 3ULCA 1BWNA 4HDOA 1E5WA 1U5GA 4HAXB 2M38A 3KSYA 3NSUA 5LONB 1MIXA 2M14A 5FI0A 5J3TA 4MY6A 1IRSA 4HAVB 2COCA 1DBHA 1UPRA 1U29A 3ODWA 4MT7A 2P8VA 1OY2A 2DYQA 4HB2B 5DI9B 3T06A 2D10A 2RSGA 1UNRA 3U8ZA 2NZ8B 5HE0A 4Z2MB 4PNKA 4H8SA 1XODA 5DIFB 2E2XA 3ZVRA 4HB0B 4KHAA 5LOPB 1U27A 3QBVB 3KZ1A 2W2XD 4WJ7A 2P0FA 2G35A 3KRWA 1P3RA 4GPTB 3FM8C 1LB1A 5KCVA 2DKQA 1FHWA 2GS0A 3ODXA 1V5MA 2N23A 3PVUA 5D3VA 4HAYB 4ZRKA 2CY4A 1Y5OA 1J0WA 3D8DA 2W2WA 1W1DA 1I2HA 1DDWA 2P0DA 2COFA 4GMVA 1P6SA 2DHJA 3PZDA 3G9WA 1X86A 2DKPA 4HATB 1I7AA 1U2BA 2V76A 3DXEA 1EAZA 1XX0A 4CYEA 2Z0PA 1ISNA 1XCGA 4TYZA 1WGQA 1K5GB 2Y7BA 1V5PA 2YT1A 3RCPA 3VOQA 2YS5A 1XKEA 3D8EA 4K2OA 2CRFA 3WYFB 1NTYA 2D9YA 3BJIA 2K00A 2EMSA 1BTKA 4HAZB 3LJUX 1XR0B 4HAUB 1ZM0A 4CHMA 2UVMA 5D3YA 2DTCA 4XWXA 2VSZA 4IFSA 1FB8A 5KQ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GC6 A;  2DYN A;  2YRY A;  5C79 A;  1MIZ B;  1FHO A;  4BBK A;  2ELA A;  4C0A A;  2RVB B;  2RLO A;  2ZPY A;  1WVH A;  2COD A;  2Y8F A;  2D2Q A;  2YVC A;  3IVF A;  4A6F B;  3F0W A;  4IOY X;  3D8F A;  4F7G A;  4CHJ A;  1DYN A;  1UEF A;  4EJN A;  1TJ6 A;  5C6R A;  1ZSQ A;  1X1G A;  1OQN A;  2VRW B;  5JHG A;  5JHH A;  2I1K A;  3TFM A;  2GCJ A;  2D9V A;  3ML4 A;  2I5C A;  5CLL B;  4K2P A;  4GXB A;  1Q67 A;  2H7E A;  3BIN A;  4P7I A;  1WJM A;  2MFQ A;  2Q13 A;  4DX8 A;  2HTH B;  2COA A;  2DN6 A;  2BCJ A;  1OMW A;  3KY9 A;  1V61 A;  2N0Y A;  2IYB A;  3P7Z A;  2J59 M;  5D3X A;  5JLJ B;  5J3Q A;  1FHX A;  2HE7 A;  1MK9 B;  1FAO A;  3MPX A;  3TO1 A;  1XD4 A;  1M7E A;  3PVL A;  1QQG A;  1LW3 A;  2MWN B;  2IFS A;  4DBB A;  1BAK A;  2RNR B;  2DFK A;  4HHV A;  3VIA A;  3PVW A;  1N3H A;  1UNP A;  2PZ1 A;  3U7D A;  2EJ8 A;  1WGU A;  2EMT A;  4K17 A;  3ODO A;  5GOW B;  3SUZ A;  5C5B B;  2YT0 A;  4A6H A;  5HE3 A;  1V88 A;  4PQ0 A;  3ZDT A;  4EKU A;  4KHB B;  2JP2 A;  4HB3 B;  1P5T A;  4DX9 0;  2RGN B;  1RRP B;  2GCL A;  4NY0 A;  3UZT A;  5DHF B;  1X11 A;  5L81 A;  1ZC4 B;  3HQC A;  1KZG A;  3PEG A;  1FGZ A;  4D0N B;  1SHC A;  2D9W A;  2R09 A;  2DHK