2NMBA

Dnumb ptb domain complexed with a phosphotyrosine peptide, nmr, ensemble of structures.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
147
structure length
147
Chain Sequence
SKPHQWQADEEAVRSATCSFSVKYLGCVEVFESRGMQVCEEALKVLRQSRRRPVRGLLHVSGDGLRVVDDETKGLIVDQTIEKVSFCAPDRNHERGFSYICRDGTTRRWMCHGFLACKDSGERLSHAVGCAFAVCLERKQRRTRAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Numb PTB domain-peptide complex suggests a basis for diverse binding specificity.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Cell cycle/gene regulation
molecule keywords PROTEIN (NUMB PROTEIN)
total genus 20
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 1998-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2nmbA00
1UPRA 2Q13A 3RCPA 2RGNB 3VOQA 1U5DA 2H7EA 3KRXA 3WA0A 1Z87A 1QC6A 4XWXA 3TFMA 5DHAB 1ZVRA 1EF1A 3MPXA 4DX8A 4A6KA 2M38A 4A6FA 3HW2B 4DXAB 1KZ7A 2ROZB 2COAA 2H7DA 1ISNA 4B6HA 2GCJA 1Y19B 3GYOA 1FOEA 3VIAA 2DKPA 2ELBA 5KQ1A 5C5BA 3PZDA 3A8QA 5DH9B 3V5WA 4L6EA 2AL6A 2DTCA 4F7GA 2P8VA 2DYNA 4GN1A 2UZRA 5D27A 4ZRJA 1XODA 1TQZA 2Z0OA 3CIKA 1OMWA 2Y7BA 4HDOA 1TJ6A 3NSUA 3A8PA 5CLLB 2YT1A 2ZPYA 2JP2A 1X11A 1PMSA 2M14A 2D4QA 2G35A 4HAYB 2NMBA 2E2XA 2NZ8B 3UZTA 1B55A 5DHFB 1AQCA 3O96A 2N0YA 3ODWA 3F0WA 3HK0A 1IRSA 4DBBA 4WVFB 3BJIA 5J3QA 1MIXA 4GPTB 1WGQA 1X05A 1UNPA 1UNQA 4K2OA 1GC6A 1X1FA 1QQGA 4MK0A 2D10A 3GYPA 3SUZA 1FGZA 3OANA 2W2XD 1V5UA 4WJ7A 1V89A 2I5CA 4HAUB 2N23A 2DKQA 2VRWB 4HB0B 1X86A 1PFJA 3ULCA 2EMTA 3AU5A 2L2IA 5HE3A 5LOPB 2LOZA 4Z2NA 3AU4A 1X1GA 4A6HA 1XKEA 5JLJB 3KRWA 2OQBA 4K2PA 4TKNA 1U27A 1MIZB 3M1IB 5DIFB 2RVBB 2W2WA 1GC7A 1V5PA 2HE7A 3KY9A 2YS3A 4CHMA 4IOYX 3T06A 2XQNM 1U29A 2J0MA 1UPQA 2VSZA 1LW3A 5HE0A 2DHJA 4KVGB 3SYXA 1NU2A 2L1CA 3D8DA 2YRYA 3U7DA 5HE1A 2COFA 3QWMA 2Y8GA 4KHOA 2I1JA 2MFQA 1WVHA 3FSSA 1BWNA 1MK9B 4NSWA 3ODXA 5L81A 2ADZA 1EGXA 1ZM0A 5D3VA 1DDMA 4KHBB 1DROA 4KHAA 2D9YA 1FGYA 1XCGA 4Z2MB 4HAWB 1WI1A 3KZ1A 2LYDA 2EJ8A 1U2BA 2Z0QA 3HQCA 3DXCA 3TO1A 2AEHA 5C79A 4Y94A 3DXEA 5J3YA 1DDWA 1OY2A 2CY4A 3QBVB 3SNHA 2CODA 2W2XC 2GS0A 3PVLA 4NY0A 1K5DB 3DXDA 1ZSQA 3PSCA 3P6AA 3SO6A 4H8SA 2KUPA 2EC1A 4YL8A 1M7RA 4DX90 5EFXA 3TVVA 4BBKA 3PEGA 2OTXA 2D9XA 3D8FA 1OQNA 2RUKB 4HB2B 2J59M 4ZRIA 5C16A 1SGHA 2YS1A 5J3TA 4F7HA 2DYQA 2P0DA 2K00A 1M7EA 3CXBB 3F5RA 2DX1A 2P0HA 2DHKA 1P6SA 3MDBC 1I7AA 2RSGA 1TXDA 1WGUA 3KSYA 3BINA 2R0DA 2FJLA 3PVUA 4YONA 4HB3B 3AJ4A 1PLSA 2LOXA 3PP2A 1U5GA 2RNRB 4D0NB 4HDQA 1MKEA 5JP4A 2IFSA 2I1KA 4PNKA 2X18A 4GZUA 1MK7B 5FI1A 2V76A 5KCVA 2VKIA 1GG3A 2MKRA 4F7UP 1Y5OA 2CY5A 1BAKA 2YVCA 2J0JA 2YSZA 3PG7A 1E5WA 1Q67A 2YS5A 4K17A 1N3HA 4CHJA 1K5GB 4A5KA 4A6FB 1H4RA 4HHVA 1RJ2A 1U5EA 1UNRA 1WJMA 5HE2A 2D2QA 1XR0B 3ML4A 2P0FA 2YF0A 1U5FA 2Y8FA 3TW1A 2Z0PA 4K81A 2D9VA 1V61A 3D8EA 5JHGA 4EKUA 1KI1B 1SHCA 1FHXA 5LONB 1ZC3B 2DFKA 1FB8A 3WYFB 2K2UA 4MT7A 4C0AA 3FM8C 2K2JA 2BCJA 1J19A 2CAYA 1FAOA 3U8ZA 2DLWA 2MWNB 4HATB 