2NMBA

Dnumb ptb domain complexed with a phosphotyrosine peptide, nmr, ensemble of structures.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
147
structure length
147
Chain Sequence
b'SKPHQWQADEEAVRSATCSFSVKYLGCVEVFESRGMQVCEEALKVLRQSRRRPVRGLLHVSGDGLRVVDDETKGLIVDQTIEKVSFCAPDRNHERGFSYICRDGTTRRWMCHGFLACKDSGERLSHAVGCAFAVCLERKQRRTRAAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (NUMB PROTEIN)
publication title Structure of a Numb PTB domain-peptide complex suggests a basis for diverse binding specificity.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Cell cycle/gene regulation
total genus 20
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 1998-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2nmbA00
1Y19B 2W2XD 5CLQB 3U8ZA 5HE1A 3IVFA 3V5WA 1U5GA 2DA0A 2GCJA 1U29A 2DTCA 1FHOA 3ULBA 4HB0B 1P3RA 4KAXB 1UNRA 4GXBA 1TXDA 1X86A 4MK0A 2RLOA 2R09A 1FHXA 1U5EA 4Z2MB 3PVLA 1E5WA 2L2IA 1V61A 2J59M 2JP2A 3O96A 3OANA 5HE0A 3KRWA 2K2JA 3TW1A 5L81A 2DYNA 3KRXA 1UEFA 1W1GA 1BTKA 3AU5A 1PLSA 2P0HA 2G35A 1BWNA 5D3VA 4GMXB 1BTNA 1WGQA 4D0NB 1I2HA 1ZSQA 2DFKA 1EVHA 4MT7A 2E2XA 2Y7BA 2P0FA 3ODXA 3WYFB 4GZUA 2P0DA 1QC6A 4ZRJA 3PZDA 1Y5OA 1MK9B 2D9YA 3FM8C 1MIXA 1SHCA 3N7CA 1XD4A 5LOPB 3KSYA 1AWEA 2LKOA 1AQCA 1ISNA 1XCGA 4A6KA 4A6FA 1MK7B 3U7DA 1WJ1A 4TKNA 1OQNA 3A98B 2N0YA 2ADZA 4DXAB 2L1CA 2EJ8A 4HDOA 5D27A 4HAUB 1SGHA 1XODA 3VOQA 1K5DB 1X05A 3F0WA 3HQCA 2M38A 1J19A 3MDBC 3D8FA 1PFJA 2HTHB 1ZM0A 1V5UA 3GYOA 4GPTB 2VSZA 1TQZA 2DHIA 2NZ8B 3QBVB 4K2OA 1V89A 2H7DA 3BJIA 3ULCA 5D3YA 2W2XC 4HAVB 1DROA 3ML4A 1H4RA 1Q67A 1ZC4B 1NTYA 2K2UA 1IRSA 3A8QA 1NU2A 5J3TA 2V76A 3ZVRA 1NTVA 2YS3A 2YVCA 3PP2A 2MDXA 4YL8A 4DX8A 1MIZB 2CRFA 3SUZA 2DX5A 4ZRIA 5FI1A 3NSUA 3SNHA 1M7RA 2LG1A 2J0MA 4H8SA 2J0KA 4L6EA 2KGXB 4KVGB 3WA0A 2QKMA 2UZRA 2YT0A 3M1IB 4TYZA 3SO6A 2YS1A 4HB4B 1X1GA 2I5FA 2GCLA 4KHBB 1P6SA 1RJ2A 1GC7A 1H10A 2DN6A 2I5CA 2NMBA 4F7GA 1UNQA 3TFMA 4Y94A 4HDQA 1X11A 3T06A 1LW3A 4XWXA 5D3XA 3BINA 2GS0A 2RVBB 2AEHA 2OTXA 2MWNB 2UZSA 3A8PA 1FAOA 2N23A 4K17A 3HK0A 5C79A 5KQ4A 4HAWB 2RGNB 4DX90 2PZ1A 2Z0QA 2LULA 1MKEA 1KZ7A 3X23A 5JP4A 1ZVRA 3TCAA 4CHJA 2BCJA 2D4QA 3TO1A 1WG7A 4HHVA 2EMSA 4HAYB 4A5KA 2R0DA 1GG3A 1TJ6A 1J0WA 4PQ0A 4YONA 1WJMA 4HAXB 1FGYA 2DKPA 3SYXA 1N3HA 2UVMA 2VKIA 2MFQA 1V5PA 3FSSA 2DLWA 3UZTA 1U2BA 2HE7A 3VIAA 2EMTA 3ODOA 3PVUA 3D8DA 5DH9B 2Y8GA 3CIKA 3CXBB 3PVWA 1BAKA 1GC6A 1I7AA 4Z2NA 1U5FA 3P6AA 3DXEA 5JHHA 2ELAA 5DHFB 2COFA 2D9XA 4ZRKA 1EGXA 3PG7A 1KZGA 2D11A 3SV1A 5DHAB 2CODA 4WSFA 4DBBA 4KHAA 3QWMA 2CAYA 1UPQA 3DXCA 4HATB 2D9VA 4GMVA 2DHJA 3D8EA 1EAZA 5JHGA 2CY4A 2K00A 2ELBA 2KCJA 5C6RA 1DDWA 2X18A 2RSGA 5LONB 3G9WA 5JLJB 5FI0A 3P7ZA 4MY6A 3AU4A 1WVHA 1W1HA 4F7HA 5EFXA 1XKEA 3F5RA 4F7UP 4NY0A 1OMWA 2LOXA 4P7IA 1FB8A 2COAA 2YSZA 4KHOA 3MPXA 4EJNA 1K5GB 2MKRA 2ROVA 1XR0B 2VRWB 3AJ4A 1PMSA 2GJYA 2ROZB 2FJLA 1EF1A 2D2QA 1XX0A 2ZPYA 4HAZB 3TVVA 5J3QA 