2NMBA

Dnumb ptb domain complexed with a phosphotyrosine peptide, nmr, ensemble of structures.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
147
structure length
147
Chain Sequence
SKPHQWQADEEAVRSATCSFSVKYLGCVEVFESRGMQVCEEALKVLRQSRRRPVRGLLHVSGDGLRVVDDETKGLIVDQTIEKVSFCAPDRNHERGFSYICRDGTTRRWMCHGFLACKDSGERLSHAVGCAFAVCLERKQRRTRAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle/gene regulation
molecule keywords PROTEIN (NUMB PROTEIN)
publication title Structure of a Numb PTB domain-peptide complex suggests a basis for diverse binding specificity.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 20
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 1998-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2nmbA00
2JP2A 5DIFB 1BTKA 1Y19B 1W1DA 1Y5OA 2I1KA 3AU5A 4P7IA 2L1CA 1BTNA 4EKUA 4IFSA 3TCAA 1UEFA 2AEHA 3CIKA 1QQGA 2P0HA 1V5MA 3VIAA 2RSGA 5C16A 4DX8A 2Z0OA 4NY0A 2D9ZA 3KZ1A 1P3RA 2Y7BA 2M38A 5J3TA 1ZM0A 4MT7A 1UNQA 2DKQA 1WVHA 2K2UA 2DHJA 1MPHA 2COAA 3KY9A 1WGUA 4KAXB 2G35A 5D27A 3CXBB 3TO1A 1FHXA 3FEHA 1NTVA 4KHAA 2Z0QA 2J0MA 2J59M 1V5PA 2VKIA 3U7DA 1X05A 2H7EA 1OMWA 2KGXB 2UZSA 1U5FA 1Q67A 1FGYA 2J0KA 1M7EA 4KHBB 2D9XA 3SUZA 4MK0A 3ZDTA 3AJ4A 1N3HA 4ZRKA 2ROZB 1V89A 2ADZA 2V76A 4HHVA 2DA0A 2VRWB 3KRXA 2Y8FA 2UZRA 3BJIA 2AL6A 2DYNA 3D8FA 1K5DB 1ZC4B 3F5RA 5HE3A 5JHGA 5KQ4A 5DH9B 1P5TA 4HB4B 2ZPYA 1UNRA 4YL8A 4C0AA 2HTHB 2CODA 5J3YA 4GZUA 5CLLB 5FI1A 4IOYX 1MIXA 4Z2MB 1TQZA 2DKPA 3SV1A 3ULCA 1Z87A 2DLWA 4CHJA 1H4RA 2COCA 3LJUX 1GC6A 2DFKA 2LOXA 1M7RA 4GN1A 4WJ7A 1LW3A 2ROVA 4A6FB 1W1GA 2HE7A 4A6KA 2ELAA 2CY4A 1FOEA 4GMXB 4HATB 5EFXA 1X86A 4TYZA 3A98B 1DDMA 3O96A 1NU2A 1XX0A 4PNKA 2YRYA 3WA0A 3ODWA 2J0JA 1MK7B 2DX5A 3M1IB 3TW1A 2W2WA 1MKEA 2Q13A 1DDVA 3HW2B 3PZDA 4CHMA 2D2QA 3DXCA 1TJ6A 4PQ0A 4DX90 5DHFB 2MWNB 1I7AA 2DX1A 3MDBC 4EJNA 2DHKA 2GS0A 3PG7A 3ODXA 3HQCA 3T06A 1XR0B 4K2PA 4MY6A 5HE2A 3KRWA 2EMTA 5DHAB 2K00A 3GYPA 5CLQB 1DYNA 2XQNM 4B6HA 4BBKA 1LB1A 4WVFB 1X11A 2DHIA 1GC7A 2YS5A 4K2OA 1U5DA 1UPRA 3RCPA 1B55A 4K17A 2GCJA 3ODOA 1XD4A 5C6RA 1FHOA 2P0DA 1FAOA 2KCJA 2ELBA 1UPQA 1W1HA 2D9VA 3DXDA 1MK9B 5KQ1A 3PEGA 1X1GA 3PVWA 3F0WA 2RVBB 1GG3A 3A8QA 1UNPA 1PMSA 5LONB 4XWXA 4HAVB 4YONA 3FM8C 2YF0A 3UZTA 3WYFB 2L2IA 4HDQA 4IAPA 2D10A 2Z0PA 4Y94A 1AWEA 2EC1A 2MFQA 1EAZA 1V5UA 1ZC3B 1SHCA 2D4QA 1U5EA 3QWMA 3HK0A 4F7HA 4H8SA 1SGHA 5HE1A 4NSWA 2YSZA 1J19A 1PFJA 1H10A 1ZVRA 1V88A 1FHWA 5KCVA 2R0DA 4KVGB 4A6HA 2K2JA 5C79A 5JLJB 1NI2A 3AU4A 2CRFA 4GPTB 5C5BA 2W2XD 3OANA 5HE0A 2LYDA 3PP2A 4GXBA 1AQCA 2M14A 2D11A 3PVUA 4K81A 1U27A 1TXDA 1BAKA 2IYBA 2MDXA 4GMVA 4HDOA 2CAYA 3N7CA 4Z2NA 4ZRJA 2RGNB 1KI1B 1WJ1A 1EVHA 4CYEA 2LG1A 1RRPB 2X18A 2RNRB 2EJ8A 2YVCA 2RUKB 2BCJA 2D9WA 2QKLA 2NZ8B 2YS1A 4EMOA 3SO6A 4HAZB 4F7UP 3X23A 1V61A 3VOQA 3DXEA 1ISNA 3ULBA 1BWNA 1U2BA 2NMBA 2OQBA 3P7ZA 5FI0A 2DYQA 3V5WA 2W2XC 4HB3B 1DBHA 3P6AA 3D8DA 5J3QA 1WG7A 4HAWB 1PLSA 