2NMBA

Dnumb ptb domain complexed with a phosphotyrosine peptide, nmr, ensemble of structures.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
147
structure length
147
Chain Sequence
SKPHQWQADEEAVRSATCSFSVKYLGCVEVFESRGMQVCEEALKVLRQSRRRPVRGLLHVSGDGLRVVDDETKGLIVDQTIEKVSFCAPDRNHERGFSYICRDGTTRRWMCHGFLACKDSGERLSHAVGCAFAVCLERKQRRTRAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (NUMB PROTEIN)
publication title Structure of a Numb PTB domain-peptide complex suggests a basis for diverse binding specificity.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Cell cycle/gene regulation
total genus 20
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 1998-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2nmbA00
3SYXA 5HE0A 1X1GA 1WI1A 5KQ1A 3PZDA 4K81A 3KY9A 4EKUA 4HB0B 2D9XA 1Q67A 1NU2A 1DDWA 1U5GA 4ZRJA 4PQ0A 1Y19B 1WGUA 2GCLA 2CY5A 3TCAA 2COFA 5HE2A 2DHJA 2KGXB 3ODXA 2D11A 2GS0A 2LYDA 2LOZA 1DYNA 5CLLB 2XQNM 1BTNA 3F5RA 2CODA 1I7AA 1I2HA 1WJ1A 1U27A 4K17A 5D3YA 5DHAB 2D2QA 3FSSA 4F7HA 4DBBA 2DN6A 2Y8GA 2COCA 3P6AA 2G35A 4WJ7A 5DI9B 2P0FA 3HK0A 2KUPA 1X1FA 5JHGA 3LJUX 2DKPA 2DTCA 2RSGA 1ZC4B 1V5UA 4IFSA 5DHFB 2ROVA 2ELAA 5C79A 4K2PA 2YS1A 4ZRIA 1TQZA 4KHBB 2PZ1A 1FOEA 4HB2B 1FGZA 1KZ7A 1AWEA 1V61A 2VKIA 4MT7A 1ZSQA 3SV1A 5CLQB 5FI0A 1B55A 5C6RA 1KI1B 1OMWA 3VOQA 3AJ4A 2P8VA 1GC6A 2DFKA 2J0MA 5HE1A 2I5CA 2YS5A 1XD4A 1FAOA 4GN1A 1M7RA 2RGNB 3VIAA 5FI1A 1OQNA 2IYBA 1NTVA 2D10A 2Z0OA 2V76A 2VSZA 1XODA 3QBVB 3ODWA 3FM8C 2UZRA 5GOWB 3CXBB 4TYZA 1EF1A 1SHCA 1H4RA 1UNPA 1K5GB 5EFXA 3PG7A 4IAPA 3KRWA 4XWXA 2DX1A 2UZSA 2YSZA 2K00A 2L1CA 2MKRA 4Y94A 4HAWB 1PFJA 5C16A 1E5WA 3ZDTA 1AQCA 4EJNA 2D9YA 3OANA 1FHWA 3G9WA 2H7DA 4C0AA 3HQCA 2E2XA 2DA0A 1DDMA 1U29A 4EMOA 4Z2NA 3P7ZA 2MFQA 1N3HA 1X11A 5KQ4A 1FB8A 4H8SA 1SGHA 4CHJA 3A8PA 4L6EA 1K5DB 1V88A 4YL8A 3ODOA 2RUKB 4IOYX 2GCJA 1BWNA 2ADZA 4HAXB 4HAZB 2D9ZA 4A6KA 4D0NB 2YF0A 2W2XC 2LG1A 3M1IB 2YS3A 3BJIA 3TO1A 2I1JA 3D8EA 2LOXA 2MDXA 2OTXA 1XKEA 4K2OA 5D3VA 1V5PA 4KHAA 1XR0B 1TXDA 2P0DA 2JP2A 3SO6A 1MAIA 3SNHA 2J59M 3NSUA 2Y8FA 1KZGA 1P6SA 4HHVA 2EC1A 1PLSA 3GYOA 3PVUA 5JP4A 2H7EA 2COAA 2LULA 2YRYA 2ROZB 4DX90 5HE3A 4F7UP 3ULBA 2HE7A 2I1KA 3IVFA 3BINA 3ZVRA 5LONB 1V89A 4KHOA 2R0DA 2VRWB 4WSFA 3PEGA 1FHOA 1QQGA 1UPRA 3TVVA 3WYFB 3ML4A 2MWNB 2P0HA 4DXAB 3SUZA 4MY6A 4HB3B 1NI2A 2CRFA 2Q13A 3O96A 3X23A 1U5FA 1DDVA 1RJ2A 1MK9B 1LW3A 3QIJA 3HW2B 3A8QA 4NSWA 3DXCA 4GPTB 1P5TA 2R09A 2J0KA 1OY2A 4GMXB 2YT0A 4HAUB 1X86A 3PVWA 4BBKA 3QWMA 4PNKA 1FHXA 1W1DA 1EAZA 3AU5A 1WJMA 4KVGB 1XX0A 2J0JA 2CY4A 1EVHA 4HAVB 1BAKA 2QKLA 2M14A 2DKQA 1U2BA 2KCJA 1UNRA 1EGXA 3FEHA 1GG3A 3GYPA 4CYEA 1U5DA 4P7IA 5JLJB 2ZPYA 1P3RA 4HAYB 5JHHA 3RCPA 1LB1A 3WA0A 2N0YA 2DYQA 4GZUA 3TW1A 2BCJA 3T06A 3MPXA 3CIKA 1PMSA 2EJ8A 1IRSA 4WVFB 1U5EA 2Z0PA 2D9VA 2YT1A 1RRPB 4A6FA 1TJ6A 2M38A 5KCVA 3KRXA 2W2WA 2EMTA 2I5FA 1GC7A 2N23A 4GMVA 2RVBB 4NY0A 1UNQA 