1KI1B 3KZ1A 2KUPA 1Z87A 5DI9B 1UPRA 2RNRB 1FOEA 2DX1A 4K2PA 2D10A 5J3YA 2Q13A 3DXDA 4IFSA 2Z0OA 1LB1A 1FGZA 1RRPB 2I1JA 4A6HA 2H7EA 4A6FB 2DYQA 3QIJA 2CY5A 3KY9A 1M7EA 2Y8FA 2M14A 2AL6A 4B6HA 2W2WA 1V88A 1DBHA 5D3WA 4CHMA 5KQ1A 1WI1A 1OY2A 2YS5A 3PSCA 2DKQA 2QKLA 4CYEA 3PEGA 4IOYX 1U27A 2OQBA 1P5TA 1V5MA 5DIFB 4WJ7A 3HW2B 5C5BB 2J0JA 2D9WA 4K81A 2YF0A 2IYBA 2Z0PA 4WVFB 2LYDA 4GN1A 2RUKB 4HB3B 1W1DA 1ZC3B 1MPHA 2IFSA 2DHKA 4C0AA 3LJUX 5HE3A 4EKUA 5C16A 1X1FA 3FEHA 1MAIA 4IAPA 2YRYA 4PNKA 2YT1A 1B55A 5KCVA 1WGUA 3GYPA 1UNPA 2LOZA 1FHWA 2I1KA 4HB2B 4EMOA 4NSWA 2XQNM 1QQGA 1DDMA 5HE2A 1DYNA 5CLLB 2COCA 1U5DA 1NI2A 2D9ZA 5C5BA 3ZDTA 2EC1A 1DDVA 2P8VA 3ODWA 4BBKA 5GOWB 3RCPA
chains in the Genus database with same CATH superfamily
1Y19B 3NW8A 3OHMB 2W2XD 5CLQB 3U8ZA 5HE1A 3IVFA 3V5WA 1U5GA 2DA0A 2GCJA 2K49A 1U29A 1MI1A 2DTCA 4HSIA 1FHOA 4DIXA 3ULBA 4HB0B 1P3RA 4KAXB 1UNRA 2Z14A 4GXBA 1TXDA 1X86A 4MK0A 2RLOA 2R09A 1FHXA 1U5EA 4OT1A 4Z2MB 1ZYIA 3PVLA 1E5WA 2L2IA 1V61A 2J59M 2GUMA 2JP2A 3O96A 3OANA 2KIEA 5HE0A 3KRWA 2K2JA 3TW1A 5L81A 2DYNA 3KRXA 1UEFA 1W1GA 1BTKA 3AU5A 1PLSA 2P0HA 2G35A 1BWNA 5D3VA 4GMXB 1BTNA 1WGQA 4D0NB 1I2HA 1ZSQA 2DFKA 1EVHA 4MT7A 2E2XA 2Y7BA 2P0FA 3ODXA 3WYFB 4QJ5B 4GZUA 2P0DA 1QC6A 4ZRJA 3PZDA 1Y5OA 1MK9B 2D9YA 3FM8C 1MIXA 1SHCA 3N7CA 1XD4A 5LOPB 3KSYA 1AWEA 2LKOA 1AQCA 1ISNA 1T77A 1XCGA 3HSAA 4A6KA 4A6FA 1MK7B 3U7DA 1WJ1A 4TKNA 1OQNA 3A98B 2N0YA 2ADZA 4DXAB 2L1CA 2EJ8A 4HDOA 5D27A 4HAUB 1SGHA 2KIGA 1XODA 3VOQA 1K5DB 1X05A 3F0WA 3HQCA 2M38A 1J19A 3A58A 3MDBC 2Z4DA 3D8FA 1PFJA 2HTHB 1ZM0A 2RRFA 1V5UA 4GNKB 4D6WA 3GYOA 4GPTB 2VSZA 5I2SA 1TQZA 2DHIA 2NZ8B 3QBVB 4K2OA 1V89A 2H7DA 3BJIA 3ULCA 5D3YA 2W2XC 4HAVB 1DROA 3ML4A 1H4RA 1Q67A 1ZC4B 1NTYA 2K2UA 1IRSA 3HIEA 3A8QA 1NU2A 4GOUA 5J3TA 2V76A 3ZVRA 5LG4B 1NTVA 2YS3A 2YVCA 3PP2A 2MDXA 4YL8A 4DX8A 1MIZB 2CRFA 3SUZA 2DX5A 4ZRIA 5FI1A 3NSUA 3SNHA 1M7RA 2Z59A 2LG1A 2J0MA 4QJ4B 4H8SA 2J0KA 4L6EA 4L1RA 2KGXB 4KVGB 3WA0A 2QKMA 2UZRA 2YT0A 3M1IB 4TYZA 3SO6A 2YS1A 4HB4B 1X1GA 2I5FA 2GCLA 4KHBB 1P6SA 1RJ2A 1GC7A 1H10A 2DN6A 2I5CA 2NMBA 4F7GA 1UNQA 3TFMA 4Y94A 4HDQA 1X11A 3T06A 1LW3A 4XWXA 5D3XA 3BINA 2GS0A 2RVBB 2AEHA 2OTXA 5I2MA 2MWNB 2UZSA 3A8PA 1FAOA 2N23A 4K17A 3HK0A 2ZKMX 5C79A 5KQ4A 4HAWB 2RGNB 2KR0A 4DX90 2PZ1A 2Z0QA 2LULA 1MKEA 1KZ7A 3X23A 5JP4A 1ZVRA 3TCAA 4CHJA 2BCJA 2D4QA 3TO1A 1WG7A 4HHVA 2EMSA 4HAYB 4A5KA 2R0DA 1GG3A 1TJ6A 1J0WA 4OSNA 4PQ0A 3NWAA 4YONA 2Z13A 1WJMA 4HAXB 1FGYA 2DKPA 3SYXA 1N3HA 2UVMA 2VKIA 2MFQA 1V5PA 3FSSA 2DLWA 3UZTA 1U2BA 2HE7A 3VIAA 2EMTA 3ODOA 3PVUA 3D8DA 3FVCA 5DH9B 2Y8GA 3CIKA 3CXBB 3PVWA 1BAKA 1GC6A 1I7AA 4Z2NA 1U5FA 3P6AA 3DXEA 5JHHA 2ELAA 3U12A 5DHFB 2YT2A 2COFA 2D9XA 4ZRKA 1EGXA 3PG7A 3DCXA 1KZGA 2D11A 3SV1A 5DHAB 2CODA 4WSFA 4DBBA 4KHAA 3NWFA 3QWMA 2CAYA 1UPQA 3DXCA 4HATB 2D9VA 4GMVA 2DHJA 3D8EA 1EAZA 5JHGA 2CY4A 2K00A 2ELBA 2KCJA 4QXAB 5C6RA 1DDWA 2X18A 2RSGA 5LONB 3G9WA 