2H7DA 4F7GA 3IVFA 4TKNA 3U8ZA 1DDWA 1ZSQA 2YT1A 3KSYA 1J0WA 2N23A 5D3VA 3FSSA 2DTCA 2GJYA 3TVVA 5L81A 2COFA 4WSFA 3ML4A 1KZ7A 2IFSA 1WJMA 3SNHA 1U29A 2UVMA 2E2XA 5D3XA 3ZVRA 4HB2B 3GYOA 1P6SA 1EF1A 1EGXA 3QBVB 2LULA 1NTYA 1MIZB 2FJLA 4KHOA 2I5FA 2Y8GA 3TFMA 5JP4A 1FB8A 4ZRIA 2VSZA 2MKRA 3G9WA 3MPXA 1U5GA 4A6FA 1WGQA 3A8PA 3BINA 2PZ1A 5D3YA 2DN6A 4D0NB 4HAUB 2YT0A 3QIJA 3PVLA 1K5GB 1XCGA 2P0FA 2N0YA 3D8EA 1QC6A 2GCLA 2RLOA 4HB0B 2QKMA 5GOWB 4L6EA 4HAYB 5D3WA 1X1FA 2KUPA 1I2HA 2I5CA 3NSUA 4A5KA 2P8VA 1DROA 1WI1A 2LKOA 3PSCA 2YS3A 1E5WA 2D9YA 2I1JA 5LOPB 4DBBA 5C5BB 4DXAB 5JHHA 1XODA 1FGZA 1IRSA 1RJ2A 1KZGA 2R09A 2CY5A 4HAXB 1XKEA 1OQNA 1MAIA 5DI9B 2EMSA 2LOZA 2OTXA 1OY2A 3SYXA
chains in the Genus database with same CATH superfamily
2JP2A 5DIFB 1BTKA 1Y19B 1W1DA 1Y5OA 2I1KA 3AU5A 4P7IA 4GOUA 2L1CA 4CSQA 1BTNA 3FVCA 4EKUA 4IFSA 3TCAA 1UEFA 2AEHA 3CIKA 3U12A 1QQGA 2P0HA 1V5MA 3NWDA 3VIAA 2RSGA 5C16A 4DX8A 2Z0OA 4NY0A 2D9ZA 3KZ1A 4KHBA 1P3RA 2Y7BA 2M38A 5J3TA 3A58A 1ZM0A 4MT7A 1UNQA 2DKQA 4OSNA 1WVHA 2K2UA 2DHJA 1MPHA 2COAA 3KY9A 1WGUA 4KAXB 2G35A 5D27A 3CXBB 3TO1A 1FHXA 3FEHA 1NTVA 4KHAA 2Z0QA 2J0MA 2J59M 1V5PA 2VKIA 3U7DA 1X05A 2H7EA 1OMWA 2KGXB 2UZSA 1U5FA 1Q67A 1FGYA 2ZKMX 2J0KA 1M7EA 4KHBB 2D9XA 3SUZA 4MK0A 3ZDTA 3AJ4A 1N3HA 4ZRKA 2ROZB 1V89A 2ADZA 2V76A 4HHVA 2DA0A 2VRWB 3KRXA 2Y8FA 2UZRA 3BJIA 2AL6A 2DYNA 3D8FA 1K5DB 1ZC4B 3F5RA 5HE3A 1T77A 5JHGA 5KQ4A 5DH9B 1P5TA 4HB4B 2ZPYA 1UNRA 4YL8A 4C0AA 2HTHB 2CODA 5J3YA 4GZUA 5CLLB 5FI1A 4IOYX 1MIXA 4Z2MB 1TQZA 2DKPA 3SV1A 3ULCA 1Z87A 2DLWA 4CHJA 1H4RA 2COCA 3LJUX 1GC6A 2DFKA 2LOXA 1M7RA 5I2SA 4GN1A 4WJ7A 1LW3A 2ROVA 4A6FB 1W1GA 2HE7A 4A6KA 2ELAA 2CY4A 1FOEA 4GMXB 4HATB 5EFXA 1X86A 4TYZA 3A98B 1DDMA 3O96A 1NU2A 1XX0A 4PNKA 2YRYA 3WA0A 3ODWA 2J0JA 1MK7B 2DX5A 3M1IB 3TW1A 2W2WA 1MKEA 2Q13A 1DDVA 3HW2B 3PZDA 4CHMA 2D2QA 3DXCA 1TJ6A 4PQ0A 4DX90 5DHFB 2MWNB 1I7AA 2DX1A 3MDBC 4EJNA 2DHKA 2GS0A 3HIEA 3PG7A 3ODXA 3HQCA 3T06A 1XR0B 4K2PA 4MY6A 5HE2A 3KRWA 2EMTA 5DHAB 2K00A 3GYPA 5CLQB 1DYNA 2XQNM 4B6HA 2Z14A 4BBKA 1LB1A 4QXAB 4WVFB 1X11A 2DHIA 1GC7A 2YS5A 4K2OA 1U5DA 1UPRA 3RCPA 1B55A 4K17A 2GCJA 3ODOA 1XD4A 5C6RA 1FHOA 2P0DA 1FAOA 2KCJA 2ELBA 1UPQA 1W1HA 2D9VA 3DXDA 1MK9B 5KQ1A 3PEGA 5IRSA 1X1GA 3PVWA 3F0WA 2RVBB 1GG3A 3A8QA 1UNPA 1PMSA 5LONB 4XWXA 4QJ5B 4HAVB 4YONA 3FM8C 2YF0A 3UZTA 3WYFB 2L2IA 4HDQA 4IAPA 2D10A 2Z0PA 4Y94A 4DIXA 1AWEA 4GNKB 2EC1A 2MFQA 4QJ3B 1EAZA 1V5UA 3DCXA 1ZC3B 1SHCA 2D4QA 1U5EA 2Z59A 3QWMA 1ZYIA 2YT2A 3HK0A 4F7HA 5M4YB 4H8SA 1SGHA 5HE1A 4NSWA 2YSZA 2NBVA 5LG4B 1J19A 1PFJA 1H10A 3NWFA 1ZVRA 1V88A 1FHWA 5KCVA 2R0DA 4KVGB 4A6HA 2K2JA 5C79A 5JLJB 1NI2A 3AU4A 2CRFA 4GPTB 5C5BA 2W2XD 3OANA 5HE0A 2LYDA 3PP2A 4GXBA 1AQCA 2M14A 2D11A 3PVUA 4K81A 1U27A 2RRFA 1TXDA 1BAKA 2IYBA 2MDXA 4GMVA 4HDOA 2CAYA 3N7CA 4Z2NA 4ZRJA 2RGNB 1KI1B 1WJ1A 1EVHA 4CYEA 2LG1A 1RRPB 2X18A 2RNRB 2EJ8A 2YVCA 2RUKB 2BCJA 2D9WA 2QKLA 2NZ8B 