2NMBA 5DH9B 1NTYA 1QC6A 2EMSA 2HTHB 3PVLA 5L81A 2CAYA 5J3TA 1BTKA 5D3XA 2W2XD 2L2IA 4CHMA 3KSYA 4F7GA 2D4QA 1W1GA 1UPQA 4HATB 2Z0QA 1FGYA 1MIZB 2K2UA 1UEFA 1XCGA 2DHKA 4A6FB 3TFMA 2Y7BA 3PSCA 1M7EA 1WVHA 1MKEA 3DXDA 5DIFB 1Y5OA 3F0WA 2IFSA 5LOPB 1MPHA 3V5WA 3D8FA 2AEHA 1ZVRA 4TKNA 5C5BA 3UZTA 4KAXB 2RNRB 5J3YA 1DBHA 4HDOA 2QKMA 2AL6A 3A98B 1W1HA 3KZ1A 4DX8A 2K2JA 2X18A 4ZRKA 2UVMA 2OQBA 1ISNA 2NZ8B 4GXBA 1ZC3B 4A6HA 1MK7B 1J0WA 5J3QA 4HDQA 1Z87A 1WG7A 1MIXA 2DLWA 1WGQA 1V5MA 2D9WA 3U7DA 1J19A 2FJLA 2DX5A 1ZM0A 2GJYA 3MDBC 2LKOA 3PP2A 4HB4B 3DXEA 1X05A 3U8ZA 1DROA 4MK0A 4YONA 5C5BB 1H10A 4A5KA 5D27A 4B6HA 4Z2MB 3ULCA 2ELBA 3AU4A 2YVCA 3D8DA 2DHIA 2RLOA 5D3WA 3N7CA 2DYNA
chains in the Genus database with same CATH superfamily
3SYXA 5HE0A 1X1GA 1WI1A 3HSAA 5KQ1A 3PZDA 4K81A 3KY9A 4EKUA 4HB0B 3NW8A 2D9XA 1Q67A 1NU2A 1DDWA 1U5GA 4ZRJA 2NBVA 4PQ0A 1Y19B 1WGUA 2GCLA 2CY5A 3TCAA 2COFA 5I2MA 4GOUA 5HE2A 3A58A 4KHBA 2DHJA 2KGXB 3ODXA 2D11A 2GS0A 2LYDA 4QJ4B 2LOZA 1DYNA 5CLLB 2XQNM 1BTNA 3F5RA 3HIEA 1MI1A 2CODA 1I7AA 1I2HA 1WJ1A 1U27A 4K17A 4QJ5B 5D3YA 5DHAB 2D2QA 3FSSA 4F7HA 4HSIA 4DBBA 2DN6A 2Y8GA 2COCA 3P6AA 2G35A 4WJ7A 5DI9B 2P0FA 3HK0A 2KUPA 1X1FA 5JHGA 3LJUX 2DKPA 2DTCA 2RSGA 1ZC4B 1V5UA 4IFSA 4CSQA 5DHFB 2ROVA 2ELAA 5C79A 4K2PA 3DCXA 2K49A 2YS1A 4ZRIA 1TQZA 4KHBB 2PZ1A 1FOEA 4HB2B 1FGZA 1KZ7A 1AWEA 1V61A 2VKIA 4MT7A 1ZSQA 3SV1A 5CLQB 5FI0A 1B55A 5C6RA 1KI1B 1OMWA 3VOQA 3AJ4A 2P8VA 1GC6A 2DFKA 2J0MA 5HE1A 2I5CA 2YS5A 1XD4A 1FAOA 4GN1A 1M7RA 2RGNB 3VIAA 5FI1A 1OQNA 2IYBA 1NTVA 2D10A 2Z0OA 2V76A 4QXAB 2VSZA 1XODA 3QBVB 3ODWA 3FM8C 2UZRA 5GOWB 3CXBB 4TYZA 4L1RA 1EF1A 3NWDA 1SHCA 1H4RA 1UNPA 1K5GB 5EFXA 3PG7A 4IAPA 3KRWA 4XWXA 2DX1A 2UZSA 2YSZA 2K00A 2L1CA 2MKRA 1T77A 4Y94A 4HAWB 1PFJA 5C16A 1E5WA 3ZDTA 1AQCA 4EJNA 2D9YA 3OANA 1FHWA 3G9WA 2H7DA 4C0AA 3HQCA 2E2XA 2DA0A 1DDMA 1U29A 4EMOA 4Z2NA 3P7ZA 2MFQA 1N3HA 1X11A 3NWAA 1FB8A 4H8SA 5KQ4A 1SGHA 4CHJA 3A8PA 4L6EA 1K5DB 1V88A 4YL8A 3ODOA 2RUKB 4IOYX 2GCJA 1BWNA 2ADZA 4HAXB 4HAZB 2D9ZA 4A6KA 4D0NB 2YF0A 2R2YA 2W2XC 2LG1A 3M1IB 2YS3A 3BJIA 3TO1A 2I1JA 3D8EA 2LOXA 2K8EA 2MDXA 2OTXA 2ZKMX 1XKEA 4K2OA 5D3VA 1V5PA 4KHAA 1XR0B 1TXDA 2P0DA 2JP2A 3SO6A 1MAIA 3SNHA 2J59M 3NWFA 3NSUA 2Y8FA 2KR0A 1KZGA 1P6SA 4HHVA 2EC1A 1PLSA 3GYOA 3PVUA 5JP4A 2H7EA 2COAA 2LULA 2YRYA 2ROZB 4DX90 5HE3A 4F7UP 3ULBA 2HE7A 2I1KA 3IVFA 3BINA 3ZVRA 5LONB 1V89A 4KHOA 2R0DA 2VRWB 3B77A 4OT1A 4WSFA 3PEGA 1FHOA 1QQGA 1UPRA 3TVVA 3WYFB 3ML4A 2MWNB 2P0HA 2YT2A 4DXAB 3SUZA 4MY6A 5I2SA 4HB3B 1NI2A 2CRFA 2Q13A 3O96A 3X23A 1U5FA 5M4YB 1DDVA 1RJ2A 1MK9B 1LW3A 3QIJA 3HW2B 3A8QA 4NSWA 3DXCA 4GPTB 1P5TA 2R09A 2J0KA 1OY2A 4GMXB 2YT0A 4HAUB 1X86A 2KIEA 3PVWA 4BBKA 3QWMA 4PNKA 1FHXA 1W1DA 1EAZA 3AU5A 1WJMA 4KVGB 5LG4B 1ZYIA 1XX0A 2J0JA 2CY4A 1EVHA 4HAVB 1BAKA 2QKLA 2M14A 2DKQA 1U2BA 2KCJA 1UNRA 1EGXA 3FEHA 1GG3A 3GYPA 4CYEA 1U5DA 4P7IA 5JLJB 2ZPYA 1P3RA 4HAYB 5JHHA 3RCPA 