5JLJB 5FI0A 3P7ZA 4MY6A 3AU4A 1WVHA 1W1HA 4F7HA 5EFXA 1XKEA 3F5RA 4F7UP 4NY0A 1OMWA 2LOXA 4P7IA 1FB8A 2K8EA 2COAA 2YSZA 4KHOA 3MPXA 4EJNA 1K5GB 2MKRA 5M4YB 2ROVA 1XR0B 2VRWB 3AJ4A 1PMSA 2GJYA 2ROZB 2FJLA 1EF1A 2D2QA 1XX0A 2ZPYA 4HAZB 3TVVA 5J3QA 1KI1B 3KZ1A 2KUPA 1Z87A 5DI9B 1UPRA 2RNRB 1FOEA 2DX1A 4K2PA 2D10A 5J3YA 2Q13A 3DXDA 4IFSA 2Z0OA 1LB1A 1FGZA 1RRPB 2I1JA 4A6HA 2H7EA 4A6FB 2DYQA 3QIJA 2CY5A 3KY9A 1M7EA 2Y8FA 2M14A 2FJUB 2AL6A 4B6HA 2W2WA 4KHBA 1V88A 1DBHA 5D3WA 4CHMA 5KQ1A 1WI1A 1OY2A 2YS5A 3PSCA 2DKQA 2QKLA 4CYEA 3PEGA 4IOYX 1U27A 2OQBA 2NBVA 1P5TA 1V5MA 5DIFB 4WJ7A 3HW2B 5C5BB 2J0JA 2D9WA 4K81A 2YF0A 2IYBA 2Z0PA 4WVFB 2LYDA 4GN1A 2KUQA 2RUKB 4HB3B 1W1DA 1ZC3B 1MPHA 2IFSA 2DHKA 3NWDA 4C0AA 3LJUX 5HE3A 4EKUA 5C16A 1X1FA 3FEHA 1MAIA 4IAPA 2R2YA 2YRYA 4PNKA 2YT1A 1B55A 5KCVA 1WGUA 3GYPA 1UNPA 2LOZA 1FHWA 2I1KA 4CSQA 4HB2B 4EMOA 4NSWA 2XQNM 1QQGA 1DDMA 4QJ3B 5HE2A 1DYNA 5CLLB 2COCA 3B77A 1U5DA 1NI2A 2D9ZA 5C5BA 3ZDTA 2EC1A 1DDVA 2P8VA 3ODWA 5IRSA 4BBKA 5GOWB 3RCPA
chains in the Genus database with same CATH topology
1Y19B 2W2XD 5CLQB 3U8ZA 5HE1A 3IVFA 3V5WA 1U5GA 2DA0A 2GCJA 1U29A 2DTCA 1FHOA 3ULBA 4HB0B 1P3RA 4KAXB 1UNRA 4GXBA 1TXDA 1X86A 4MK0A 2RLOA 2R09A 1FHXA 1U5EA 4Z2MB 3PVLA 1E5WA 2L2IA 1V61A 2J59M 2JP2A 3O96A 3OANA 5HE0A 3KRWA 2K2JA 3TW1A 5L81A 2DYNA 3KRXA 1UEFA 1W1GA 1BTKA 3AU5A 1PLSA 2P0HA 2G35A 1BWNA 5D3VA 4GMXB 1BTNA 1WGQA 4D0NB 1I2HA 1ZSQA 2DFKA 1EVHA 4MT7A 2E2XA 2Y7BA 2P0FA 3ODXA 3WYFB 4GZUA 2P0DA 1QC6A 4ZRJA 3PZDA 1Y5OA 1MK9B 2D9YA 3FM8C 1MIXA 1SHCA 3N7CA 1XD4A 5LOPB 3KSYA 1AWEA 2LKOA 1AQCA 1ISNA 1XCGA 4A6KA 4A6FA 1MK7B 3U7DA 1WJ1A 4TKNA 1OQNA 3A98B 2N0YA 2ADZA 4DXAB 2L1CA 2EJ8A 4HDOA 5D27A 4HAUB 1SGHA 1XODA 3VOQA 1K5DB 1X05A 3F0WA 3HQCA 2M38A 1J19A 3MDBC 3D8FA 1PFJA 2HTHB 1ZM0A 1V5UA 3GYOA 4GPTB 2VSZA 1TQZA 2DHIA 2NZ8B 3QBVB 4K2OA 1V89A 2H7DA 3BJIA 3ULCA 5D3YA 2W2XC 4HAVB 1DROA 3ML4A 1H4RA 1Q67A 1ZC4B 1NTYA 2K2UA 1IRSA 3A8QA 1NU2A 5J3TA 2V76A 3ZVRA 1NTVA 2YS3A 2YVCA 3PP2A 2MDXA 4YL8A 4DX8A 1MIZB 2CRFA 3SUZA 2DX5A 4ZRIA 5FI1A 3NSUA 3SNHA 1M7RA 2LG1A 2J0MA 4H8SA 2J0KA 4L6EA 2KGXB 4KVGB 3WA0A 2QKMA 2UZRA 2YT0A 3M1IB 4TYZA 3SO6A 2YS1A 4HB4B 1X1GA 2I5FA 2GCLA 4KHBB 1P6SA 1RJ2A 1GC7A 1H10A 2DN6A 2I5CA 2NMBA 4F7GA 1UNQA 3TFMA 4Y94A 4HDQA 1X11A 3T06A 1LW3A 4XWXA 5D3XA 3BINA 2GS0A 2RVBB 2AEHA 2OTXA 2MWNB 2UZSA 3A8PA 1FAOA 2N23A 4K17A 3HK0A 5C79A 5KQ4A 4HAWB 2RGNB 4DX90 2PZ1A 2Z0QA 2LULA 1MKEA 1KZ7A 3X23A 5JP4A 1ZVRA 3TCAA 4CHJA 2BCJA 2D4QA 3TO1A 1WG7A 4HHVA 2EMSA 4HAYB 4A5KA 2R0DA 1GG3A 1TJ6A 1J0WA 4PQ0A 4YONA 1WJMA 4HAXB 1FGYA 2DKPA 3SYXA 1N3HA 2UVMA 2VKIA 2MFQA 1V5PA 3FSSA 2DLWA 3UZTA 1U2BA 2HE7A 3VIAA 2EMTA 3ODOA 3PVUA 3D8DA 5DH9B 2Y8GA 3CIKA 3CXBB 3PVWA 1BAKA 1GC6A 1I7AA 4Z2NA 1U5FA 3P6AA 3DXEA 5JHHA 2ELAA 5DHFB 2COFA 2D9XA 4ZRKA 1EGXA 3PG7A 1KZGA 2D11A 3SV1A 5DHAB 2CODA 4WSFA 4DBBA 4KHAA 3QWMA 2CAYA 1UPQA 3DXCA 4HATB 2D9VA 4GMVA 2DHJA 3D8EA 