2YS1A 4EMOA 3NW8A 3SO6A 2K8EA 4HAZB 4F7UP 3X23A 1V61A 4D6WA 3VOQA 3DXEA 1ISNA 3ULBA 1BWNA 1U2BA 2NMBA 2OQBA 3P7ZA 5FI0A 2DYQA 4L1RA 3V5WA 2W2XC 4HB3B 1DBHA 3P6AA 5I2MA 3D8DA 5J3QA 1WG7A 4HAWB 1PLSA 2H7DA 4F7GA 3IVFA 4TKNA 1MI1A 3U8ZA 1DDWA 1ZSQA 2YT1A 3KSYA 1J0WA 2KR0A 2N23A 5D3VA 3FSSA 2DTCA 2GJYA 3TVVA 5L81A 2COFA 4WSFA 3ML4A 1KZ7A 2Z13A 2IFSA 1WJMA 3SNHA 2GUMA 1U29A 2UVMA 3NWAA 2E2XA 5D3XA 3ZVRA 4HB2B 2KUQA 3GYOA 1P6SA 1EF1A 1EGXA 3QBVB 2LULA 1NTYA 1MIZB 2KIGA 2FJLA 4KHOA 2R2YA 2I5FA 2Y8GA 4QJ4B 3TFMA 5JP4A 1FB8A 4ZRIA 4HSIA 2VSZA 2MKRA 3G9WA 3MPXA 1U5GA 4A6FA 1WGQA 3A8PA 3BINA 2PZ1A 5D3YA 2DN6A 4D0NB 4HAUB 2YT0A 3QIJA 3PVLA 1K5GB 1XCGA 2P0FA 2N0YA 3D8EA 1QC6A 2GCLA 2RLOA 4HB0B 2QKMA 5GOWB 3OHMB 4L6EA 4OT1A 4HAYB 5D3WA 3HSAA 1X1FA 2KUPA 1I2HA 2I5CA 3NSUA 2FJUB 4A5KA 2KIEA 2P8VA 1DROA 1WI1A 2LKOA 3PSCA 2YS3A 1E5WA 2D9YA 2I1JA 5LOPB 4DBBA 2Z4DA 5C5BB 4DXAB 5JHHA 3B77A 1XODA 1FGZA 1IRSA 1RJ2A 1KZGA 2R09A 2CY5A 4HAXB 1XKEA 1OQNA 1MAIA 5DI9B 2EMSA 2LOZA 2OTXA 1OY2A 2K49A 3SYXA
chains in the Genus database with same CATH topology
2JP2A 5DIFB 1BTKA 1Y19B 1W1DA 1Y5OA 2I1KA 3AU5A 4P7IA 2L1CA 1BTNA 4EKUA 4IFSA 3TCAA 1UEFA 2AEHA 3CIKA 1QQGA 2P0HA 1V5MA 3VIAA 2RSGA 5C16A 4DX8A 2Z0OA 4NY0A 2D9ZA 3KZ1A 1P3RA 2Y7BA 2M38A 5J3TA 1ZM0A 4MT7A 1UNQA 2DKQA 1WVHA 2K2UA 2DHJA 1MPHA 2COAA 3KY9A 1WGUA 4KAXB 2G35A 5D27A 3CXBB 3TO1A 1FHXA 3FEHA 1NTVA 4KHAA 2Z0QA 2J0MA 2J59M 1V5PA 2VKIA 3U7DA 1X05A 2H7EA 1OMWA 2KGXB 2UZSA 1U5FA 1Q67A 1FGYA 2J0KA 1M7EA 4KHBB 2D9XA 3SUZA 4MK0A 3ZDTA 3AJ4A 1N3HA 4ZRKA 2ROZB 1V89A 2ADZA 2V76A 4HHVA 2DA0A 2VRWB 3KRXA 2Y8FA 2UZRA 3BJIA 2AL6A 2DYNA 3D8FA 1K5DB 1ZC4B 3F5RA 5HE3A 5JHGA 5KQ4A 5DH9B 1P5TA 4HB4B 2ZPYA 1UNRA 4YL8A 4C0AA 2HTHB 2CODA 5J3YA 4GZUA 5CLLB 5FI1A 4IOYX 1MIXA 4Z2MB 1TQZA 2DKPA 3SV1A 3ULCA 1Z87A 2DLWA 4CHJA 1H4RA 2COCA 3LJUX 1GC6A 2DFKA 2LOXA 1M7RA 4GN1A 4WJ7A 1LW3A 2ROVA 4A6FB 1W1GA 2HE7A 4A6KA 2ELAA 2CY4A 1FOEA 4GMXB 4HATB 5EFXA 1X86A 4TYZA 3A98B 1DDMA 3O96A 1NU2A 1XX0A 4PNKA 2YRYA 3WA0A 3ODWA 2J0JA 1MK7B 2DX5A 3M1IB 3TW1A 2W2WA 1MKEA 2Q13A 1DDVA 3HW2B 3PZDA 4CHMA 2D2QA 3DXCA 1TJ6A 4PQ0A 4DX90 5DHFB 2MWNB 1I7AA 2DX1A 3MDBC 4EJNA 2DHKA 2GS0A 3PG7A 3ODXA 3HQCA 3T06A 1XR0B 4K2PA 4MY6A 5HE2A 3KRWA 2EMTA 5DHAB 2K00A 3GYPA 5CLQB 1DYNA 2XQNM 4B6HA 4BBKA 1LB1A 4WVFB 1X11A 2DHIA 1GC7A 2YS5A 4K2OA 1U5DA 1UPRA 3RCPA 1B55A 4K17A 2GCJA 3ODOA 1XD4A 5C6RA 1FHOA 2P0DA 1FAOA 2KCJA 2ELBA 1UPQA 1W1HA 2D9VA 3DXDA 1MK9B 5KQ1A 3PEGA 1X1GA 3PVWA 3F0WA 2RVBB 1GG3A 3A8QA 1UNPA 1PMSA 5LONB 4XWXA 4HAVB 4YONA 3FM8C 2YF0A 3UZTA 3WYFB 2L2IA 4HDQA 4IAPA 2D10A 2Z0PA 4Y94A 1AWEA 2EC1A 2MFQA 1EAZA 1V5UA 1ZC3B 1SHCA 2D4QA 1U5EA 3QWMA 3HK0A 4F7HA 4H8SA 1SGHA 5HE1A 4NSWA 2YSZA 1J19A 1PFJA 1H10A 1ZVRA 1V88A 1FHWA 5KCVA 2R0DA 4KVGB 4A6HA 2K2JA 5C79A 5JLJB 1NI2A 3AU4A 2CRFA 4GPTB 5C5BA 2W2XD 3OANA 5HE0A 2LYDA 3PP2A 4GXBA 1AQCA 2M14A 2D11A 3PVUA 4K81A 1U27A 1TXDA 1BAKA 2IYBA 2MDXA 