3TCAA 2I5FA 1J0WA 4IAPA 3G9WA 3N7CA 1V5MA 1AWEA 5D3XA 4EMOA 5D3WA 2KGXB 2EMSA 3X23A 2COCA 1FHWA 1RRPB 2QKLA 4WSFA 1MAIA 3FEHA 2UVMA 5GOWB 1P5TA 2YT0A 1DYNA 2RLOA 3ODOA 3ZVRA 3SV1A 4P7IA 1XD4A 1NI2A 1BTNA 1I2HA 1MPHA 2DA0A 2IYBA 1KZGA 4HAZB 1EVHA 2J0KA 2ELAA 3PVWA 4HAXB 5C5BB 3IVFA 3P7ZA 5D3YA 4CYEA 1DDVA 1P3RA 2LG1A 4KAXB 1WG7A 2MDXA 3ZDTA 1UEFA 3ULBA 1XX0A 1NTVA 2LULA 5CLQB 4GMVA 2D11A 1V88A 2DHIA 2DX5A 3A98B 2D9WA 1W1HA 2R09A 1LB1A 3LJUX 1BTKA 2HTHB 5DI9B 4ZRKA 5JHHA 1EAZA 4EJNA 3QIJA 1DBHA 1W1GA 2CRFA 2PZ1A 4IFSA 1NTYA 1ZC4B 1FHOA 4HAVB 4MY6A 1W1DA 4GXBA 5C6RA 2GCLA 1WJ1A 2ROVA 2KCJA 2QKMA 2UZSA 2LKOA 2DN6A 1H10A 5FI0A 2D9ZA 4TYZA 4PQ0A 5KQ4A 2GJYA 4HB4B 4GMXB
chains in the Genus database with same CATH superfamily
2Z13A 1UPRA 2Q13A 3RCPA 2RGNB 3VOQA 1U5DA 2H7EA 3KRXA 3WA0A 4OT1A 1Z87A 1QC6A 4XWXA 5IRSA 3TFMA 5DHAB 1ZVRA 1EF1A 3MPXA 4DX8A 4A6KA 2M38A 4A6FA 3HW2B 4DXAB 1KZ7A 2ROZB 2COAA 2H7DA 1ISNA 4B6HA 2GCJA 1Y19B 3GYOA 3HIEA 1FOEA 3VIAA 2DKPA 2ELBA 5KQ1A 5C5BA 3PZDA 3A8QA 5DH9B 3V5WA 4L6EA 2AL6A 2DTCA 3B77A 4F7GA 2P8VA 2DYNA 2Z4DA 4GN1A 4CSQA 2UZRA 5D27A 4ZRJA 1XODA 1TQZA 2Z0OA 3CIKA 1OMWA 2Y7BA 4HDOA 4QJ5B 1TJ6A 3NSUA 3A8PA 5CLLB 2YT1A 2ZPYA 2KIGA 2JP2A 1X11A 1PMSA 2FJUB 2M14A 2D4QA 2G35A 4HAYB 2NMBA 2E2XA 2NZ8B 3UZTA 1B55A 5DHFB 1AQCA 1MI1A 3O96A 2N0YA 3ODWA 3F0WA 3HK0A 1IRSA 4DBBA 4WVFB 3BJIA 5J3QA 1MIXA 4GPTB 1WGQA 1X05A 1UNPA 1UNQA 4K2OA 1GC6A 1X1FA 1QQGA 4MK0A 2D10A 3GYPA 3SUZA 1FGZA 3OANA 2W2XD 1V5UA 4WJ7A 3U12A 1V89A 2I5CA 4HAUB 2N23A 2DKQA 2VRWB 4HB0B 1X86A 1PFJA 3ULCA 2EMTA 3AU5A 2L2IA 4KHBA 5HE3A 5LOPB 5LG4B 2LOZA 4Z2NA 3AU4A 1X1GA 4A6HA 1XKEA 5JLJB 3KRWA 2OQBA 1ZYIA 4K2PA 4TKNA 4QJ4B 1U27A 1MIZB 3M1IB 5DIFB 2RVBB 2W2WA 4GOUA 1GC7A 1V5PA 2HE7A 3KY9A 2YS3A 4CHMA 2NBVA 4IOYX 3T06A 2XQNM 1U29A 2J0MA 1UPQA 2VSZA 1LW3A 5HE0A 2DHJA 4KVGB 3SYXA 1NU2A 2L1CA 5I2SA 3D8DA 2YRYA 3U7DA 5HE1A 2COFA 3QWMA 2Y8GA 3A58A 4KHOA 2I1JA 2MFQA 2KUQA 1WVHA 3FSSA 1BWNA 1MK9B 4NSWA 3ODXA 4HSIA 5L81A 2ADZA 1EGXA 1ZM0A 5D3VA 4D6WA 1DDMA 4KHBB 1DROA 2K49A 2RRFA 4KHAA 2D9YA 1FGYA 1XCGA 4Z2MB 4HAWB 1WI1A 5I2MA 3KZ1A 2LYDA 2EJ8A 1U2BA 2Z0QA 3HQCA 3DXCA 3TO1A 2AEHA 5C79A 2KR0A 4Y94A 3DXEA 5J3YA 1DDWA 1OY2A 2CY4A 3QBVB 3SNHA 2CODA 3FVCA 2W2XC 2GS0A 3PVLA 4NY0A 1K5DB 3DXDA 1ZSQA 3PSCA 3P6AA 3SO6A 4H8SA 2KUPA 2EC1A 4YL8A 1M7RA 4DX90 5EFXA 3TVVA 4BBKA 3PEGA 2OTXA 2D9XA 3D8FA 2R2YA 1OQNA 2RUKB 4HB2B 2J59M 4ZRIA 5C16A 1SGHA 2YS1A 3DCXA 5J3TA 4F7HA 2DYQA 2P0DA 3HSAA 4GNKB 2K00A 1M7EA 3CXBB 3F5RA 2DX1A 2P0HA 2DHKA 1P6SA 3MDBC 1I7AA 2RSGA 1TXDA 1WGUA 3NW8A 3KSYA 3BINA 2R0DA 2FJLA 3PVUA 4YONA 4HB3B 3AJ4A 1PLSA 2LOXA 3PP2A 5M4YB 1U5GA 2RNRB 4D0NB 4HDQA 1MKEA 5JP4A 2IFSA 2I1KA 4PNKA 2X18A 4GZUA 1MK7B 5FI1A 4QXAB 2V76A 5KCVA 2VKIA 1GG3A 2MKRA 4F7UP 1Y5OA 2CY5A 1BAKA 2YVCA 2J0JA 2YSZA 3PG7A 1E5WA 1Q67A 2YS5A 2Z59A 4K17A 1N3HA 4CHJA 1K5GB 4A5KA 4A6FB 1H4RA 4HHVA 1RJ2A 2K8EA 1U5EA 1UNRA 1WJMA 