1LB1A 3WA0A 2Z13A 2N0YA 2DYQA 4GZUA 3TW1A 2BCJA 3T06A 3MPXA 3CIKA 1PMSA 2EJ8A 1IRSA 2Z59A 4WVFB 1U5EA 2Z0PA 2D9VA 2YT1A 1RRPB 4A6FA 1TJ6A 2M38A 5KCVA 3KRXA 2W2WA 2EMTA 2I5FA 1GC7A 2N23A 4GMVA 2RVBB 4NY0A 1UNQA 2NMBA 5DH9B 2FJUB 2Z4DA 1NTYA 1QC6A 2EMSA 2HTHB 3PVLA 5L81A 4GNKB 2CAYA 2RRFA 5J3TA 2KUQA 1BTKA 4DIXA 5D3XA 2W2XD 2L2IA 4CHMA 4OSNA 3KSYA 4QJ3B 4F7GA 2D4QA 1W1GA 1UPQA 4HATB 2Z0QA 1FGYA 1MIZB 2K2UA 1UEFA 1XCGA 2DHKA 4A6FB 3TFMA 2Y7BA 3PSCA 1M7EA 3OHMB 1WVHA 1MKEA 3DXDA 5DIFB 1Y5OA 3F0WA 2IFSA 3FVCA 5LOPB 1MPHA 3V5WA 3D8FA 2AEHA 2Z14A 1ZVRA 4TKNA 5C5BA 3UZTA 3U12A 4KAXB 2RNRB 5J3YA 1DBHA 4HDOA 2GUMA 2QKMA 2AL6A 3A98B 1W1HA 3KZ1A 4DX8A 2K2JA 2X18A 4ZRKA 4D6WA 2UVMA 2OQBA 1ISNA 2NZ8B 4GXBA 1ZC3B 4A6HA 1MK7B 1J0WA 5J3QA 2KIGA 4HDQA 1Z87A 1WG7A 1MIXA 2DLWA 1WGQA 1V5MA 2D9WA 3U7DA 1J19A 2FJLA 2DX5A 1ZM0A 2GJYA 3MDBC 2LKOA 3PP2A 4HB4B 3DXEA 1X05A 3U8ZA 1DROA 4MK0A 4YONA 5C5BB 5IRSA 1H10A 4A5KA 5D27A 4B6HA 4Z2MB 3ULCA 2ELBA 3AU4A 2YVCA 3D8DA 2DHIA 2RLOA 5D3WA 3N7CA 2DYNA
chains in the Genus database with same CATH topology
3SYXA 5HE0A 1X1GA 1WI1A 5KQ1A 3PZDA 4K81A 3KY9A 4EKUA 4HB0B 2D9XA 1Q67A 1NU2A 1DDWA 1U5GA 4ZRJA 4PQ0A 1Y19B 1WGUA 2GCLA 2CY5A 3TCAA 2COFA 5HE2A 2DHJA 2KGXB 3ODXA 2D11A 2GS0A 2LYDA 2LOZA 1DYNA 5CLLB 2XQNM 1BTNA 3F5RA 2CODA 1I7AA 1I2HA 1WJ1A 1U27A 4K17A 5D3YA 5DHAB 2D2QA 3FSSA 4F7HA 4DBBA 2DN6A 2Y8GA 2COCA 3P6AA 2G35A 4WJ7A 5DI9B 2P0FA 3HK0A 2KUPA 1X1FA 5JHGA 3LJUX 2DKPA 2DTCA 2RSGA 1ZC4B 1V5UA 4IFSA 5DHFB 2ROVA 2ELAA 5C79A 4K2PA 2YS1A 4ZRIA 1TQZA 4KHBB 2PZ1A 1FOEA 4HB2B 1FGZA 1KZ7A 1AWEA 1V61A 2VKIA 4MT7A 1ZSQA 3SV1A 5CLQB 5FI0A 1B55A 5C6RA 1KI1B 1OMWA 3VOQA 3AJ4A 2P8VA 1GC6A 2DFKA 2J0MA 5HE1A 2I5CA 2YS5A 1XD4A 1FAOA 4GN1A 1M7RA 2RGNB 3VIAA 5FI1A 1OQNA 2IYBA 1NTVA 2D10A 2Z0OA 2V76A 2VSZA 1XODA 3QBVB 3ODWA 3FM8C 2UZRA 5GOWB 3CXBB 4TYZA 1EF1A 1SHCA 1H4RA 1UNPA 1K5GB 5EFXA 3PG7A 4IAPA 3KRWA 4XWXA 2DX1A 2UZSA 2YSZA 2K00A 2L1CA 2MKRA 4Y94A 4HAWB 1PFJA 5C16A 1E5WA 3ZDTA 1AQCA 4EJNA 2D9YA 3OANA 1FHWA 3G9WA 2H7DA 4C0AA 3HQCA 2E2XA 2DA0A 1DDMA 1U29A 4EMOA 4Z2NA 3P7ZA 2MFQA 1N3HA 1X11A 5KQ4A 1FB8A 4H8SA 1SGHA 4CHJA 3A8PA 4L6EA 1K5DB 1V88A 4YL8A 3ODOA 2RUKB 4IOYX 2GCJA 1BWNA 2ADZA 4HAXB 4HAZB 2D9ZA 4A6KA 4D0NB 2YF0A 2W2XC 2LG1A 3M1IB 2YS3A 3BJIA 3TO1A 2I1JA 3D8EA 2LOXA 2MDXA 2OTXA 1XKEA 4K2OA 5D3VA 1V5PA 4KHAA 1XR0B 1TXDA 2P0DA 2JP2A 3SO6A 1MAIA 3SNHA 2J59M 3NSUA 2Y8FA 1KZGA 1P6SA 4HHVA 2EC1A 1PLSA 3GYOA 3PVUA 5JP4A 2H7EA 2COAA 2LULA 2YRYA 2ROZB 4DX90 5HE3A 4F7UP 3ULBA 2HE7A 2I1KA 3IVFA 3BINA 3ZVRA 5LONB 1V89A 4KHOA 2R0DA 2VRWB 4WSFA 3PEGA 1FHOA 1QQGA 1UPRA 3TVVA 3WYFB 3ML4A 2MWNB 2P0HA 4DXAB 3SUZA 4MY6A 4HB3B 1NI2A 2CRFA 2Q13A 3O96A 3X23A 1U5FA 1DDVA 1RJ2A 1MK9B 1LW3A 3QIJA 3HW2B 3A8QA 4NSWA 3DXCA 4GPTB 1P5TA 2R09A 2J0KA 1OY2A 4GMXB 2YT0A 4HAUB 1X86A 3PVWA 4BBKA 3QWMA 4PNKA 1FHXA 1W1DA 1EAZA 3AU5A 1WJMA 4KVGB 1XX0A 2J0JA 2CY4A 1EVHA 4HAVB 1BAKA 2QKLA 