4GMVA 4HDOA 2CAYA 3N7CA 4Z2NA 4ZRJA 2RGNB 1KI1B 1WJ1A 1EVHA 4CYEA 2LG1A 1RRPB 2X18A 2RNRB 2EJ8A 2YVCA 2RUKB 2BCJA 2D9WA 2QKLA 2NZ8B 2YS1A 4EMOA 3SO6A 4HAZB 4F7UP 3X23A 1V61A 3VOQA 3DXEA 1ISNA 3ULBA 1BWNA 1U2BA 2NMBA 2OQBA 3P7ZA 5FI0A 2DYQA 3V5WA 2W2XC 4HB3B 1DBHA 3P6AA 3D8DA 5J3QA 1WG7A 4HAWB 1PLSA 2H7DA 4F7GA 3IVFA 4TKNA 3U8ZA 1DDWA 1ZSQA 2YT1A 3KSYA 1J0WA 2N23A 5D3VA 3FSSA 2DTCA 2GJYA 3TVVA 5L81A 2COFA 4WSFA 3ML4A 1KZ7A 2IFSA 1WJMA 3SNHA 1U29A 2UVMA 2E2XA 5D3XA 3ZVRA 4HB2B 3GYOA 1P6SA 1EF1A 1EGXA 3QBVB 2LULA 1NTYA 1MIZB 2FJLA 4KHOA 2I5FA 2Y8GA 3TFMA 5JP4A 1FB8A 4ZRIA 2VSZA 2MKRA 3G9WA 3MPXA 1U5GA 4A6FA 1WGQA 3A8PA 3BINA 2PZ1A 5D3YA 2DN6A 4D0NB 4HAUB 2YT0A 3QIJA 3PVLA 1K5GB 1XCGA 2P0FA 2N0YA 3D8EA 1QC6A 2GCLA 2RLOA 4HB0B 2QKMA 5GOWB 4L6EA 4HAYB 5D3WA 1X1FA 2KUPA 1I2HA 2I5CA 3NSUA 4A5KA 2P8VA 1DROA 1WI1A 2LKOA 3PSCA 2YS3A 1E5WA 2D9YA 2I1JA 5LOPB 4DBBA 5C5BB 4DXAB 5JHHA 1XODA 1FGZA 1IRSA 1RJ2A 1KZGA 2R09A 2CY5A 4HAXB 1XKEA 1OQNA 1MAIA 5DI9B 2EMSA 2LOZA 2OTXA 1OY2A 3SYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JP2 A;  5DIF B;  1BTK A;  1Y19 B;  1W1D A;  1Y5O A;  2I1K A;  3AU5 A;  4P7I A;  2L1C A;  1BTN A;  4EKU A;  4IFS A;  3TCA A;  1UEF A;  2AEH A;  3CIK A;  1QQG A;  2P0H A;  1V5M A;  3VIA A;  2RSG A;  5C16 A;  4DX8 A;  2Z0O A;  4NY0 A;  2D9Z A;  3KZ1 A;  1P3R A;  2Y7B A;  2M38 A;  5J3T A;  1ZM0 A;  4MT7 A;  1UNQ A;  2DKQ A;  1WVH A;  2K2U A;  2DHJ A;  1MPH A;  2COA A;  3KY9 A;  1WGU A;  4KAX B;  2G35 A;  5D27 A;  3CXB B;  3TO1 A;  1FHX A;  3FEH A;  1NTV A;  4KHA A;  2Z0Q A;  2J0M A;  2J59 M;  1V5P A;  2VKI A;  3U7D A;  1X05 A;  2H7E A;  1OMW A;  2KGX B;  2UZS A;  1U5F A;  1Q67 A;  1FGY A;  2J0K A;  1M7E A;  4KHB B;  2D9X A;  3SUZ A;  4MK0 A;  3ZDT A;  3AJ4 A;  1N3H A;  4ZRK A;  2ROZ B;  1V89 A;  2ADZ A;  2V76 A;  4HHV A;  2DA0 A;  2VRW B;  3KRX A;  2Y8F A;  2UZR A;  3BJI A;  2AL6 A;  2DYN A;  3D8F A;  1K5D B;  1ZC4 B;  3F5R A;  5HE3 A;  5JHG A;  5KQ4 A;  5DH9 B;  1P5T A;  4HB4 B;  2ZPY A;  1UNR A;  4YL8 A;  4C0A A;  2HTH B;  2COD A;  5J3Y A;  4GZU A;  5CLL B;  5FI1 A;  4IOY X;  1MIX A;  4Z2M B;  1TQZ A;  2DKP A;  3SV1 A;  3ULC A;  1Z87 A;  2DLW A;  4CHJ A;  1H4R A;  2COC A;  3LJU X;  1GC6 A;  2DFK A;  2LOX A;  1M7R A;  4GN1 A;  4WJ7 A;  1LW3 A;  2ROV A;  4A6F B;  1W1G A;  2HE7 A;  4A6K A;  2ELA A;  2CY4 A;  1FOE A;  4GMX B;  4HAT B;  5EFX A;  1X86 A;  4TYZ A;  3A98 B;  1DDM A;  3O96 A;  1NU2 A;  1XX0 A;  4PNK A;  2YRY A;  3WA0 A;  3ODW A;  2J0J A;  1MK7 B;  2DX5 A;  3M1I B;  3TW1 A;  2W2W A;  1MKE A;  2Q13 A;  1DDV A;  3HW2 B;  3PZD A;  4CHM A;  2D2Q A;  3DXC A;  1TJ6 A;  4PQ0 A;  4DX9 0;  5DHF B;  2MWN B;  1I7A A;  2DX1 A;  3MDB C;  4EJN A;  2DHK A;  2GS0 A;  3PG7 A;  3ODX A;  3HQC A;  3T06 A;  1XR0 B;  4K2P A;  4MY6 A;  5HE2 A;  3KRW A;  2EMT A;  5DHA B;  2K00 A;  3GYP A;  5CLQ B;  1DYN A;  2XQN M;  4B6H A;  4BBK A;  1LB1 A;  4WVF B;  1X11 A;  