5HE2A 2D2QA 1XR0B 3ML4A 2P0FA 2YF0A 1U5FA 2Y8FA 3TW1A 3NWFA 2Z0PA 4K81A 2D9VA 1V61A 2ZKMX 3D8EA 5JHGA 4EKUA 1KI1B 1SHCA 1FHXA 5LONB 1ZC3B 2DFKA 1FB8A 3WYFB 2K2UA 4MT7A 4C0AA 3FM8C 2K2JA 2BCJA 1J19A 2CAYA 1FAOA 3U8ZA 2DLWA 2MWNB 4HATB 3TCAA 2I5FA 1J0WA 4QJ3B 4IAPA 3G9WA 3N7CA 2YT2A 1V5MA 3OHMB 1AWEA 5D3XA 4EMOA 3NWAA 2KGXB 2EMSA 5D3WA 2COCA 3X23A 1FHWA 1RRPB 2QKLA 4WSFA 4DIXA 1MAIA 3FEHA 2UVMA 5GOWB 1P5TA 2YT0A 1DYNA 2RLOA 3ODOA 3ZVRA 3SV1A 4P7IA 1XD4A 1NI2A 1BTNA 1I2HA 1MPHA 2DA0A 2IYBA 1KZGA 4HAZB 1EVHA 2J0KA 2ELAA 3PVWA 4HAXB 5C5BB 3NWDA 3IVFA 3P7ZA 5D3YA 4CYEA 1DDVA 1P3RA 2LG1A 4KAXB 1WG7A 2MDXA 3ZDTA 1UEFA 3ULBA 1XX0A 4OSNA 1NTVA 2LULA 5CLQB 4GMVA 2D11A 1V88A 2DHIA 2DX5A 3A98B 2D9WA 1W1HA 2R09A 2Z14A 1LB1A 3LJUX 1BTKA 2HTHB 5DI9B 4ZRKA 5JHHA 1EAZA 4EJNA 3QIJA 1DBHA 1W1GA 2CRFA 2PZ1A 4IFSA 1NTYA 1ZC4B 4L1RA 1FHOA 2KIEA 4HAVB 4MY6A 1T77A 1W1DA 4GXBA 5C6RA 2GCLA 1WJ1A 2ROVA 2KCJA 2QKMA 2UZSA 2LKOA 2DN6A 1H10A 5FI0A 2D9ZA 4TYZA 2GUMA 4PQ0A 2GJYA 5KQ4A 4HB4B 4GMXB
chains in the Genus database with same CATH topology
1UPRA 2Q13A 3RCPA 2RGNB 3VOQA 1U5DA 2H7EA 3KRXA 3WA0A 1Z87A 1QC6A 4XWXA 3TFMA 5DHAB 1ZVRA 1EF1A 3MPXA 4DX8A 4A6KA 2M38A 4A6FA 3HW2B 4DXAB 1KZ7A 2ROZB 2COAA 2H7DA 1ISNA 4B6HA 2GCJA 1Y19B 3GYOA 1FOEA 3VIAA 2DKPA 2ELBA 5KQ1A 5C5BA 3PZDA 3A8QA 5DH9B 3V5WA 4L6EA 2AL6A 2DTCA 4F7GA 2P8VA 2DYNA 4GN1A 2UZRA 5D27A 4ZRJA 1XODA 1TQZA 2Z0OA 3CIKA 1OMWA 2Y7BA 4HDOA 1TJ6A 3NSUA 3A8PA 5CLLB 2YT1A 2ZPYA 2JP2A 1X11A 1PMSA 2M14A 2D4QA 2G35A 4HAYB 2NMBA 2E2XA 2NZ8B 3UZTA 1B55A 5DHFB 1AQCA 3O96A 2N0YA 3ODWA 3F0WA 3HK0A 1IRSA 4DBBA 4WVFB 3BJIA 5J3QA 1MIXA 4GPTB 1WGQA 1X05A 1UNPA 1UNQA 4K2OA 1GC6A 1X1FA 1QQGA 4MK0A 2D10A 3GYPA 3SUZA 1FGZA 3OANA 2W2XD 1V5UA 4WJ7A 1V89A 2I5CA 4HAUB 2N23A 2DKQA 2VRWB 4HB0B 1X86A 1PFJA 3ULCA 2EMTA 3AU5A 2L2IA 5HE3A 5LOPB 2LOZA 4Z2NA 3AU4A 1X1GA 4A6HA 1XKEA 5JLJB 3KRWA 2OQBA 4K2PA 4TKNA 1U27A 1MIZB 3M1IB 5DIFB 2RVBB 2W2WA 1GC7A 1V5PA 2HE7A 3KY9A 2YS3A 4CHMA 4IOYX 3T06A 2XQNM 1U29A 2J0MA 1UPQA 2VSZA 1LW3A 5HE0A 2DHJA 4KVGB 3SYXA 1NU2A 2L1CA 3D8DA 2YRYA 3U7DA 5HE1A 2COFA 3QWMA 2Y8GA 4KHOA 2I1JA 2MFQA 1WVHA 3FSSA 1BWNA 1MK9B 4NSWA 3ODXA 5L81A 2ADZA 1EGXA 1ZM0A 5D3VA 1DDMA 4KHBB 1DROA 4KHAA 2D9YA 1FGYA 1XCGA 4Z2MB 4HAWB 1WI1A 3KZ1A 2LYDA 2EJ8A 1U2BA 2Z0QA 3HQCA 3DXCA 3TO1A 2AEHA 5C79A 4Y94A 3DXEA 5J3YA 1DDWA 1OY2A 2CY4A 3QBVB 3SNHA 2CODA 2W2XC 2GS0A 3PVLA 4NY0A 1K5DB 3DXDA 1ZSQA 3PSCA 3P6AA 3SO6A 4H8SA 2KUPA 2EC1A 4YL8A 1M7RA 4DX90 5EFXA 3TVVA 4BBKA 3PEGA 2OTXA 2D9XA 3D8FA 1OQNA 2RUKB 4HB2B 2J59M 4ZRIA 5C16A 1SGHA 2YS1A 5J3TA 4F7HA 2DYQA 2P0DA 2K00A 1M7EA 3CXBB 3F5RA 2DX1A 2P0HA 2DHKA 1P6SA 3MDBC 1I7AA 2RSGA 1TXDA 1WGUA 3KSYA 3BINA 2R0DA 2FJLA 3PVUA 4YONA 4HB3B 3AJ4A 1PLSA 2LOXA 3PP2A 1U5GA 2RNRB 4D0NB 4HDQA 1MKEA 5JP4A 2IFSA 2I1KA 4PNKA 2X18A 4GZUA 1MK7B 5FI1A 2V76A 5KCVA 2VKIA 1GG3A 2MKRA 4F7UP 1Y5OA 2CY5A 1BAKA 2YVCA 2J0JA 2YSZA 3PG7A 1E5WA 