A;  2QKM A;  3MDB C;  2CAY A;  3HK0 A;  4HAW B;  2D9Z A;  2UZS A;  2DHI A;  4B6H A;  2D4Q A;  1KI1 B;  1GG3 A;  3A98 B;  3HW2 B;  2XQN M;  3O96 A;  3X23 A;  2LYD A;  3SYX A;  4YL8 A;  3N7C A;  1FGY A;  4YON A;  3P6A A;  1V5U A;  5FI1 A;  1V89 A;  3F5R A;  1ZVR A;  1WI1 A;  5JP4 A;  4A6K A;  1FOE A;  2K2J A;  2LKO A;  2YS3 A;  3TVV A;  1W1G A;  1U5F A;  3DXC A;  3GYP A;  1EF1 A;  1QC6 A;  3TCA A;  2KCJ A;  4NSW A;  3V5W A;  5EFX A;  5KQ1 A;  3PP2 A;  2Z0O A;  2ELB A;  1RJ2 A;  3AU5 A;  2DX5 A;  1MK7 B;  4K81 A;  1X05 A;  1UNQ A;  2P0H A;  1EGX A;  1ZC3 B;  5HE1 A;  2DLW A;  1KZ7 A;  4A5K A;  2VKI A;  1NI2 A;  2FJL A;  5D27 A;  2Z0Q A;  4F7U P;  5DH9 B;  1M7R A;  3SNH A;  3TW1 A;  1PFJ A;  5J3Y A;  1AQC A;  2OTX A;  2YS1 A;  1U5E A;  2RUK B;  1SGH A;  1MPH A;  1J19 A;  1EVH A;  3PG7 A;  1Z87 A;  2KGX B;  4A6F A;  2H7D A;  5D3W A;  2J0M A;  4MK0 A;  4ZRI A;  2MKR A;  2MDX A;  5CLQ B;  1WJ1 A;  4WVF B;  3PSC A;  3QWM A;  4KHO A;  3GYO A;  1B55 A;  2UZR A;  2I1J A;  2J0K A;  2ADZ A;  3A8Q A;  5C16 A;  3WA0 A;  1BTN A;  2GJY A;  2AL6 A;  2D11 A;  1PMS A;  1K5D B;  1WG7 A;  2DX1 A;  4Z2N A;  4EMO A;  1H4R A;  1MKE A;  4IAP A;  3SO6 A;  5HE2 A;  4GN1 A;  2YSZ A;  3CIK A;  2OQB A;  3OAN A;  2EC1 A;  2J0J A;  2CY5 A;  3QIJ A;  1W1H A;  2L1C A;  3M1I B;  3AJ4 A;  1MAI A;  1X1F A;  3AU4 A;  2LOX A;  4F7H A;  2LUL A;  4GZU A;  2K2U A;  1DDM A;  4GMX B;  3FEH A;  4DXA B;  1TXD A;  4WSF A;  2D9X A;  1GC7 A;  1DDV A;  4TKN A;  3FSS A;  2X18 A;  2DA0 A;  2ROV A;  1DRO A;  3A8P A;  2YF0 A;  2W2X C;  3KRX A;  2AEH A;  4HB4 B;  4KVG B;  1H10 A;  1UPQ A;  2LG1 A;  1TQZ A;  1Y19 B;  5DHA B;  2LOZ A;  1U5D A;  2L2I A;  3ULB A;  2R0D A;  5C5B A;  1PLS A;  2ROZ B;  4ZRJ A;  1NU2 A;  4Y94 A;  2NMB A;  4KAX B;  3SV1 A;  1AWE A;  2I5F A;  2KUP A;  3CXB B;  3DXD A;  2QKL A;  2Y8G A;  4L6E A;  1NTV A;  4HDQ A;  3ULC A;  1BWN A;  4HDO A;  1E5W A;  1U5G A;  4HAX B;  2M38 A;  3KSY A;  3NSU A;  5LON B;  1MIX A;  2M14 A;  5FI0 A;  5J3T A;  4MY6 A;  1IRS A;  4HAV B;  2COC A;  