2DHI A;  1GC7 A;  2YS5 A;  4K2O A;  1U5D A;  1UPR A;  3RCP A;  1B55 A;  4K17 A;  2GCJ A;  3ODO A;  1XD4 A;  5C6R A;  1FHO A;  2P0D A;  1FAO A;  2KCJ A;  2ELB A;  1UPQ A;  1W1H A;  2D9V A;  3DXD A;  1MK9 B;  5KQ1 A;  3PEG A;  1X1G A;  3PVW A;  3F0W A;  2RVB B;  1GG3 A;  3A8Q A;  1UNP A;  1PMS A;  5LON B;  4XWX A;  4HAV B;  4YON A;  3FM8 C;  2YF0 A;  3UZT A;  3WYF B;  2L2I A;  4HDQ A;  4IAP A;  2D10 A;  2Z0P A;  4Y94 A;  1AWE A;  2EC1 A;  2MFQ A;  1EAZ A;  1V5U A;  1ZC3 B;  1SHC A;  2D4Q A;  1U5E A;  3QWM A;  3HK0 A;  4F7H A;  4H8S A;  1SGH A;  5HE1 A;  4NSW A;  2YSZ A;  1J19 A;  1PFJ A;  1H10 A;  1ZVR A;  1V88 A;  1FHW A;  5KCV A;  2R0D A;  4KVG B;  4A6H A;  2K2J A;  5C79 A;  5JLJ B;  1NI2 A;  3AU4 A;  2CRF A;  4GPT B;  5C5B A;  2W2X D;  3OAN A;  5HE0 A;  2LYD A;  3PP2 A;  4GXB A;  1AQC A;  2M14 A;  2D11 A;  3PVU A;  4K81 A;  1U27 A;  1TXD A;  1BAK A;  2IYB A;  2MDX A;  4GMV A;  4HDO A;  2CAY A;  3N7C A;  4Z2N A;  4ZRJ A;  2RGN B;  1KI1 B;  1WJ1 A;  1EVH A;  4CYE A;  2LG1 A;  1RRP B;  2X18 A;  2RNR B;  2EJ8 A;  2YVC A;  2RUK B;  2BCJ A;  2D9W A;  2QKL A;  2NZ8 B;  2YS1 A;  4EMO A;  3SO6 A;  4HAZ B;  4F7U P;  3X23 A;  1V61 A;  3VOQ A;  3DXE A;  1ISN A;  3ULB A;  1BWN A;  1U2B A;  2NMB A;  2OQB A;  3P7Z A;  5FI0 A;  2DYQ A;  3V5W A;  2W2X C;  4HB3 B;  1DBH A;  3P6A A;  3D8D A;  5J3Q A;  1WG7 A;  4HAW B;  1PLS A;  2H7D A;  4F7G A;  3IVF A;  4TKN A;  3U8Z A;  1DDW A;  1ZSQ A;  2YT1 A;  3KSY A;  1J0W A;  2N23 A;  5D3V A;  3FSS A;  2DTC A;  2GJY A;  3TVV A;  5L81 A;  2COF A;  4WSF A;  3ML4 A;  1KZ7 A;  2IFS A;  1WJM A;  3SNH A;  1U29 A;  2UVM A;  2E2X A;  5D3X A;  3ZVR A;  4HB2 B;  3GYO A;  1P6S A;  1EF1 A;  1EGX A;  3QBV B;  2LUL A;  1NTY A;  1MIZ B;  2FJL A;  4KHO A;  2I5F A;  2Y8G A;  3TFM A;  5JP4 A;  1FB8 A;  4ZRI A;  2VSZ A;  2MKR A;  3G9W A;  3MPX A;  1U5G A;  4A6F A;  1WGQ A;  3A8P A;  3BIN A;  2PZ1 A;  5D3Y A;  2DN6 A;  4D0N B;  4HAU B;  2YT0 A;  3QIJ A;  3PVL A;  1K5G B;  1XCG A;  2P0F A;  2N0Y A;  3D8E A;  1QC6 A;  2GCL A;  2RLO A;  4HB0 B;  2QKM A;  5GOW B;  4L6E A;  4HAY B;  5D3W A;  1X1F A;  2KUP A;  1I2H A;  2I5C A;  3NSU A;  4A5K A;  2P8V A;  1DRO A;  1WI1 A;  2LKO A;  3PSC A;  2YS3 A;  1E5W A;  2D9Y A;  2I1J A;  5LOP B;  4DBB A;  5C5B B;  4DXA B;  5JHH A;  1XOD A;  1FGZ A;  1IRS A;  1RJ2 A;  1KZG A;  2R09 A;  2CY5 A;  4HAX B;  1XKE A;  1OQN A;  1MAI A;  5DI9 B;  2EMS A;  2LOZ A;  2OTX A;  1OY2 A;  3SYX A; 
#chains in the Genus database with same CATH topology