1Q67A 2YS5A 4K17A 1N3HA 4CHJA 1K5GB 4A5KA 4A6FB 1H4RA 4HHVA 1RJ2A 1U5EA 1UNRA 1WJMA 5HE2A 2D2QA 1XR0B 3ML4A 2P0FA 2YF0A 1U5FA 2Y8FA 3TW1A 2Z0PA 4K81A 2D9VA 1V61A 3D8EA 5JHGA 4EKUA 1KI1B 1SHCA 1FHXA 5LONB 1ZC3B 2DFKA 1FB8A 3WYFB 2K2UA 4MT7A 4C0AA 3FM8C 2K2JA 2BCJA 1J19A 2CAYA 1FAOA 3U8ZA 2DLWA 2MWNB 4HATB 3TCAA 2I5FA 1J0WA 4IAPA 3G9WA 3N7CA 1V5MA 1AWEA 5D3XA 4EMOA 5D3WA 2KGXB 2EMSA 3X23A 2COCA 1FHWA 1RRPB 2QKLA 4WSFA 1MAIA 3FEHA 2UVMA 5GOWB 1P5TA 2YT0A 1DYNA 2RLOA 3ODOA 3ZVRA 3SV1A 4P7IA 1XD4A 1NI2A 1BTNA 1I2HA 1MPHA 2DA0A 2IYBA 1KZGA 4HAZB 1EVHA 2J0KA 2ELAA 3PVWA 4HAXB 5C5BB 3IVFA 3P7ZA 5D3YA 4CYEA 1DDVA 1P3RA 2LG1A 4KAXB 1WG7A 2MDXA 3ZDTA 1UEFA 3ULBA 1XX0A 1NTVA 2LULA 5CLQB 4GMVA 2D11A 1V88A 2DHIA 2DX5A 3A98B 2D9WA 1W1HA 2R09A 1LB1A 3LJUX 1BTKA 2HTHB 5DI9B 4ZRKA 5JHHA 1EAZA 4EJNA 3QIJA 1DBHA 1W1GA 2CRFA 2PZ1A 4IFSA 1NTYA 1ZC4B 1FHOA 4HAVB 4MY6A 1W1DA 4GXBA 5C6RA 2GCLA 1WJ1A 2ROVA 2KCJA 2QKMA 2UZSA 2LKOA 2DN6A 1H10A 5FI0A 2D9ZA 4TYZA 4PQ0A 5KQ4A 2GJYA 4HB4B 4GMXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UPR A;  2Q13 A;  3RCP A;  2RGN B;  3VOQ A;  1U5D A;  2H7E A;  3KRX A;  3WA0 A;  1Z87 A;  1QC6 A;  4XWX A;  3TFM A;  5DHA B;  1ZVR A;  1EF1 A;  3MPX A;  4DX8 A;  4A6K A;  2M38 A;  4A6F A;  3HW2 B;  4DXA B;  1KZ7 A;  2ROZ B;  2COA A;  2H7D A;  1ISN A;  4B6H A;  2GCJ A;  1Y19 B;  3GYO A;  1FOE A;  3VIA A;  2DKP A;  2ELB A;  5KQ1 A;  5C5B A;  3PZD A;  3A8Q A;  5DH9 B;  3V5W A;  4L6E A;  2AL6 A;  2DTC A;  4F7G A;  2P8V A;  2DYN A;  4GN1 A;  2UZR A;  5D27 A;  4ZRJ A;  1XOD A;  1TQZ A;  2Z0O A;  3CIK A;  1OMW A;  2Y7B A;  4HDO A;  1TJ6 A;  3NSU A;  3A8P A;  5CLL B;  2YT1 A;  2ZPY A;  2JP2 A;  1X11 A;  1PMS A;  2M14 A;  2D4Q A;  2G35 A;  4HAY B;  2NMB A;  2E2X A;  2NZ8 B;  3UZT A;  1B55 A;  5DHF B;  1AQC A;  3O96 A;  2N0Y A;  3ODW A;  3F0W A;  3HK0 A;  1IRS A;  4DBB A;  4WVF B;  3BJI A;  5J3Q A;  1MIX A;  4GPT B;  1WGQ A;  1X05 A;  1UNP A;  1UNQ A;  4K2O A;  1GC6 A;  1X1F A;  1QQG A;  4MK0 A;  2D10 A;  3GYP A;  3SUZ A;  1FGZ A;  3OAN A;  2W2X D;  1V5U A;  4WJ7 A;  1V89 A;  2I5C A;  4HAU B;  2N23 A;  2DKQ A;  2VRW B;  4HB0 B;  1X86 A;  1PFJ A;  3ULC A;  2EMT A;  3AU5 A;  2L2I A;  5HE3 A;  5LOP B;  2LOZ A;  4Z2N A;  3AU4 A;  1X1G A;  4A6H A;  1XKE A;  5JLJ B;  3KRW A;  2OQB A;  4K2P A;  4TKN A;  1U27 A;  1MIZ B;  3M1I B;  5DIF B;  2RVB B;  2W2W A;  1GC7 A;  1V5P A;  2HE7 A;  3KY9 A;  2YS3 A;  4CHM A;  4IOY X;  3T06 A;  2XQN M;  1U29 A;  2J0M A;  1UPQ A;  2VSZ A;  1LW3 A;  5HE0 A;  2DHJ A;  4KVG B;  3SYX A;  1NU2 A;  2L1C A;  3D8D A;  2YRY A;  3U7D A;  5HE1 A;  2COF A;  3QWM A;  2Y8G A;  4KHO A;  2I1J A;  2MFQ A;  1WVH A;  3FSS A;  1BWN A;  1MK9 B;  4NSW A;  3ODX A;  5L81 A;  2ADZ A;  1EGX A;  1ZM0 A;  5D3V A;  1DDM A;  4KHB B;  1DRO A;  4KHA A;  2D9Y A;  1FGY A;  1XCG A;  4Z2M B;  4HAW B;  1WI1 A;  3KZ1 A;  2LYD A;  2EJ8 A;  1U2B A;  2Z0Q A;  3HQC A;  3DXC A;  