1DBH A;  1UPR A;  1U29 A;  3ODW A;  4MT7 A;  2P8V A;  1OY2 A;  2DYQ A;  4HB2 B;  5DI9 B;  3T06 A;  2D10 A;  2RSG A;  1UNR A;  3U8Z A;  2NZ8 B;  5HE0 A;  4Z2M B;  4PNK A;  4H8S A;  1XOD A;  5DIF B;  2E2X A;  3ZVR A;  4HB0 B;  4KHA A;  5LOP B;  1U27 A;  3QBV B;  3KZ1 A;  2W2X D;  4WJ7 A;  2P0F A;  2G35 A;  3KRW A;  1P3R A;  4GPT B;  3FM8 C;  1LB1 A;  5KCV A;  2DKQ A;  1FHW A;  2GS0 A;  3ODX A;  1V5M A;  2N23 A;  3PVU A;  5D3V A;  4HAY B;  4ZRK A;  2CY4 A;  1Y5O A;  1J0W A;  3D8D A;  2W2W A;  1W1D A;  1I2H A;  1DDW A;  2P0D A;  2COF A;  4GMV A;  1P6S A;  2DHJ A;  3PZD A;  3G9W A;  1X86 A;  2DKP A;  4HAT B;  1I7A A;  1U2B A;  2V76 A;  3DXE A;  1EAZ A;  1XX0 A;  4CYE A;  2Z0P A;  1ISN A;  1XCG A;  4TYZ A;  1WGQ A;  1K5G B;  2Y7B A;  1V5P A;  2YT1 A;  3RCP A;  3VOQ A;  2YS5 A;  1XKE A;  3D8E A;  4K2O A;  2CRF A;  3WYF B;  1NTY A;  2D9Y A;  3BJI A;  2K00 A;  2EMS A;  1BTK A;  4HAZ B;  3LJU X;  1XR0 B;  4HAU B;  1ZM0 A;  4CHM A;  2UVM A;  5D3Y A;  2DTC A;  4XWX A;  2VSZ A;  4IFS A;  1FB8 A;  5KQ4 A; 
#chains in the Genus database with same CATH topology
 1GC6 A;  2DYN A;  2YRY A;  5C79 A;  3U12 A;  1MIZ B;  1FHO A;  4BBK A;  2ELA A;  4C0A A;  4GOU A;  2RVB B;  2RLO A;  2ZPY A;  1WVH A;  2COD A;  2Y8F A;  2D2Q A;  2YVC A;  3IVF A;  4A6F B;  3F0W A;  2R2Y A;  4IOY X;  4GNK B;  3D8F A;  4F7G A;  4CHJ A;  1DYN A;  4QJ5 B;  2KUQ A;  1UEF A;  4EJN A;  1TJ6 A;  5C6R A;  1ZSQ A;  5I2S A;  1X1G A;  1OQN A;  2VRW B;  5JHG A;  5JHH A;  2I1K A;  3TFM A;  2GCJ A;  2D9V A;  2K8E A;  3ML4 A;  2I5C A;  5CLL B;  4K2P A;  4GXB A;  1Q67 A;  2H7E A;  3BIN A;  4P7I A;  1WJM A;  2MFQ A;  2Q13 A;  4DX8 A;  2HTH B;  2COA A;  2DN6 A;  4QJ3 B;  2BCJ A;  1OMW A;  3KY9 A;  1V61 A;  2N0Y A;  2IYB A;  1ZYI A;  3P7Z A;  2J59 M;  5D3X A;  5JLJ B;  5J3Q A;  1FHX A;  2HE7 A;  1MK9 B;  1FAO A;  3MPX A;  3TO1 A;  1XD4 A;  1M7E A;  3PVL A;  1QQG A;  1LW3 A;  2MWN B;  2IFS A;  4DBB A;  2Z13 A;  2RNR B;  1BAK A;  2DFK A;  4HHV A;  3VIA A;  3PVW A;  1N3H A;  1UNP A;  2PZ1 A;  2YT2 A;  3U7D A;  