 2JP2 A;  5DIF B;  1BTK A;  1Y19 B;  1W1D A;  1Y5O A;  2I1K A;  3AU5 A;  4P7I A;  4GOU A;  2L1C A;  4CSQ A;  1BTN A;  3FVC A;  4EKU A;  4IFS A;  3TCA A;  1UEF A;  2AEH A;  3CIK A;  3U12 A;  1QQG A;  2P0H A;  1V5M A;  3NWD A;  3VIA A;  2RSG A;  5C16 A;  4DX8 A;  2Z0O A;  4NY0 A;  2D9Z A;  3KZ1 A;  4KHB A;  1P3R A;  2Y7B A;  2M38 A;  5J3T A;  3A58 A;  1ZM0 A;  4MT7 A;  1UNQ A;  2DKQ A;  4OSN A;  1WVH A;  2K2U A;  2DHJ A;  1MPH A;  2COA A;  3KY9 A;  1WGU A;  4KAX B;  2G35 A;  5D27 A;  3CXB B;  3TO1 A;  1FHX A;  3FEH A;  1NTV A;  4KHA A;  2Z0Q A;  2J0M A;  2J59 M;  1V5P A;  2VKI A;  3U7D A;  1X05 A;  2H7E A;  1OMW A;  2KGX B;  2UZS A;  1U5F A;  1Q67 A;  1FGY A;  2ZKM X;  2J0K A;  1M7E A;  4KHB B;  2D9X A;  3SUZ A;  4MK0 A;  3ZDT A;  3AJ4 A;  1N3H A;  4ZRK A;  2ROZ B;  1V89 A;  2ADZ A;  2V76 A;  4HHV A;  2DA0 A;  2VRW B;  3KRX A;  2Y8F A;  2UZR A;  3BJI A;  2AL6 A;  2DYN A;  3D8F A;  1K5D B;  1ZC4 B;  3F5R A;  5HE3 A;  1T77 A;  5JHG A;  5KQ4 A;  5DH9 B;  1P5T A;  4HB4 B;  2ZPY A;  1UNR A;  4YL8 A;  4C0A A;  2HTH B;  2COD A;  5J3Y A;  4GZU A;  5CLL B;  5FI1 A;  4IOY X;  1MIX A;  4Z2M B;  1TQZ A;  2DKP A;  3SV1 A;  3ULC A;  1Z87 A;  2DLW A;  4CHJ A;  1H4R A;  2COC A;  3LJU X;  1GC6 A;  2DFK A;  2LOX A;  1M7R A;  5I2S A;  4GN1 A;  4WJ7 A;  1LW3 A;  2ROV A;  4A6F B;  1W1G A;  2HE7 A;  4A6K A;  2ELA A;  2CY4 A;  1FOE A;  4GMX B;  4HAT B;  5EFX A;  1X86 A;  4TYZ A;  3A98 B;  1DDM A;  3O96 A;  1NU2 A;  1XX0 A;  4PNK A;  2YRY A;  3WA0 A;  3ODW A;  2J0J A;  1MK7 B;  2DX5 A;  3M1I B;  3TW1 A;  2W2W A;  1MKE A;  2Q13 A;  1DDV A;  3HW2 B;  3PZD A;  4CHM A;  2D2Q A;  3DXC A;  1TJ6 A;  4PQ0 A;  4DX9 0;  5DHF B;  2MWN B;  1I7A A;  2DX1 A;  3MDB C;  4EJN A;  2DHK A;  2GS0 A;  3HIE A;  3PG7 A;  3ODX A;  3HQC A;  3T06 A;  1XR0 B;  4K2P A;  4MY6 A;  5HE2 A;  3KRW A;  2EMT A;  5DHA B;  2K00 A;  3GYP A;  5CLQ B;  1DYN A;  2XQN M;  4B6H A;  2Z14 A;  4BBK A;  1LB1 A;  4QXA B;  4WVF B;  1X11 A;  2DHI A;  1GC7 A;  2YS5 A;  4K2O A;  1U5D A;  1UPR A;  3RCP A;  1B55 A;  4K17 A;  2GCJ A;  3ODO A;  1XD4 A;  5C6R A;  1FHO A;  2P0D A;  1FAO A;  2KCJ A;  2ELB A;  1UPQ A;  1W1H A;  2D9V A;  3DXD A;  1MK9 B;  5KQ1 A;  3PEG A;  5IRS A;  1X1G A;  3PVW A;  3F0W A;  2RVB B;  1GG3 A;  3A8Q A;  1UNP A;  1PMS A;  5LON B;  4XWX A;  4QJ5 B;  4HAV B;  4YON A;  3FM8 C;  2YF0 A;  3UZT A;  3WYF B;  2L2I A;  4HDQ A;  4IAP A;  2D10 A;  2Z0P A;  4Y94 A;  4DIX A;  1AWE A;  4GNK B;  2EC1 A;  2MFQ A;  4QJ3 B;  1EAZ A;  1V5U A;  3DCX A;  1ZC3 B;  1SHC A;  2D4Q A;  1U5E A;  2Z59 A;  3QWM A;  1ZYI A;  2YT2 A;  3HK0 A;  4F7H A;  5M4Y B;  4H8S A;  1SGH A;  5HE1 A;  4NSW A;  2YSZ A;  2NBV A;  5LG4 B;  1J19 A;  1PFJ A;  1H10 A;  3NWF A;  1ZVR A;  1V88 A;  1FHW A;  5KCV A;  2R0D A;  4KVG B;  4A6H A;  2K2J A;  5C79 A;  5JLJ B;  1NI2 A;  3AU4 A;  2CRF A;  4GPT B;  5C5B A;  2W2X D;  3OAN A;  5HE0 A;  2LYD A;  3PP2 A;  4GXB A;  1AQC A;  2M14 A;  2D11 A;  3PVU A;  4K81 A;  1U27 A;  2RRF A;  1TXD A;  1BAK A;  2IYB A;  2MDX A;  4GMV A;  4HDO A;  2CAY A;  3N7C A;  4Z2N A;  4ZRJ A;  2RGN B;  1KI1 B;  1WJ1 A;  1EVH A;  4CYE A;  2LG1 A;  1RRP B;  2X18 A;  2RNR B;  2EJ8 A;  2YVC A;  2RUK B;  2BCJ A;  2D9W A;  2QKL A;  2NZ8 B;  2YS1 A;  4EMO A;  3NW8 A;  3SO6 A;  2K8E A;  4HAZ B;  4F7U P;  3X23 A;  1V61 A;  4D6W A;  3VOQ A;  3DXE