2M14A 2DKQA 1U2BA 2KCJA 1UNRA 1EGXA 3FEHA 1GG3A 3GYPA 4CYEA 1U5DA 4P7IA 5JLJB 2ZPYA 1P3RA 4HAYB 5JHHA 3RCPA 1LB1A 3WA0A 2N0YA 2DYQA 4GZUA 3TW1A 2BCJA 3T06A 3MPXA 3CIKA 1PMSA 2EJ8A 1IRSA 4WVFB 1U5EA 2Z0PA 2D9VA 2YT1A 1RRPB 4A6FA 1TJ6A 2M38A 5KCVA 3KRXA 2W2WA 2EMTA 2I5FA 1GC7A 2N23A 4GMVA 2RVBB 4NY0A 1UNQA 2NMBA 5DH9B 1NTYA 1QC6A 2EMSA 2HTHB 3PVLA 5L81A 2CAYA 5J3TA 1BTKA 5D3XA 2W2XD 2L2IA 4CHMA 3KSYA 4F7GA 2D4QA 1W1GA 1UPQA 4HATB 2Z0QA 1FGYA 1MIZB 2K2UA 1UEFA 1XCGA 2DHKA 4A6FB 3TFMA 2Y7BA 3PSCA 1M7EA 1WVHA 1MKEA 3DXDA 5DIFB 1Y5OA 3F0WA 2IFSA 5LOPB 1MPHA 3V5WA 3D8FA 2AEHA 1ZVRA 4TKNA 5C5BA 3UZTA 4KAXB 2RNRB 5J3YA 1DBHA 4HDOA 2QKMA 2AL6A 3A98B 1W1HA 3KZ1A 4DX8A 2K2JA 2X18A 4ZRKA 2UVMA 2OQBA 1ISNA 2NZ8B 4GXBA 1ZC3B 4A6HA 1MK7B 1J0WA 5J3QA 4HDQA 1Z87A 1WG7A 1MIXA 2DLWA 1WGQA 1V5MA 2D9WA 3U7DA 1J19A 2FJLA 2DX5A 1ZM0A 2GJYA 3MDBC 2LKOA 3PP2A 4HB4B 3DXEA 1X05A 3U8ZA 1DROA 4MK0A 4YONA 5C5BB 1H10A 4A5KA 5D27A 4B6HA 4Z2MB 3ULCA 2ELBA 3AU4A 2YVCA 3D8DA 2DHIA 2RLOA 5D3WA 3N7CA 2DYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SYX A;  5HE0 A;  1X1G A;  1WI1 A;  5KQ1 A;  3PZD A;  4K81 A;  3KY9 A;  4EKU A;  4HB0 B;  2D9X A;  1Q67 A;  1NU2 A;  1DDW A;  1U5G A;  4ZRJ A;  4PQ0 A;  1Y19 B;  1WGU A;  2GCL A;  2CY5 A;  3TCA A;  2COF A;  5HE2 A;  2DHJ A;  2KGX B;  3ODX A;  2D11 A;  2GS0 A;  2LYD A;  2LOZ A;  1DYN A;  5CLL B;  2XQN M;  1BTN A;  3F5R A;  2COD A;  1I7A A;  1I2H A;  1WJ1 A;  1U27 A;  4K17 A;  5D3Y A;  5DHA B;  2D2Q A;  3FSS A;  4F7H A;  4DBB A;  2DN6 A;  2Y8G A;  2COC A;  3P6A A;  2G35 A;  4WJ7 A;  5DI9 B;  2P0F A;  3HK0 A;  2KUP A;  1X1F A;  5JHG A;  3LJU X;  2DKP A;  2DTC A;  2RSG A;  1ZC4 B;  1V5U A;  4IFS A;  5DHF B;  2ROV A;  2ELA A;  5C79 A;  4K2P A;  2YS1 A;  4ZRI A;  1TQZ A;  4KHB B;  2PZ1 A;  1FOE A;  4HB2 B;  1FGZ A;  1KZ7 A;  1AWE A;  1V61 A;  2VKI A;  4MT7 A;  1ZSQ A;  3SV1 A;  5CLQ B;  5FI0 A;  1B55 A;  5C6R A;  1KI1 B;  1OMW A;  3VOQ A;  3AJ4 A;  2P8V A;  1GC6 A;  2DFK A;  2J0M A;  5HE1 A;  2I5C A;  2YS5 A;  1XD4 A;  1FAO A;  4GN1 A;  1M7R A;  2RGN B;  3VIA A;  5FI1 A;  1OQN A;  2IYB A;  1NTV A;  2D10 A;  2Z0O A;  2V76 A;  2VSZ A;  1XOD A;  3QBV B;  3ODW A;  3FM8 C;  2UZR A;  5GOW B;  3CXB B;  4TYZ A;  1EF1 A;  1SHC A;  1H4R A;  1UNP A;  1K5G B;  5EFX A;  3PG7 A;  4IAP A;  3KRW A;  4XWX A;  2DX1 A;  2UZS A;  2YSZ A;  2K00 A;  2L1C A;  2MKR A;  4Y94 A;  4HAW B;  1PFJ A;  5C16 A;  1E5W A;  3ZDT A;  1AQC A;  4EJN A;  2D9Y A;  3OAN A;  1FHW A;  3G9W A;  2H7D A;  4C0A A;  3HQC A;  2E2X A;  2DA0 A;  1DDM A;  1U29 A;  4EMO A;  4Z2N A;  3P7Z A;  2MFQ A;  1N3H A;  1X11 A;  5KQ4 A;  1FB8 A;  4H8S A;  1SGH A;  4CHJ A;  3A8P A;  4L6E A;  1K5D B;  1V88 A;  4YL8 A;  3ODO A;  2RUK B;  4IOY X;  2GCJ A;  1BWN A;  2ADZ A;  4HAX B;  4HAZ B;  2D9Z A;  4A6K A;  4D0N B;  2YF0 A;  2W2X C;  2LG1 A;  3M1I B;  2YS3 A;  3BJI A;  3TO1 A;  2I1J A;  3D8E A;  2LOX A;  2MDX A;  2OTX