3TO1 A;  2AEH A;  5C79 A;  4Y94 A;  3DXE A;  5J3Y A;  1DDW A;  1OY2 A;  2CY4 A;  3QBV B;  3SNH A;  2COD A;  2W2X C;  2GS0 A;  3PVL A;  4NY0 A;  1K5D B;  3DXD A;  1ZSQ A;  3PSC A;  3P6A A;  3SO6 A;  4H8S A;  2KUP A;  2EC1 A;  4YL8 A;  1M7R A;  4DX9 0;  5EFX A;  3TVV A;  4BBK A;  3PEG A;  2OTX A;  2D9X A;  3D8F A;  1OQN A;  2RUK B;  4HB2 B;  2J59 M;  4ZRI A;  5C16 A;  1SGH A;  2YS1 A;  5J3T A;  4F7H A;  2DYQ A;  2P0D A;  2K00 A;  1M7E A;  3CXB B;  3F5R A;  2DX1 A;  2P0H A;  2DHK A;  1P6S A;  3MDB C;  1I7A A;  2RSG A;  1TXD A;  1WGU A;  3KSY A;  3BIN A;  2R0D A;  2FJL A;  3PVU A;  4YON A;  4HB3 B;  3AJ4 A;  1PLS A;  2LOX A;  3PP2 A;  1U5G A;  2RNR B;  4D0N B;  4HDQ A;  1MKE A;  5JP4 A;  2IFS A;  2I1K A;  4PNK A;  2X18 A;  4GZU A;  1MK7 B;  5FI1 A;  2V76 A;  5KCV A;  2VKI A;  1GG3 A;  2MKR A;  4F7U P;  1Y5O A;  2CY5 A;  1BAK A;  2YVC A;  2J0J A;  2YSZ A;  3PG7 A;  1E5W A;  1Q67 A;  2YS5 A;  4K17 A;  1N3H A;  4CHJ A;  1K5G B;  4A5K A;  4A6F B;  1H4R A;  4HHV A;  1RJ2 A;  1U5E A;  1UNR A;  1WJM A;  5HE2 A;  2D2Q A;  1XR0 B;  3ML4 A;  2P0F A;  2YF0 A;  1U5F A;  2Y8F A;  3TW1 A;  2Z0P A;  4K81 A;  2D9V A;  1V61 A;  3D8E A;  5JHG A;  4EKU A;  1KI1 B;  1SHC A;  1FHX A;  5LON B;  1ZC3 B;  2DFK A;  1FB8 A;  3WYF B;  2K2U A;  4MT7 A;  4C0A A;  3FM8 C;  2K2J A;  2BCJ A;  1J19 A;  2CAY A;  1FAO A;  3U8Z A;  2DLW A;  2MWN B;  4HAT B;  3TCA A;  2I5F A;  1J0W A;  4IAP A;  3G9W A;  3N7C A;  1V5M A;  1AWE A;  5D3X A;  4EMO A;  5D3W A;  2KGX B;  2EMS A;  3X23 A;  2COC A;  1FHW A;  1RRP B;  2QKL A;  4WSF A;  1MAI A;  3FEH A;  2UVM A;  5GOW B;  1P5T A;  2YT0 A;  1DYN A;  2RLO A;  3ODO A;  3ZVR A;  3SV1 A;  4P7I A;  1XD4 A;  1NI2 A;  1BTN A;  1I2H A;  1MPH A;  2DA0 A;  2IYB A;  1KZG A;  4HAZ B;  1EVH A;  2J0K A;  2ELA A;  3PVW A;  4HAX B;  5C5B B;  3IVF A;  3P7Z A;  5D3Y A;  4CYE A;  1DDV A;  1P3R A;  2LG1 A;  4KAX B;  1WG7 A;  2MDX A;  3ZDT A;  1UEF A;  3ULB A;  1XX0 A;  1NTV A;  2LUL A;  5CLQ B;  4GMV A;  2D11 A;  1V88 A;  2DHI A;  2DX5 A;  3A98 B;  2D9W A;  1W1H A;  2R09 A;  1LB1 A;  3LJU X;  1BTK A;  2HTH B;  5DI9 B;  4ZRK A;  5JHH A;  1EAZ A;  4EJN A;  3QIJ A;  1DBH A;  1W1G A;  2CRF A;  2PZ1 A;  4IFS A;  1NTY A;  1ZC4 B;  1FHO A;  4HAV B;  4MY6 A;  1W1D A;  4GXB A;  5C6R A;  2GCL A;  1WJ1 A;  2ROV A;  2KCJ A;  2QKM A;  2UZS A;  2LKO A;  2DN6 A;  1H10 A;  5FI0 A;  2D9Z A;  4TYZ A;  4PQ0 A;  5KQ4 A;  2GJY A;  4HB4 B;  4GMX B; 
#chains in the Genus database with same CATH topology