1EAZA 5JHGA 2CY4A 2K00A 2ELBA 2KCJA 5C6RA 1DDWA 2X18A 2RSGA 5LONB 3G9WA 5JLJB 5FI0A 3P7ZA 4MY6A 3AU4A 1WVHA 1W1HA 4F7HA 5EFXA 1XKEA 3F5RA 4F7UP 4NY0A 1OMWA 2LOXA 4P7IA 1FB8A 2COAA 2YSZA 4KHOA 3MPXA 4EJNA 1K5GB 2MKRA 2ROVA 1XR0B 2VRWB 3AJ4A 1PMSA 2GJYA 2ROZB 2FJLA 1EF1A 2D2QA 1XX0A 2ZPYA 4HAZB 3TVVA 5J3QA 1KI1B 3KZ1A 2KUPA 1Z87A 5DI9B 1UPRA 2RNRB 1FOEA 2DX1A 4K2PA 2D10A 5J3YA 2Q13A 3DXDA 4IFSA 2Z0OA 1LB1A 1FGZA 1RRPB 2I1JA 4A6HA 2H7EA 4A6FB 2DYQA 3QIJA 2CY5A 3KY9A 1M7EA 2Y8FA 2M14A 2AL6A 4B6HA 2W2WA 1V88A 1DBHA 5D3WA 4CHMA 5KQ1A 1WI1A 1OY2A 2YS5A 3PSCA 2DKQA 2QKLA 4CYEA 3PEGA 4IOYX 1U27A 2OQBA 1P5TA 1V5MA 5DIFB 4WJ7A 3HW2B 5C5BB 2J0JA 2D9WA 4K81A 2YF0A 2IYBA 2Z0PA 4WVFB 2LYDA 4GN1A 2RUKB 4HB3B 1W1DA 1ZC3B 1MPHA 2IFSA 2DHKA 4C0AA 3LJUX 5HE3A 4EKUA 5C16A 1X1FA 3FEHA 1MAIA 4IAPA 2YRYA 4PNKA 2YT1A 1B55A 5KCVA 1WGUA 3GYPA 1UNPA 2LOZA 1FHWA 2I1KA 4HB2B 4EMOA 4NSWA 2XQNM 1QQGA 1DDMA 5HE2A 1DYNA 5CLLB 2COCA 1U5DA 1NI2A 2D9ZA 5C5BA 3ZDTA 2EC1A 1DDVA 2P8VA 3ODWA 4BBKA 5GOWB 3RCPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y19 B;  2W2X D;  5CLQ B;  3U8Z A;  5HE1 A;  3IVF A;  3V5W A;  1U5G A;  2DA0 A;  2GCJ A;  1U29 A;  2DTC A;  1FHO A;  3ULB A;  4HB0 B;  1P3R A;  4KAX B;  1UNR A;  4GXB A;  1TXD A;  1X86 A;  4MK0 A;  2RLO A;  2R09 A;  1FHX A;  1U5E A;  4Z2M B;  3PVL A;  1E5W A;  2L2I A;  1V61 A;  2J59 M;  2JP2 A;  3O96 A;  3OAN A;  5HE0 A;  3KRW A;  2K2J A;  3TW1 A;  5L81 A;  2DYN A;  3KRX A;  1UEF A;  1W1G A;  1BTK A;  3AU5 A;  1PLS A;  2P0H A;  2G35 A;  1BWN A;  5D3V A;  4GMX B;  1BTN A;  1WGQ A;  4D0N B;  1I2H A;  1ZSQ A;  2DFK A;  1EVH A;  4MT7 A;  2E2X A;  2Y7B A;  2P0F A;  3ODX A;  3WYF B;  4GZU A;  2P0D A;  1QC6 A;  4ZRJ A;  3PZD A;  1Y5O A;  1MK9 B;  2D9Y A;  3FM8 C;  1MIX A;  1SHC A;  3N7C A;  1XD4 A;  5LOP B;  3KSY A;  1AWE A;  2LKO A;  1AQC A;  1ISN A;  1XCG A;  4A6K A;  4A6F A;  1MK7 B;  3U7D A;  1WJ1 A;  4TKN A;  1OQN A;  3A98 B;  2N0Y A;  2ADZ A;  4DXA B;  2L1C A;  2EJ8 A;  4HDO A;  5D27 A;  4HAU B;  1SGH A;  1XOD A;  3VOQ A;  1K5D B;  1X05 A;  3F0W A;  3HQC A;  2M38 A;  1J19 A;  3MDB C;  3D8F A;  1PFJ A;  2HTH B;  1ZM0 A;  1V5U A;  3GYO A;  4GPT B;  2VSZ A;  1TQZ A;  2DHI A;  2NZ8 B;  3QBV B;  4K2O A;  1V89 A;  2H7D A;  3BJI A;  3ULC A;  5D3Y A;  2W2X C;  4HAV B;  1DRO A;  3ML4 A;  1H4R A;  1Q67 A;  1ZC4 B;  1NTY A;  2K2U A;  1IRS A;  3A8Q A;  1NU2 A;  5J3T A;  2V76 A;  3ZVR A;  1NTV A;  2YS3 A;  2YVC A;  3PP2 A;  2MDX A;  4YL8 A;  4DX8 A;  1MIZ B;  2CRF A;  3SUZ A;  2DX5 A;  4ZRI A;  5FI1 A;  3NSU A;  3SNH A;  1M7R A;  2LG1 A;  2J0M A;  4H8S A;  2J0K A;  4L6E A;  2KGX B;  4KVG B;  3WA0 A;  2QKM A;  2UZR A;  2YT0 A;  3M1I B;  4TYZ A;  3SO6 A;  2YS1 A;  4HB4 B;  1X1G A;  2I5F A;  2GCL A;  4KHB B;  1P6S A;  1RJ2 A;  1GC7 A;  1H10 A;  2DN6 A;  2I5C A;  2NMB A;  4F7G A;  1UNQ A;  3TFM A;  4Y94 A;  4HDQ A;  1X11 A;  3T06 A;  1LW3 A;  4XWX A;  5D3X A;  3BIN