A;  1XKE A;  4K2O A;  5D3V A;  1V5P A;  4KHA A;  1XR0 B;  1TXD A;  2P0D A;  2JP2 A;  3SO6 A;  1MAI A;  3SNH A;  2J59 M;  3NSU A;  2Y8F A;  1KZG A;  1P6S A;  4HHV A;  2EC1 A;  1PLS A;  3GYO A;  3PVU A;  5JP4 A;  2H7E A;  2COA A;  2LUL A;  2YRY A;  2ROZ B;  4DX9 0;  5HE3 A;  4F7U P;  3ULB A;  2HE7 A;  2I1K A;  3IVF A;  3BIN A;  3ZVR A;  5LON B;  1V89 A;  4KHO A;  2R0D A;  2VRW B;  4WSF A;  3PEG A;  1FHO A;  1QQG A;  1UPR A;  3TVV A;  3WYF B;  3ML4 A;  2MWN B;  2P0H A;  4DXA B;  3SUZ A;  4MY6 A;  4HB3 B;  1NI2 A;  2CRF A;  2Q13 A;  3O96 A;  3X23 A;  1U5F A;  1DDV A;  1RJ2 A;  1MK9 B;  1LW3 A;  3QIJ A;  3HW2 B;  3A8Q A;  4NSW A;  3DXC A;  4GPT B;  1P5T A;  2R09 A;  2J0K A;  1OY2 A;  4GMX B;  2YT0 A;  4HAU B;  1X86 A;  3PVW A;  4BBK A;  3QWM A;  4PNK A;  1FHX A;  1W1D A;  1EAZ A;  3AU5 A;  1WJM A;  4KVG B;  1XX0 A;  2J0J A;  2CY4 A;  1EVH A;  4HAV B;  1BAK A;  2QKL A;  2M14 A;  2DKQ A;  1U2B A;  2KCJ A;  1UNR A;  1EGX A;  3FEH A;  1GG3 A;  3GYP A;  4CYE A;  1U5D A;  4P7I A;  5JLJ B;  2ZPY A;  1P3R A;  4HAY B;  5JHH A;  3RCP A;  1LB1 A;  3WA0 A;  2N0Y A;  2DYQ A;  4GZU A;  3TW1 A;  2BCJ A;  3T06 A;  3MPX A;  3CIK A;  1PMS A;  2EJ8 A;  1IRS A;  4WVF B;  1U5E A;  2Z0P A;  2D9V A;  2YT1 A;  1RRP B;  4A6F A;  1TJ6 A;  2M38 A;  5KCV A;  3KRX A;  2W2W A;  2EMT A;  2I5F A;  1GC7 A;  2N23 A;  4GMV A;  2RVB B;  4NY0 A;  1UNQ A;  2NMB A;  5DH9 B;  1NTY A;  1QC6 A;  2EMS A;  2HTH B;  3PVL A;  5L81 A;  2CAY A;  5J3T A;  1BTK A;  5D3X A;  2W2X D;  2L2I A;  4CHM A;  3KSY A;  4F7G A;  2D4Q A;  1W1G A;  1UPQ A;  4HAT B;  2Z0Q A;  1FGY A;  1MIZ B;  2K2U A;  1UEF A;  1XCG A;  2DHK A;  4A6F B;  3TFM A;  2Y7B A;  3PSC A;  1M7E A;  1WVH A;  1MKE A;  3DXD A;  5DIF B;  1Y5O A;  3F0W A;  2IFS A;  5LOP B;  1MPH A;  3V5W A;  3D8F A;  2AEH A;  1ZVR A;  4TKN A;  5C5B A;  3UZT A;  4KAX B;  2RNR B;  5J3Y A;  1DBH A;  4HDO A;  2QKM A;  2AL6 A;  3A98 B;  1W1H A;  3KZ1 A;  4DX8 A;  2K2J A;  2X18 A;  4ZRK A;  2UVM A;  2OQB A;  1ISN A;  2NZ8 B;  4GXB A;  1ZC3 B;  4A6H A;  1MK7 B;  1J0W A;  5J3Q A;  4HDQ A;  1Z87 A;  1WG7 A;  1MIX A;  2DLW A;  1WGQ A;  1V5M A;  2D9W A;  3U7D A;  1J19 A;  2FJL A;  2DX5 A;  1ZM0 A;  2GJY A;  3MDB C;  2LKO A;  3PP2 A;  4HB4 B;  3DXE A;  1X05 A;  3U8Z A;  1DRO A;  4MK0 A;  4YON A;  5C5B B;  1H10 A;  4A5K A;  5D27 A;  4B6H A;  4Z2M B;  3ULC A;  2ELB A;  3AU4 A;  2YVC A;  3D8D A;  2DHI A;  2RLO A;  5D3W A;  3N7C A;  2DYN A; 
#chains in the Genus database with same CATH topology