 2Z13 A;  1UPR A;  2Q13 A;  3RCP A;  2RGN B;  3VOQ A;  1U5D A;  2H7E A;  3KRX A;  3WA0 A;  4OT1 A;  1Z87 A;  1QC6 A;  4XWX A;  5IRS A;  3TFM A;  5DHA B;  1ZVR A;  1EF1 A;  3MPX A;  4DX8 A;  4A6K A;  2M38 A;  4A6F A;  3HW2 B;  4DXA B;  1KZ7 A;  2ROZ B;  2COA A;  2H7D A;  1ISN A;  4B6H A;  2GCJ A;  1Y19 B;  3GYO A;  3HIE A;  1FOE A;  3VIA A;  2DKP A;  2ELB A;  5KQ1 A;  5C5B A;  3PZD A;  3A8Q A;  5DH9 B;  3V5W A;  4L6E A;  2AL6 A;  2DTC A;  3B77 A;  4F7G A;  2P8V A;  2DYN A;  2Z4D A;  4GN1 A;  4CSQ A;  2UZR A;  5D27 A;  4ZRJ A;  1XOD A;  1TQZ A;  2Z0O A;  3CIK A;  1OMW A;  2Y7B A;  4HDO A;  4QJ5 B;  1TJ6 A;  3NSU A;  3A8P A;  5CLL B;  2YT1 A;  2ZPY A;  2KIG A;  2JP2 A;  1X11 A;  1PMS A;  2FJU B;  2M14 A;  2D4Q A;  2G35 A;  4HAY B;  2NMB A;  2E2X A;  2NZ8 B;  3UZT A;  1B55 A;  5DHF B;  1AQC A;  1MI1 A;  3O96 A;  2N0Y A;  3ODW A;  3F0W A;  3HK0 A;  1IRS A;  4DBB A;  4WVF B;  3BJI A;  5J3Q A;  1MIX A;  4GPT B;  1WGQ A;  1X05 A;  1UNP A;  1UNQ A;  4K2O A;  1GC6 A;  1X1F A;  1QQG A;  4MK0 A;  2D10 A;  3GYP A;  3SUZ A;  1FGZ A;  3OAN A;  2W2X D;  1V5U A;  4WJ7 A;  3U12 A;  1V89 A;  2I5C A;  4HAU B;  2N23 A;  2DKQ A;  2VRW B;  4HB0 B;  1X86 A;  1PFJ A;  3ULC A;  2EMT A;  3AU5 A;  2L2I A;  4KHB A;  5HE3 A;  5LOP B;  5LG4 B;  2LOZ A;  4Z2N A;  3AU4 A;  1X1G A;  4A6H A;  1XKE A;  5JLJ B;  3KRW A;  2OQB A;  1ZYI A;  4K2P A;  4TKN A;  4QJ4 B;  1U27 A;  1MIZ B;  3M1I B;  5DIF B;  2RVB B;  2W2W A;  4GOU A;  1GC7 A;  1V5P A;  2HE7 A;  3KY9 A;  2YS3 A;  4CHM A;  2NBV A;  4IOY X;  3T06 A;  2XQN M;  1U29 A;  2J0M A;  1UPQ A;  2VSZ A;  1LW3 A;  5HE0 A;  2DHJ A;  4KVG B;  3SYX A;  1NU2 A;  2L1C A;  5I2S A;  3D8D A;  2YRY A;  3U7D A;  5HE1 A;  2COF A;  3QWM A;  2Y8G A;  3A58 A;  4KHO A;  2I1J A;  2MFQ A;  2KUQ A;  1WVH A;  3FSS A;  1BWN A;  1MK9 B;  4NSW A;  3ODX A;  4HSI A;  5L81 A;  2ADZ A;  1EGX A;  1ZM0 A;  5D3V A;  4D6W A;  1DDM A;  4KHB B;  1DRO A;  2K49 A;  2RRF A;  4KHA A;  2D9Y A;  1FGY A;  1XCG A;  4Z2M B;  4HAW B;  1WI1 A;  5I2M A;  3KZ1 A;  2LYD A;  2EJ8 A;  1U2B A;  2Z0Q A;  3HQC A;  3DXC A;  3TO1 A;  2AEH A;  5C79 A;  2KR0 A;  4Y94 A;  3DXE A;  5J3Y A;  1DDW A;  1OY2 A;  2CY4 A;  3QBV B;  3SNH A;  2COD A;  3FVC A;  2W2X C;  2GS0 A;  3PVL A;  4NY0 A;  1K5D B;  3DXD A;  1ZSQ A;  3PSC A;  3P6A A;  3SO6 A;  4H8S A;  2KUP A;  2EC1 A;  4YL8 A;  1M7R A;  4DX9 0;  5EFX A;  3TVV A;  4BBK A;  3PEG A;  2OTX A;  2D9X A;  3D8F A;  2R2Y A;  1OQN A;  2RUK B;  4HB2 B;  2J59 M;  4ZRI A;  5C16 A;  1SGH A;  2YS1 A;  3DCX A;  5J3T A;  4F7H A;  2DYQ A;  2P0D A;  3HSA A;  4GNK B;  2K00 A;  1M7E A;  3CXB B;  3F5R A;  2DX1 A;  2P0H A;  2DHK A;  1P6S A;  3MDB C;  1I7A A;  2RSG A;  1TXD A;  1WGU A;  3NW8 A;  3KSY A;  3BIN A;  2R0D A;  2FJL A;  3PVU A;  4YON A;  4HB3 B;  3AJ4 A;  1PLS A;  2LOX A;  3PP2 A;  5M4Y B;  1U5G A;  2RNR B;  4D0N B;  4HDQ A;  1MKE A;  5JP4 A;  2IFS A;  2I1K A;  4PNK A;  2X18 A;  4GZU A;  1MK7 B;  5FI1 A;  4QXA B;  2V76 A;  5KCV A;  2VKI A;  1GG3 A;  2MKR A;  4F7U P;  1Y5O A;  2CY5 A;  1BAK A;  2YVC A;  2J0J A;  2YSZ A;  3PG7 A;  1E5W A;  1Q67 A;  2YS5 A;  2Z59 A;  4K17 A;  1N3H A;  4CHJ A;  1K5G B;  4A5K A;  4A6F B;  1H4R A;  4HHV A;  1RJ2 A;  2K8E A;  1U5E A;  1UNR A;  1WJM A;  5HE2 A;  2D2Q A;  1XR0 B;  3ML4 A;  2P0F A;  2YF0 A;  1U5F A;  2Y8F A;  3TW1 A;  3NWF A;  