A;  1ISN A;  3ULB A;  1BWN A;  1U2B A;  2NMB A;  2OQB A;  3P7Z A;  5FI0 A;  2DYQ A;  4L1R A;  3V5W A;  2W2X C;  4HB3 B;  1DBH A;  3P6A A;  5I2M A;  3D8D A;  5J3Q A;  1WG7 A;  4HAW B;  1PLS A;  2H7D A;  4F7G A;  3IVF A;  4TKN A;  1MI1 A;  3U8Z A;  1DDW A;  1ZSQ A;  2YT1 A;  3KSY A;  1J0W A;  2KR0 A;  2N23 A;  5D3V A;  3FSS A;  2DTC A;  2GJY A;  3TVV A;  5L81 A;  2COF A;  4WSF A;  3ML4 A;  1KZ7 A;  2Z13 A;  2IFS A;  1WJM A;  3SNH A;  2GUM A;  1U29 A;  2UVM A;  3NWA A;  2E2X A;  5D3X A;  3ZVR A;  4HB2 B;  2KUQ A;  3GYO A;  1P6S A;  1EF1 A;  1EGX A;  3QBV B;  2LUL A;  1NTY A;  1MIZ B;  2KIG A;  2FJL A;  4KHO A;  2R2Y A;  2I5F A;  2Y8G A;  4QJ4 B;  3TFM A;  5JP4 A;  1FB8 A;  4ZRI A;  4HSI A;  2VSZ A;  2MKR A;  3G9W A;  3MPX A;  1U5G A;  4A6F A;  1WGQ A;  3A8P A;  3BIN A;  2PZ1 A;  5D3Y A;  2DN6 A;  4D0N B;  4HAU B;  2YT0 A;  3QIJ A;  3PVL A;  1K5G B;  1XCG A;  2P0F A;  2N0Y A;  3D8E A;  1QC6 A;  2GCL A;  2RLO A;  4HB0 B;  2QKM A;  5GOW B;  3OHM B;  4L6E A;  4OT1 A;  4HAY B;  5D3W A;  3HSA A;  1X1F A;  2KUP A;  1I2H A;  2I5C A;  3NSU A;  2FJU B;  4A5K A;  2KIE A;  2P8V A;  1DRO A;  1WI1 A;  2LKO A;  3PSC A;  2YS3 A;  1E5W A;  2D9Y A;  2I1J A;  5LOP B;  4DBB A;  2Z4D A;  5C5B B;  4DXA B;  5JHH A;  3B77 A;  1XOD A;  1FGZ A;  1IRS A;  1RJ2 A;  1KZG A;  2R09 A;  2CY5 A;  4HAX B;  1XKE A;  1OQN A;  1MAI A;  5DI9 B;  2EMS A;  2LOZ A;  2OTX A;  1OY2 A;  2K49 A;  3SYX A; 
#chains in the Genus database with same CATH homology
 2JP2 A;  5DIF B;  1BTK A;  1Y19 B;  1W1D A;  1Y5O A;  2I1K A;  3AU5 A;  4P7I A;  2L1C A;  1BTN A;  4EKU A;  4IFS A;  3TCA A;  1UEF A;  2AEH A;  3CIK A;  1QQG A;  2P0H A;  1V5M A;  3VIA A;  2RSG A;  5C16 A;  4DX8 A;  2Z0O A;  4NY0 A;  2D9Z A;  3KZ1 A;  1P3R A;  2Y7B A;  2M38 A;  5J3T A;  1ZM0 A;  4MT7 A;  1UNQ A;  2DKQ A;  1WVH A;  2K2U A;  2DHJ A;  1MPH A;  2COA A;  3KY9 A;  1WGU A;  4KAX B;  2G35 A;  5D27 A;  3CXB B;  3TO1 A;  1FHX A;  3FEH A;  1NTV A;  4KHA A;  2Z0Q A;  2J0M A;  2J59 M;  1V5P A;  2VKI A;  3U7D A;  1X05 A;  2H7E A;  1OMW A;  2KGX B;  2UZS A;  1U5F A;  1Q67 A;  1FGY A;  2J0K A;  1M7E A;  4KHB B;  2D9X A;  3SUZ A;  4MK0 A;  3ZDT A;  3AJ4 A;  1N3H A;  4ZRK A;  2ROZ B;  1V89 A;  2ADZ A;  2V76 A;  4HHV A;  2DA0 A;  2VRW B;  3KRX A;  2Y8F A;  2UZR A;  3BJI A;  2AL6 A;  2DYN A;  3D8F A;  1K5D B;  1ZC4 B;  3F5R A;  5HE3 A;  5JHG A;  5KQ4 A;  5DH9 B;  1P5T A;  4HB4 B;  2ZPY A;  1UNR A;  4YL8 A;  4C0A A;  2HTH B;  2COD A;  5J3Y A;  4GZU A;  5CLL B;  5FI1 A;  4IOY X;  1MIX A;  4Z2M B;  1TQZ A;  2DKP A;  3SV1 A;  3ULC A;  1Z87 A;  2DLW A;  4CHJ A;  1H4R A;  2COC A;  3LJU X;  1GC6 A;  2DFK A;  2LOX A;  1M7R A;  4GN1 A;  4WJ7 A;  1LW3 A;  2ROV A;  4A6F B;  1W1G A;  2HE7 A;  4A6K A;  2ELA A;  2CY4 A;  1FOE A;  4GMX B;  4HAT B;  5EFX A;  1X86 A;  4TYZ A;  3A98 B;  1DDM A;  3O96 A;  1NU2 A;  1XX0 A;  4PNK A;  2YRY A;  3WA0 A;  3ODW A;  2J0J A;  1MK7 