 3SYX A;  5HE0 A;  1X1G A;  1WI1 A;  3HSA A;  5KQ1 A;  3PZD A;  4K81 A;  3KY9 A;  4EKU A;  4HB0 B;  3NW8 A;  2D9X A;  1Q67 A;  1NU2 A;  1DDW A;  1U5G A;  4ZRJ A;  2NBV A;  4PQ0 A;  1Y19 B;  1WGU A;  2GCL A;  2CY5 A;  3TCA A;  2COF A;  5I2M A;  4GOU A;  5HE2 A;  3A58 A;  4KHB A;  2DHJ A;  2KGX B;  3ODX A;  2D11 A;  2GS0 A;  2LYD A;  4QJ4 B;  2LOZ A;  1DYN A;  5CLL B;  2XQN M;  1BTN A;  3F5R A;  3HIE A;  1MI1 A;  2COD A;  1I7A A;  1I2H A;  1WJ1 A;  1U27 A;  4K17 A;  4QJ5 B;  5D3Y A;  5DHA B;  2D2Q A;  3FSS A;  4F7H A;  4HSI A;  4DBB A;  2DN6 A;  2Y8G A;  2COC A;  3P6A A;  2G35 A;  4WJ7 A;  5DI9 B;  2P0F A;  3HK0 A;  2KUP A;  1X1F A;  5JHG A;  3LJU X;  2DKP A;  2DTC A;  2RSG A;  1ZC4 B;  1V5U A;  4IFS A;  4CSQ A;  5DHF B;  2ROV A;  2ELA A;  5C79 A;  4K2P A;  3DCX A;  2K49 A;  2YS1 A;  4ZRI A;  1TQZ A;  4KHB B;  2PZ1 A;  1FOE A;  4HB2 B;  1FGZ A;  1KZ7 A;  1AWE A;  1V61 A;  2VKI A;  4MT7 A;  1ZSQ A;  3SV1 A;  5CLQ B;  5FI0 A;  1B55 A;  5C6R A;  1KI1 B;  1OMW A;  3VOQ A;  3AJ4 A;  2P8V A;  1GC6 A;  2DFK A;  2J0M A;  5HE1 A;  2I5C A;  2YS5 A;  1XD4 A;  1FAO A;  4GN1 A;  1M7R A;  2RGN B;  3VIA A;  5FI1 A;  1OQN A;  2IYB A;  1NTV A;  2D10 A;  2Z0O A;  2V76 A;  4QXA B;  2VSZ A;  1XOD A;  3QBV B;  3ODW A;  3FM8 C;  2UZR A;  5GOW B;  3CXB B;  4TYZ A;  4L1R A;  1EF1 A;  3NWD A;  1SHC A;  1H4R A;  1UNP A;  1K5G B;  5EFX A;  3PG7 A;  4IAP A;  3KRW A;  4XWX A;  2DX1 A;  2UZS A;  2YSZ A;  2K00 A;  2L1C A;  2MKR A;  1T77 A;  4Y94 A;  4HAW B;  1PFJ A;  5C16 A;  1E5W A;  3ZDT A;  1AQC A;  4EJN A;  2D9Y A;  3OAN A;  1FHW A;  3G9W A;  2H7D A;  4C0A A;  3HQC A;  2E2X A;  2DA0 A;  1DDM A;  1U29 A;  4EMO A;  4Z2N A;  3P7Z A;  2MFQ A;  1N3H A;  1X11 A;  3NWA A;  1FB8 A;  4H8S A;  5KQ4 A;  1SGH A;  4CHJ A;  3A8P A;  4L6E A;  1K5D B;  1V88 A;  4YL8 A;  3ODO A;  2RUK B;  4IOY X;  2GCJ A;  1BWN A;  2ADZ A;  4HAX B;  4HAZ B;  2D9Z A;  4A6K A;  4D0N B;  2YF0 A;  2R2Y A;  2W2X C;  2LG1 A;  3M1I B;  2YS3 A;  3BJI A;  3TO1 A;  2I1J A;  3D8E A;  2LOX A;  2K8E A;  2MDX A;  2OTX A;  2ZKM X;  1XKE A;  4K2O A;  5D3V A;  1V5P A;  4KHA A;  1XR0 B;  1TXD A;  2P0D A;  2JP2 A;  3SO6 A;  1MAI A;  3SNH A;  2J59 M;  3NWF A;  3NSU A;  2Y8F A;  2KR0 A;  1KZG A;  1P6S A;  4HHV A;  2EC1 A;  1PLS A;  3GYO A;  3PVU A;  5JP4 A;  2H7E A;  2COA A;  2LUL A;  2YRY A;  2ROZ B;  4DX9 0;  5HE3 A;  4F7U P;  3ULB A;  2HE7 A;  2I1K A;  3IVF A;  3BIN A;  3ZVR A;  5LON B;  1V89 A;  4KHO A;  2R0D A;  2VRW B;  3B77 A;  4OT1 A;  4WSF A;  3PEG A;  1FHO A;  1QQG A;  1UPR A;  3TVV A;  3WYF B;  3ML4 A;  2MWN B;  2P0H A;  2YT2 A;  4DXA B;  3SUZ A;  4MY6 A;  5I2S A;  4HB3 B;  1NI2 A;  2CRF A;  2Q13 A;  3O96 A;  3X23 A;  1U5F A;  5M4Y B;  1DDV A;  1RJ2 A;  1MK9 B;  1LW3 A;  3QIJ A;  3HW2 B;  3A8Q A;  4NSW A;  3DXC A;  4GPT B;  1P5T A;  2R09 A;  2J0K A;  1OY2 A;  4GMX B;  2YT0 A;  4HAU B;  1X86 A;  2KIE A;  3PVW A;  4BBK A;  3QWM A;  4PNK A;  1FHX A;  1W1D A;  1EAZ A;  3AU5 A;  1WJM A;  4KVG B;  5LG4 B;  1ZYI A;  1XX0 A;  2J0J A;  2CY4 A;  1EVH A;  4HAV B;  1BAK A;  2QKL A;  2M14 A;  2DKQ A;  1U2B A;  2KCJ A;  1UNR A;  1EGX A;  3FEH A;  1GG3 A;  3GYP A;  4CYE A;  1U5D A;  4P7I A;  5JLJ B;  2ZPY A;  1P3R A;  4HAY B;  5JHH A;  3RCP A;  1LB1 A;  3WA0 A;  2Z13 A;  2N0Y A;  2DYQ A;  4GZU A;  3TW1 A;  2BCJ A;  3T06 A;  3MPX A;  3CIK