2Z0P A;  4K81 A;  2D9V A;  1V61 A;  2ZKM X;  3D8E A;  5JHG A;  4EKU A;  1KI1 B;  1SHC A;  1FHX A;  5LON B;  1ZC3 B;  2DFK A;  1FB8 A;  3WYF B;  2K2U A;  4MT7 A;  4C0A A;  3FM8 C;  2K2J A;  2BCJ A;  1J19 A;  2CAY A;  1FAO A;  3U8Z A;  2DLW A;  2MWN B;  4HAT B;  3TCA A;  2I5F A;  1J0W A;  4QJ3 B;  4IAP A;  3G9W A;  3N7C A;  2YT2 A;  1V5M A;  3OHM B;  1AWE A;  5D3X A;  4EMO A;  3NWA A;  2KGX B;  2EMS A;  5D3W A;  2COC A;  3X23 A;  1FHW A;  1RRP B;  2QKL A;  4WSF A;  4DIX A;  1MAI A;  3FEH A;  2UVM A;  5GOW B;  1P5T A;  2YT0 A;  1DYN A;  2RLO A;  3ODO A;  3ZVR A;  3SV1 A;  4P7I A;  1XD4 A;  1NI2 A;  1BTN A;  1I2H A;  1MPH A;  2DA0 A;  2IYB A;  1KZG A;  4HAZ B;  1EVH A;  2J0K A;  2ELA A;  3PVW A;  4HAX B;  5C5B B;  3NWD A;  3IVF A;  3P7Z A;  5D3Y A;  4CYE A;  1DDV A;  1P3R A;  2LG1 A;  4KAX B;  1WG7 A;  2MDX A;  3ZDT A;  1UEF A;  3ULB A;  1XX0 A;  4OSN A;  1NTV A;  2LUL A;  5CLQ B;  4GMV A;  2D11 A;  1V88 A;  2DHI A;  2DX5 A;  3A98 B;  2D9W A;  1W1H A;  2R09 A;  2Z14 A;  1LB1 A;  3LJU X;  1BTK A;  2HTH B;  5DI9 B;  4ZRK A;  5JHH A;  1EAZ A;  4EJN A;  3QIJ A;  1DBH A;  1W1G A;  2CRF A;  2PZ1 A;  4IFS A;  1NTY A;  1ZC4 B;  4L1R A;  1FHO A;  2KIE A;  4HAV B;  4MY6 A;  1T77 A;  1W1D A;  4GXB A;  5C6R A;  2GCL A;  1WJ1 A;  2ROV A;  2KCJ A;  2QKM A;  2UZS A;  2LKO A;  2DN6 A;  1H10 A;  5FI0 A;  2D9Z A;  4TYZ A;  2GUM A;  4PQ0 A;  2GJY A;  5KQ4 A;  4HB4 B;  4GMX B; 
#chains in the Genus database with same CATH homology
 1UPR A;  2Q13 A;  3RCP A;  2RGN B;  3VOQ A;  1U5D A;  2H7E A;  3KRX A;  3WA0 A;  1Z87 A;  1QC6 A;  4XWX A;  3TFM A;  5DHA B;  1ZVR A;  1EF1 A;  3MPX A;  4DX8 A;  4A6K A;  2M38 A;  4A6F A;  3HW2 B;  4DXA B;  1KZ7 A;  2ROZ B;  2COA A;  2H7D A;  1ISN A;  4B6H A;  2GCJ A;  1Y19 B;  3GYO A;  1FOE A;  3VIA A;  2DKP A;  2ELB A;  5KQ1 A;  5C5B A;  3PZD A;  3A8Q A;  5DH9 B;  3V5W A;  4L6E A;  2AL6 A;  2DTC A;  4F7G A;  2P8V A;  2DYN A;  4GN1 A;  2UZR A;  5D27 A;  4ZRJ A;  1XOD A;  1TQZ A;  2Z0O A;  3CIK A;  1OMW A;  2Y7B A;  4HDO A;  1TJ6 A;  3NSU A;  3A8P A;  5CLL B;  2YT1 A;  2ZPY A;  2JP2 A;  1X11 A;  1PMS A;  2M14 A;  2D4Q A;  2G35 A;  4HAY B;  2NMB A;  2E2X A;  2NZ8 B;  3UZT A;  1B55 A;  5DHF B;  1AQC A;  3O96 A;  2N0Y A;  3ODW A;  3F0W A;  3HK0 A;  1IRS A;  4DBB A;  4WVF B;  3BJI A;  5J3Q A;  1MIX A;  4GPT B;  1WGQ A;  1X05 A;  1UNP A;  1UNQ A;  4K2O A;  1GC6 A;  1X1F A;  1QQG A;  4MK0 A;  2D10 A;  3GYP A;  3SUZ A;  1FGZ A;  3OAN A;  2W2X D;  1V5U A;  4WJ7 A;  1V89 A;  2I5C A;  4HAU B;  2N23 A;  2DKQ A;  2VRW B;  4HB0 B;  1X86 A;  1PFJ A;  3ULC A;  2EMT A;  3AU5 A;  2L2I A;  5HE3 A;  5LOP B;  2LOZ A;  4Z2N A;  3AU4 A;  1X1G A;  4A6H A;  1XKE A;  5JLJ B;  3KRW A;  2OQB A;  4K2P A;  4TKN A;  1U27 A;  1MIZ B;  3M1I B;  5DIF B;  2RVB B;  2W2W A;  1GC7 A;  1V5P A;  2HE7 A;  3KY9 A;  2YS3 A;  4CHM A;  4IOY X;  3T06 A;  2XQN M;  1U29 A;  2J0M A;  1UPQ A;  2VSZ A;  1LW3 A;  5HE0 A;  2DHJ A;  4KVG B;  3SYX A;  1NU2 A;  2L1C A;  3D8D A;  2YRY A;  3U7D A;  5HE1 A;  2COF A;  3QWM A;  2Y8G A;  4KHO A;  2I1J A;  2MFQ A;  1WVH A;  3FSS A;  1BWN A;  1MK9 B;  4NSW A;  3ODX A;  5L81 A;  2ADZ A;  1EGX A;  1ZM0 A;  5D3V A;  1DDM A;  4KHB B;  1DRO A;  4KHA A;  2D9Y A;  1FGY A;  1XCG A;  4Z2M B;  4HAW B;  1WI1 A;  3KZ1 A;  2LYD A;  2EJ8 A;  1U2B A;  2Z0Q A;  3HQC A;  3DXC A;  3TO1 A;  2AEH A;  5C79 A;  4Y94 A;  3DXE A;  5J3Y A;  1DDW A;  1OY2 A;  2CY4 A;  3QBV B;  3SNH A;  2COD A;  2W2X C;  2GS0 A;  3PVL A;  4NY0 A;  1K5D B;  3DXD A;  1ZSQ A;  3PSC A;  3P6A A;  3SO6 A;  4H8S A;  2KUP A;  2EC1 A;  4YL8 A;  1M7R A;  4DX9 0;  5EFX A;  3TVV A;  4BBK A;  3PEG A;  2OTX A;  2D9X A;  3D8F A;  1OQN A;  2RUK B;  4HB2 B;  2J59 M;  4ZRI A;  5C16 A;  1SGH A;  2YS1 A;  5J3T A;  4F7H A;  2DYQ A;  2P0D A;  2K00 A;  1M7E A;  3CXB B;  3F5R A;  2DX1 A;  2P0H A;  2DHK A;  1P6S A;  3MDB C;  1I7A A;  2RSG A;  1TXD A;  1WGU A;  3KSY A;  3BIN A;  2R0D A;  2FJL A;  3PVU A;  4YON A;  4HB3 B;  3AJ4 A;  1PLS A;  2LOX A;  3PP2 A;  1U5G A;  2RNR B;  4D0N B;  4HDQ A;  1MKE A;  5JP4 A;  2IFS A;  2I1K A;  4PNK A;  2X18 A;  4GZU A;  1MK7 B;  5FI1 A;  2V76 A;  5KCV A;  2VKI A;  1GG3 A;  2MKR A;  4F7U P;  1Y5O A;  2CY5 A;  1BAK A;  2YVC A;  2J0J A;  2YSZ A;  3PG7 A;  1E5W A;  1Q67 A;  2YS5 A;  4K17 A;  1N3H A;  4CHJ A;  1K5G B;  4A5K A;  4A6F B;  1H4R A;  4HHV A;  1RJ2 A;  1U5E A;  1UNR A;  1WJM A;  5HE2 A;  2D2Q A;  1XR0 B;  3ML4 A;  2P0F A;  2YF0 A;  1U5F A;  2Y8F A;  3TW1 A;  2Z0P A;  4K81 A;  2D9V A;  1V61 A;  3D8E A;  5JHG A;  4EKU A;  1KI1 B;  1SHC A;  1FHX A;  5LON B;  1ZC3 B;  2DFK A;  1FB8 A;  3WYF B;  2K2U A;  4MT7 A;  4C0A A;  3FM8 C;  2K2J A;  2BCJ A;  1J19 A;  2CAY A;  1FAO A;  3U8Z A;  2DLW A;  2MWN B;  4HAT B;  3TCA A;  2I5F A;  1J0W A;  4IAP A;  3G9W A;  3N7C A;  1V5M A;  1AWE A;  5D3X A;  4EMO A;  5D3W A;  2KGX B;  2EMS A;  3X23 A;  2COC A;  1FHW A;  1RRP B;  2QKL A;  4WSF A;  1MAI A;  3FEH A;  2UVM A;  5GOW B;  1P5T A;  2YT0 A;  1DYN A;  2RLO A;  3ODO A;  3ZVR A;  3SV1 A;  4P7I A;  1XD4 A;  1NI2 A;  1BTN A;  1I2H A;  1MPH A;  2DA0 A;  2IYB A;  1KZG A;  4HAZ B;  1EVH A;  2J0K A;  2ELA A;  3PVW A;  4HAX B;  5C5B B;  3IVF A;  3P7Z A;  5D3Y A;  4CYE A;  1DDV A;  1P3R A;  2LG1 A;  4KAX B;  1WG7 A;  2MDX A;  3ZDT A;  1UEF A;  3ULB A;  1XX0 A;  1NTV A;  2LUL A;  5CLQ B;  4GMV A;  2D11 A;  1V88 A;  2DHI A;  2DX5 A;  3A98 B;  2D9W A;  1W1H A;  2R09 A;  1LB1 A;  3LJU X;  1BTK A;  2HTH B;  5DI9 B;  4ZRK A;  5JHH A;  1EAZ A;  4EJN A;  3QIJ A;  1DBH A;  1W1G A;  2CRF A;  2PZ1 A;  4IFS A;  1NTY A;  1ZC4 B;  1FHO A;  4HAV B;  4MY6 A;  1W1D A;  4GXB A;  5C6R A;  2GCL A;  1WJ1 A;  2ROV A;  2KCJ A;  2QKM A;  2UZS A;  2LKO A;  2DN6 A;  1H10 A;  5FI0 A;  2D9Z A;  4TYZ A;  4PQ0 A;  5KQ4 A;  2GJY A;  4HB4 B;  4GMX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...