2EJ8 A;  1WGU A;  2EMT A;  4K17 A;  3ODO A;  5GOW B;  3SUZ A;  5C5B B;  2YT0 A;  4A6H A;  5HE3 A;  1V88 A;  4PQ0 A;  3ZDT A;  4EKU A;  4KHB B;  4OSN A;  2JP2 A;  4HB3 B;  1P5T A;  4DX9 0;  2RGN B;  1RRP B;  2GCL A;  4NY0 A;  3UZT A;  5DHF B;  1X11 A;  5L81 A;  1ZC4 B;  3HQC A;  4CSQ A;  1KZG A;  3PEG A;  1FGZ A;  4D0N B;  1SHC A;  2D9W A;  2R09 A;  2DHK A;  2QKM A;  3MDB C;  2RRF A;  3NWD A;  5M4Y B;  2CAY A;  3HK0 A;  4HAW B;  2D9Z A;  2UZS A;  3B77 A;  2DHI A;  4B6H A;  2D4Q A;  1KI1 B;  1GG3 A;  3A98 B;  3HW2 B;  2XQN M;  3O96 A;  3X23 A;  2LYD A;  3SYX A;  4YL8 A;  3N7C A;  3HSA A;  1FGY A;  4YON A;  3P6A A;  1V5U A;  5FI1 A;  1V89 A;  3F5R A;  1ZVR A;  1WI1 A;  5JP4 A;  4A6K A;  2ZKM X;  1FOE A;  2K2J A;  2LKO A;  2KR0 A;  2YS3 A;  3TVV A;  1W1G A;  1U5F A;  3DXC A;  3GYP A;  1EF1 A;  1QC6 A;  3TCA A;  2KCJ A;  4NSW A;  3V5W A;  5EFX A;  5KQ1 A;  3PP2 A;  2Z0O A;  2ELB A;  1RJ2 A;  3AU5 A;  2DX5 A;  2NBV A;  1MI1 A;  1MK7 B;  4K81 A;  1X05 A;  1UNQ A;  2P0H A;  3FVC A;  5IRS A;  1ZC3 B;  5HE1 A;  1EGX A;  2DLW A;  1KZ7 A;  4A5K A;  2VKI A;  1NI2 A;  2GUM A;  2FJL A;  2Z59 A;  5D27 A;  2Z0Q A;  4F7U P;  5DH9 B;  1M7R A;  3SNH A;  3TW1 A;  1PFJ A;  5J3Y A;  1AQC A;  2OTX A;  2YS1 A;  1U5E A;  2RUK B;  3OHM B;  1SGH A;  1MPH A;  1J19 A;  1EVH A;  3PG7 A;  1Z87 A;  2KGX B;  4A6F A;  2H7D A;  5D3W A;  2J0M A;  4MK0 A;  4ZRI A;  2MKR A;  2MDX A;  5CLQ B;  1WJ1 A;  4WVF B;  3PSC A;  3QWM A;  2KIG A;  4KHO A;  3GYO A;  1B55 A;  2UZR A;  2I1J A;  4QJ4 B;  2J0K A;  2ADZ A;  3A8Q A;  5C16 A;  3WA0 A;  1BTN A;  2GJY A;  2AL6 A;  2D11 A;  4DIX A;  1PMS A;  1K5D B;  1WG7 A;  2DX1 A;  4Z2N A;  4EMO A;  3DCX A;  1H4R A;  1MKE A;  4IAP A;  3SO6 A;  5HE2 A;  4GN1 A;  2YSZ A;  3CIK A;  4HSI A;  2OQB A;  3OAN A;  2EC1 A;  2J0J A;  2CY5 A;  3QIJ A;  1W1H A;  2L1C A;  3M1I B;  3AJ4 A;  1MAI A;  1X1F A;  3AU4 A;  2Z14 A;  2LOX A;  4F7H A;  2LUL A;  4GZU A;  2K2U A;  2Z4D A;  1DDM A;  4GMX B;  3FEH A;  4DXA B;  1TXD A;  4WSF A;  2D9X A;  1GC7 A;  1DDV A;  4TKN