A;  1PMS A;  2EJ8 A;  1IRS A;  2Z59 A;  4WVF B;  1U5E A;  2Z0P A;  2D9V A;  2YT1 A;  1RRP B;  4A6F A;  1TJ6 A;  2M38 A;  5KCV A;  3KRX A;  2W2W A;  2EMT A;  2I5F A;  1GC7 A;  2N23 A;  4GMV A;  2RVB B;  4NY0 A;  1UNQ A;  2NMB A;  5DH9 B;  2FJU B;  2Z4D A;  1NTY A;  1QC6 A;  2EMS A;  2HTH B;  3PVL A;  5L81 A;  4GNK B;  2CAY A;  2RRF A;  5J3T A;  2KUQ A;  1BTK A;  4DIX A;  5D3X A;  2W2X D;  2L2I A;  4CHM A;  4OSN A;  3KSY A;  4QJ3 B;  4F7G A;  2D4Q A;  1W1G A;  1UPQ A;  4HAT B;  2Z0Q A;  1FGY A;  1MIZ B;  2K2U A;  1UEF A;  1XCG A;  2DHK A;  4A6F B;  3TFM A;  2Y7B A;  3PSC A;  1M7E A;  3OHM B;  1WVH A;  1MKE A;  3DXD A;  5DIF B;  1Y5O A;  3F0W A;  2IFS A;  3FVC A;  5LOP B;  1MPH A;  3V5W A;  3D8F A;  2AEH A;  2Z14 A;  1ZVR A;  4TKN A;  5C5B A;  3UZT A;  3U12 A;  4KAX B;  2RNR B;  5J3Y A;  1DBH A;  4HDO A;  2GUM A;  2QKM A;  2AL6 A;  3A98 B;  1W1H A;  3KZ1 A;  4DX8 A;  2K2J A;  2X18 A;  4ZRK A;  4D6W A;  2UVM A;  2OQB A;  1ISN A;  2NZ8 B;  4GXB A;  1ZC3 B;  4A6H A;  1MK7 B;  1J0W A;  5J3Q A;  2KIG A;  4HDQ A;  1Z87 A;  1WG7 A;  1MIX A;  2DLW A;  1WGQ A;  1V5M A;  2D9W A;  3U7D A;  1J19 A;  2FJL A;  2DX5 A;  1ZM0 A;  2GJY A;  3MDB C;  2LKO A;  3PP2 A;  4HB4 B;  3DXE A;  1X05 A;  3U8Z A;  1DRO A;  4MK0 A;  4YON A;  5C5B B;  5IRS A;  1H10 A;  4A5K A;  5D27 A;  4B6H A;  4Z2M B;  3ULC A;  2ELB A;  3AU4 A;  2YVC A;  3D8D A;  2DHI A;  2RLO A;  5D3W A;  3N7C A;  2DYN A; 
#chains in the Genus database with same CATH homology
 3SYX A;  5HE0 A;  1X1G A;  1WI1 A;  5KQ1 A;  3PZD A;  4K81 A;  3KY9 A;  4EKU A;  4HB0 B;  2D9X A;  1Q67 A;  1NU2 A;  1DDW A;  1U5G A;  4ZRJ A;  4PQ0 A;  1Y19 B;  1WGU A;  2GCL A;  2CY5 A;  3TCA A;  2COF A;  5HE2 A;  2DHJ A;  2KGX B;  3ODX A;  2D11 A;  2GS0 A;  2LYD A;  2LOZ A;  1DYN A;  5CLL B;  2XQN M;  1BTN A;  3F5R A;  2COD A;  1I7A A;  1I2H A;  1WJ1 A;  1U27 A;  4K17 A;  5D3Y A;  5DHA B;  2D2Q A;  3FSS A;  4F7H A;  4DBB A;  2DN6 A;  2Y8G A;  2COC A;  3P6A A;  2G35 A;  4WJ7 A;  5DI9 B;  2P0F A;  3HK0 A;  2KUP A;  1X1F A;  5JHG A;  3LJU X;  2DKP A;  2DTC A;  2RSG A;  1ZC4 B;  1V5U A;  4IFS A;  5DHF B;  2ROV A;  2ELA A;  5C79 A;  4K2P A;  2YS1 A;  4ZRI A;  1TQZ A;  4KHB B;  2PZ1 A;  1FOE A;  4HB2 B;  1FGZ A;  1KZ7 A;  1AWE A;  1V61 A;  2VKI A;  4MT7 A;  1ZSQ A;  3SV1 A;  5CLQ B;  5FI0 A;  1B55 A;  5C6R A;  1KI1 B;  1OMW A;  3VOQ A;  3AJ4 A;  2P8V A;  1GC6 A;  2DFK A;  2J0M A;  5HE1 A;  2I5C A;  2YS5 A;  1XD4 A;  1FAO A;  4GN1 A;  1M7R A;  2RGN B;  3VIA A;  5FI1 A;  1OQN A;  2IYB A;  1NTV A;  2D10 A;  2Z0O A;  2V76 A;  2VSZ A;  1XOD A;  3QBV B;  3ODW A;  3FM8 C;  2UZR A;  5GOW B;  3CXB B;  4TYZ A;  1EF1 A;  1SHC A;  1H4R A;  1UNP A;  1K5G B;  5EFX A;  3PG7 A;  4IAP A;  3KRW A;  4XWX A;  2DX1 A;  2UZS A;  2YSZ A;  2K00 A;  2L1C A;  2MKR A;  4Y94 A;  4HAW B;  1PFJ A;  5C16 A;  1E5W A;  3ZDT A;  1AQC A;  4EJN A;  2D9Y A;  3OAN A;  1FHW A;  3G9W A;  2H7D