A;  2GS0 A;  2RVB B;  2AEH A;  2OTX A;  2MWN B;  2UZS A;  3A8P A;  1FAO A;  2N23 A;  4K17 A;  3HK0 A;  5C79 A;  5KQ4 A;  4HAW B;  2RGN B;  4DX9 0;  2PZ1 A;  2Z0Q A;  2LUL A;  1MKE A;  1KZ7 A;  3X23 A;  5JP4 A;  1ZVR A;  3TCA A;  4CHJ A;  2BCJ A;  2D4Q A;  3TO1 A;  1WG7 A;  4HHV A;  2EMS A;  4HAY B;  4A5K A;  2R0D A;  1GG3 A;  1TJ6 A;  1J0W A;  4PQ0 A;  4YON A;  1WJM A;  4HAX B;  1FGY A;  2DKP A;  3SYX A;  1N3H A;  2UVM A;  2VKI A;  2MFQ A;  1V5P A;  3FSS A;  2DLW A;  3UZT A;  1U2B A;  2HE7 A;  3VIA A;  2EMT A;  3ODO A;  3PVU A;  3D8D A;  5DH9 B;  2Y8G A;  3CIK A;  3CXB B;  3PVW A;  1BAK A;  1GC6 A;  1I7A A;  4Z2N A;  1U5F A;  3P6A A;  3DXE A;  5JHH A;  2ELA A;  5DHF B;  2COF A;  2D9X A;  4ZRK A;  1EGX A;  3PG7 A;  1KZG A;  2D11 A;  3SV1 A;  5DHA B;  2COD A;  4WSF A;  4DBB A;  4KHA A;  3QWM A;  2CAY A;  1UPQ A;  3DXC A;  4HAT B;  2D9V A;  4GMV A;  2DHJ A;  3D8E A;  1EAZ A;  5JHG A;  2CY4 A;  2K00 A;  2ELB A;  2KCJ A;  5C6R A;  1DDW A;  2X18 A;  2RSG A;  5LON B;  3G9W A;  5JLJ B;  5FI0 A;  3P7Z A;  4MY6 A;  3AU4 A;  1WVH A;  1W1H A;  4F7H A;  5EFX A;  1XKE A;  3F5R A;  4F7U P;  4NY0 A;  1OMW A;  2LOX A;  4P7I A;  1FB8 A;  2COA A;  2YSZ A;  4KHO A;  3MPX A;  4EJN A;  1K5G B;  2MKR A;  2ROV A;  1XR0 B;  2VRW B;  3AJ4 A;  1PMS A;  2GJY A;  2ROZ B;  2FJL A;  1EF1 A;  2D2Q A;  1XX0 A;  2ZPY A;  4HAZ B;  3TVV A;  5J3Q A;  1KI1 B;  3KZ1 A;  2KUP A;  1Z87 A;  5DI9 B;  1UPR A;  2RNR B;  1FOE A;  2DX1 A;  4K2P A;  2D10 A;  5J3Y A;  2Q13 A;  3DXD A;  4IFS A;  2Z0O A;  1LB1 A;  1FGZ A;  1RRP B;  2I1J A;  4A6H A;  2H7E A;  4A6F B;  2DYQ A;  3QIJ A;  2CY5 A;  3KY9 A;  1M7E A;  2Y8F A;  2M14 A;  2AL6 A;  4B6H A;  2W2W A;  1V88 A;  1DBH A;  5D3W A;  4CHM A;  5KQ1 A;  1WI1 A;  1OY2 A;  2YS5 A;  3PSC A;  2DKQ A;  2QKL A;  4CYE A;  3PEG A;  4IOY X;  1U27 A;  2OQB A;  1P5T A;  1V5M A;  5DIF B;  4WJ7 A;  3HW2 B;  5C5B B;  2J0J A;  2D9W A;  4K81 A;  2YF0 A;  2IYB A;  2Z0P A;  4WVF B;  2LYD A;  4GN1 A;  2RUK B;  4HB3 B;  1W1D A;  1ZC3 B;  1MPH A;  2IFS A;  2DHK A;  4C0A A;  3LJU X;  5HE3 A;  4EKU A;  5C16 A;  1X1F A;  3FEH A;  1MAI A;  4IAP A;  2YRY A;  4PNK A;  2YT1 A;  1B55 A;  5KCV A;  1WGU A;  3GYP A;  1UNP A;  2LOZ A;  1FHW A;  2I1K A;  4HB2 B;  4EMO A;  4NSW A;  2XQN M;  1QQG A;  1DDM A;  5HE2 A;  1DYN A;  5CLL B;  2COC A;  1U5D A;  1NI2 A;  2D9Z A;  5C5B A;  3ZDT A;  2EC1 A;  1DDV A;  2P8V A;  3ODW A;  4BBK A;  5GOW B;  3RCP A; 
#chains in the Genus database with same CATH topology
 1Y19 B;  3NW8 A;  3OHM B;  2W2X D;  5CLQ B;  3U8Z A;  5HE1 A;  3IVF A;  3V5W A;  1U5G A;  2DA0 A;  2GCJ A;  2K49 A;  1U29 A;  1MI1 A;  2DTC A;  4HSI A;  1FHO A;  4DIX A;  3ULB A;  4HB0 B;  1P3R A;  4KAX B;  1UNR A;  2Z14 A;  4GXB A;  1TXD A;  1X86 A;  4MK0 A;  2RLO A;  2R09 A;  1FHX A;  1U5E A;  4OT1 A;  4Z2M B;  1ZYI A;  3PVL A;  1E5W A;  2L2I A;  1V61 A;  2J59 M;  2GUM A;  2JP2 A;  3O96 A;  3OAN A;  2KIE A;  5HE0 A;  3KRW A;  2K2J A;  3TW1 A;  5L81 A;  2DYN A;  3KRX A;  1UEF A;  1W1G A;  1BTK A;  3AU5 A;  1PLS A;  2P0H A;  2G35 A;  1BWN A;  5D3V A;  4GMX B;  1BTN A;  1WGQ A;  4D0N B;  1I2H A;  1ZSQ A;  2DFK A;  1EVH A;  4MT7 A;  2E2X A;  2Y7B A;  2P0F A;  3ODX A;  3WYF B;  4QJ5 B;  4GZU A;  2P0D A;  1QC6 A;  4ZRJ A;  3PZD A;  1Y5O A;  1MK9 B;  2D9Y A;  3FM8 C;  1MIX A;  1SHC A;  3N7C A;  1XD4 A;  5LOP B;  3KSY A;  1AWE A;  2LKO A;  1AQC A;  1ISN A;  1T77 A;  1XCG A;  3HSA A;  4A6K A;  4A6F A;  1MK7 B;  3U7D A;  1WJ1 A;  4TKN A;  1OQN A;  3A98 B;  2N0Y A;  2ADZ A;  4DXA B;  2L1C A;  2EJ8 A;  4HDO A;  5D27 A;  4HAU B;  1SGH A;  2KIG A;  1XOD A;  3VOQ A;  1K5D B;  1X05 A;  3F0W A;  3HQC A;  2M38 A;  1J19 A;  3A58 A;  3MDB C;  2Z4D A;  3D8F A;  1PFJ A;  2HTH B;  1ZM0 A;  2RRF A;  1V5U A;  4GNK B;  4D6W A;  3GYO A;  4GPT B;  2VSZ A;  5I2S A;  1TQZ A;  2DHI A;  2NZ8 B;  3QBV B;  4K2O A;  1V89 A;  2H7D A;  3BJI A;  3ULC A;  5D3Y A;  2W2X C;  4HAV B;  1DRO A;  3ML4 A;  1H4R A;  1Q67 A;  1ZC4 B;  1NTY A;  2K2U A;  1IRS A;  3HIE A;  3A8Q A;  1NU2 A;  4GOU A;  5J3T A;  2V76 A;  3ZVR A;  5LG4 B;  1NTV A;  2YS3 A;  2YVC A;  3PP2 A;  2MDX A;  4YL8 A;  4DX8 A;  1MIZ B;  2CRF A;  3SUZ A;  2DX5 A;  4ZRI A;  5FI1 A;  3NSU A;  3SNH A;  1M7R A;  2Z59 A;  2LG1 A;  2J0M A;  4QJ4 B;  4H8S A;  2J0K A;  4L6E A;  4L1R A;  2KGX B;  4KVG B;  3WA0 A;  2QKM A;  2UZR A;  2YT0 A;  3M1I B;  4TYZ A;  3SO6 A;  2YS1 A;  4HB4 B;  1X1G A;  2I5F A;  2GCL A;  4KHB B;  1P6S A;  1RJ2 A;  1GC7 A;  1H10 A;  2DN6 A;  2I5C A;  2NMB A;  4F7G A;  1UNQ A;  3TFM A;  4Y94 A;  4HDQ A;  1X11 A;  3T06 A;  1LW3 A;  4XWX A;  5D3X A;  3BIN A;  2GS0 A;  2RVB B;  2AEH A;  2OTX A;  5I2M A;  2MWN B;  2UZS A;  3A8P A;  1FAO A;  2N23 A;  4K17 A;  3HK0 A;  2ZKM X;  5C79 A;  5KQ4 A;  4HAW B;  2RGN B;  2KR0 A;  4DX9 0;  2PZ1 A;  2Z0Q A;  2LUL A;  1MKE A;  1KZ7 A;  3X23 A;  5JP4 A;  1ZVR A;  3TCA A;  4CHJ A;  2BCJ A;  2D4Q A;  3TO1 A;  1WG7 A;  4HHV A;  2EMS A;  4HAY B;  4A5K A;  2R0D A;  1GG3 A;  1TJ6 A;  1J0W A;  4OSN A;  4PQ0 A;  3NWA A;  4YON A;  2Z13 A;  1WJM A;  4HAX B;  1FGY A;  2DKP A;  3SYX A;  1N3H A;  2UVM A;  2VKI A;  2MFQ A;  1V5P A;  3FSS A;  2DLW A;  3UZT A;  1U2B A;  2HE7 A;  3VIA A;  2EMT A;  3ODO A;  3PVU A;  3D8D A;  3FVC A;  5DH9 B;  2Y8G A;  3CIK A;  3CXB B;  3PVW A;  1BAK A;  1GC6 A;  1I7A A;  4Z2N A;  1U5F A;  3P6A A;  3DXE A;  5JHH A;  2ELA A;  3U12 A;  5DHF B;  2YT2 A;  2COF A;  2D9X A;  4ZRK A;  1EGX A;  3PG7 A;  3DCX A;  1KZG A;  2D11 A;  3SV1 A;  5DHA B;  2COD A;  4WSF A;  4DBB A;  4KHA A;  3NWF A;  3QWM A;  2CAY A;  1UPQ A;  3DXC A;  4HAT B;  2D9V A;  4GMV A;  2DHJ A;  3D8E A;  1EAZ A;  5JHG A;  2CY4 A;  2K00 A;  2ELB A;  2KCJ A;  4QXA B;  5C6R A;  1DDW A;  2X18 A;  2RSG A;  5LON B;  3G9W A;  5JLJ B;  5FI0 A;  3P7Z A;  4MY6 A;  3AU4 A;  1WVH A;  1W1H A;  4F7H A;  5EFX A;  1XKE A;  3F5R