A;  3FSS A;  2X18 A;  2DA0 A;  2ROV A;  1DRO A;  3A8P A;  2YF0 A;  2W2X C;  3NW8 A;  3KRX A;  2AEH A;  4HB4 B;  4KVG B;  3HIE A;  2K49 A;  1H10 A;  1UPQ A;  2LG1 A;  1TQZ A;  1Y19 B;  5DHA B;  2LOZ A;  1U5D A;  2L2I A;  3ULB A;  2R0D A;  5C5B A;  1PLS A;  2ROZ B;  4ZRJ A;  1NU2 A;  4Y94 A;  2NMB A;  4KAX B;  3SV1 A;  4KHB A;  1AWE A;  2I5F A;  2KUP A;  3CXB B;  3DXD A;  2QKL A;  2Y8G A;  4L6E A;  1NTV A;  1T77 A;  4HDQ A;  3ULC A;  1BWN A;  2FJU B;  4HDO A;  1E5W A;  1U5G A;  4HAX B;  2M38 A;  3KSY A;  3NSU A;  5LON B;  1MIX A;  2M14 A;  5FI0 A;  3A58 A;  5J3T A;  4MY6 A;  1IRS A;  4HAV B;  2COC A;  1DBH A;  1UPR A;  1U29 A;  5LG4 B;  3ODW A;  4MT7 A;  2P8V A;  1OY2 A;  2DYQ A;  4HB2 B;  5DI9 B;  3T06 A;  2D10 A;  2RSG A;  4OT1 A;  1UNR A;  3U8Z A;  2NZ8 B;  5HE0 A;  4Z2M B;  4PNK A;  4H8S A;  1XOD A;  5DIF B;  4L1R A;  2E2X A;  3ZVR A;  4D6W A;  4HB0 B;  4KHA A;  5LOP B;  1U27 A;  4QXA B;  5I2M A;  3QBV B;  3KZ1 A;  2W2X D;  4WJ7 A;  2P0F A;  2G35 A;  3KRW A;  1P3R A;  4GPT B;  3FM8 C;  1LB1 A;  5KCV A;  2DKQ A;  1FHW A;  2GS0 A;  3ODX A;  1V5M A;  2N23 A;  3PVU A;  5D3V A;  4HAY B;  4ZRK A;  2CY4 A;  1Y5O A;  1J0W A;  3D8D A;  2KIE A;  2W2W A;  1W1D A;  1I2H A;  1DDW A;  2P0D A;  2COF A;  4GMV A;  1P6S A;  2DHJ A;  3PZD A;  3G9W A;  3NWA A;  1X86 A;  2DKP A;  4HAT B;  1I7A A;  1U2B A;  2V76 A;  3DXE A;  1EAZ A;  1XX0 A;  4CYE A;  2Z0P A;  1ISN A;  1XCG A;  4TYZ A;  1WGQ A;  1K5G B;  2Y7B A;  1V5P A;  2YT1 A;  3RCP A;  3VOQ A;  2YS5 A;  1XKE A;  3D8E A;  4K2O A;  2CRF A;  3WYF B;  1NTY A;  3NWF A;  2D9Y A;  3BJI A;  2K00 A;  2EMS A;  1BTK A;  4HAZ B;  3LJU X;  1XR0 B;  4HAU B;  1ZM0 A;  4CHM A;  2UVM A;  5D3Y A;  2DTC A;  4XWX A;  2VSZ A;  4IFS A;  1FB8 A;  5KQ4 A; 
#chains in the Genus database with same CATH homology