A;  4C0A A;  3HQC A;  2E2X A;  2DA0 A;  1DDM A;  1U29 A;  4EMO A;  4Z2N A;  3P7Z A;  2MFQ A;  1N3H A;  1X11 A;  5KQ4 A;  1FB8 A;  4H8S A;  1SGH A;  4CHJ A;  3A8P A;  4L6E A;  1K5D B;  1V88 A;  4YL8 A;  3ODO A;  2RUK B;  4IOY X;  2GCJ A;  1BWN A;  2ADZ A;  4HAX B;  4HAZ B;  2D9Z A;  4A6K A;  4D0N B;  2YF0 A;  2W2X C;  2LG1 A;  3M1I B;  2YS3 A;  3BJI A;  3TO1 A;  2I1J A;  3D8E A;  2LOX A;  2MDX A;  2OTX A;  1XKE A;  4K2O A;  5D3V A;  1V5P A;  4KHA A;  1XR0 B;  1TXD A;  2P0D A;  2JP2 A;  3SO6 A;  1MAI A;  3SNH A;  2J59 M;  3NSU A;  2Y8F A;  1KZG A;  1P6S A;  4HHV A;  2EC1 A;  1PLS A;  3GYO A;  3PVU A;  5JP4 A;  2H7E A;  2COA A;  2LUL A;  2YRY A;  2ROZ B;  4DX9 0;  5HE3 A;  4F7U P;  3ULB A;  2HE7 A;  2I1K A;  3IVF A;  3BIN A;  3ZVR A;  5LON B;  1V89 A;  4KHO A;  2R0D A;  2VRW B;  4WSF A;  3PEG A;  1FHO A;  1QQG A;  1UPR A;  3TVV A;  3WYF B;  3ML4 A;  2MWN B;  2P0H A;  4DXA B;  3SUZ A;  4MY6 A;  4HB3 B;  1NI2 A;  2CRF A;  2Q13 A;  3O96 A;  3X23 A;  1U5F A;  1DDV A;  1RJ2 A;  1MK9 B;  1LW3 A;  3QIJ A;  3HW2 B;  3A8Q A;  4NSW A;  3DXC A;  4GPT B;  1P5T A;  2R09 A;  2J0K A;  1OY2 A;  4GMX B;  2YT0 A;  4HAU B;  1X86 A;  3PVW A;  4BBK A;  3QWM A;  4PNK A;  1FHX A;  1W1D A;  1EAZ A;  3AU5 A;  1WJM A;  4KVG B;  1XX0 A;  2J0J A;  2CY4 A;  1EVH A;  4HAV B;  1BAK A;  2QKL A;  2M14 A;  2DKQ A;  1U2B A;  2KCJ A;  1UNR A;  1EGX A;  3FEH A;  1GG3 A;  3GYP A;  4CYE A;  1U5D A;  4P7I A;  5JLJ B;  2ZPY A;  1P3R A;  4HAY B;  5JHH A;  3RCP A;  1LB1 A;  3WA0 A;  2N0Y A;  2DYQ A;  4GZU A;  3TW1 A;  2BCJ A;  3T06 A;  3MPX A;  3CIK A;  1PMS A;  2EJ8 A;  1IRS A;  4WVF B;  1U5E A;  2Z0P A;  2D9V A;  2YT1 A;  1RRP B;  4A6F A;  1TJ6 A;  2M38 A;  5KCV A;  3KRX A;  2W2W A;  2EMT A;  2I5F A;  1GC7 A;  2N23 A;  4GMV A;  2RVB B;  4NY0 A;  1UNQ A;  2NMB A;  5DH9 B;  1NTY A;  1QC6 A;  2EMS A;  2HTH B;  3PVL A;  5L81 A;  2CAY A;  5J3T A;  1BTK A;  5D3X A;  2W2X D;  2L2I A;  4CHM A;  3KSY A;  4F7G A;  2D4Q A;  1W1G A;  1UPQ A;  4HAT B;  2Z0Q A;  1FGY A;  1MIZ B;  2K2U A;  1UEF A;  1XCG A;  2DHK A;  4A6F B;  3TFM A;  2Y7B A;  3PSC A;  1M7E A;  1WVH A;  1MKE A;  3DXD A;  5DIF B;  1Y5O A;  3F0W A;  2IFS A;  5LOP B;  1MPH A;  3V5W A;  3D8F A;  2AEH A;  1ZVR A;  4TKN A;  5C5B A;  3UZT A;  4KAX B;  2RNR B;  5J3Y A;  1DBH A;  4HDO A;  2QKM A;  2AL6 A;  3A98 B;  1W1H A;  3KZ1 A;  4DX8 A;  2K2J A;  2X18 A;  4ZRK A;  2UVM A;  2OQB A;  1ISN A;  2NZ8 B;  4GXB A;  1ZC3 B;  4A6H A;  1MK7 B;  1J0W A;  5J3Q A;  4HDQ A;  1Z87 A;  1WG7 A;  1MIX A;  2DLW A;  1WGQ A;  1V5M A;  2D9W A;  3U7D A;  1J19 A;  2FJL A;  2DX5 A;  1ZM0 A;  2GJY A;  3MDB C;  2LKO A;  3PP2 A;  4HB4 B;  3DXE A;  1X05 A;  3U8Z A;  1DRO A;  4MK0 A;  4YON A;  5C5B B;  1H10 A;  4A5K A;  5D27 A;  4B6H A;  4Z2M B;  3ULC A;  2ELB A;  3AU4 A;  2YVC A;  3D8D A;  2DHI A;  2RLO A;  5D3W A;  3N7C A;  2DYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...