A;  4F7U P;  4NY0 A;  1OMW A;  2LOX A;  4P7I A;  1FB8 A;  2K8E A;  2COA A;  2YSZ A;  4KHO A;  3MPX A;  4EJN A;  1K5G B;  2MKR A;  5M4Y B;  2ROV A;  1XR0 B;  2VRW B;  3AJ4 A;  1PMS A;  2GJY A;  2ROZ B;  2FJL A;  1EF1 A;  2D2Q A;  1XX0 A;  2ZPY A;  4HAZ B;  3TVV A;  5J3Q A;  1KI1 B;  3KZ1 A;  2KUP A;  1Z87 A;  5DI9 B;  1UPR A;  2RNR B;  1FOE A;  2DX1 A;  4K2P A;  2D10 A;  5J3Y A;  2Q13 A;  3DXD A;  4IFS A;  2Z0O A;  1LB1 A;  1FGZ A;  1RRP B;  2I1J A;  4A6H A;  2H7E A;  4A6F B;  2DYQ A;  3QIJ A;  2CY5 A;  3KY9 A;  1M7E A;  2Y8F A;  2M14 A;  2FJU B;  2AL6 A;  4B6H A;  2W2W A;  4KHB A;  1V88 A;  1DBH A;  5D3W A;  4CHM A;  5KQ1 A;  1WI1 A;  1OY2 A;  2YS5 A;  3PSC A;  2DKQ A;  2QKL A;  4CYE A;  3PEG A;  4IOY X;  1U27 A;  2OQB A;  2NBV A;  1P5T A;  1V5M A;  5DIF B;  4WJ7 A;  3HW2 B;  5C5B B;  2J0J A;  2D9W A;  4K81 A;  2YF0 A;  2IYB A;  2Z0P A;  4WVF B;  2LYD A;  4GN1 A;  2KUQ A;  2RUK B;  4HB3 B;  1W1D A;  1ZC3 B;  1MPH A;  2IFS A;  2DHK A;  3NWD A;  4C0A A;  3LJU X;  5HE3 A;  4EKU A;  5C16 A;  1X1F A;  3FEH A;  1MAI A;  4IAP A;  2R2Y A;  2YRY A;  4PNK A;  2YT1 A;  1B55 A;  5KCV A;  1WGU A;  3GYP A;  1UNP A;  2LOZ A;  1FHW A;  2I1K A;  4CSQ A;  4HB2 B;  4EMO A;  4NSW A;  2XQN M;  1QQG A;  1DDM A;  4QJ3 B;  5HE2 A;  1DYN A;  5CLL B;  2COC A;  3B77 A;  1U5D A;  1NI2 A;  2D9Z A;  5C5B A;  3ZDT A;  2EC1 A;  1DDV A;  2P8V A;  3ODW A;  5IRS A;  4BBK A;  5GOW B;  3RCP A; 
#chains in the Genus database with same CATH homology
 1Y19 B;  2W2X D;  5CLQ B;  3U8Z A;  5HE1 A;  3IVF A;  3V5W A;  1U5G A;  2DA0 A;  2GCJ A;  1U29 A;  2DTC A;  1FHO A;  3ULB A;  4HB0 B;  1P3R A;  4KAX B;  1UNR A;  4GXB A;  1TXD A;  1X86 A;  4MK0 A;  2RLO A;  2R09 A;  1FHX A;  1U5E A;  4Z2M B;  3PVL A;  1E5W A;  2L2I A;  1V61 A;  2J59 M;  2JP2 A;  3O96 A;  3OAN A;  5HE0 A;  3KRW A;  2K2J A;  3TW1 A;  5L81 A;  2DYN A;  3KRX A;  1UEF A;  1W1G A;  1BTK A;  3AU5 A;  1PLS A;  2P0H A;  2G35 A;  1BWN A;  5D3V A;  4GMX B;  1BTN A;  1WGQ A;  4D0N B;  1I2H A;  1ZSQ A;  2DFK A;  1EVH A;  4MT7 A;  2E2X A;  2Y7B A;  2P0F A;  3ODX A;  3WYF B;  4GZU A;  2P0D A;  1QC6 A;  4ZRJ A;  3PZD A;  1Y5O A;  1MK9 B;  2D9Y A;  3FM8 C;  1MIX A;  1SHC A;  3N7C A;  1XD4 A;  5LOP B;  3KSY A;  1AWE A;  2LKO A;  1AQC A;  1ISN A;  1XCG A;  4A6K A;  4A6F A;  1MK7 B;  3U7D A;  1WJ1 A;  4TKN A;  1OQN A;  3A98 B;  2N0Y A;  2ADZ A;  4DXA B;  2L1C A;  2EJ8 A;  4HDO A;  5D27 A;  4HAU B;  1SGH A;  1XOD A;  3VOQ A;  1K5D B;  1X05 A;  3F0W A;  3HQC A;  2M38 A;  1J19 A;  3MDB C;  3D8F A;  1PFJ A;  2HTH B;  1ZM0 A;  1V5U A;  3GYO A;  4GPT B;  2VSZ A;  1TQZ A;  2DHI A;  2NZ8 B;  3QBV B;  4K2O A;  1V89 A;  2H7D A;  3BJI A;  3ULC A;  5D3Y A;  2W2X C;  4HAV B;  1DRO A;  3ML4 A;  1H4R A;  1Q67 A;  1ZC4 B;  1NTY A;  2K2U A;  1IRS A;  3A8Q A;  1NU2 A;  5J3T A;  2V76 A;  3ZVR A;  1NTV A;  2YS3 A;  2YVC A;  3PP2 A;  2MDX A;  4YL8 A;  4DX8 A;  1MIZ B;  2CRF