 1GC6 A;  2DYN A;  2YRY A;  5C79 A;  1MIZ B;  1FHO A;  4BBK A;  2ELA A;  4C0A A;  2RVB B;  2RLO A;  2ZPY A;  1WVH A;  2COD A;  2Y8F A;  2D2Q A;  2YVC A;  3IVF A;  4A6F B;  3F0W A;  4IOY X;  3D8F A;  4F7G A;  4CHJ A;  1DYN A;  1UEF A;  4EJN A;  1TJ6 A;  5C6R A;  1ZSQ A;  1X1G A;  1OQN A;  2VRW B;  5JHG A;  5JHH A;  2I1K A;  3TFM A;  2GCJ A;  2D9V A;  3ML4 A;  2I5C A;  5CLL B;  4K2P A;  4GXB A;  1Q67 A;  2H7E A;  3BIN A;  4P7I A;  1WJM A;  2MFQ A;  2Q13 A;  4DX8 A;  2HTH B;  2COA A;  2DN6 A;  2BCJ A;  1OMW A;  3KY9 A;  1V61 A;  2N0Y A;  2IYB A;  3P7Z A;  2J59 M;  5D3X A;  5JLJ B;  5J3Q A;  1FHX A;  2HE7 A;  1MK9 B;  1FAO A;  3MPX A;  3TO1 A;  1XD4 A;  1M7E A;  3PVL A;  1QQG A;  1LW3 A;  2MWN B;  2IFS A;  4DBB A;  1BAK A;  2RNR B;  2DFK A;  4HHV A;  3VIA A;  3PVW A;  1N3H A;  1UNP A;  2PZ1 A;  3U7D A;  2EJ8 A;  1WGU A;  2EMT A;  4K17 A;  3ODO A;  5GOW B;  3SUZ A;  5C5B B;  2YT0 A;  4A6H A;  5HE3 A;  1V88 A;  4PQ0 A;  3ZDT A;  4EKU A;  4KHB B;  2JP2 A;  4HB3 B;  1P5T A;  4DX9 0;  2RGN B;  1RRP B;  2GCL A;  4NY0 A;  3UZT A;  5DHF B;  1X11 A;  5L81 A;  1ZC4 B;  3HQC A;  1KZG A;  3PEG A;  1FGZ A;  4D0N B;  1SHC A;  2D9W A;  2R09 A;  2DHK A;  2QKM A;  3MDB C;  2CAY A;  3HK0 A;  4HAW B;  2D9Z A;  2UZS A;  2DHI A;  4B6H A;  2D4Q A;  1KI1 B;  1GG3 A;  3A98 B;  3HW2 B;  2XQN M;  3O96 A;  3X23 A;  2LYD A;  3SYX A;  4YL8 A;  3N7C A;  1FGY A;  4YON A;  3P6A A;  1V5U A;  5FI1 A;  1V89 A;  3F5R A;  1ZVR A;  1WI1 A;  5JP4 A;  4A6K A;  1FOE A;  2K2J A;  2LKO A;  2YS3 A;  3TVV A;  1W1G A;  1U5F A;  3DXC A;  3GYP A;  1EF1 A;  1QC6 A;  3TCA A;  2KCJ A;  4NSW A;  3V5W A;  5EFX A;  5KQ1 A;  3PP2 A;  2Z0O A;  2ELB A;  1RJ2 A;  3AU5 A;  2DX5 A;  1MK7 B;  4K81 A;  1X05 A;  1UNQ A;  2P0H A;  1EGX A;  1ZC3 B;  5HE1 A;  2DLW A;  1KZ7 A;  4A5K A;  2VKI A;  1NI2 A;  2FJL A;  5D27 A;  2Z0Q A;  4F7U P;  5DH9 B;  1M7R A;  3SNH A;  3TW1 A;  1PFJ A;  5J3Y A;  1AQC A;  2OTX A;  2YS1 A;  1U5E A;  2RUK B;  1SGH A;  1MPH A;  1J19 A;  1EVH A;  3PG7 A;  1Z87 A;  2KGX B;  4A6F A;  2H7D A;  5D3W A;  2J0M A;  4MK0 A;  4ZRI A;  2MKR A;  2MDX A;  5CLQ B;  1WJ1 A;  4WVF B;  3PSC A;  3QWM A;  4KHO A;  3GYO A;  1B55 A;  2UZR A;  2I1J A;  2J0K A;  2ADZ A;  3A8Q A;  5C16 A;  3WA0 A;  1BTN A;  2GJY A;  2AL6 A;  2D11 A;  