B;  2DX5 A;  3M1I B;  3TW1 A;  2W2W A;  1MKE A;  2Q13 A;  1DDV A;  3HW2 B;  3PZD A;  4CHM A;  2D2Q A;  3DXC A;  1TJ6 A;  4PQ0 A;  4DX9 0;  5DHF B;  2MWN B;  1I7A A;  2DX1 A;  3MDB C;  4EJN A;  2DHK A;  2GS0 A;  3PG7 A;  3ODX A;  3HQC A;  3T06 A;  1XR0 B;  4K2P A;  4MY6 A;  5HE2 A;  3KRW A;  2EMT A;  5DHA B;  2K00 A;  3GYP A;  5CLQ B;  1DYN A;  2XQN M;  4B6H A;  4BBK A;  1LB1 A;  4WVF B;  1X11 A;  2DHI A;  1GC7 A;  2YS5 A;  4K2O A;  1U5D A;  1UPR A;  3RCP A;  1B55 A;  4K17 A;  2GCJ A;  3ODO A;  1XD4 A;  5C6R A;  1FHO A;  2P0D A;  1FAO A;  2KCJ A;  2ELB A;  1UPQ A;  1W1H A;  2D9V A;  3DXD A;  1MK9 B;  5KQ1 A;  3PEG A;  1X1G A;  3PVW A;  3F0W A;  2RVB B;  1GG3 A;  3A8Q A;  1UNP A;  1PMS A;  5LON B;  4XWX A;  4HAV B;  4YON A;  3FM8 C;  2YF0 A;  3UZT A;  3WYF B;  2L2I A;  4HDQ A;  4IAP A;  2D10 A;  2Z0P A;  4Y94 A;  1AWE A;  2EC1 A;  2MFQ A;  1EAZ A;  1V5U A;  1ZC3 B;  1SHC A;  2D4Q A;  1U5E A;  3QWM A;  3HK0 A;  4F7H A;  4H8S A;  1SGH A;  5HE1 A;  4NSW A;  2YSZ A;  1J19 A;  1PFJ A;  1H10 A;  1ZVR A;  1V88 A;  1FHW A;  5KCV A;  2R0D A;  4KVG B;  4A6H A;  2K2J A;  5C79 A;  5JLJ B;  1NI2 A;  3AU4 A;  2CRF A;  4GPT B;  5C5B A;  2W2X D;  3OAN A;  5HE0 A;  2LYD A;  3PP2 A;  4GXB A;  1AQC A;  2M14 A;  2D11 A;  3PVU A;  4K81 A;  1U27 A;  1TXD A;  1BAK A;  2IYB A;  2MDX A;  4GMV A;  4HDO A;  2CAY A;  3N7C A;  4Z2N A;  4ZRJ A;  2RGN B;  1KI1 B;  1WJ1 A;  1EVH A;  4CYE A;  2LG1 A;  1RRP B;  2X18 A;  2RNR B;  2EJ8 A;  2YVC A;  2RUK B;  2BCJ A;  2D9W A;  2QKL A;  2NZ8 B;  2YS1 A;  4EMO A;  3SO6 A;  4HAZ B;  4F7U P;  3X23 A;  1V61 A;  3VOQ A;  3DXE A;  1ISN A;  3ULB A;  1BWN A;  1U2B A;  2NMB A;  2OQB A;  3P7Z A;  5FI0 A;  2DYQ A;  3V5W A;  2W2X C;  4HB3 B;  1DBH A;  3P6A A;  3D8D A;  5J3Q A;  1WG7 A;  4HAW B;  1PLS A;  2H7D A;  4F7G A;  3IVF A;  4TKN A;  3U8Z A;  1DDW A;  1ZSQ A;  2YT1 A;  3KSY A;  1J0W A;  2N23 A;  5D3V A;  3FSS A;  2DTC A;  2GJY A;  3TVV A;  5L81 A;  2COF A;  4WSF A;  3ML4 A;  1KZ7 A;  2IFS A;  1WJM A;  3SNH A;  1U29 A;  2UVM A;  2E2X A;  5D3X A;  3ZVR A;  4HB2 B;  3GYO A;  1P6S A;  1EF1 A;  1EGX A;  3QBV B;  2LUL A;  1NTY A;  1MIZ B;  2FJL A;  4KHO A;  2I5F A;  2Y8G A;  3TFM A;  5JP4 A;  1FB8 A;  4ZRI A;  2VSZ A;  2MKR A;  3G9W A;  3MPX A;  1U5G A;  4A6F A;  1WGQ A;  3A8P A;  3BIN A;  2PZ1 A;  5D3Y A;  2DN6 A;  4D0N B;  4HAU B;  2YT0 A;  3QIJ A;  3PVL A;  1K5G B;  1XCG A;  2P0F A;  2N0Y A;  3D8E A;  1QC6 A;  2GCL A;  2RLO A;  4HB0 B;  2QKM A;  5GOW B;  4L6E A;  4HAY B;  5D3W A;  1X1F A;  2KUP A;  1I2H A;  2I5C A;  3NSU A;  4A5K A;  2P8V A;  1DRO A;  1WI1 A;  2LKO A;  3PSC A;  2YS3 A;  1E5W A;  2D9Y A;  2I1J A;  5LOP B;  4DBB A;  5C5B B;  4DXA B;  5JHH A;  1XOD A;  1FGZ A;  1IRS A;  1RJ2 A;  1KZG A;  2R09 A;  2CY5 A;  4HAX B;  1XKE A;  1OQN A;  1MAI A;  5DI9 B;  2EMS A;  2LOZ A;  2OTX A;  1OY2 A;  3SYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...