A;  3SUZ A;  2DX5 A;  4ZRI A;  5FI1 A;  3NSU A;  3SNH A;  1M7R A;  2LG1 A;  2J0M A;  4H8S A;  2J0K A;  4L6E A;  2KGX B;  4KVG B;  3WA0 A;  2QKM A;  2UZR A;  2YT0 A;  3M1I B;  4TYZ A;  3SO6 A;  2YS1 A;  4HB4 B;  1X1G A;  2I5F A;  2GCL A;  4KHB B;  1P6S A;  1RJ2 A;  1GC7 A;  1H10 A;  2DN6 A;  2I5C A;  2NMB A;  4F7G A;  1UNQ A;  3TFM A;  4Y94 A;  4HDQ A;  1X11 A;  3T06 A;  1LW3 A;  4XWX A;  5D3X A;  3BIN A;  2GS0 A;  2RVB B;  2AEH A;  2OTX A;  2MWN B;  2UZS A;  3A8P A;  1FAO A;  2N23 A;  4K17 A;  3HK0 A;  5C79 A;  5KQ4 A;  4HAW B;  2RGN B;  4DX9 0;  2PZ1 A;  2Z0Q A;  2LUL A;  1MKE A;  1KZ7 A;  3X23 A;  5JP4 A;  1ZVR A;  3TCA A;  4CHJ A;  2BCJ A;  2D4Q A;  3TO1 A;  1WG7 A;  4HHV A;  2EMS A;  4HAY B;  4A5K A;  2R0D A;  1GG3 A;  1TJ6 A;  1J0W A;  4PQ0 A;  4YON A;  1WJM A;  4HAX B;  1FGY A;  2DKP A;  3SYX A;  1N3H A;  2UVM A;  2VKI A;  2MFQ A;  1V5P A;  3FSS A;  2DLW A;  3UZT A;  1U2B A;  2HE7 A;  3VIA A;  2EMT A;  3ODO A;  3PVU A;  3D8D A;  5DH9 B;  2Y8G A;  3CIK A;  3CXB B;  3PVW A;  1BAK A;  1GC6 A;  1I7A A;  4Z2N A;  1U5F A;  3P6A A;  3DXE A;  5JHH A;  2ELA A;  5DHF B;  2COF A;  2D9X A;  4ZRK A;  1EGX A;  3PG7 A;  1KZG A;  2D11 A;  3SV1 A;  5DHA B;  2COD A;  4WSF A;  4DBB A;  4KHA A;  3QWM A;  2CAY A;  1UPQ A;  3DXC A;  4HAT B;  2D9V A;  4GMV A;  2DHJ A;  3D8E A;  1EAZ A;  5JHG A;  2CY4 A;  2K00 A;  2ELB A;  2KCJ A;  5C6R A;  1DDW A;  2X18 A;  2RSG A;  5LON B;  3G9W A;  5JLJ B;  5FI0 A;  3P7Z A;  4MY6 A;  3AU4 A;  1WVH A;  1W1H A;  4F7H A;  5EFX A;  1XKE A;  3F5R A;  4F7U P;  4NY0 A;  1OMW A;  2LOX A;  4P7I A;  1FB8 A;  2COA A;  2YSZ A;  4KHO A;  3MPX A;  4EJN A;  1K5G B;  2MKR A;  2ROV A;  1XR0 B;  2VRW B;  3AJ4 A;  1PMS A;  2GJY A;  2ROZ B;  2FJL A;  1EF1 A;  2D2Q A;  1XX0 A;  2ZPY A;  4HAZ B;  3TVV A;  5J3Q A;  1KI1 B;  3KZ1 A;  2KUP A;  1Z87 A;  5DI9 B;  1UPR A;  2RNR B;  1FOE A;  2DX1 A;  4K2P A;  2D10 A;  5J3Y A;  2Q13 A;  3DXD A;  4IFS A;  2Z0O A;  1LB1 A;  1FGZ A;  1RRP B;  2I1J A;  4A6H A;  2H7E A;  4A6F B;  2DYQ A;  3QIJ A;  2CY5 A;  3KY9 A;  1M7E A;  2Y8F A;  2M14 A;  2AL6 A;  4B6H A;  2W2W A;  1V88 A;  1DBH A;  5D3W A;  4CHM A;  5KQ1 A;  1WI1 A;  1OY2 A;  2YS5 A;  3PSC A;  2DKQ A;  2QKL A;  4CYE A;  3PEG A;  4IOY X;  1U27 A;  2OQB A;  1P5T A;  1V5M A;  5DIF B;  4WJ7 A;  3HW2 B;  5C5B B;  2J0J A;  2D9W A;  4K81 A;  2YF0 A;  2IYB A;  2Z0P A;  4WVF B;  2LYD A;  4GN1 A;  2RUK B;  4HB3 B;  1W1D A;  1ZC3 B;  1MPH A;  2IFS A;  2DHK A;  4C0A A;  3LJU X;  5HE3 A;  4EKU A;  5C16 A;  1X1F A;  3FEH A;  1MAI A;  4IAP A;  2YRY A;  4PNK A;  2YT1 A;  1B55 A;  5KCV A;  1WGU A;  3GYP A;  1UNP A;  2LOZ A;  1FHW A;  2I1K A;  4HB2 B;  4EMO A;  4NSW A;  2XQN M;  1QQG A;  1DDM A;  5HE2 A;  1DYN A;  5CLL B;  2COC A;  1U5D A;  1NI2 A;  2D9Z A;  5C5B A;  3ZDT A;  2EC1 A;  1DDV A;  2P8V A;  3ODW A;  4BBK A;  5GOW B;  3RCP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...