1PMS A;  1K5D B;  1WG7 A;  2DX1 A;  4Z2N A;  4EMO A;  1H4R A;  1MKE A;  4IAP A;  3SO6 A;  5HE2 A;  4GN1 A;  2YSZ A;  3CIK A;  2OQB A;  3OAN A;  2EC1 A;  2J0J A;  2CY5 A;  3QIJ A;  1W1H A;  2L1C A;  3M1I B;  3AJ4 A;  1MAI A;  1X1F A;  3AU4 A;  2LOX A;  4F7H A;  2LUL A;  4GZU A;  2K2U A;  1DDM A;  4GMX B;  3FEH A;  4DXA B;  1TXD A;  4WSF A;  2D9X A;  1GC7 A;  1DDV A;  4TKN A;  3FSS A;  2X18 A;  2DA0 A;  2ROV A;  1DRO A;  3A8P A;  2YF0 A;  2W2X C;  3KRX A;  2AEH A;  4HB4 B;  4KVG B;  1H10 A;  1UPQ A;  2LG1 A;  1TQZ A;  1Y19 B;  5DHA B;  2LOZ A;  1U5D A;  2L2I A;  3ULB A;  2R0D A;  5C5B A;  1PLS A;  2ROZ B;  4ZRJ A;  1NU2 A;  4Y94 A;  2NMB A;  4KAX B;  3SV1 A;  1AWE A;  2I5F A;  2KUP A;  3CXB B;  3DXD A;  2QKL A;  2Y8G A;  4L6E A;  1NTV A;  4HDQ A;  3ULC A;  1BWN A;  4HDO A;  1E5W A;  1U5G A;  4HAX B;  2M38 A;  3KSY A;  3NSU A;  5LON B;  1MIX A;  2M14 A;  5FI0 A;  5J3T A;  4MY6 A;  1IRS A;  4HAV B;  2COC A;  1DBH A;  1UPR A;  1U29 A;  3ODW A;  4MT7 A;  2P8V A;  1OY2 A;  2DYQ A;  4HB2 B;  5DI9 B;  3T06 A;  2D10 A;  2RSG A;  1UNR A;  3U8Z A;  2NZ8 B;  5HE0 A;  4Z2M B;  4PNK A;  4H8S A;  1XOD A;  5DIF B;  2E2X A;  3ZVR A;  4HB0 B;  4KHA A;  5LOP B;  1U27 A;  3QBV B;  3KZ1 A;  2W2X D;  4WJ7 A;  2P0F A;  2G35 A;  3KRW A;  1P3R A;  4GPT B;  3FM8 C;  1LB1 A;  5KCV A;  2DKQ A;  1FHW A;  2GS0 A;  3ODX A;  1V5M A;  2N23 A;  3PVU A;  5D3V A;  4HAY B;  4ZRK A;  2CY4 A;  1Y5O A;  1J0W A;  3D8D A;  2W2W A;  1W1D A;  1I2H A;  1DDW A;  2P0D A;  2COF A;  4GMV A;  1P6S A;  2DHJ A;  3PZD A;  3G9W A;  1X86 A;  2DKP A;  4HAT B;  1I7A A;  1U2B A;  2V76 A;  3DXE A;  1EAZ A;  1XX0 A;  4CYE A;  2Z0P A;  1ISN A;  1XCG A;  4TYZ A;  1WGQ A;  1K5G B;  2Y7B A;  1V5P A;  2YT1 A;  3RCP A;  3VOQ A;  2YS5 A;  1XKE A;  3D8E A;  4K2O A;  2CRF A;  3WYF B;  1NTY A;  2D9Y A;  3BJI A;  2K00 A;  2EMS A;  1BTK A;  4HAZ B;  3LJU X;  1XR0 B;  4HAU B;  1ZM0 A;  4CHM A;  2UVM A;  5D3Y A;  2DTC A;  4XWX A;  2VSZ A;  4IFS A;  1FB8 A;  5KQ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...